CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NC_013928	Streptococcus mutans NN2025, complete genome	2 crisprs	DEDDh,cas3,WYL,csa3,cas8e,cse2gr11,cas7,cas5,cas6e,cas1,cas9,cas2,csn2,DinG,csm6,RT	0	73	4	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_013928_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_013928_1

644279-645406

TypeI-E

Consensus_repeat	Method
ATTTTACCCGCACGAGCGGGGGTGATCC	PILER-CR
ATTTTACCCGCACGAGCGGGGGTGATCCT	CRISPRCasFinder
ATTTTACCCGCACGAGCGGGGGTGATCCT	CRT

18 spacers

DEDDh,cas1,cas6e,cas5,cas7,cse2gr11,cas8e,cas3,WYL

The CRISPR arrays of NC_013928_1

>merge|NC_013928|1|644279-645406|PILER-CR,CRISPRCasFinder,CRT
ATTTTACCCGCACGAGCGGGGGTGATCCTGGGTCTGACACCCAGTCACCCAAAGCTTTGAGATTTTACCCGCACGAGCGGGGGTGATCCTAGTTCAACCGCTTATCTTTACAGCAAAGAAAAATTTTACCCGCACGAGCGGGGGTGATCCTGCTTGGAAAGATTGACCACACAGGGTCAGGCGATTTTACCCGCACGAGCGGGGGTGATCCTACTTGACAGCGCAGTGCGCGCTGTTGAATAGCATTTTACCCGCACGAGCGGGGGTGATCCCAGCTCCAACAGCTACAACAGCTACAACAGCTAATTTTACCCGCACGAGCGGGGGTGATCCTGGTAAGGAGGTGCGATTATATGCAAGAGTTAGATTTTACCCGCACGAGCGGGGGTGATCCTCATGCGCCAGTATATTATCAGGTCGTGGAATAATTTTACCCGCACGAGCGGGGGTGATCCTAAAATATACTTCTTTTGTGAAAGGGTTGAGATATTTTACCCGCACGAGCGGGGGTGATCCTTTGATTTTCATTATCGCGGTCTGATGGCTTAAAATTTTACCCGCACGAGCGGGGGTGATCCCCGGCTGACAAGCCTAAAATTGTTAATGTTTTCATTTTACCCGCACGAGCGGGGGTGATCCTAACTCGCTAGCTTTTTTAGATACATAGCTCTTATTTTACCCGCACGAGCGGGGGTGATCCTTACTGGAGACTCCGCTTATCCCTTTTTTGATGATTTTACCCGCACGAGCGGGGGTGATCCTAGTTTTCGTGCGATTGCTTCCAAAATTTGAAAATTTTACCCGCACGAGCGGGGGTGATCCCATATACGACAGTCTGAAAGAAGGCTACCGCGGATTTTACCCGCACGAGCGGGGGTGATCCTGACCTCAGTTGCTATCCTCTTTTTTATTGTTGATTTTACCCGCACGAGCGGGGGTGATCCTGACGGCAACGATAGCCCTGAGACTGACAATCGATTTTACCCGCACGAGCGGGGGTGATCCTGTTTTCCTACCTCTTACCAAGGTTTTTTCTAAATTTTACCCGCACGAGCGGAGGTGATCCTGCCGTTGGGTCAATGCCGTTAGCTTTTAAAGAATTTTACCCGCACGAGCGGGGGTGATCCC

>NC_013928|1|1|644279-645405|PILER-CR
ATTTTACCCGCACGAGCGGGGGTGATCC	TGGGTCTGACACCCAGTCACCCAAAGCTTTGAG
ATTTTACCCGCACGAGCGGGGGTGATCC	TAGTTCAACCGCTTATCTTTACAGCAAAGAAAA
ATTTTACCCGCACGAGCGGGGGTGATCC	TGCTTGGAAAGATTGACCACACAGGGTCAGGCG
ATTTTACCCGCACGAGCGGGGGTGATCC	TACTTGACAGCGCAGTGCGCGCTGTTGAATAGC
ATTTTACCCGCACGAGCGGGGGTGATCC	CAGCTCCAACAGCTACAACAGCTACAACAGCTA
ATTTTACCCGCACGAGCGGGGGTGATCC	TGGTAAGGAGGTGCGATTATATGCAAGAGTTAG
ATTTTACCCGCACGAGCGGGGGTGATCC	TCATGCGCCAGTATATTATCAGGTCGTGGAATA
ATTTTACCCGCACGAGCGGGGGTGATCC	TAAAATATACTTCTTTTGTGAAAGGGTTGAGAT
ATTTTACCCGCACGAGCGGGGGTGATCC	TTTGATTTTCATTATCGCGGTCTGATGGCTTAAA
ATTTTACCCGCACGAGCGGGGGTGATCC	CCGGCTGACAAGCCTAAAATTGTTAATGTTTTC
ATTTTACCCGCACGAGCGGGGGTGATCC	TAACTCGCTAGCTTTTTTAGATACATAGCTCTT
ATTTTACCCGCACGAGCGGGGGTGATCC	TTACTGGAGACTCCGCTTATCCCTTTTTTGATG
ATTTTACCCGCACGAGCGGGGGTGATCC	TAGTTTTCGTGCGATTGCTTCCAAAATTTGAAA
ATTTTACCCGCACGAGCGGGGGTGATCC	CATATACGACAGTCTGAAAGAAGGCTACCGCGG
ATTTTACCCGCACGAGCGGGGGTGATCC	TGACCTCAGTTGCTATCCTCTTTTTTATTGTTG
ATTTTACCCGCACGAGCGGGGGTGATCC	TGACGGCAACGATAGCCCTGAGACTGACAATCG
ATTTTACCCGCACGAGCGGGGGTGATCC	TGTTTTCCTACCTCTTACCAAGGTTTTTTCTAA
ATTTTACCCGCACGAGCGGAGGTGATCC	TGCCGTTGGGTCAATGCCGTTAGCTTTTAAAGA
ATTTTACCCGCACGAGCGGGGGTGATCC

>NC_013928|1|1|644279-645406|CRISPRCasFinder
ATTTTACCCGCACGAGCGGGGGTGATCCT	GGGTCTGACACCCAGTCACCCAAAGCTTTGAG
ATTTTACCCGCACGAGCGGGGGTGATCCT	AGTTCAACCGCTTATCTTTACAGCAAAGAAAA
ATTTTACCCGCACGAGCGGGGGTGATCCT	GCTTGGAAAGATTGACCACACAGGGTCAGGCG
ATTTTACCCGCACGAGCGGGGGTGATCCT	ACTTGACAGCGCAGTGCGCGCTGTTGAATAGC
ATTTTACCCGCACGAGCGGGGGTGATCCC	AGCTCCAACAGCTACAACAGCTACAACAGCTA
ATTTTACCCGCACGAGCGGGGGTGATCCT	GGTAAGGAGGTGCGATTATATGCAAGAGTTAG
ATTTTACCCGCACGAGCGGGGGTGATCCT	CATGCGCCAGTATATTATCAGGTCGTGGAATA
ATTTTACCCGCACGAGCGGGGGTGATCCT	AAAATATACTTCTTTTGTGAAAGGGTTGAGAT
ATTTTACCCGCACGAGCGGGGGTGATCCT	TTGATTTTCATTATCGCGGTCTGATGGCTTAAA
ATTTTACCCGCACGAGCGGGGGTGATCCC	CGGCTGACAAGCCTAAAATTGTTAATGTTTTC
ATTTTACCCGCACGAGCGGGGGTGATCCT	AACTCGCTAGCTTTTTTAGATACATAGCTCTT
ATTTTACCCGCACGAGCGGGGGTGATCCT	TACTGGAGACTCCGCTTATCCCTTTTTTGATG
ATTTTACCCGCACGAGCGGGGGTGATCCT	AGTTTTCGTGCGATTGCTTCCAAAATTTGAAA
ATTTTACCCGCACGAGCGGGGGTGATCCC	ATATACGACAGTCTGAAAGAAGGCTACCGCGG
ATTTTACCCGCACGAGCGGGGGTGATCCT	GACCTCAGTTGCTATCCTCTTTTTTATTGTTG
ATTTTACCCGCACGAGCGGGGGTGATCCT	GACGGCAACGATAGCCCTGAGACTGACAATCG
ATTTTACCCGCACGAGCGGGGGTGATCCT	GTTTTCCTACCTCTTACCAAGGTTTTTTCTAA
ATTTTACCCGCACGAGCGGAGGTGATCCT	GCCGTTGGGTCAATGCCGTTAGCTTTTAAAGA
ATTTTACCCGCACGAGCGGGGGTGATCCC

>NC_013928|1|1|644279-645406|CRT
ATTTTACCCGCACGAGCGGGGGTGATCCT	GGGTCTGACACCCAGTCACCCAAAGCTTTGAG
ATTTTACCCGCACGAGCGGGGGTGATCCT	AGTTCAACCGCTTATCTTTACAGCAAAGAAAA
ATTTTACCCGCACGAGCGGGGGTGATCCT	GCTTGGAAAGATTGACCACACAGGGTCAGGCG
ATTTTACCCGCACGAGCGGGGGTGATCCT	ACTTGACAGCGCAGTGCGCGCTGTTGAATAGC
ATTTTACCCGCACGAGCGGGGGTGATCCC	AGCTCCAACAGCTACAACAGCTACAACAGCTA
ATTTTACCCGCACGAGCGGGGGTGATCCT	GGTAAGGAGGTGCGATTATATGCAAGAGTTAG
ATTTTACCCGCACGAGCGGGGGTGATCCT	CATGCGCCAGTATATTATCAGGTCGTGGAATA
ATTTTACCCGCACGAGCGGGGGTGATCCT	AAAATATACTTCTTTTGTGAAAGGGTTGAGAT
ATTTTACCCGCACGAGCGGGGGTGATCCT	TTGATTTTCATTATCGCGGTCTGATGGCTTAAA
ATTTTACCCGCACGAGCGGGGGTGATCCC	CGGCTGACAAGCCTAAAATTGTTAATGTTTTC
ATTTTACCCGCACGAGCGGGGGTGATCCT	AACTCGCTAGCTTTTTTAGATACATAGCTCTT
ATTTTACCCGCACGAGCGGGGGTGATCCT	TACTGGAGACTCCGCTTATCCCTTTTTTGATG
ATTTTACCCGCACGAGCGGGGGTGATCCT	AGTTTTCGTGCGATTGCTTCCAAAATTTGAAA
ATTTTACCCGCACGAGCGGGGGTGATCCC	ATATACGACAGTCTGAAAGAAGGCTACCGCGG
ATTTTACCCGCACGAGCGGGGGTGATCCT	GACCTCAGTTGCTATCCTCTTTTTTATTGTTG
ATTTTACCCGCACGAGCGGGGGTGATCCT	GACGGCAACGATAGCCCTGAGACTGACAATCG
ATTTTACCCGCACGAGCGGGGGTGATCCT	GTTTTCCTACCTCTTACCAAGGTTTTTTCTAA
ATTTTACCCGCACGAGCGGAGGTGATCCT	GCCGTTGGGTCAATGCCGTTAGCTTTTAAAGA
ATTTTACCCGCACGAGCGGGGGTGATCCC

Protein	Signature genes	Signature genes Name	Protein_function
NC_013928.1\|WP_002265219.1\|658818_660225_+\|6-phospho-beta-galactosidase	unknown	unknown	gnl\|CDD\|184102
NC_013928.1\|WP_002277661.1\|655786_656764_+\|tagatose-bisphosphate-aldolase	unknown	unknown	gnl\|CDD\|183502
NC_013928.1\|WP_002262463.1\|653861_654290_+\|galactose-6-phosphate-isomerase-subunit-LacA	unknown	unknown	gnl\|CDD\|181505
NC_013928.1\|WP_012997666.1\|656779_657094_+\|PTS-lactose/cellobiose-transporter-subunit-IIA	unknown	unknown	gnl\|CDD\|129903
NC_013928.1\|WP_002283928.1\|643352_644255_+\|type-I-E-CRISPR-associated-endoribonuclease-Cas2	DEDDh	cd06127_DEDDh_CAS-I	gnl\|CDD\|176648
NC_013928.1\|WP_012997657.1\|639958_641038_+\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	cas7	pfam09344_cas7_CAS-I-E	gnl\|CDD\|378153
NC_013928.1\|WP_002267329.1\|639372_639975_+\|type-I-E-CRISPR-associated-protein-Cse2/CasB	cse2gr11	mkCas0194_cse2gr11_CAS-I-E	gnl\|CDD\|378191
NC_013928.1\|WP_012997660.1\|645703_648946_+\|ATP-dependent-nuclease-subunit-B	unknown	unknown	gnl\|CDD\|274291
NC_013928.1\|WP_002283925.1\|634865_637652_+\|CRISPR-associated-helicase/endonuclease-Cas3	cas3	cd09639_cas3_CAS-I	gnl\|CDD\|182031
NC_013928.1\|WP_002265225.1\|652798_653554_+\|DeoR/GlpR-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224268
NC_013928.1\|WP_012997659.1\|642409_643351_+\|type-I-E-CRISPR-associated-endonuclease-Cas1	cas1	cd09719_cas1_CAS-I-E	gnl\|CDD\|274693
NC_013928.1\|WP_012997661.1\|648935_652574_+\|helicase-exonuclease-AddAB-subunit-AddA	unknown	unknown	gnl\|CDD\|274299
NC_013928.1\|WP_002277662.1\|654849_655782_+\|tagatose-6-phosphate-kinase	unknown	unknown	gnl\|CDD\|273515
NC_013928.1\|WP_002262464.1\|654315_654831_+\|galactose-6-phosphate-isomerase-subunit-LacB	unknown	unknown	gnl\|CDD\|181506
NC_013928.1\|WP_002262921.1\|632782_633028_+\|membrane-protein	unknown	unknown	unknown
NC_013928.1\|WP_012997655.1\|637644_639363_+\|type-I-E-CRISPR-associated-protein-Cse1/CasA	cas8e	cd09729_cas8e_CAS-I-E	gnl\|CDD\|378189
NC_013928.1\|WP_002267326.1\|633692_634676_+\|WYL-domain-containing-protein	WYL	pfam13280_WYL_CAS-I:CAS-III	gnl\|CDD\|379100
NC_013928.1\|WP_002277660.1\|657100_658807_+\|PTS-transporter-subunit-EIIC	unknown	unknown	gnl\|CDD\|273055
NC_013928.1\|WP_002283064.1\|641043_641760_+\|type-I-E-CRISPR-associated-protein-Cas5/CasD	cas5	cd09756_cas5_CAS-I-E	gnl\|CDD\|187886
NC_013928.1\|WP_002267332.1\|641759_642407_+\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	cas6e	pfam08798_cas6e_CAS-I-E:CAS-IV	gnl\|CDD\|378050

Protein	Function_ID	Function_description	E-value
NC_013928.1\|WP_002265219.1\|658818_660225_+\|6-phospho-beta-galactosidase	gnl\|CDD\|184102	PRK13511, PRK13511, 6-phospho-beta-galactosidase; Provisional.	0
NC_013928.1\|WP_002262463.1\|653861_654290_+\|galactose-6-phosphate-isomerase-subunit-LacA	gnl\|CDD\|181505	PRK08621, PRK08621, galactose-6-phosphate isomerase subunit LacA; Reviewed.	3.84241e-90
NC_013928.1\|WP_012997666.1\|656779_657094_+\|PTS-lactose/cellobiose-transporter-subunit-IIA	gnl\|CDD\|129903	TIGR00823, PTS_system_lactose-specific_IIA_component, phosphotransferase system enzyme II, lactose-specific, factor III. The PTS Lactose-N,N?-Diacetylchitobiose-b-glucoside (Lac) Family (TC 4.A.3)Bacterial PTS transporters transport and concomitantly phosphorylate their sugar substrates, and typically consist of multiple subunits or protein domains.The Lac family includes several sequenced lactose (b-galactoside) permeases of Gram-positive bacteria as well as the E. coli N,N?-diacetylchitobiose (Chb)permease which can transport aromatic b-glucosides and cellobiose as well as the chitin disaccharide, Chb, but only Chb induces expression of the chboperon. While the Lac permeases consist of two polypeptide chains (IIA and IICB), the Chb permease of E. coli consists of three (IIA, IIB and IIC). In B. subtilis, a PTS permease similar to the Chb permease of E. coli is believed to transport lichenan (a b-1,3;1,4 glucan) degradation products, oligosaccharides of 2-4 glucose units. This model is specific for the IIA subunit of the Lac PTS family. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids].	1.76719e-44
NC_013928.1\|WP_002283928.1\|643352_644255_+\|type-I-E-CRISPR-associated-endoribonuclease-Cas2	gnl\|CDD\|176648	cd06127, DEDDh, DEDDh 3'-5' exonuclease domain family. DEDDh exonucleases, part of the DnaQ-like (or DEDD) exonuclease superfamily, catalyze the excision of nucleoside monophosphates at the DNA or RNA termini in the 3'-5' direction. These proteins contain four invariant acidic residues in three conserved sequence motifs termed ExoI, ExoII and ExoIII. DEDDh exonucleases are classified as such because of the presence of specific Hx(4)D conserved pattern at the ExoIII motif. The four conserved acidic residues are clustered around the active site and serve as ligands for the two metal ions required for catalysis. Most DEDDh exonucleases are the proofreading subunits (epsilon) or domains of bacterial DNA polymerase III, the main replicating enzyme in bacteria, which functions as the chromosomal replicase. Other members include other DNA and RNA exonucleases such as RNase T, Oligoribonuclease, and RNA exonuclease (REX), among others.	6.99436e-42
NC_013928.1\|WP_012997657.1\|639958_641038_+\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	gnl\|CDD\|378153	pfam09344, Cas_CT1975, CT1975-like protein. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family is represented by CT1975 of Chlorobium tepidum.	4.29481e-142
NC_013928.1\|WP_002267329.1\|639372_639975_+\|type-I-E-CRISPR-associated-protein-Cse2/CasB	gnl\|CDD\|378191	pfam09485, CRISPR_Cse2, CRISPR-associated protein Cse2 (CRISPR_cse2). Clusters of short DNA repeats with non-homologous spacers, which are found at regular intervals in the genomes of phylogenetically distinct prokaryotic species, comprise a family with recognisable features. This family is known as CRISPR (short for Clustered, Regularly Interspaced Short Palindromic Repeats). A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family of proteins, represented by CT1973 from Chlorobaculum tepidum, is encoded by genes found in the CRISPR/Cas subtype Ecoli regions of many bacteria (most of which are mesophiles), and not in Archaea. It is designated Cse2.	1.14607e-33
NC_013928.1\|WP_012997660.1\|645703_648946_+\|ATP-dependent-nuclease-subunit-B	gnl\|CDD\|274291	TIGR02774, putative_ATP-dependent_exonuclease_subunit_B, ATP-dependent nuclease subunit B. DNA repair is accomplished by several different systems in prokaryotes. Recombinational repair of double-stranded DNA breaks involves the RecBCD pathway in some lineages, and AddAB (also called RecAB) in other. The AddA protein is conserved between the firmicutes and the alphaproteobacteria, while the partner protein is not. The partner may be designated AddB, as in Bacillus and in alphaproteobacteria, or RexB as in Streptococcus and Lactococcus. Note, however, that RexB proteins lack an N-terminal GxxGxGK[ST] ATP-binding motif found in Bacillus subtilis and related species, and this difference may be important; this model represents specifically RexB proteins as found in Streptococcus and Lactococcus. [DNA metabolism, DNA replication, recombination, and repair].	0
NC_013928.1\|WP_002283925.1\|634865_637652_+\|CRISPR-associated-helicase/endonuclease-Cas3	gnl\|CDD\|182031	PRK09694, PRK09694, CRISPR-associated helicase/endonuclease Cas3.	5.76681e-95
NC_013928.1\|WP_002265225.1\|652798_653554_+\|DeoR/GlpR-transcriptional-regulator	gnl\|CDD\|224268	COG1349, GlpR, Transcriptional regulators of sugar metabolism [Transcription / Carbohydrate transport and metabolism].	2.81514e-78
NC_013928.1\|WP_012997659.1\|642409_643351_+\|type-I-E-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|274693	TIGR03638, cas1_ECOLI, CRISPR-associated endonuclease Cas1, subtype I-E/ECOLI. The CRISPR-associated protein Cas1 is virtually universal to CRISPR systems. CRISPR, an acronym for Clustered Regularly Interspaced Short Palindromic Repeats, is prokaryotic immunity system for foreign DNA, mostly from phage. CRISPR systems belong to different subtypes, distinguished by both nature of the repeats, the makeup of the cohort of associated Cas proteins, and by molecular phylogeny within the more universal Cas proteins such as this one. This model is of type EXCEPTION and provides more specific information than the EQUIVALOG model TIGR00287. It describes the Cas1 protein particular to the ECOLI subtype of CRISPR/Cas system.	7.11484e-132
NC_013928.1\|WP_002277661.1\|655786_656764_+\|tagatose-bisphosphate-aldolase	gnl\|CDD\|183502	PRK12399, PRK12399, tagatose 1,6-diphosphate aldolase; Reviewed.	0
NC_013928.1\|WP_002277662.1\|654849_655782_+\|tagatose-6-phosphate-kinase	gnl\|CDD\|273515	TIGR01231, Tagatose-6-phosphate_kinase, tagatose-6-phosphate kinase. This enzyme is part of the tagatose-6-phosphate pathway of lactose degradation. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0
NC_013928.1\|WP_002262464.1\|654315_654831_+\|galactose-6-phosphate-isomerase-subunit-LacB	gnl\|CDD\|181506	PRK08622, PRK08622, galactose-6-phosphate isomerase subunit LacB; Reviewed.	8.58673e-124
NC_013928.1\|WP_002283064.1\|641043_641760_+\|type-I-E-CRISPR-associated-protein-Cas5/CasD	gnl\|CDD\|187886	cd09756, Cas5_I-E, CRISPR/Cas system-associated RAMP superfamily protein Cas5. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas5 is a RAMP superfamily protein; Subunit of the Cascade complex.	4.78886e-43
NC_013928.1\|WP_012997655.1\|637644_639363_+\|type-I-E-CRISPR-associated-protein-Cse1/CasA	gnl\|CDD\|378189	pfam09481, CRISPR_Cse1, CRISPR-associated protein Cse1 (CRISPR_cse1). Clusters of short DNA repeats with non-homologous spacers, which are found at regular intervals in the genomes of phylogenetically distinct prokaryotic species, comprise a family with recognisable features. This family is known as CRISPR (short for Clustered, Regularly Interspaced Short Palindromic Repeats). A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This entry, represented by CT1972 from Chlorobaculum tepidum, is found in the CRISPR/Cas subtype Ecoli regions of many bacteria (most of which are mesophiles), and not in Archaea. It is designated Cse1.	5.22353e-77
NC_013928.1\|WP_002267326.1\|633692_634676_+\|WYL-domain-containing-protein	gnl\|CDD\|379100	pfam13280, WYL, WYL domain. WYL is a Sm-like SH3 beta-barrel fold containing domain. It is a member of the WYL-like superfamily, named for three conserved amino acids found in a subset of the superfamily. However, these residues are not strongly conserved throughout the family. Rather, the conservation pattern includes four basic residues and a position often occupied by a cysteine, which are predicted to line a ligand-binding groove typical of the Sm-like SH3 beta-barrels. A WYL domain protein (sll7009) is a negative regulator of the I-D CRISPR-Cas system in Synechocystis sp. It is predicted to be a ligand-sensing domain that could bind negatively charged ligands, such as nucleotides or nucleic acid fragments, to regulate CRISPR-Cas and other defense systems such as the abortive infection AbiG system.	9.10188e-10
NC_013928.1\|WP_002277660.1\|657100_658807_+\|PTS-transporter-subunit-EIIC	gnl\|CDD\|273055	TIGR00394, lac_pts_IIC, phosphotransferase system, lactose specific, IIC component. This family of proteins models the IIC domain of the phosphotransferase system (PTS) for lactose. The IIC domain catalyzes the transfer of a phosphoryl group from the IIB domain to lactose. When the IIC component and IIB components are in the same polypeptide chain they are designated IIBC. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids, Signal transduction, PTS].	0
NC_013928.1\|WP_012997661.1\|648935_652574_+\|helicase-exonuclease-AddAB-subunit-AddA	gnl\|CDD\|274299	TIGR02785, ATP-dependent_helicase/nuclease_subunit_A, helicase-exonuclease AddAB, AddA subunit, Firmicutes type. AddAB, also called RexAB, substitutes for RecBCD in several bacterial lineages. These DNA recombination proteins act before synapse and are particularly important for DNA repair of double-stranded breaks by homologous recombination. The term AddAB is used broadly, with AddA homologous between the Firmicutes (as modeled here) and the alphaproteobacteria, while the partner AddB proteins show no strong homology across the two groups of species. [DNA metabolism, DNA replication, recombination, and repair].	0
NC_013928.1\|WP_002267332.1\|641759_642407_+\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	gnl\|CDD\|378050	pfam08798, CRISPR_assoc, CRISPR associated protein. This domain forms an anti-parallel beta strand structure with flanking alpha helical regions.	9.43583e-68

>NC_013928.1|WP_002283928.1|643352_644255_+|type-I-E-CRISPR-associated-endoribonuclease-Cas2
MPLTVITVKNAPPSLRGDLTKWMQEIATGVYVGNFNTKVREQLWSRVKDSVSNGEATLSFAYRNEIGYCFDTMNAQRKVVDFEGIPLVQLPNSNNNIKEEMNLGFSHAAKFRKIRRYSSHSKNNSPSLVPYVVIDIETDGLDENENSIIEIGAVKIDPSQLEEFNYLVKYDKILPKQISKLTGISQELLDRDGKDLQVVLQEFLNFIGNHDLVGYGINFDIKFINKKLKELNQPLLKNRVYDLMQYAKKEKLFLDNYKLQTVLKAYEIEDEVPHRALHDSKLIYDLSTKMNKFLKGINQK
>NC_013928.1|WP_012997659.1|642409_643351_+|type-I-E-CRISPR-associated-endonuclease-Cas1
MKEKFGAKKTSLKELPKISDRVSFIYVEHAKINRVDSAITVSDSNGTVRIPAAMLGVLLLGPGTDISHRAVELIGDTGTSIVWIGERGVRQYAHGRALAHSTKFLEKQARLVSNSRSRLKVARKMYQMRFPNEDVSSLTMQQLRGREGARIRKVYKLQSKKYKVPWTKREYSPDNFEDGTAVNQSLSAANVALYGLVHSIVVALGASPGLGFVHTGHDLSFVYDVADLYKAEFTIPIAFEVAANHEIGDDIGRIIRLKIRDSFVDGKLMARIVKDIQYLLDIEAEDELLIDILALWDDREKLVKHGVSYKENS
>NC_013928.1|WP_002267332.1|641759_642407_+|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE
MIMYISRVEIDMNNRRRMKNLTHVGAFHDWVERSFPNEIEKQIRTRKLWRIDTLQGKNYLVIISSGKPDLLLLEKYGVEGSAQTKLYDNCLNTLKKGNRMKFRVALNPVISLPSSDNKKRGIVKPHVTSEYQMKYLKDRSEKNGFLLDEAEFLIVERGYEVFKKAKPKPIRLIKTVYEGTLTISDVDRFRKVLTEGIGKKKAYGFGLMTVIPAGD
>NC_013928.1|WP_002283064.1|641043_641760_+|type-I-E-CRISPR-associated-protein-Cas5/CasD
MKTILLKFAGPLQSWGTNSHFETRHTDFYPSKSAVIGMIAASLGYRRNEDEKIRKLNELDFAVRVDQQGNLLRDWHNAKSDKRKDPYTTNRYYLEDAVFVVAISHQNYAFIQMIEDGLRSPYFQPFMGRRACPLPVDFIVQVTNDSALDSLKQLDWQAATWYMKRQSTDDRISLEIYTDSYLTGKESYQLRQDKVLSFSQKERKFGFRYESRVRVEVLNPLWQEQSSTEHDIFNSIGD
>NC_013928.1|WP_012997657.1|639958_641038_+|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC
MTISNNQDRLFLDIYAIQTLPPSNINRDDTGSPKTTQYGGVRRARVSSQSWKKAMRDYFYEHAEEEQLGKRTRKVVNYVAEKIIHQKIDLNEKESSKLATDILKLAGVPTDGKVLFFIGNTEAEKLATAAVKGVKDKEEARKIMQSNLALDVALFGRMVANDKETEADASSQFAHPISTHAVQTEFDFYTAVDDLASDDDAKAGMLGTVEFNSSTLYRYANVAIHEFLVQRGNREDLVDSLQLFIKAFAESMPRGKINSFANQTIPQTLIITVRSDRPVNLVSAFEEPVKSSNGYVTKSIEKLSKEFVKVEKMVKKPVLSFYVSLEEVEALTKVGIEKNSITELVEDFSQELSELIQNR
>NC_013928.1|WP_002267329.1|639372_639975_+|type-I-E-CRISPR-associated-protein-Cse2/CasB
MSEQSKPTVSSVTRKILMKLSNQIDTSPGKAVLAKIRHSIGKPINKATEIWSLLFENLPEEFLGKSGRASYEETVILITVQLYALYQQGLSHSVLVEDVEKYHNIGSSLRQLRKGDDTTAIDRRFNVMITSSTFEELTHHLRHLVKLLKSRSPETKIDFAKLSQNLYWFLRDSQETVRLDWAREYYKQDNKGEKDNDNIQ
>NC_013928.1|WP_012997655.1|637644_639363_+|type-I-E-CRISPR-associated-protein-Cse1/CasA
MSRFNLLDEPWISVVFDEKGSTKEVSLLDFFQNAHHYKDLAGDTKTQDFAVLRVLLAVLHTVFSRFDANGNAYGYLEIDEKYRQIEEIEEDDLEEYEDDLYETWLTLWQNRQFPDIIEEYLKKWRDRFYLFDEEYPFFQVRKEDIEMVMDLNKDAGKIFGKNINRLVSESSNKIALFSPKHNYDNNKERLSNSEIVRWLLTYHGYSEIGGRMKKIGKRDYSKGWLYNLGGLFLKGKNLYETLLLNLTLFYFEYDNHLHIQKPCWEFDSAVIIDSYVSGKRIDNLASLYTSWSKEVYIDPHVVQPEFECRVAKIPAISPNDLFLEPMTLWKYEENSFQPQSHYTNQSLWRSFGLITMGGMEKLNHIPGIIDWQRTIKDNIENASINICSVGMVSDKTANNTPIIEVFDTLSINEFVLTDIQKDGWVIRINDEVDRVKKVISHTYAYFVKDVIVIRKHIEEKEIPKLKKSILRGSLFRQDYEKQISNRIEELYFKIDQPFRQWLSNIQPGDDKDSKILEWREILEKIVLKEAKSLLYEGNPRDYIGWSYGEPKTFHNIATAYESFTYWLNKNLK
>NC_013928.1|WP_002283925.1|634865_637652_+|CRISPR-associated-helicase/endonuclease-Cas3
MDKKVLRYNFWAKKREEKGQFLWLPLMQHLEDTKNVAGLLWEHWLGEGQKALIIASLKTGKKDEKTAKQLAQFLAAVHDIGKATPVFQSKKGYANSKDLDLELLEKLERAGFEGISSITLANPEKSPHALAGQYILHYNKVKEDIATIVGGHHGKPVDDRATYKNQRSQESNYYQSGKSGNTIYQKWERAQEEILNWALEVSGFKSVDELPTIKQPAQVILSGLLIMADWIASNEDYFPLISIDEREVENKADRLSGFEKWKRSSLWVSRNTWDFEGLYQARFDFEPRDVQAVLSKTIADTEQPGIFILEAPMGIGKTEAALVATEQLAEKTDRNGIFFGLPTQATSNGIFPRIEKWLESIKEDLDDNISIQLVHGKAALNADFSELPKGISINIDDFENGSVIVNEWFSGRKTAVLDDFVVGTVDQFLMLALKQKHLALRHLGFSKKVVVIDEVHAYDAYMNQYLLEALRWMGAYGVPVIILSATLPAERREKLLKSYMFGMGKRFEEKEKEQLSKQLKTEAYPLITYNNGFDICQITEFKKGENKKILLSQLEEEDLLDTVKGLLSDGGVAGIIVNTVKRAQKIAKVFADSLGEDMVEIFHSGFIATERVRKEQELLKMIGKDANRPYRKIIIGTQVIEQSLDIDFDVMISDLAPMDLLIQRMGRLHRHKIDRPQKHVFPKFYVIGMNDDLKFEEGSSFVYGDYLLARTQYYLPDSINLPEDISILVQKVYDEKLELDYPTELLDKKYHNAKSEHETKIGNKESKARDYKIADPVLRETRSRKENLIGWLENSHPDDSDERAYAQVRDIEDIVEVIALKKVGDGYALFGEGEDLSELITDFNIAKKVAQNTLRLPIALTKSYNVDDTIKELEMYSRMNLNNWQDSSWLKGALGIIFDENNEFLIGGYKLVYDEKYGVRMEEIENHE
>NC_013928.1|WP_002267326.1|633692_634676_+|WYL-domain-containing-protein
MDEFNQVERFLYLYTELYKGNTISKQVYLDKFGVSDASFNKDIRKLKDAARHLNLDFDIKINKKESYYYLDYTSETGGNLSDIEAYTLSKILLESRALSKKKTKNIIKKLINRTVNEDYRTILDKQTENELSFYKQLNYFNDENHDQNYLSNLGKLSQAVEDTLKTEIPIKIEYSSKGETKSALILPFAILFHEYYFYITSYKFENEEWVSRTYRLDRIESISNADGKEIVKAQAFFHKYPSPSLIRDQVIMMFSGEPYLIRLKIVDKTITEYLKDALPTLQVIDEEEAIYEIRTLGVEGIQLFLRRYGSQVEFVSMTELNTGDNEG
>NC_013928.1|WP_002262921.1|632782_633028_+|membrane-protein
MLILGWVATFMSIMMYVSYIPQIMNNLAGNKGDFIQPSVAALNCTLWVIYGLCKEKRDLPLAAANMPGIVFGLIAAITALV
>NC_013928.1|WP_012997660.1|645703_648946_+|ATP-dependent-nuclease-subunit-B
MKLLYTDIPYNITEILAEEAQIAAKAGKRVFYIAPNSLSFEKERAVLETLPERASFAITITRFEQMARYFVLNDIHQGETIDDNGLAMVFYRALSSFSDQDLRVFGRLKQDAHFINQLVDLYKELKASNLTVLELNQLNSAEKQEDLIKIFTEVETILSAGHFDNQSKIAFFAQQIKFGHLDTALQDLTIVVDGFTRFSAEEENLIGLLHEKGVDIIIGTYISQKAYRSTFSNGNVYQASLDFIRGLAGKFQTKPEYVVSKQEALPAFTKLSQLFESRHDFSDSQLVLTDKDKEHVTIWDVINQKEEVEHVAKSIRRKLYEGHRYKDILVLLGDVDAYKLQIGKIFDKYEIPYYFGKAESMSSHPLVHFVDSLERVKRYNFRAEDVMNLLKSGLYGKIRQNQLDKLEQYVIYADIKGKTKFFKDFTLDNHGQFDLKALNKLRAEVMSPLQELVKIQAQKGDSILQKLTNFLEAISLTNNFSKLIQGVSDTEQEKNEQVWKTFTVILEQFHTIFGQEKMKLADFLALLRSGMLAADYRTVPASVDVVTVKSYDLVEPHSNKFVFALGMTQSHFPKIVQNKSLISDEERAKINEATPNNRRFDIVTKENLKKNHFTALSLFNAATQELVLTLPQILNEAEDNTSSYLLELQDMGVPVVEKGRNRLAADPEDIGNYKALLSRVIELNRSAIDQELSKEEQTFWSVAVRYLRQKLAKEGLTIPEVNDKMQTKQVAAEVMAARFPIDQPLNLSSSALTTFYNNQYLYFLQYVLGLQELETIHPDARNHGTYLHRVFELVMQDQSTDDFDSKLNRAIDITNHEDSFHLVYNEDEESRYALGILEDIARSTATILKGDNPVQAESEEEAFELMLDQAVKIRGVIDRIDRLSDGSLGIVDYKSSKNTFDLQKFYNGLSPQLVTYIEALRSCKNLNETDKIFGAMYLHMQEPKTDLANMKSIEKIPETVHKNLSYKGLFLEDEKAHLANGKYHLHDAVYSQKEVDLLLDYNKRLYRSAAKQIRKGNFLINPYSQDGKSVQGEQLKAITHFEADRHMPYARKLYQLPRKEKRQGFLALMQSKKEEEGNDL
>NC_013928.1|WP_012997661.1|648935_652574_+|helicase-exonuclease-AddAB-subunit-AddA
MTFKSFLTDQEIASLQIQEAQSDKKQKRTPEQIEAIYTSGTNILVSASAGSGKTFVMIERIMDKILRGVTIDQLFISTFTVKAAGELKERLEKKITEQLRLTNDTALKQFLSEQLLGLQTADIGTMDAFTQKLVTQYGYTLGISPNFRILQDKSEQDLLKNDVFDDLFTDYRTGDQAELFTKLVRNFAGNRKDSSNFRQIIYKIYDFSQATDNPQRWLLENFLKGANTYKDFSAIPEQEVKDFLNTLQETALALRDVTDLEDYKQVTAKGTPTAAYQRHLKMIEQLQDWVLHFDNLYGRDGLGKLANDIATLIPSGNDVTVAGVKYPVFRSLHSRLRGLKHLETIFKYQDQSLPLLQVLQSFALDFSKQYLQAKMQENAFEFSDIAHFAIQILEENDAIRQLYIDKYHEVMVDEYQDNNHTQERMLELLSNGRNRFMVGDIKQSIYRFRQADPQIFNQKFKDFQEHPEHGKLILLKENFRSQSEVLDATNSVFTHLMDETVGEILYDDTHQLVAGSSAQKIPYPQNETQVLIYDTKDQQNQDLAVEDDSNQISLGEVKLVAKEIIRLHNEEKVQFEDITLLVSSRTRNDGILQTFDDYGIPLVTDGGEQNYLKSVEVMVMLDTLRSIDNPLNDYALVALLRSPMFAFDEDDLARLALQNLPDQHKQNLYEKMENARNGQGQQVQLITEALSAKLDAFFETFLSWRKFSLLNSLYDLIWKIYNDKFYYDYVGSLPKSEQRQANLYALALRADNFEKTGFKGLSRFIRMIDKILENQNDLADVEVALPKNAVTLMTIHKSKGLEFKYVFILNIDKKFSIQDMTSPLILSRQNGVGIKYIADMKEELEEKLLPIVKVSMDTLPYQLNKRELRLATLSEQMRLLYVAMTRSEKKLYLVGKGSQEKLGDQYDGKSENNHLPVADREHYLTFQDWLLAIEAAYAADELHFKTSFITDEDLTEDKMGSLEAEQAYDADNLKDNRQSDDIARALDMLEAVEKLNQHYKAAIHLPTVRTPSQIKKFYEPVMETEGVEVMQTSYQTKPKFELPQFSKKAGQDPTALGSSVHELMQRLHLSEQVSLEDILTALAELSVEENVKKAIQVDKILHFFQTSQLGKLIQANADKVYREAPFAMLQADPASGEDYVVRGIIDGYILFDNRIVLFDYKTDKFTNSQAIKERYQGQMTLYAQALSQSYNIQQVDSYLILLGGEKLEVVEI
>NC_013928.1|WP_002265225.1|652798_653554_+|DeoR/GlpR-transcriptional-regulator
MKKEERLEEITKLINKRGTIRVTEVVERLKVSDMTVRRDLTELEGLGVLTRIHGGARSNNIFQYKEMSHEEKHSRQIEEKHYIAQKAAELVEEGDTIFLGPGTTVELLAEEINKTTLQVITNCLPVFQILSQKQSETFRVHLLGGEMRSITQSFIGEITNIVLEKMHFSKMFFSGNGVKGNEVMTSSFQEAYTQKMALGRAIEKYLLIDSSKIGKEDFTSFYQLSQLTALITDCQDDDKLQKLSKYTEIIN
>NC_013928.1|WP_002262463.1|653861_654290_+|galactose-6-phosphate-isomerase-subunit-LacA
MAIIIGSDAAGKRLKDVIKTFLKDNNHEVLDVTERKDLDFVDSTLAVVHEVQKNDKNLGIAIDAYGAGSFMVATKVKGMIAAEVSDERSAYMTRGHNNARIITLGAEIVGDELAKNIVKDFVEAKYDGGRHQIRVDMLNKMC
>NC_013928.1|WP_002262464.1|654315_654831_+|galactose-6-phosphate-isomerase-subunit-LacB
MKIAIGCDHIVTDVKMELSKHLKEEGYEVLDVGTYDFTRTHYPIFGKKVGEAVSSGEADLGVCMCGTGVGISNAANKVPGVRTALVRDMTSALYSKEELNANVVSFGGAIIGKLLLFDIVDAFIKAQYKPTEENKKLIAKIKHLEAHNDKQADPHFFDEFLEKWNRGDYHD
>NC_013928.1|WP_002277662.1|654849_655782_+|tagatose-6-phosphate-kinase
MMLTVTMNPSIDIAYQLDDLKVDTVNRVIETHKTPGGKGLNVTRVLSQLGDDVLASGLLGGKLGEFLEAELDKSAIKHSFYKISAETRNCIAILHGGYQTEILEQGPYVSAKESKGFLEFFEKLLPKLEVVAISGSLPKGVPVDYYSQMIAICKQHQVPIVLDCSGQALLEVLNGAAKPTVIKPNTEELSQIMEREITNDVAVLKYALASPIFSGIDWIIVSLGSQGAFAKHGQTFYKVTIPKIAVVNPVGSGDSTVAGITSALAAGASDEKLLKKANTLGMLNAQEKLTGHVNLENYDNLYQQIEVAEV
>NC_013928.1|WP_002277661.1|655786_656764_+|tagatose-bisphosphate-aldolase
MTLTQEKRSYMEKLSDENGIISALAFDQRGALKRLMAQYQTQEPTIAQMEELKVLVAEELTPYASSMLLDPEYGLPAAKHLDKNAGLLLAYEKTGYDTTSTKRLPDCLVEWSAKRLKKQGADAVKFLLYYDVDGDEEVNQQKQAYIERIGSECKAEDIPFFLEILAYDETITDAASVEYAKVKPHKVLDAMKVFSDERFGIDVLKVEVPVNMKYVEGFGDGPIVHTQDQAANFFKQQDQATPLPYIYLSAGVSAKLFQDTLVFAKESGANFNGVLCGRATWAGSVKDYIEKGEAAARQWLRTEGFKNIDELNKVLKATATSWKER
>NC_013928.1|WP_012997666.1|656779_657094_+|PTS-lactose/cellobiose-transporter-subunit-IIA
MNREEATLLGFEIVAYAGDARSKLLEALNAVQAGEYDRAEELVAAADDCIVDAHKAQTSLLAKEAQGDDIELSVTLMHGQDHLMTTILLKDLMKHLIELYKRGS
>NC_013928.1|WP_002277660.1|657100_658807_+|PTS-transporter-subunit-EIIC
MNTLIAQIEKGKPFFEKISRNIYLRAIRDGFISAMPVILFSSIFLLIAYVPNIFGFTWPKGIENMLMTPYNYTMGIIGFLVAGTTAKSLTDSMNRQLEKTNQINFISTMLASMAGFLIMAADPAKEGGFLSAFMGTKGLLTAFIAAFITVNVYKICVKNNVTIRMPEEVPPNISQVFKDIFPFAFSIIILYAIQLAIKAVIGVNVAQSIGTLLAPLFSAADGYLGITIIFGAYALFWFVGIHGPSIVEPAIAAITYSNVELNAHLIHAGQHADKVITSGTQMFIVTMGGTGATLVVPFMFMWLCKSKRNKAIGRASVVPTFFGVNEPILFGAPIVLNPVFFIPFILAPIVNVWIFKFFVDTLGMNSFFANLPWTTPGPIGIVLGTGFAVLSFVLAALLILVDTVIYYPFVKVYDEQILAEEAEGKSSSDALKEKVAANFDTKKADAILEGAESKEEPATHAITEETNVLVLCAGGGTSGLLANALNKAAEEYGAPVKAAAGSYGAHREILDQYQLVILAPQVASNYEDMKAETDKLGIKLAKTEGAQYIGLTRDGKGALAFVEEQFRD
>NC_013928.1|WP_002265219.1|658818_660225_+|6-phospho-beta-galactosidase
MSKTLPKDFIFGGATAAYQAEGATHADGKGPVAWDKYLEDNYWYTAEPASDFYHQYPVDLKLAEEFGVNGIRISIAWSRIFPKGYGAVNPKGLAFYHNLFAECHKRHVEPFVTLHHFDTPEALHSNGDFLNRENIEHFVNYAEFCFKEFSEVNYWTTFNEIGPIGDGQYLVGKFPPGIQYDLAKVFQSHHNMMVAHSKAVKLFKDGGYSGEIGVVHALPTKYPYDPNNPADIRAAELEDIIHNKFILDATYLGKYSEKTMEGVNHILAVNGGQLDLREEDFAALEAAKDLNDFLGINYYMSDWMRAFDGETEITHNAKGEKGSSKYQIKGVGRREAPVNVPKTDWDWIIYPQGLYDQIMRVKQDYPNYKKIYITENGLGYKDEFVNHTVYDDARIDYVKKHLEVLSDAIADGANVKGYFIWSLMDVFSWSNGYEKRYGLFYVDFDTQERYPKKSAYWYKKLAETQIID

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_013928_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_013928_2

743991-748647

TypeII

II-A,II-B

Consensus_repeat	Method
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	PILER-CR
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	CRISPRCasFinder
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	CRT
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	PILER-CR

70 spacers

csn2,cas2,cas1,cas9

The CRISPR arrays of NC_013928_2

>merge|NC_013928|2|743991-748647|PILER-CR,CRISPRCasFinder,CRT,PILER-CR
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACCAAAAGGGTTTCTAATCCCATTCGAAAGCGGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACGATTGTGCCCGCTAGTAAACCGCCTCGCGCGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACCCAAGCTATGCAGTCACGCCTGACCCTGTGGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACTAGAGTTGAAAAAAACACTACAGGCGAAAAGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACTAATACTTCCTCAATTATAAATTCAATTCTGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACGATTGTATCAGTAATCGAACTTCTGCTTATGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACGTTGCTTATGCAGATGATAACACAGGCGCAGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACTGGTCCAAAGTGCAGAGCCAAAGAAAAACAGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACATTGTCAATCGCCGTTCTGCGCTTGCGACGGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACCTCTAGCGCTTATTTCGAGGACAGCGGAGCGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACTCATTGCTCTTGACATCAATAACTTTTTCAGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACGAGCAAAATCAACTATCTCAAAGCTTAGTTGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACTGGCAATTTACCAGCACAGCAATTGCTGGCGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACTTCGCGGTCTACTTTTTTTGATATGCTAATGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACAAAGAATAAGTTCTCTCACAATGTTTGAAAGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACCAGGTTTCATCTTAGGAAACGTATTGATGAGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACGCTTGAATATAATTGTGTATCCGCCAATGAGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACACCTTGTGGTCCGTCTTCTCCGCCACTTTCGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACCAAACGGCGGTTTGACTGACTCAGGAATTTGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACGATTAAAAACATAGATGAAAACGGCTATTTGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACATCCACAGGCACAGAATTAGTGTTAATCCAGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACTTGACCGTGATAAAGTGTTCAACCACACGTGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACAAAAAGAAACGCCTTTTGATTTGACCAATCGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACCAATGCTAGTTAAGCTCTTGATGCTTTGAGGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACCCACTCTTGCTCCTGATTGGTCAAATCAAAGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACGTTCCATTGAACGCATTGATGGGAACAACAGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACCGTTACTGGTGTTCACGGCGACAGCATGGAGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACATGAAAAGCCTCGTTTCTAAGGCTTTTGGTGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACAGTTATTAATATCTATGACAGTCTCAAAGAGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACCGGATATAGCCTAGCATATAATCGCGTGTGGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACTTCAATCGGTGATGATATTGTCTGCTATCAGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACAATGTATGCACCGCGTTTTTTAACAAAATAGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACGTTTGCTTTTGTTTTTGCCTTGTGTGTTTCGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACATAAAGACGAATATAAAGACCCGAGCACTTGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACTAGACACGGTTGCTAAAACAAAGAAGGTTAGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACTAATATTATTGAGCAAAAATCCTTTAACTCGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACTTCTGGCTGTCTTTCAGAGTGATAAGCGCAGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACGTATCAATACAATCTTAGACGCTCGCACTGGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACCGCCGGTTACAACCGGTTGAACGCCTGCGTGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACTGCAAGTTATCTTGCTATGTGGACGAATTGGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACTGACGGAAACAGAGACGGAACGGCAACTGTGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACGCACTACAAGACGGCTATTGCTGATGAAGTGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACGCAATTTAGTTTTATTCCGTGGGAGCAGCAGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACCGATAAAATTTTGCTAACCCGGAAAGCGGTTGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACAATTGTTACTCCCAACTTCAGCATTGACCAGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACCTCTGCGCTTTGCACGAGCACAGCGATATCGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACTGGCCATGACGATGACGGGACTAAGACTGTGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACAGAGTATAGCCAGTGTTTTCAAGGCCTTTAGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACCGCAACAATGACTATTAATATCAACGGTGGGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACATCAAATTTCGCTTCTGGAGCAATCTCAACGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACAAGAACTCTTAGAAAATATGGTCCACTCATGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACCAGTATACGCCATATTCCATCAGGATGACTGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACCGATAAAGCTACTGTAGCAATTAAAGGCTAGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACTTTCTGTTTTAGCTGAGTTAAGTGCCTTCTGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACTTAAAAAGCTGACAAAAGACAGCAATGAGAGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACAATCGCTTCTTTGCTAACCACAATTTGTGCGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACTTAAAAAGCTGACAAAAGACAGCAATGAGAGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACTATATGTGATGGCAGTTGAAAACATACGTAGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACTTGCAATTGAGGGCAAACGTAGTGAATTGCGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACAAATGCTCTTGAAGAACCTGATAGATGACAGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACTCAGATAAAGATTTTTTTGGAAAGTACAATGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACTATTAAATTACTTGTAATTACAAAGCCTAAGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACATTAGAGAGCAGATGCAATCACCCGTTATGGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACTAGAGCTCTTAGTTTTTTACGCGTTGGGCCGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACCAAATTTGCCGGCGGGGTCGGTAAAACGGTCGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACTGCAAAAGATGGCCTCGAGCAATTATCGCAGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACGAAAAGGAAAATCTTACTTAGCTCATGAGTGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACCTGACCAAGAGAATTAATTCTAAAGATAAAGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACCTGACCAAGAGAATTAATTCTAAAGATAAAGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACGGCACATATAATCCGTAAAGGCGGCACATGTTTTAGAGCCATGTTAGTTACTGATTTACTAAAAC

>NC_013928|2|2|743991-744356|PILER-CR
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	CAAAAGGGTTTCTAATCCCATTCGAAAGCG
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	GATTGTGCCCGCTAGTAAACCGCCTCGCGC
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	CCAAGCTATGCAGTCACGCCTGACCCTGTG
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	TAGAGTTGAAAAAAACACTACAGGCGAAAA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	TAATACTTCCTCAATTATAAATTCAATTCT
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACGATTGTATCAGTAATCGAACTTCTGCTTATGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACGTTGCTTATGCAGATGATAACACAGGCGCAGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACTGGTCCAAAGTGCAGAGCCAAAGAAAAACAGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACATTGTCAATCGCCGTTCTGCGCTTGCGACGGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACCTCTAGCGCTTATTTCGAGGACAGCGGAGCGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACTCATTGCTCTTGACATCAATAACTTTTTCAGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACGAGCAAAATCAACTATCTCAAAGCTTAGTTGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACTGGCAATTTACCAGCACAGCAATTGCTGGCGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACTTCGCGGTCTACTTTTTTTGATATGCTAATGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACAAAGAATAAGTTCTCTCACAATGTTTGAAAGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACCAGGTTTCATCTTAGGAAACGTATTGATGAGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACGCTTGAATATAATTGTGTATCCGCCAATGAGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACACCTTGTGGTCCGTCTTCTCCGCCACTTTCGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACCAAACGGCGGTTTGACTGACTCAGGAATTTGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACGATTAAAAACATAGATGAAAACGGCTATTTGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACATCCACAGGCACAGAATTAGTGTTAATCCAGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACTTGACCGTGATAAAGTGTTCAACCACACGTGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACAAAAAGAAACGCCTTTTGATTTGACCAATCGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACCAATGCTAGTTAAGCTCTTGATGCTTTGAGGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACCCACTCTTGCTCCTGATTGGTCAAATCAAAGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACGTTCCATTGAACGCATTGATGGGAACAACAGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACCGTTACTGGTGTTCACGGCGACAGCATGGAGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACATGAAAAGCCTCGTTTCTAAGGCTTTTGGTGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACAGTTATTAATATCTATGACAGTCTCAAAGAGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACCGGATATAGCCTAGCATATAATCGCGTGTGGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACTTCAATCGGTGATGATATTGTCTGCTATCAGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACAATGTATGCACCGCGTTTTTTAACAAAATAGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACGTTTGCTTTTGTTTTTGCCTTGTGTGTTTCGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACATAAAGACGAATATAAAGACCCGAGCACTTGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACTAGACACGGTTGCTAAAACAAAGAAGGTTAGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACTAATATTATTGAGCAAAAATCCTTTAACTCGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACTTCTGGCTGTCTTTCAGAGTGATAAGCGCAGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACGTATCAATACAATCTTAGACGCTCGCACTGGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACCGCCGGTTACAACCGGTTGAACGCCTGCGTGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACTGCAAGTTATCTTGCTATGTGGACGAATTGGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACTGACGGAAACAGAGACGGAACGGCAACTGTGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACGCACTACAAGACGGCTATTGCTGATGAAGTGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACGCAATTTAGTTTTATTCCGTGGGAGCAGCAGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACCGATAAAATTTTGCTAACCCGGAAAGCGGTTGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACAATTGTTACTCCCAACTTCAGCATTGACCAGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACCTCTGCGCTTTGCACGAGCACAGCGATATCGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACTGGCCATGACGATGACGGGACTAAGACTGTGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	AGAGTATAGCCAGTGTTTTCAAGGCCTTTA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	CGCAACAATGACTATTAATATCAACGGTGG
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	ATCAAATTTCGCTTCTGGAGCAATCTCAAC
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	AAGAACTCTTAGAAAATATGGTCCACTCAT
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	CAGTATACGCCATATTCCATCAGGATGACT
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	CGATAAAGCTACTGTAGCAATTAAAGGCTA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	TTTCTGTTTTAGCTGAGTTAAGTGCCTTCT
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	TTAAAAAGCTGACAAAAGACAGCAATGAGA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	AATCGCTTCTTTGCTAACCACAATTTGTGC
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	TTAAAAAGCTGACAAAAGACAGCAATGAGA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	TATATGTGATGGCAGTTGAAAACATACGTA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	TTGCAATTGAGGGCAAACGTAGTGAATTGC
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	AAATGCTCTTGAAGAACCTGATAGATGACA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	TCAGATAAAGATTTTTTTGGAAAGTACAAT
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	TATTAAATTACTTGTAATTACAAAGCCTAA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	ATTAGAGAGCAGATGCAATCACCCGTTATG
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	TAGAGCTCTTAGTTTTTTACGCGTTGGGCC
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	CAAATTTGCCGGCGGGGTCGGTAAAACGGTC
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	TGCAAAAGATGGCCTCGAGCAATTATCGCA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	GAAAAGGAAAATCTTACTTAGCTCATGAGT
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	CTGACCAAGAGAATTAATTCTAAAGATAAA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	CTGACCAAGAGAATTAATTCTAAAGATAAA


>NC_013928|2|2|743991-748582|CRISPRCasFinder
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	CAAAAGGGTTTCTAATCCCATTCGAAAGCG
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	GATTGTGCCCGCTAGTAAACCGCCTCGCGC
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	CCAAGCTATGCAGTCACGCCTGACCCTGTG
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	TAGAGTTGAAAAAAACACTACAGGCGAAAA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	TAATACTTCCTCAATTATAAATTCAATTCT
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	GATTGTATCAGTAATCGAACTTCTGCTTAT
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	GTTGCTTATGCAGATGATAACACAGGCGCA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	TGGTCCAAAGTGCAGAGCCAAAGAAAAACA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	ATTGTCAATCGCCGTTCTGCGCTTGCGACG
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	CTCTAGCGCTTATTTCGAGGACAGCGGAGC
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	TCATTGCTCTTGACATCAATAACTTTTTCA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	GAGCAAAATCAACTATCTCAAAGCTTAGTT
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	TGGCAATTTACCAGCACAGCAATTGCTGGC
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	TTCGCGGTCTACTTTTTTTGATATGCTAAT
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	AAAGAATAAGTTCTCTCACAATGTTTGAAA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	CAGGTTTCATCTTAGGAAACGTATTGATGA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	GCTTGAATATAATTGTGTATCCGCCAATGA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	ACCTTGTGGTCCGTCTTCTCCGCCACTTTC
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	CAAACGGCGGTTTGACTGACTCAGGAATTT
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	GATTAAAAACATAGATGAAAACGGCTATTT
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	ATCCACAGGCACAGAATTAGTGTTAATCCA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	TTGACCGTGATAAAGTGTTCAACCACACGT
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	AAAAAGAAACGCCTTTTGATTTGACCAATC
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	CAATGCTAGTTAAGCTCTTGATGCTTTGAG
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	CCACTCTTGCTCCTGATTGGTCAAATCAAA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	GTTCCATTGAACGCATTGATGGGAACAACA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	CGTTACTGGTGTTCACGGCGACAGCATGGA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	ATGAAAAGCCTCGTTTCTAAGGCTTTTGGT
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	AGTTATTAATATCTATGACAGTCTCAAAGA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	CGGATATAGCCTAGCATATAATCGCGTGTG
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	TTCAATCGGTGATGATATTGTCTGCTATCA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	AATGTATGCACCGCGTTTTTTAACAAAATA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	GTTTGCTTTTGTTTTTGCCTTGTGTGTTTC
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	ATAAAGACGAATATAAAGACCCGAGCACTT
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	TAGACACGGTTGCTAAAACAAAGAAGGTTA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	TAATATTATTGAGCAAAAATCCTTTAACTC
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	TTCTGGCTGTCTTTCAGAGTGATAAGCGCA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	GTATCAATACAATCTTAGACGCTCGCACTG
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	CGCCGGTTACAACCGGTTGAACGCCTGCGT
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	TGCAAGTTATCTTGCTATGTGGACGAATTG
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	TGACGGAAACAGAGACGGAACGGCAACTGT
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	GCACTACAAGACGGCTATTGCTGATGAAGT
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	GCAATTTAGTTTTATTCCGTGGGAGCAGCA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	CGATAAAATTTTGCTAACCCGGAAAGCGGTT
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	AATTGTTACTCCCAACTTCAGCATTGACCA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	CTCTGCGCTTTGCACGAGCACAGCGATATC
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	TGGCCATGACGATGACGGGACTAAGACTGT
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	AGAGTATAGCCAGTGTTTTCAAGGCCTTTA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	CGCAACAATGACTATTAATATCAACGGTGG
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	ATCAAATTTCGCTTCTGGAGCAATCTCAAC
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	AAGAACTCTTAGAAAATATGGTCCACTCAT
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	CAGTATACGCCATATTCCATCAGGATGACT
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	CGATAAAGCTACTGTAGCAATTAAAGGCTA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	TTTCTGTTTTAGCTGAGTTAAGTGCCTTCT
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	TTAAAAAGCTGACAAAAGACAGCAATGAGA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	AATCGCTTCTTTGCTAACCACAATTTGTGC
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	TTAAAAAGCTGACAAAAGACAGCAATGAGA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	TATATGTGATGGCAGTTGAAAACATACGTA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	TTGCAATTGAGGGCAAACGTAGTGAATTGC
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	AAATGCTCTTGAAGAACCTGATAGATGACA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	TCAGATAAAGATTTTTTTGGAAAGTACAAT
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	TATTAAATTACTTGTAATTACAAAGCCTAA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	ATTAGAGAGCAGATGCAATCACCCGTTATG
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	TAGAGCTCTTAGTTTTTTACGCGTTGGGCC
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	CAAATTTGCCGGCGGGGTCGGTAAAACGGTC
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	TGCAAAAGATGGCCTCGAGCAATTATCGCA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	GAAAAGGAAAATCTTACTTAGCTCATGAGT
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	CTGACCAAGAGAATTAATTCTAAAGATAAA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	CTGACCAAGAGAATTAATTCTAAAGATAAA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC

>NC_013928|2|2|743991-748647|CRT
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	CAAAAGGGTTTCTAATCCCATTCGAAAGCG
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	GATTGTGCCCGCTAGTAAACCGCCTCGCGC
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	CCAAGCTATGCAGTCACGCCTGACCCTGTG
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	TAGAGTTGAAAAAAACACTACAGGCGAAAA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	TAATACTTCCTCAATTATAAATTCAATTCT
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	GATTGTATCAGTAATCGAACTTCTGCTTAT
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	GTTGCTTATGCAGATGATAACACAGGCGCA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	TGGTCCAAAGTGCAGAGCCAAAGAAAAACA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	ATTGTCAATCGCCGTTCTGCGCTTGCGACG
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	CTCTAGCGCTTATTTCGAGGACAGCGGAGC
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	TCATTGCTCTTGACATCAATAACTTTTTCA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	GAGCAAAATCAACTATCTCAAAGCTTAGTT
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	TGGCAATTTACCAGCACAGCAATTGCTGGC
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	TTCGCGGTCTACTTTTTTTGATATGCTAAT
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	AAAGAATAAGTTCTCTCACAATGTTTGAAA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	CAGGTTTCATCTTAGGAAACGTATTGATGA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	GCTTGAATATAATTGTGTATCCGCCAATGA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	ACCTTGTGGTCCGTCTTCTCCGCCACTTTC
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	CAAACGGCGGTTTGACTGACTCAGGAATTT
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	GATTAAAAACATAGATGAAAACGGCTATTT
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	ATCCACAGGCACAGAATTAGTGTTAATCCA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	TTGACCGTGATAAAGTGTTCAACCACACGT
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	AAAAAGAAACGCCTTTTGATTTGACCAATC
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	CAATGCTAGTTAAGCTCTTGATGCTTTGAG
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	CCACTCTTGCTCCTGATTGGTCAAATCAAA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	GTTCCATTGAACGCATTGATGGGAACAACA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	CGTTACTGGTGTTCACGGCGACAGCATGGA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	ATGAAAAGCCTCGTTTCTAAGGCTTTTGGT
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	AGTTATTAATATCTATGACAGTCTCAAAGA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	CGGATATAGCCTAGCATATAATCGCGTGTG
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	TTCAATCGGTGATGATATTGTCTGCTATCA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	AATGTATGCACCGCGTTTTTTAACAAAATA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	GTTTGCTTTTGTTTTTGCCTTGTGTGTTTC
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	ATAAAGACGAATATAAAGACCCGAGCACTT
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	TAGACACGGTTGCTAAAACAAAGAAGGTTA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	TAATATTATTGAGCAAAAATCCTTTAACTC
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	TTCTGGCTGTCTTTCAGAGTGATAAGCGCA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	GTATCAATACAATCTTAGACGCTCGCACTG
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	CGCCGGTTACAACCGGTTGAACGCCTGCGT
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	TGCAAGTTATCTTGCTATGTGGACGAATTG
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	TGACGGAAACAGAGACGGAACGGCAACTGT
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	GCACTACAAGACGGCTATTGCTGATGAAGT
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	GCAATTTAGTTTTATTCCGTGGGAGCAGCA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	CGATAAAATTTTGCTAACCCGGAAAGCGGTT
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	AATTGTTACTCCCAACTTCAGCATTGACCA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	CTCTGCGCTTTGCACGAGCACAGCGATATC
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	TGGCCATGACGATGACGGGACTAAGACTGT
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	AGAGTATAGCCAGTGTTTTCAAGGCCTTTA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	CGCAACAATGACTATTAATATCAACGGTGG
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	ATCAAATTTCGCTTCTGGAGCAATCTCAAC
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	AAGAACTCTTAGAAAATATGGTCCACTCAT
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	CAGTATACGCCATATTCCATCAGGATGACT
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	CGATAAAGCTACTGTAGCAATTAAAGGCTA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	TTTCTGTTTTAGCTGAGTTAAGTGCCTTCT
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	TTAAAAAGCTGACAAAAGACAGCAATGAGA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	AATCGCTTCTTTGCTAACCACAATTTGTGC
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	TTAAAAAGCTGACAAAAGACAGCAATGAGA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	TATATGTGATGGCAGTTGAAAACATACGTA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	TTGCAATTGAGGGCAAACGTAGTGAATTGC
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	AAATGCTCTTGAAGAACCTGATAGATGACA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	TCAGATAAAGATTTTTTTGGAAAGTACAAT
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	TATTAAATTACTTGTAATTACAAAGCCTAA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	ATTAGAGAGCAGATGCAATCACCCGTTATG
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	TAGAGCTCTTAGTTTTTTACGCGTTGGGCC
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	CAAATTTGCCGGCGGGGTCGGTAAAACGGTC
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	TGCAAAAGATGGCCTCGAGCAATTATCGCA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	GAAAAGGAAAATCTTACTTAGCTCATGAGT
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	CTGACCAAGAGAATTAATTCTAAAGATAAA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	CTGACCAAGAGAATTAATTCTAAAGATAAA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	GGCACATATAATCCGTAAAGGCGGCACAT
GTTTTAGAGCCATGTTAGTTACTGATTTACTAAAAC

>NC_013928|2|3|747094-748582|PILER-CR
	CAAAAGGGTTTCTAATCCCATTCGAAAGCG
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	GATTGTGCCCGCTAGTAAACCGCCTCGCGC
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	CCAAGCTATGCAGTCACGCCTGACCCTGTG
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	TAGAGTTGAAAAAAACACTACAGGCGAAAA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	TAATACTTCCTCAATTATAAATTCAATTCT
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACGATTGTATCAGTAATCGAACTTCTGCTTATGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACGTTGCTTATGCAGATGATAACACAGGCGCAGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACTGGTCCAAAGTGCAGAGCCAAAGAAAAACAGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACATTGTCAATCGCCGTTCTGCGCTTGCGACGGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACCTCTAGCGCTTATTTCGAGGACAGCGGAGCGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACTCATTGCTCTTGACATCAATAACTTTTTCAGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACGAGCAAAATCAACTATCTCAAAGCTTAGTTGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACTGGCAATTTACCAGCACAGCAATTGCTGGCGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACTTCGCGGTCTACTTTTTTTGATATGCTAATGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACAAAGAATAAGTTCTCTCACAATGTTTGAAAGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACCAGGTTTCATCTTAGGAAACGTATTGATGAGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACGCTTGAATATAATTGTGTATCCGCCAATGAGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACACCTTGTGGTCCGTCTTCTCCGCCACTTTCGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACCAAACGGCGGTTTGACTGACTCAGGAATTTGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACGATTAAAAACATAGATGAAAACGGCTATTTGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACATCCACAGGCACAGAATTAGTGTTAATCCAGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACTTGACCGTGATAAAGTGTTCAACCACACGTGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACAAAAAGAAACGCCTTTTGATTTGACCAATCGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACCAATGCTAGTTAAGCTCTTGATGCTTTGAGGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACCCACTCTTGCTCCTGATTGGTCAAATCAAAGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACGTTCCATTGAACGCATTGATGGGAACAACAGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACCGTTACTGGTGTTCACGGCGACAGCATGGAGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACATGAAAAGCCTCGTTTCTAAGGCTTTTGGTGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACAGTTATTAATATCTATGACAGTCTCAAAGAGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACCGGATATAGCCTAGCATATAATCGCGTGTGGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACTTCAATCGGTGATGATATTGTCTGCTATCAGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACAATGTATGCACCGCGTTTTTTAACAAAATAGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACGTTTGCTTTTGTTTTTGCCTTGTGTGTTTCGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACATAAAGACGAATATAAAGACCCGAGCACTTGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACTAGACACGGTTGCTAAAACAAAGAAGGTTAGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACTAATATTATTGAGCAAAAATCCTTTAACTCGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACTTCTGGCTGTCTTTCAGAGTGATAAGCGCAGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACGTATCAATACAATCTTAGACGCTCGCACTGGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACCGCCGGTTACAACCGGTTGAACGCCTGCGTGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACTGCAAGTTATCTTGCTATGTGGACGAATTGGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACTGACGGAAACAGAGACGGAACGGCAACTGTGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACGCACTACAAGACGGCTATTGCTGATGAAGTGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACGCAATTTAGTTTTATTCCGTGGGAGCAGCAGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACCGATAAAATTTTGCTAACCCGGAAAGCGGTTGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACAATTGTTACTCCCAACTTCAGCATTGACCAGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACCTCTGCGCTTTGCACGAGCACAGCGATATCGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAACTGGCCATGACGATGACGGGACTAAGACTGTGTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	AGAGTATAGCCAGTGTTTTCAAGGCCTTTA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	CGCAACAATGACTATTAATATCAACGGTGG
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	ATCAAATTTCGCTTCTGGAGCAATCTCAAC
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	AAGAACTCTTAGAAAATATGGTCCACTCAT
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	CAGTATACGCCATATTCCATCAGGATGACT
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	CGATAAAGCTACTGTAGCAATTAAAGGCTA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	TTTCTGTTTTAGCTGAGTTAAGTGCCTTCT
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	TTAAAAAGCTGACAAAAGACAGCAATGAGA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	AATCGCTTCTTTGCTAACCACAATTTGTGC
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	TTAAAAAGCTGACAAAAGACAGCAATGAGA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	TATATGTGATGGCAGTTGAAAACATACGTA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	TTGCAATTGAGGGCAAACGTAGTGAATTGC
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	AAATGCTCTTGAAGAACCTGATAGATGACA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	TCAGATAAAGATTTTTTTGGAAAGTACAAT
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	TATTAAATTACTTGTAATTACAAAGCCTAA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	ATTAGAGAGCAGATGCAATCACCCGTTATG
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	TAGAGCTCTTAGTTTTTTACGCGTTGGGCC
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	CAAATTTGCCGGCGGGGTCGGTAAAACGGTC
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	TGCAAAAGATGGCCTCGAGCAATTATCGCA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	GAAAAGGAAAATCTTACTTAGCTCATGAGT
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	CTGACCAAGAGAATTAATTCTAAAGATAAA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC	CTGACCAAGAGAATTAATTCTAAAGATAAA
GTTTTAGAGCTGTGTTGTTTCGAATGGTTCCAAAAC

Protein	Signature genes	Signature genes Name	Protein_function
NC_013928.1\|WP_002287734.1\|755678_756155_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NC_013928.1\|WP_002272315.1\|757893_759534_+\|phosphoenolpyruvate-carboxykinase-(ATP)	unknown	unknown	gnl\|CDD\|236471
NC_013928.1\|WP_002274019.1\|733318_734809_-\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|180854
NC_013928.1\|WP_002275415.1\|750385_752137_+\|LPXTG-cell-wall-anchor-domain-containing-protein	unknown	unknown	gnl\|CDD\|369832
NC_013928.1\|WP_002264921.1\|734939_735818_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197666
NC_013928.1\|WP_002263547.1\|742157_742502_+\|CRISPR-associated-endonuclease-Cas2	cas2	COG3512_cas2_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|226043
NC_013928.1\|WP_002278029.1\|754772_755600_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223669
NC_013928.1\|WP_002277363.1\|741294_742161_+\|type-II-CRISPR-associated-endonuclease-Cas1	cas1	cd09720_cas1_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|187851
NC_013928.1\|WP_002283187.1\|729440_731969_+\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|213222
NC_013928.1\|WP_012997704.1\|756234_756843_+\|hypothetical-protein	unknown	unknown	unknown
NC_013928.1\|WP_002272314.1\|756907_757564_-\|Pr6Pr-family-membrane-protein	unknown	unknown	unknown
NC_013928.1\|WP_012997702.1\|748729_749623_-\|LexA-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|119397
NC_013928.1\|WP_002272316.1\|759726_760809_-\|DEAD/DEAH-box-helicase	unknown	unknown	gnl\|CDD\|223587
NC_013928.1\|WP_002275427.1\|742491_743154_+\|type-II-A-CRISPR-associated-protein-Csn2	csn2	cd09758_csn2_CAS-II-A	gnl\|CDD\|213408
NC_013928.1\|WP_002264916.1\|743250_743442_+\|type-II-toxin-antitoxin-system-HicA-family-toxin	unknown	unknown	gnl\|CDD\|377942
NC_013928.1\|WP_002275416.1\|752908_754744_+\|elongation-factor-4	unknown	unknown	gnl\|CDD\|235462
NC_013928.1\|WP_012997687.1\|735924_736791_+\|NAD(P)H-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|377026
NC_013928.1\|WP_012997688.1\|737257_741295_+\|type-II-CRISPR-RNA-guided-endonuclease-Cas9	cas9	COG3513_cas9_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|226044
NC_013928.1\|WP_002265422.1\|743459_743837_+\|type-II-toxin-antitoxin-system-HicB-family-antitoxin	unknown	unknown	gnl\|CDD\|374224
NC_013928.1\|WP_002262720.1\|749938_750223_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197775

Protein	Function_ID	Function_description	E-value
NC_013928.1\|WP_002287734.1\|755678_756155_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	1.80867e-16
NC_013928.1\|WP_002272315.1\|757893_759534_+\|phosphoenolpyruvate-carboxykinase-(ATP)	gnl\|CDD\|236471	PRK09344, PRK09344, phosphoenolpyruvate carboxykinase.	4.15747e-12
NC_013928.1\|WP_002274019.1\|733318_734809_-\|FAD-dependent-oxidoreductase	gnl\|CDD\|180854	PRK07121, PRK07121, FAD-binding protein.	1.02417e-41
NC_013928.1\|WP_002275415.1\|750385_752137_+\|LPXTG-cell-wall-anchor-domain-containing-protein	gnl\|CDD\|369832	pfam08363, GbpC, Glucan-binding protein C. This domain is found in the Streptococcus Glucan-binding protein C (GbpC) and also in surface protein antigen (Spa)-family proteins which show sequence similarity to GbpC.	4.862e-110
NC_013928.1\|WP_002264921.1\|734939_735818_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|197666	smart00342, HTH_ARAC, helix_turn_helix, arabinose operon control protein.	6.70782e-21
NC_013928.1\|WP_002263547.1\|742157_742502_+\|CRISPR-associated-endonuclease-Cas2	gnl\|CDD\|226043	COG3512, COG3512, CRISPR-associated protein, Cas2 homolog [Defense mechanisms].	1.02077e-50
NC_013928.1\|WP_002278029.1\|754772_755600_+\|alpha/beta-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	1.87894e-06
NC_013928.1\|WP_002277363.1\|741294_742161_+\|type-II-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|187851	cd09720, Cas1_II, CRISPR/Cas system-associated protein Cas1. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas1 is the most universal CRISPR system protein thought to be involved in spacer intergration. Cas1 is metal-dependent deoxyribonuclease, also binds RNA; Shown to possess a unique fold consisting of a N-terminal beta-strand domain and a C-terminal alpha-helical domain.	2.57007e-129
NC_013928.1\|WP_002283187.1\|729440_731969_+\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|213222	cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein. This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of lipoproteins from the cytoplasmic membrane (LolCDE). They are clustered together phylogenetically. MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all. An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport. The LolCDE complex catalyzes the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane.	6.97053e-103
NC_013928.1\|WP_012997702.1\|748729_749623_-\|LexA-family-transcriptional-regulator	gnl\|CDD\|119397	cd06529, S24_LexA-like, Peptidase S24 LexA-like proteins are involved in the SOS response leading to the repair of single-stranded DNA within the bacterial cell. This family includes: the lambda repressor CI/C2 family and related bacterial prophage repressor proteins; LexA (EC 3.4.21.88), the repressor of genes in the cellular SOS response to DNA damage; MucA and the related UmuD proteins, which are lesion-bypass DNA polymerases, induced in response to mitogenic DNA damage; RulA, a component of the rulAB locus that confers resistance to UV, and RuvA, which is a component of the RuvABC resolvasome that catalyzes the resolution of Holliday junctions that arise during genetic recombination and DNA repair. The LexA-like proteins contain two-domains: an N-terminal DNA binding domain and a C-terminal domain (CTD) that provides LexA dimerization as well as cleavage activity. They undergo autolysis, cleaving at an Ala-Gly or a Cys-Gly bond, separating the DNA-binding domain from the rest of the protein. In the presence of single-stranded DNA, the LexA, UmuD and MucA proteins interact with RecA, activating self cleavage, thus either derepressing transcription in the case of LexA or activating the lesion-bypass polymerase in the case of UmuD and MucA. The LexA proteins are serine proteases that carry out catalysis using a serine/lysine dyad instead of the prototypical serine/histidine/aspartic acid triad found in most serine proteases. LexA sequence homologs are found in almost all of the bacterial genomes sequenced to date, covering a large number of phyla, suggesting both, an ancient origin and a widespread distribution of lexA and the SOS response.	4.52382e-23
NC_013928.1\|WP_002272316.1\|759726_760809_-\|DEAD/DEAH-box-helicase	gnl\|CDD\|223587	COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis].	1.41144e-94
NC_013928.1\|WP_002275427.1\|742491_743154_+\|type-II-A-CRISPR-associated-protein-Csn2	gnl\|CDD\|213408	cd09758, Csn2, CRISPR/Cas system-associated protein Csn2. Csn2 is a Nmeni subtype-specific Cas protein, which may function in the adaptation process which mediates the incorporation of foreign nucleic acids into the microbial host genome. Csn 2 may interact directly with double-stranded DNA. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA. Csn2 has been predicted to be a functional analog of Cas4 based on anti-correlated phyletic patterns; also known as SPy1049 family.	1.44325e-115
NC_013928.1\|WP_002264916.1\|743250_743442_+\|type-II-toxin-antitoxin-system-HicA-family-toxin	gnl\|CDD\|377942	pfam07927, HicA_toxin, HicA toxin of bacterial toxin-antitoxin,. HicA_toxin is a bacterial family of toxins that act as mRNA interferases. The antitoxin that neutralizes this is family HicB, pfam15919.	2.78474e-15
NC_013928.1\|WP_002275416.1\|752908_754744_+\|elongation-factor-4	gnl\|CDD\|235462	PRK05433, PRK05433, GTP-binding protein LepA; Provisional.	0
NC_013928.1\|WP_012997687.1\|735924_736791_+\|NAD(P)H-dependent-oxidoreductase	gnl\|CDD\|377026	pfam03358, FMN_red, NADPH-dependent FMN reductase.	8.92055e-36
NC_013928.1\|WP_012997688.1\|737257_741295_+\|type-II-CRISPR-RNA-guided-endonuclease-Cas9	gnl\|CDD\|226044	COG3513, COG3513, Predicted CRISPR-associated nuclease, contains McrA/HNH-nuclease and RuvC-like nuclease domain [Defense mechanisms].	0
NC_013928.1\|WP_002265422.1\|743459_743837_+\|type-II-toxin-antitoxin-system-HicB-family-antitoxin	gnl\|CDD\|374224	pfam15919, HicB_lk_antitox, HicB_like antitoxin of bacterial toxin-antitoxin system. This is a family of HicB-like antitoxins.	2.66065e-14
NC_013928.1\|WP_002262720.1\|749938_750223_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|197775	smart00530, HTH_XRE, Helix-turn-helix XRE-family like proteins.	8.64754e-07

>NC_013928.1|WP_002265422.1|743459_743837_+|type-II-toxin-antitoxin-system-HicB-family-antitoxin
MLKTYPAIFHKEEEGYWVEFPEFGGGTQGEDLEEAMKNARQMLESVLASYLDEGMKLPNPSEIRKLSVEDGFATMIQADPNPYLKNNKAIRKNVTVPEWLVQLADRDQVNYSEVLTKALERKLQL
>NC_013928.1|WP_002264916.1|743250_743442_+|type-II-toxin-antitoxin-system-HicA-family-toxin
MPLTGKELAKLAINNGWEEVRVRGSHHHFKKDGVPYIVTIPIHGNKVLKIGLEKKLLRDLNLL
>NC_013928.1|WP_002275427.1|742491_743154_+|type-II-A-CRISPR-associated-protein-Csn2
MKLNFPILDEPITLEKSTILVLEDVQVFAQMVRNLYQYDEDSELKFFNRKFKSLKPSELMLVTDILGYDVNAPSLLKLVHADLENQFNEKPEVKSMVEKLANTITELIAYECLENELDLEYDEITILELIKALGVKIETQSDTIFEKMFEVLQVYKYLNKKKLLVFINTLSYFKREEIAQILEYIHLSDMVVLFIEPRKIDDFAQYILDEDYFLITESNN
>NC_013928.1|WP_002263547.1|742157_742502_+|CRISPR-associated-endonuclease-Cas2
MSYRYMRMILMFDMPTDTAEERKAYRKFRKFLLSEGFIMHQFSVYSKLLLNNSANTAMIARLKENNPKKGNITLLTVTEKQFARMIYLNGERDTSIANSDSRLVFLGEAFPDET
>NC_013928.1|WP_002277363.1|741294_742161_+|type-II-CRISPR-associated-endonuclease-Cas1
MGWRTVVVNTHSKLSYKNNHLIFKDTYQTEMIHLSEIDILLLETTDIVLSTMLVKRLVDENILIIFCDDKRLPTAMLMPYYARHDSSLQLNNQISWAEEVKCDVWTTIIAQKILNQSCYLGECSYFEKSQSIMDLYHDLEPFDPSNREGHSARIYFNTLFGNDFSREQDNDINAGLDYGYTLLLSMFAREVVVSGCMTQFGLKHANQFNQFNFASDIMEPFRPIVDRIVYENRNNSFIKIKRELFSMFSDTYLYNNKEMYLTNIVSDYTKKVIKALNNDGKGVPEFRI
>NC_013928.1|WP_012997688.1|737257_741295_+|type-II-CRISPR-RNA-guided-endonuclease-Cas9
MKKPYSIGLDIGTNSVGWAVVTDDYKVPAKKMKVLGNTDKSHIKKNLLGALLFDSGNTAADRRLKRTARRRYTRRRNRILYLQEIFAEEMSKVDDSFFHRLEDSFLVTEDKRGERHPIFGNLEEEVKYHENFPTIYHLRQYLADNPEKVDLRLVYLALAHIIKFRGHFLIEGKFDTRNNDVQRLFQEFLAVYDNTFENSSLQEQNVQVEEILTDKISKSAKKDRVLKLFPNEKSNGRFAEFLKLIVGNQADFKKHFELEEKAPLQFSKDTYEEELEVLLAQIGDNYAELFLSAKKLYDSILLSGILTVTDVSTKAPLSASMIQRYNEHQMDLAQLKQFIRQKLSDKYNEVFSDVSKDGYAGYIDGKTNQEAFYKYLKGLLNKIEGSGYFLDKIEREDFLRKQRTFDNGSIPHQIHLQEMRAIIRRQAEFYPFLADNQDRIEKILTFRIPYYVGPLARGKSDFAWLSRKSADKITPWNFDEIVDKESSAEAFINRMTNYDLYLPNQKVLPKHSLLYEKFTVYNELTKVKYKTEQGKTAFFDANMKQEIFDGVFKVYRKVTKDKLMDFLEKEFDEFRIVDLTGLDKENKAFNASYGTYHDLRKILDKDFLDNSKNEKILEDIVLTLTLFEDREMIRKRLENYSDLLTKEQVKKLERRHYTGWGRLSAELIHGIRNKESRKTILDYLIDDGNSNRNFMQLINDDALSFKEEIAKAQVIGETDNLNQVVSDIAGSPAIKKGILQSLKIVDELVKIMGHQPENIVVEMARENQFTNQGRRNSQQRLKGLTDSIKEFGSQILKEHPVKHSQLQNDRLFLYYLQNGRDMYTGEELDIDYLSQYDIDHIIPQAFIKDNSIDNRVLTSSKENRGKSDDVPSKNVVRKMKSYWSKLLSAKLITQRKFDNLTKAERGGLTDDDKAGFIKRQLVETRQITKHVARILDERFHTETDENNKKIRQVKIVTLKSNLVSNFRKEFELYKVREINDYHHAHDAYLNAVIGKALLGVYPQLEPEFVYGDYPHFHGHKENKATAKKFFYSNIMNFFKKDDVRTDKNGEIIWKKDEHISNIKKVLSYPQVNIVKKVEEQTGGFSKESILPKGNSDKLIPRKTKKFYWDTKKYGGFDSPIVAYSILVIADIEKGKSKKLKTVKALVGVTIMEKMTFERDPVAFLERKGYRNVQEENIIKLPKYSLFKLENGRKRLLASARELQKGNEIVLPNHLGTLLYHAKNIHKVDEPKHLDYVDKHKDEFKELLDVVSNFSKKYTLAEGNLEKIKELYAQNNGEDLKELASSFINLLTFTAIGAPATFKFFDKNIDRKRYTSTTEILNATLIHQSITGLYETRIDLSKLGGD
>NC_013928.1|WP_012997687.1|735924_736791_+|NAD(P)H-dependent-oxidoreductase
MKLVAIVDSNASFSYNRLLLQFIKERFGQAFALEILEIKELPLFNQDSSAADCPLIQKLNEDILNADGIIIATAEHNQTITASLKSMLEWLSYQLHPFKNKPVMIVGASYYNQGTSHAQEHLRQILNAPGLDAWVMSGNEFFLGNASEVFDENNQIKDDDTVIYLAQCLQRFIRYVTVVQELKGDSIQLSDAISGASESVQEDSAASAMLEKRLSLQKKETNTPFERALDKTYGPALKDTLEDPFDKDLDAQYKAIKKQPIPFEKALDNIFGKDLGIETTDPLDALLK
>NC_013928.1|WP_002264921.1|734939_735818_+|helix-turn-helix-transcriptional-regulator
MVRFISNTLSQTLNEPFQQSHKSCKHLYILEILSQVVIVSDQKQVPLQPYDIILAQSFNHLQIDSLDRNPILLRLYSLDFDLPSPLNQYTVGDNPLIHDLMNDHTSEDAYILFTNLSDLICHAYLDALEKLENLRDNNDEQVYIDFQRQKLAGLLFTELLRQHDAKVSKFASRFPSVNVKYASKDSQSGAIMKYVSDNVHHISLKEAAAHFSYQANYFSRLCHELFGISFNQLKTTIRLEIAKEQLRLTTKSVEEISQELGYKAVSNFHRNFKSQTGMTPNDYRQDKQWKDT
>NC_013928.1|WP_002274019.1|733318_734809_-|FAD-dependent-oxidoreductase
MEKEYKVDVVVAGAGGAGLAAAHAAAQNGLKVLVLEKLKQIGGNTRISSGFFAINTKEQNAAGLKLSTQEAIRQLQEHNHFLSNGALLKNIIEHAKETLEEIEKLGMEIKLNPTKNSTQFAHFGNDYQGGSYHMYMNKDSSYLQIQKSLEAMGVTFIFGVRMTELLQDSNGHVRGLKALNDAGESMTVHAKASIITTGGFGGDKRRVAKVMRTLNLRTLGVPNMGEGLSAMEAAGGVNIDGSALIHAAQMAQSTVTQETKGKQLAGFNDSPLTQLLLSPLLWVDPNGSRFTNEDVVYDTVQWSNAAYGVGSKYYYVMDTATLESYTKQPLLTISKSGPGASQAKGDFVSLAEQAVQQGIAFKGDSLEELAQNSGMDPIAFKATVAEYNKAIASQNDEIFSKSASSLKYDVKKGPFYAFIAQVVYLGTVGGVRVDKDLRVLDAYMKAIPGLYTGGANAGGYYAPRNYPAYEGLASGFSWTSGRLAGLAAANDIKKYN
>NC_013928.1|WP_002283187.1|729440_731969_+|ATP-binding-cassette-domain-containing-protein
MLELKHITKVYETAGIKRMALENVSVNFRANEFVAVLGQSGSGKTTLLNIIGGLDQYTTGDLLINGKSTKDFKDKDWDSYRNNTIGFVFQSYNLISHQTALANVELALTLSGVSKAERRKRALDALKRVGLEDEINKKPNQMSGGQMQRVAIARALVNNPDILLADEPTGALDSETSLQIMDLLKEIAQERLVIMVTHNPDLAEKYSNRIIKVLDGHIINDSNPYTDDEIRKATVDFKKTKMSFTTALSLSFNNLLTKKGRTLLTAFAGSIGIIGIALILSLSNGVQKYIAKTQEDTLVAYPLSIEKSSNKNFIGLLAANSNENKKSDKKKTNKKIGTNSILKNMISTQVVDNDLASFKTYIKKHQKKFAAVTKDIQYSYKITPRIYQSDTSKEVKAVNPNTLSKDLKDTSTSIQTVVSNLDIWQELSSNEKMLSSQYQVISGHLPKQYNEVVLMADENNKIDDYVLYSLGIKDAKQLNSKTIKKVKASSYHYKDLIGRTYKLVINSDLYQKEGNAWIDRSDNDAYMKQVINAAENIKIVGIVKPQEGTTSESSSAGVGYSHDLTDYLAKKIKSSTIAKEQLANKKLNVFTGQSFSSGNKTFSSDNLSVQQQASMASMSAEELADYVNRYNENANATYKDNLGKIGIIDNNNPETIHFYASSFKDKEALKDLISDYNKKVKKDKHKSRVIRYTDTVGLMMSSVTTMINAVTYILIGFVAISLIVSSIMIGIITYISVLERTKEIGVLRAMGASKRDVTRIFTAETIIEGAIAGVLGILITLLLNIAITLIVKNWLNINHISSLPIWSAIVLIAISILLTVFAGILPSRVAAKKDPVEALRTE
>NC_013928.1|WP_012997702.1|748729_749623_-|LexA-family-transcriptional-regulator
MGRGKLTPQDLEAMKTISTNLQRLLAESGMKQSHLATILNIPTSSLNEYVKGKSLPKIGNIQKIADYFGLQKSDIDPRFASKKDSSTLDKINHIAKQLEMKRQIKVLDFCYQQSKEQDETASLSASDETTEDKVADKSNHTQYQKVVDSFIAKELNDQTIIHWDNVIKAKDLYQTFGRQYENIQIYGEVSAGTGIWVGHEKQETIKYPIPIPEHDIALIVNGNSMEPLFYNGDVIFVKKTKAIHHGQIIVVIVNNEAYVKKLYRKNKEIRLISLNPDYDDIILKEDDTIEVIGTVIT
>NC_013928.1|WP_002262720.1|749938_750223_+|helix-turn-helix-transcriptional-regulator
MQFVWESNGKLKGDAEVEKLTLRALRVNYSLSPKEVADCLGIPQHTLLSYEEDSSEIPIQLANDLANYYDISLDSIFFGKNSDLKQKFKNKNNR
>NC_013928.1|WP_002275415.1|750385_752137_+|LPXTG-cell-wall-anchor-domain-containing-protein
MKSKTAKITLLSSLALAAFGATNVFADEASTQLNSDTVAAPTADTQASEPAATEKEQSPVVTVVESHTQGNTTTTTSQVTSKELEDAKANANQEGLEVTETEAQKQPSVEAADADNKAQAQTINTAVADYQKAKAEFPQKQEQYNKDFEKYQSDVKEYEAQKAAYEQYKKEVAQGLASGRVEKAQGLVFINEPEAKLSIEGVNQYLTKEARQKHATEDILQQYNTDNYTASDFTQANPYDPKEDTWFKMKVGDQISVTYDNIVNSKYNDKKISKVKINYTLNSSTNNEGSALVNLFHDPTKTIFIGAQTSNAGRNDKISVTMQIIFYDENGNEIDLSGNNAIMSLSSLNHWTTKYGDHVEKVNLGDNEFVKIPGSSVDLHGNEIYSAKDNQYKANGATFNGDGADGWDAVNADGTPRAATAYYGAGAMTYKGEPFTFTVGGNDQNLPTTIWFATNSAVAVPKDPGAKPTPPEKPELKKPTVTWHKNLVVETKTEEVPPVTPPTTPDEPTPEKPKTPEDPQSPVVAKSVSFRTARKGEMRVRERDYQPTLPHTGAAKQNGLATLGAISTAFAAATLIAARKKEN
>NC_013928.1|WP_002275416.1|752908_754744_+|elongation-factor-4
MTIEQLKNRQEKIRNFSIIAHIDHGKSTLADRILEQTETVSSREMQAQLLDSMDLERERGITIKLNAIELNYKAKNGETYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNDLEILPVINKIDLPAADPERVRTEIEDVIGLDASEAVLASAKAGIGIEEILEQIVEKVPAPKGDVEAPLKALIFDSVYDTYRGVILQIRVMDGMVKPGDKIELMSNGKTFEVTEVGIFTPKAVNRDFLATGDVGYLAASIKTVADTRVGDTVTLADCPAEAPLHGYKQLNPMVFAGIYPIDSSKYNDMREALEKLQLNDASLHFEPETSQALGFGFRCGFLGLLHMDVIQERLEREFNIDLIMTAPSVVYHVYTTDGERLEVSNPSEFPDPTKVDSIEEPYVKAQIMVPQEYVGAVMELSQRKRGDFVTMDYIDNNRVNVIYQIPLAEIVFDFFDKLKSSTRGYASFDYDISEYRKSKLVKMDILLNGDKVDALSFIVHKEFAYERGKLIVEKLKKIIPRQQFEVPIQAAIGQKIVARSDIKALRKNVLAKCYGGDVSRKRKLLEKQKAGKKRMKSIGSVEVPQEAFLSVLSMDDDDKKK
>NC_013928.1|WP_002278029.1|754772_755600_+|alpha/beta-hydrolase
MAALNKEMVNTLLGPIYTCHREGNPCFVFLSGAGFFSTADNFANIIDKLPDSIGILTIDAPNSGYSPVSNQANVGLRDWVNAILMIFEHFKFQSYLLCVHSIGGFAALQIMNQSSKACLGFIGLEPTTAMIYRAGFSSDLYPQLALRRQKLKTAADRLNYLKDLSRSHFSSQQFKQLWRGYDYCQRRLNDVQSLPDFKIRLALGEEDFKTVISEKVPSIVFSESFREKEYLESEYLNKHTQTKLILCGQHHYLHWSETNSILEKAEQLLSNHEKL
>NC_013928.1|WP_002287734.1|755678_756155_+|GNAT-family-N-acetyltransferase
MSIRLAQVTDIPVLKELLNQIFQVHQTVCPDLFKNTDKGSKYSETELKELLQDESKPIFVYTDGKNRVLGHLFLVIKETEGSSVSKPLKTLFIDDLCVSKEARGQKIGQELFEFALKYAKKLGCYDLTLNVWNDNKGALAFYERQGLKARETKMEKIL
>NC_013928.1|WP_012997704.1|756234_756843_+|hypothetical-protein
MPRRRASRRKSKKKAVFSILLTGITLIIIGLAVYFISAYFTNTKKTANKEKTQTHIVNPKKDPEEKKEANSASKATSKFDLTTIATGDYSSAAGTWQNELSDQLKFNASGLESATIQNATDFTISSGQATNDGLYQATLTSADSTVVYNLLFVKGGTAIPENYFTTGYSDTSDTSRDRLYISSQTTFGSDDFSKGVFYKSEN
>NC_013928.1|WP_002272314.1|756907_757564_-|Pr6Pr-family-membrane-protein
MSKTQAFRSLIALLGLIGVSIQIKQSGWGMLLYYTTLSNVIVFSFLTYLVIKEKRNGSINSNPKLLRLKGGVTMTIMITFMVYHFLLAPKVRAYDYYTIRNFLVHYIVPLSTIFDTLICDRRKIYRWFDPIIWTCLPLLYFGFALINGLLLKWPIPGTADSPFPYFFINMNKYGAQQVLINALVIALLYLLFGYILLGIKQMIGQKRQVTDNSSLNMS
>NC_013928.1|WP_002272315.1|757893_759534_+|phosphoenolpyruvate-carboxykinase-(ATP)
MVTRQHFSEDSMRKNNSYFSALKATIETAFYENHVVPLKELAEAYRLAAKSPNTIVLDTPVAHAEDLGLPKDAKILLENSGGIVGRTAKARRIFGQDSKEDAKILQIIREAIFQARHRTFYRADAVVGLDEAFMLRAHLMVPQDDINNLYSWLNNFQVLNDTYRERLKKSKRYEETDIYIFSDPEWSHPDYPDGLVYFDTNHNCAAILGLHYFGELKKATLTLAWGTANRNKYVACHGGLKIFEKEGQKPYVASFFGLSGSGKSTLTHAKHNGKYRIDVLHDDAFVISEEDGSTIALEPAYFDKTNDYPAGHREQKYFVAVQNCGAALDKEGHLRLVTEDIRNGNGRTIKSRFSTPNRVDRINHPIQSIFWIMKDDSLPPLIRVTDPIMASTMGCTLVTTRSTAENTTDSLDTLIIEPYANPFRVYPLVEDYIKFQHLFESGVNCYIINTGSYLGQDIPKETTLDVIEQVVDGTAKFEPFGSVEGFEYLSSSHYKIPNFDKAYVKIIRQRMKIRLQYLEAFNRKNPKLSLPDEAISHLKDVLANLG
>NC_013928.1|WP_002272316.1|759726_760809_-|DEAD/DEAH-box-helicase
MKTQFPSVWQDKLSQKHFSAFTTIQEAAFDPIKNGKSLLGISPTGSGKTLAYLWPSLLTLTPKKAQQLLILAPNTELAGQIFEVAKEWAQPLNLTAQLFLSGSSQKRQIERLKKGPEIIIGTPGRVFDLVKLKKIKMMNVNTIVLDEFDDLLGKSQIHFVENIVKRVPRDHQMIYMSATNSIDRTFLADDTLEIDLSKQTVDTISHYYITVAKRERGELLRKFSNIPNFRGLVFFNRLSDLGANEERLQFSGASAVSLASDVNIKFRKVILEKFKNHELSLLLATDLVARGIDIELLETVINFDLPKDKDAYNHRAGRTGRMGKNGIVVTFISHPEELKKLKKFAHVSEVYLKNQILHKK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_013928_2	2.37\|746403\|30\|NC_013928\|CRISPRCasFinder,CRT	746403-746432	30	DQ386162	Streptococcus phage M102AD, complete genome	784-813	0	1.0
NC_013928_2	2.42\|746733\|30\|NC_013928\|CRISPRCasFinder,CRT	746733-746762	30	NC_029030	Streptococcus phage APCM01, complete genome	1571-1600	0	1.0
NC_013928_2	2.66\|748319\|30\|NC_013928\|CRISPRCasFinder,CRT,PILER-CR	748319-748348	30	AM749121	Streptococcus phage M102 complete genome	27832-27861	0	1.0
NC_013928_2	2.66\|748319\|30\|NC_013928\|CRISPRCasFinder,CRT,PILER-CR	748319-748348	30	NC_012884	Streptococcus phage M102, complete genome	27832-27861	0	1.0
NC_013928_1	1.1\|644307\|33\|NC_013928\|PILER-CR	644307-644339	33	NC_029030	Streptococcus phage APCM01, complete genome	9742-9774	1	0.97
NC_013928_1	1.19\|644308\|32\|NC_013928\|CRISPRCasFinder,CRT	644308-644339	32	NC_029030	Streptococcus phage APCM01, complete genome	9742-9773	1	0.969
NC_013928_2	2.8\|744489\|30\|NC_013928\|CRISPRCasFinder,CRT	744489-744518	30	DQ386162	Streptococcus phage M102AD, complete genome	7735-7764	1	0.967
NC_013928_2	2.17\|745083\|30\|NC_013928\|CRISPRCasFinder,CRT	745083-745112	30	NC_029030	Streptococcus phage APCM01, complete genome	22055-22084	1	0.967
NC_013928_2	2.17\|745083\|30\|NC_013928\|CRISPRCasFinder,CRT	745083-745112	30	MT430910	Streptococcus phage smHBZ8, complete genome	9990-10019	1	0.967
NC_013928_2	2.29\|745875\|30\|NC_013928\|CRISPRCasFinder,CRT	745875-745904	30	MT430910	Streptococcus phage smHBZ8, complete genome	16676-16705	1	0.967
NC_013928_2	2.30\|745941\|30\|NC_013928\|CRISPRCasFinder,CRT	745941-745970	30	NC_029030	Streptococcus phage APCM01, complete genome	21438-21467	1	0.967
NC_013928_2	2.36\|746337\|30\|NC_013928\|CRISPRCasFinder,CRT	746337-746366	30	NC_029030	Streptococcus phage APCM01, complete genome	1523-1552	1	0.967
NC_013928_2	2.43\|746799\|30\|NC_013928\|CRISPRCasFinder,CRT	746799-746828	30	MT430910	Streptococcus phage smHBZ8, complete genome	30048-30077	1	0.967
NC_013928_2	2.45\|746932\|30\|NC_013928\|CRISPRCasFinder,CRT	746932-746961	30	NC_029030	Streptococcus phage APCM01, complete genome	2548-2577	1	0.967
NC_013928_2	2.49\|747196\|30\|NC_013928\|CRISPRCasFinder,CRT,PILER-CR	747196-747225	30	NC_029030	Streptococcus phage APCM01, complete genome	17264-17293	1	0.967
NC_013928_2	2.56\|747658\|30\|NC_013928\|CRISPRCasFinder,CRT,PILER-CR	747658-747687	30	MT430910	Streptococcus phage smHBZ8, complete genome	7206-7235	1	0.967
NC_013928_2	2.64\|748186\|30\|NC_013928\|CRISPRCasFinder,CRT,PILER-CR	748186-748215	30	MT430910	Streptococcus phage smHBZ8, complete genome	29415-29444	1	0.967
NC_013928_1	1.4\|644490\|33\|NC_013928\|PILER-CR	644490-644522	33	MT430910	Streptococcus phage smHBZ8, complete genome	13300-13332	2	0.939
NC_013928_1	1.7\|644673\|33\|NC_013928\|PILER-CR	644673-644705	33	AM749121	Streptococcus phage M102 complete genome	17385-17417	2	0.939
NC_013928_1	1.7\|644673\|33\|NC_013928\|PILER-CR	644673-644705	33	NC_012884	Streptococcus phage M102, complete genome	17385-17417	2	0.939
NC_013928_1	1.7\|644673\|33\|NC_013928\|PILER-CR	644673-644705	33	DQ386162	Streptococcus phage M102AD, complete genome	17507-17539	2	0.939
NC_013928_1	1.19\|644308\|32\|NC_013928\|CRISPRCasFinder,CRT	644308-644339	32	AM749121	Streptococcus phage M102 complete genome	9606-9637	2	0.938
NC_013928_1	1.19\|644308\|32\|NC_013928\|CRISPRCasFinder,CRT	644308-644339	32	NC_012884	Streptococcus phage M102, complete genome	9606-9637	2	0.938
NC_013928_1	1.19\|644308\|32\|NC_013928\|CRISPRCasFinder,CRT	644308-644339	32	DQ386162	Streptococcus phage M102AD, complete genome	9728-9759	2	0.938
NC_013928_1	1.22\|644491\|32\|NC_013928\|CRISPRCasFinder,CRT	644491-644522	32	MT430910	Streptococcus phage smHBZ8, complete genome	13301-13332	2	0.938
NC_013928_1	1.25\|644674\|32\|NC_013928\|CRISPRCasFinder,CRT	644674-644705	32	AM749121	Streptococcus phage M102 complete genome	17385-17416	2	0.938
NC_013928_1	1.25\|644674\|32\|NC_013928\|CRISPRCasFinder,CRT	644674-644705	32	NC_012884	Streptococcus phage M102, complete genome	17385-17416	2	0.938
NC_013928_1	1.25\|644674\|32\|NC_013928\|CRISPRCasFinder,CRT	644674-644705	32	DQ386162	Streptococcus phage M102AD, complete genome	17507-17538	2	0.938
NC_013928_1	1.27\|644796\|33\|NC_013928\|CRISPRCasFinder,CRT	644796-644828	33	DQ386162	Streptococcus phage M102AD, complete genome	14506-14538	2	0.939
NC_013928_1	1.36\|645346\|32\|NC_013928\|CRISPRCasFinder,CRT	645346-645377	32	NC_029030	Streptococcus phage APCM01, complete genome	12748-12779	2	0.938
NC_013928_2	2.2\|744093\|30\|NC_013928\|PILER-CR,CRISPRCasFinder,CRT	744093-744122	30	AM749121	Streptococcus phage M102 complete genome	21151-21180	2	0.933
NC_013928_2	2.2\|744093\|30\|NC_013928\|PILER-CR,CRISPRCasFinder,CRT	744093-744122	30	NC_012884	Streptococcus phage M102, complete genome	21151-21180	2	0.933
NC_013928_2	2.2\|744093\|30\|NC_013928\|PILER-CR,CRISPRCasFinder,CRT	744093-744122	30	DQ386162	Streptococcus phage M102AD, complete genome	21273-21302	2	0.933
NC_013928_2	2.6\|744357\|30\|NC_013928\|CRISPRCasFinder,CRT	744357-744386	30	DQ386162	Streptococcus phage M102AD, complete genome	30106-30135	2	0.933
NC_013928_2	2.8\|744489\|30\|NC_013928\|CRISPRCasFinder,CRT	744489-744518	30	AM749121	Streptococcus phage M102 complete genome	7614-7643	2	0.933
NC_013928_2	2.8\|744489\|30\|NC_013928\|CRISPRCasFinder,CRT	744489-744518	30	NC_012884	Streptococcus phage M102, complete genome	7614-7643	2	0.933
NC_013928_2	2.13\|744819\|30\|NC_013928\|CRISPRCasFinder,CRT	744819-744848	30	NC_029030	Streptococcus phage APCM01, complete genome	20687-20716	2	0.933
NC_013928_2	2.23\|745479\|30\|NC_013928\|CRISPRCasFinder,CRT	745479-745508	30	NC_029030	Streptococcus phage APCM01, complete genome	15654-15683	2	0.933
NC_013928_2	2.23\|745479\|30\|NC_013928\|CRISPRCasFinder,CRT	745479-745508	30	MT430910	Streptococcus phage smHBZ8, complete genome	16500-16529	2	0.933
NC_013928_2	2.29\|745875\|30\|NC_013928\|CRISPRCasFinder,CRT	745875-745904	30	AM749121	Streptococcus phage M102 complete genome	15387-15416	2	0.933
NC_013928_2	2.29\|745875\|30\|NC_013928\|CRISPRCasFinder,CRT	745875-745904	30	NC_012884	Streptococcus phage M102, complete genome	15387-15416	2	0.933
NC_013928_2	2.29\|745875\|30\|NC_013928\|CRISPRCasFinder,CRT	745875-745904	30	DQ386162	Streptococcus phage M102AD, complete genome	15509-15538	2	0.933
NC_013928_2	2.32\|746073\|30\|NC_013928\|CRISPRCasFinder,CRT	746073-746102	30	NC_029030	Streptococcus phage APCM01, complete genome	568-597	2	0.933
NC_013928_2	2.32\|746073\|30\|NC_013928\|CRISPRCasFinder,CRT	746073-746102	30	MT430910	Streptococcus phage smHBZ8, complete genome	31642-31671	2	0.933
NC_013928_2	2.33\|746139\|30\|NC_013928\|CRISPRCasFinder,CRT	746139-746168	30	NC_029030	Streptococcus phage APCM01, complete genome	7456-7485	2	0.933
NC_013928_2	2.33\|746139\|30\|NC_013928\|CRISPRCasFinder,CRT	746139-746168	30	MT430910	Streptococcus phage smHBZ8, complete genome	24745-24774	2	0.933
NC_013928_2	2.37\|746403\|30\|NC_013928\|CRISPRCasFinder,CRT	746403-746432	30	NC_029030	Streptococcus phage APCM01, complete genome	793-822	2	0.933
NC_013928_2	2.37\|746403\|30\|NC_013928\|CRISPRCasFinder,CRT	746403-746432	30	AM749121	Streptococcus phage M102 complete genome	795-824	2	0.933
NC_013928_2	2.37\|746403\|30\|NC_013928\|CRISPRCasFinder,CRT	746403-746432	30	NC_012884	Streptococcus phage M102, complete genome	795-824	2	0.933
NC_013928_2	2.40\|746601\|30\|NC_013928\|CRISPRCasFinder,CRT	746601-746630	30	AM749121	Streptococcus phage M102 complete genome	6766-6795	2	0.933
NC_013928_2	2.40\|746601\|30\|NC_013928\|CRISPRCasFinder,CRT	746601-746630	30	NC_012884	Streptococcus phage M102, complete genome	6766-6795	2	0.933
NC_013928_2	2.42\|746733\|30\|NC_013928\|CRISPRCasFinder,CRT	746733-746762	30	MT430910	Streptococcus phage smHBZ8, complete genome	30639-30668	2	0.933
NC_013928_2	2.43\|746799\|30\|NC_013928\|CRISPRCasFinder,CRT	746799-746828	30	DQ386162	Streptococcus phage M102AD, complete genome	2153-2182	2	0.933
NC_013928_2	2.48\|747130\|30\|NC_013928\|CRISPRCasFinder,CRT,PILER-CR	747130-747159	30	DQ386162	Streptococcus phage M102AD, complete genome	10056-10085	2	0.933
NC_013928_2	2.49\|747196\|30\|NC_013928\|CRISPRCasFinder,CRT,PILER-CR	747196-747225	30	AM749121	Streptococcus phage M102 complete genome	17172-17201	2	0.933
NC_013928_2	2.49\|747196\|30\|NC_013928\|CRISPRCasFinder,CRT,PILER-CR	747196-747225	30	NC_012884	Streptococcus phage M102, complete genome	17172-17201	2	0.933
NC_013928_2	2.49\|747196\|30\|NC_013928\|CRISPRCasFinder,CRT,PILER-CR	747196-747225	30	DQ386162	Streptococcus phage M102AD, complete genome	17294-17323	2	0.933
NC_013928_2	2.56\|747658\|30\|NC_013928\|CRISPRCasFinder,CRT,PILER-CR	747658-747687	30	DQ386162	Streptococcus phage M102AD, complete genome	24386-24415	2	0.933
NC_013928_2	2.60\|747922\|30\|NC_013928\|CRISPRCasFinder,CRT,PILER-CR	747922-747951	30	AM749121	Streptococcus phage M102 complete genome	1875-1904	2	0.933
NC_013928_2	2.60\|747922\|30\|NC_013928\|CRISPRCasFinder,CRT,PILER-CR	747922-747951	30	NC_012884	Streptococcus phage M102, complete genome	1875-1904	2	0.933
NC_013928_2	2.60\|747922\|30\|NC_013928\|CRISPRCasFinder,CRT,PILER-CR	747922-747951	30	DQ386162	Streptococcus phage M102AD, complete genome	1864-1893	2	0.933
NC_013928_2	2.60\|747922\|30\|NC_013928\|CRISPRCasFinder,CRT,PILER-CR	747922-747951	30	MT430910	Streptococcus phage smHBZ8, complete genome	30337-30366	2	0.933
NC_013928_1	1.1\|644307\|33\|NC_013928\|PILER-CR	644307-644339	33	AM749121	Streptococcus phage M102 complete genome	9606-9638	3	0.909
NC_013928_1	1.1\|644307\|33\|NC_013928\|PILER-CR	644307-644339	33	NC_012884	Streptococcus phage M102, complete genome	9606-9638	3	0.909
NC_013928_1	1.1\|644307\|33\|NC_013928\|PILER-CR	644307-644339	33	DQ386162	Streptococcus phage M102AD, complete genome	9728-9760	3	0.909
NC_013928_1	1.9\|644795\|34\|NC_013928\|PILER-CR	644795-644828	34	DQ386162	Streptococcus phage M102AD, complete genome	14506-14539	3	0.912
NC_013928_1	1.18\|645345\|33\|NC_013928\|PILER-CR	645345-645377	33	NC_029030	Streptococcus phage APCM01, complete genome	12748-12780	3	0.909
NC_013928_2	2.3\|744159\|30\|NC_013928\|PILER-CR,CRISPRCasFinder,CRT	744159-744188	30	MT430910	Streptococcus phage smHBZ8, complete genome	11485-11514	3	0.9
NC_013928_2	2.12\|744753\|30\|NC_013928\|CRISPRCasFinder,CRT	744753-744782	30	MT430910	Streptococcus phage smHBZ8, complete genome	23531-23560	3	0.9
NC_013928_2	2.13\|744819\|30\|NC_013928\|CRISPRCasFinder,CRT	744819-744848	30	MT430910	Streptococcus phage smHBZ8, complete genome	11419-11448	3	0.9
NC_013928_2	2.16\|745017\|30\|NC_013928\|CRISPRCasFinder,CRT	745017-745046	30	NC_029030	Streptococcus phage APCM01, complete genome	9458-9487	3	0.9
NC_013928_2	2.17\|745083\|30\|NC_013928\|CRISPRCasFinder,CRT	745083-745112	30	AM749121	Streptococcus phage M102 complete genome	21953-21982	3	0.9
NC_013928_2	2.17\|745083\|30\|NC_013928\|CRISPRCasFinder,CRT	745083-745112	30	NC_012884	Streptococcus phage M102, complete genome	21953-21982	3	0.9
NC_013928_2	2.17\|745083\|30\|NC_013928\|CRISPRCasFinder,CRT	745083-745112	30	DQ386162	Streptococcus phage M102AD, complete genome	22075-22104	3	0.9
NC_013928_2	2.23\|745479\|30\|NC_013928\|CRISPRCasFinder,CRT	745479-745508	30	AM749121	Streptococcus phage M102 complete genome	15563-15592	3	0.9
NC_013928_2	2.23\|745479\|30\|NC_013928\|CRISPRCasFinder,CRT	745479-745508	30	NC_012884	Streptococcus phage M102, complete genome	15563-15592	3	0.9
NC_013928_2	2.23\|745479\|30\|NC_013928\|CRISPRCasFinder,CRT	745479-745508	30	DQ386162	Streptococcus phage M102AD, complete genome	15685-15714	3	0.9
NC_013928_2	2.30\|745941\|30\|NC_013928\|CRISPRCasFinder,CRT	745941-745970	30	MT430910	Streptococcus phage smHBZ8, complete genome	10665-10694	3	0.9
NC_013928_2	2.48\|747130\|30\|NC_013928\|CRISPRCasFinder,CRT,PILER-CR	747130-747159	30	AM749121	Streptococcus phage M102 complete genome	9934-9963	3	0.9
NC_013928_2	2.48\|747130\|30\|NC_013928\|CRISPRCasFinder,CRT,PILER-CR	747130-747159	30	NC_012884	Streptococcus phage M102, complete genome	9934-9963	3	0.9
NC_013928_2	2.49\|747196\|30\|NC_013928\|CRISPRCasFinder,CRT,PILER-CR	747196-747225	30	MT430910	Streptococcus phage smHBZ8, complete genome	14891-14920	3	0.9
NC_013928_2	2.60\|747922\|30\|NC_013928\|CRISPRCasFinder,CRT,PILER-CR	747922-747951	30	NC_029030	Streptococcus phage APCM01, complete genome	1873-1902	3	0.9
NC_013928_1	1.10\|644857\|33\|NC_013928\|PILER-CR	644857-644889	33	MT430910	Streptococcus phage smHBZ8, complete genome	11121-11153	4	0.879
NC_013928_1	1.28\|644858\|32\|NC_013928\|CRISPRCasFinder,CRT	644858-644889	32	MT430910	Streptococcus phage smHBZ8, complete genome	11122-11153	4	0.875
NC_013928_2	2.7\|744423\|30\|NC_013928\|CRISPRCasFinder,CRT	744423-744452	30	NC_029030	Streptococcus phage APCM01, complete genome	16433-16462	4	0.867
NC_013928_2	2.7\|744423\|30\|NC_013928\|CRISPRCasFinder,CRT	744423-744452	30	MT430910	Streptococcus phage smHBZ8, complete genome	15721-15750	4	0.867
NC_013928_2	2.13\|744819\|30\|NC_013928\|CRISPRCasFinder,CRT	744819-744848	30	AM749121	Streptococcus phage M102 complete genome	20592-20621	4	0.867
NC_013928_2	2.13\|744819\|30\|NC_013928\|CRISPRCasFinder,CRT	744819-744848	30	NC_012884	Streptococcus phage M102, complete genome	20592-20621	4	0.867
NC_013928_2	2.13\|744819\|30\|NC_013928\|CRISPRCasFinder,CRT	744819-744848	30	DQ386162	Streptococcus phage M102AD, complete genome	20714-20743	4	0.867
NC_013928_2	2.33\|746139\|30\|NC_013928\|CRISPRCasFinder,CRT	746139-746168	30	AM749121	Streptococcus phage M102 complete genome	7319-7348	4	0.867
NC_013928_2	2.33\|746139\|30\|NC_013928\|CRISPRCasFinder,CRT	746139-746168	30	NC_012884	Streptococcus phage M102, complete genome	7319-7348	4	0.867
NC_013928_2	2.33\|746139\|30\|NC_013928\|CRISPRCasFinder,CRT	746139-746168	30	DQ386162	Streptococcus phage M102AD, complete genome	7440-7469	4	0.867
NC_013928_2	2.41\|746667\|30\|NC_013928\|CRISPRCasFinder,CRT	746667-746696	30	KX853513	Uncultured virus isolate Rctr41k, partial genome	7640-7669	4	0.867
NC_013928_2	2.62\|748054\|30\|NC_013928\|CRISPRCasFinder,CRT,PILER-CR	748054-748083	30	NZ_CP015592	Bacillus cereus strain AR156 plasmid pAR460, complete sequence	413238-413267	4	0.867
NC_013928_2	2.64\|748186\|30\|NC_013928\|CRISPRCasFinder,CRT,PILER-CR	748186-748215	30	DQ386162	Streptococcus phage M102AD, complete genome	2786-2815	4	0.867
NC_013928_1	1.10\|644857\|33\|NC_013928\|PILER-CR	644857-644889	33	AM749121	Streptococcus phage M102 complete genome	20887-20919	5	0.848
NC_013928_1	1.10\|644857\|33\|NC_013928\|PILER-CR	644857-644889	33	NC_012884	Streptococcus phage M102, complete genome	20887-20919	5	0.848
NC_013928_1	1.10\|644857\|33\|NC_013928\|PILER-CR	644857-644889	33	DQ386162	Streptococcus phage M102AD, complete genome	21009-21041	5	0.848
NC_013928_1	1.28\|644858\|32\|NC_013928\|CRISPRCasFinder,CRT	644858-644889	32	AM749121	Streptococcus phage M102 complete genome	20887-20918	5	0.844
NC_013928_1	1.28\|644858\|32\|NC_013928\|CRISPRCasFinder,CRT	644858-644889	32	NC_012884	Streptococcus phage M102, complete genome	20887-20918	5	0.844
NC_013928_1	1.28\|644858\|32\|NC_013928\|CRISPRCasFinder,CRT	644858-644889	32	DQ386162	Streptococcus phage M102AD, complete genome	21009-21040	5	0.844
NC_013928_2	2.5\|744291\|30\|NC_013928\|PILER-CR,CRISPRCasFinder,CRT	744291-744320	30	NC_018686	Bacillus thuringiensis MC28 plasmid pMC183, complete sequence	126773-126802	5	0.833
NC_013928_2	2.13\|744819\|30\|NC_013928\|CRISPRCasFinder,CRT	744819-744848	30	NZ_CP032703	Pantoea dispersa strain DSM 32899 plasmid unnamed1, complete sequence	467127-467156	5	0.833
NC_013928_2	2.27\|745743\|30\|NC_013928\|CRISPRCasFinder,CRT	745743-745772	30	MT084350	Xylella phage Xfas53, complete genome	411-440	5	0.833
NC_013928_2	2.61\|747988\|30\|NC_013928\|CRISPRCasFinder,CRT,PILER-CR	747988-748017	30	NC_010096	Streptococcus agalactiae plasmid pMV158, complete sequence	3991-4020	5	0.833
NC_013928_2	2.61\|747988\|30\|NC_013928\|CRISPRCasFinder,CRT,PILER-CR	747988-748017	30	HG796317	Uncultured bacterium plasmid pRGI00402	192-221	5	0.833
NC_013928_1	1.3\|644429\|33\|NC_013928\|PILER-CR	644429-644461	33	NC_029030	Streptococcus phage APCM01, complete genome	20637-20669	6	0.818
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP023350	Escherichia coli strain ETEC-2264 plasmid unnamed1, complete sequence	84709-84741	6	0.818
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	MG592390	Vibrio phage 1.003.O._10N.286.48.A2, partial genome	27789-27821	6	0.818
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP051696	Escherichia coli strain SCU-313 plasmid pSCU-313-2, complete sequence	56196-56228	6	0.818
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_MG515250	Escherichia coli strain 16-50 plasmid pNDM-EC16-50, complete sequence	68924-68956	6	0.818
NC_013928_1	1.21\|644430\|32\|NC_013928\|CRISPRCasFinder,CRT	644430-644461	32	NC_029030	Streptococcus phage APCM01, complete genome	20637-20668	6	0.812
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP023350	Escherichia coli strain ETEC-2264 plasmid unnamed1, complete sequence	84709-84740	6	0.812
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP051696	Escherichia coli strain SCU-313 plasmid pSCU-313-2, complete sequence	56197-56228	6	0.812
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_KX008967	Shigella sonnei strain 183660 plasmid p183660, complete sequence	1-31	6	0.812
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	MN823989	Klebsiella pneumoniae strain 283149 plasmid p283149-FII, complete sequence	116528-116559	6	0.812
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_MG515250	Escherichia coli strain 16-50 plasmid pNDM-EC16-50, complete sequence	68925-68956	6	0.812
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_MG288681	Klebsiella aerogenes strain E20 plasmid pE20-FIIA, complete sequence	94674-94705	6	0.812
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	MG592390	Vibrio phage 1.003.O._10N.286.48.A2, partial genome	27789-27820	6	0.812
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	MN694298	Marine virus AFVG_250M557, complete genome	18990-19021	6	0.812
NC_013928_2	2.2\|744093\|30\|NC_013928\|PILER-CR,CRISPRCasFinder,CRT	744093-744122	30	NC_047962	Xanthomonas phage Carpasina, complete genome	54404-54433	6	0.8
NC_013928_2	2.9\|744555\|30\|NC_013928\|CRISPRCasFinder,CRT	744555-744584	30	NC_007491	Rhodococcus erythropolis PR4 plasmid pREL1, complete sequence	379-408	6	0.8
NC_013928_2	2.11\|744687\|30\|NC_013928\|CRISPRCasFinder,CRT	744687-744716	30	NC_025440	Listeria phage WIL-1, complete genome	27492-27521	6	0.8
NC_013928_2	2.11\|744687\|30\|NC_013928\|CRISPRCasFinder,CRT	744687-744716	30	MK792752	UNVERIFIED: Listera phage vB-LmoM-SH3-3, complete genome	135113-135142	6	0.8
NC_013928_2	2.11\|744687\|30\|NC_013928\|CRISPRCasFinder,CRT	744687-744716	30	KJ535721	Listeria phage List-36, complete genome	125103-125132	6	0.8
NC_013928_2	2.11\|744687\|30\|NC_013928\|CRISPRCasFinder,CRT	744687-744716	30	KT319598	UNVERIFIED: Listeria phage WIL-2 genomic sequence	27214-27243	6	0.8
NC_013928_2	2.11\|744687\|30\|NC_013928\|CRISPRCasFinder,CRT	744687-744716	30	MN172529	Listeria phage LP-039, complete genome	4693-4722	6	0.8
NC_013928_2	2.11\|744687\|30\|NC_013928\|CRISPRCasFinder,CRT	744687-744716	30	MT668624	Listeria phage LP-Mix_6.2, complete genome	5207-5236	6	0.8
NC_013928_2	2.11\|744687\|30\|NC_013928\|CRISPRCasFinder,CRT	744687-744716	30	MT178766	Listeria virus P100plus, complete genome	105897-105926	6	0.8
NC_013928_2	2.11\|744687\|30\|NC_013928\|CRISPRCasFinder,CRT	744687-744716	30	MT178767	Listeria virus P200, complete genome	105898-105927	6	0.8
NC_013928_2	2.11\|744687\|30\|NC_013928\|CRISPRCasFinder,CRT	744687-744716	30	DQ004855	Listeria bacteriophage P100, complete genome	102252-102281	6	0.8
NC_013928_2	2.11\|744687\|30\|NC_013928\|CRISPRCasFinder,CRT	744687-744716	30	KJ591604	Listeria phage LMTA-148, complete genome	13813-13842	6	0.8
NC_013928_2	2.11\|744687\|30\|NC_013928\|CRISPRCasFinder,CRT	744687-744716	30	KJ094033	Listeria phage LP-048, complete genome	7147-7176	6	0.8
NC_013928_2	2.11\|744687\|30\|NC_013928\|CRISPRCasFinder,CRT	744687-744716	30	MN128594	Listeria phage LP-066, complete genome	5306-5335	6	0.8
NC_013928_2	2.11\|744687\|30\|NC_013928\|CRISPRCasFinder,CRT	744687-744716	30	NC_041862	Listeria phage LP-064, complete genome	13821-13850	6	0.8
NC_013928_2	2.11\|744687\|30\|NC_013928\|CRISPRCasFinder,CRT	744687-744716	30	KJ094030	Listeria phage LP-083-2, complete genome	10487-10516	6	0.8
NC_013928_2	2.11\|744687\|30\|NC_013928\|CRISPRCasFinder,CRT	744687-744716	30	JX126918	Listeria phage LP-125, complete genome	13820-13849	6	0.8
NC_013928_2	2.11\|744687\|30\|NC_013928\|CRISPRCasFinder,CRT	744687-744716	30	KJ094031	Listeria phage LP-124, complete genome	108372-108401	6	0.8
NC_013928_2	2.11\|744687\|30\|NC_013928\|CRISPRCasFinder,CRT	744687-744716	30	NZ_CP026738	Bacillus megaterium strain YC4-R4 plasmid unnamed2	52462-52491	6	0.8
NC_013928_2	2.17\|745083\|30\|NC_013928\|CRISPRCasFinder,CRT	745083-745112	30	MK448895	Streptococcus phage Javan274, complete genome	6392-6421	6	0.8
NC_013928_2	2.18\|745149\|30\|NC_013928\|CRISPRCasFinder,CRT	745149-745178	30	DQ386162	Streptococcus phage M102AD, complete genome	12713-12742	6	0.8
NC_013928_2	2.20\|745281\|30\|NC_013928\|CRISPRCasFinder,CRT	745281-745310	30	NC_005871	Photobacterium profundum SS9 plasmid pPBPR1, complete sequence	20274-20303	6	0.8
NC_013928_2	2.23\|745479\|30\|NC_013928\|CRISPRCasFinder,CRT	745479-745508	30	NZ_CP013578	Rhizobium phaseoli strain N671 plasmid pRphaN671d, complete sequence	33633-33662	6	0.8
NC_013928_2	2.23\|745479\|30\|NC_013928\|CRISPRCasFinder,CRT	745479-745508	30	NZ_CP013572	Rhizobium phaseoli strain N771 plasmid pRphaN671d, complete sequence	33633-33662	6	0.8
NC_013928_2	2.33\|746139\|30\|NC_013928\|CRISPRCasFinder,CRT	746139-746168	30	MH616851	Microviridae sp. isolate ctbg673, complete genome	4007-4036	6	0.8
NC_013928_2	2.40\|746601\|30\|NC_013928\|CRISPRCasFinder,CRT	746601-746630	30	MT430910	Streptococcus phage smHBZ8, complete genome	25298-25327	6	0.8
NC_013928_2	2.48\|747130\|30\|NC_013928\|CRISPRCasFinder,CRT,PILER-CR	747130-747159	30	NZ_CP025613	Niveispirillum cyanobacteriorum strain TH16 plasmid unnamed1, complete sequence	635155-635184	6	0.8
NC_013928_2	2.62\|748054\|30\|NC_013928\|CRISPRCasFinder,CRT,PILER-CR	748054-748083	30	NZ_CP026317	Vibrio campbellii strain BoB-90 plasmid unnamed 1, complete sequence	92896-92925	6	0.8
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_KX928752	Klebsiella pneumoniae strain CRKP-59-KPC plasmid pCRKP-59-KPC, complete sequence	143649-143681	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NC_017627	Escherichia coli 042 plasmid pAA, complete sequence	57658-57690	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	AP018456	Escherichia coli O25b:H4-ST131 plasmid pMRY09-581ECO_1 MRY09-581 DNA, complete sequence	88425-88457	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	AP018457	Escherichia coli O25b:H4-ST131 plasmid pMRY09-592ECO_1 MRY09-592 DNA, complete sequence	30122-30154	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	AP018458	Escherichia coli O25b:H4-ST131 plasmid pMRY09-597ECO_1 MRY09-597 DNA, complete sequence	46677-46709	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_LR213453	Shigella flexneri strain AUSMDU00008355 isolate AUSMDU00008355 plasmid 2	35944-35976	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_KT988018	Escherichia coli strain V282 plasmid pEcoV282, complete sequence	36487-36519	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP015077	Escherichia coli strain Ecol_448 plasmid pEC448_1, complete sequence	108075-108107	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP015070	Escherichia coli strain Ecol_743 plasmid pEC743_1, complete sequence	52220-52252	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP015072	Escherichia coli strain Ecol_743 plasmid pEC743_3, complete sequence	20703-20735	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_KT845955	Escherichia coli strain EP28 plasmid pHNEP28_cfr, complete sequence	47226-47258	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP041339	Escherichia coli strain CCUG 73778 plasmid pSUH-2, complete sequence	73862-73894	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP035517	Escherichia coli strain U14A plasmid pU14A_A, complete sequence	121767-121799	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP035518	Escherichia coli strain U14A plasmid pU14A_B, complete sequence	60292-60324	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP040995	Klebsiella pneumoniae strain FDAARGOS_775 plasmid unnamed3, complete sequence	55976-56008	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_LR130565	Escherichia coli strain MS14387 isolate MS14387 plasmid 2	74816-74848	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	CP022460	Shigella sonnei strain 2015C-3807 plasmid unnamed1, complete sequence	55265-55297	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP025857	Escherichia coli strain 504838 plasmid p504838_108, complete sequence	14184-14216	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP035478	Escherichia coli strain U13A plasmid pU13A_A, complete sequence	16496-16528	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP034401	Escherichia coli strain CRE10 plasmid pCRE10.1, complete sequence	115311-115343	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP014493	Escherichia coli strain MVAST0167 plasmid pMVAST0167_1, complete sequence	10792-10824	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_KT754164	Shigella dysenteriae 1 strain 3099-85 plasmid p3099-85, complete sequence	42582-42614	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP011135	Escherichia coli VR50 plasmid pVR50A, complete sequence	762-794	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP011136	Escherichia coli VR50 plasmid pVR50B, complete sequence	89028-89060	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP048338	Escherichia coli strain 142 plasmid p142_A-OXA181, complete sequence	88638-88670	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_LS992188	Escherichia coli isolate Escherichia coli str. 3426 plasmid 4, complete sequence	5775-5807	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_LS992188	Escherichia coli isolate Escherichia coli str. 3426 plasmid 4, complete sequence	86655-86687	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP053732	Escherichia coli strain CP55_Sichuan plasmid pCP55-IncFIB, complete sequence	95968-96000	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP021289	Escherichia coli strain PA45B plasmid pPA45B, complete sequence	62556-62588	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP029734	Citrobacter sp. CRE-46 strain AR_0157 plasmid unnamed6, complete sequence	54766-54798	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_LN824138	Klebsiella pneumoniae genome assembly MS6671.v1, plasmid : _Plasmid_E_Kpneumoniae_MS6671	33106-33138	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	MT077882	Escherichia coli plasmid p4, complete sequence	35228-35260	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	MT077887	Escherichia coli plasmid p62, complete sequence	22028-22060	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_LS992181	Escherichia coli isolate Escherichia coli str. TO124 plasmid 2, complete sequence	89022-89054	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_LR213457	Shigella flexneri strain AUSMDU00008332 isolate AUSMDU00008332 plasmid 3	32333-32365	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP044156	Shigella flexneri strain AR-0424 plasmid pAR-0424-1, complete sequence	49081-49113	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_LR130556	Escherichia coli strain MS14385 isolate MS14385 plasmid 2	67656-67688	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP026724	Escherichia coli strain 266917_2 plasmid p266917_2_01, complete sequence	53454-53486	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP020517	Escherichia coli strain 222 plasmid unnamed3, complete sequence	69857-69889	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP030770	Escherichia coli strain 2017C-4173W12 plasmid p2017C-4173W12, complete sequence	31163-31195	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP031548	Escherichia coli strain cq9 plasmid unnamed2, complete sequence	91028-91060	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP045279	Escherichia coli strain LAU-OXA plasmid pLAU-OXA2, complete sequence	26277-26309	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP027375	Escherichia coli strain 05-3629 plasmid unnamed2, complete sequence	108059-108091	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP023350	Escherichia coli strain ETEC-2264 plasmid unnamed1, complete sequence	84808-84840	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP023351	Escherichia coli strain ETEC-2264 plasmid unnamed2, complete sequence	11408-11440	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP027385	Escherichia coli strain 2013C-3250 plasmid unnamed5, complete sequence	86194-86226	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP012632	Escherichia coli strain SF-173 plasmid pSF-173-1, complete sequence	83192-83224	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP015160	Escherichia coli strain Eco889 plasmid pECO-fce, complete sequence	85816-85848	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP015160	Escherichia coli strain Eco889 plasmid pECO-fce, complete sequence	153190-153222	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	CP045525	Shigella sonnei strain 6904.27 plasmid p6904-27	80629-80661	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP029580	Escherichia coli strain DA33137 plasmid pDA33137-178, complete sequence	120241-120273	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP014498	Escherichia coli strain ZH193 plasmid pZH193, complete sequence	11747-11779	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP053248	Escherichia coli strain SCU-482 plasmid pSCU-482-1, complete sequence	86466-86498	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP013834	Escherichia coli strain JJ2434 plasmid pJJ2434_2, complete sequence	50411-50443	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP028193	Escherichia coli strain CFSAN018748 plasmid pGMI14-004_2, complete sequence	7236-7268	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP011019	Escherichia coli strain CI5 plasmid unnamed, complete sequence	103566-103598	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	CP053755	Shigella sonnei strain 506 plasmid pMHMC-004, complete sequence	455-487	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP015131	Klebsiella pneumoniae strain Kpn555 plasmid pKPN-7c3, complete sequence	137912-137944	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP010123	Escherichia coli strain C5 plasmid A, complete genome	35267-35299	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP034932	Shigella flexneri strain 2013C-3749 plasmid p2013C-3749-1, complete sequence	35370-35402	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP010181	Escherichia coli strain M1 plasmid A, complete sequence	141436-141468	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP008715	Escherichia coli strain ST648 plasmid pEC648_1, complete sequence	108690-108722	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP024836	Klebsiella pneumoniae strain CRKP-2297 plasmid pCRKP-2297_2, complete sequence	82927-82959	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP021210	Escherichia coli strain strain Z247 plasmid p2474-NDM1, complete sequence	65724-65756	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP035468	Escherichia coli strain U12A plasmid pU12A_A, complete sequence	16496-16528	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP051701	Escherichia coli strain SCU-125 plasmid pSCU-125-1, complete sequence	61489-61521	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP029104	Escherichia coli strain AR437 plasmid unnamed2, complete sequence	48036-48068	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP033159	Escherichia coli strain CM IVRI KOL-1 plasmid p1ESCUMpO83_CORR	78428-78460	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP051689	Escherichia coli strain SCU-387 plasmid pSCU-387-1, complete sequence	84593-84625	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP051690	Escherichia coli strain SCU-387 plasmid pSCU-387-2, complete sequence	19910-19942	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP051739	Escherichia coli strain SCU-105 plasmid pSCU-105-1, complete sequence	58846-58878	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP051739	Escherichia coli strain SCU-105 plasmid pSCU-105-1, complete sequence	149953-149985	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP051726	Escherichia coli strain SCU-112 plasmid pSCU-112-1, complete sequence	63027-63059	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP051721	Escherichia coli strain SCU-116 plasmid pSCU-116-2, complete sequence	22729-22761	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP021690	Escherichia coli strain AR_0058 plasmid tig00007555j7554, complete sequence	151209-151241	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP009860	Escherichia coli strain ECONIH1 plasmid pECO-824, complete sequence	89074-89106	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP017852	Klebsiella variicola strain GJ2 plasmid pKPGJ-2c, complete sequence	35156-35188	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP024150	Escherichia coli strain 14EC033 plasmid p14EC033c, complete sequence	93065-93097	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_LR025102	Escherichia coli isolate EC-1639 plasmid 2, complete sequence	73904-73936	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP051734	Escherichia coli strain SCU-109 plasmid pSCU-109-1, complete sequence	51837-51869	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP024258	Escherichia coli O25:H16 strain F5505-C1 plasmid unnamed1, complete sequence	15948-15980	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP024840	Klebsiella pneumoniae strain CRKP-1215 plasmid pCRKP-1215_2, complete sequence	7441-7473	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP027536	Escherichia coli strain AR_0081 plasmid unnamed3, complete sequence	60451-60483	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP027537	Escherichia coli strain AR_0081 plasmid unnamed2, complete sequence	77859-77891	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP042879	Escherichia coli strain NMBU_W05E18 plasmid pNMBU-W05E18_01, complete sequence	79039-79071	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP024241	Escherichia coli O114:H49 strain 90-9280 plasmid unnamed1	83080-83112	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP024242	Escherichia coli O114:H49 strain 90-9280 plasmid unnamed2, complete sequence	41591-41623	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP019076	Escherichia coli strain CRE1493 plasmid p1493-5, complete sequence	767-799	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	CP025927	Escherichia coli strain 520873 plasmid p520873_29, complete sequence	18119-18151	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	CP025880	Escherichia coli strain 503458 plasmid p503458_46, complete sequence	27655-27687	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP027458	Escherichia coli strain 88-3493 plasmid unnamed, complete sequence	88618-88650	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP016498	Escherichia coli strain UPEC 26-1 plasmid unnamed1, complete sequence	90096-90128	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP024238	Escherichia coli O15:H11 strain 90-9272 plasmid unnamed	84320-84352	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP024238	Escherichia coli O15:H11 strain 90-9272 plasmid unnamed	180032-180064	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP024430	Klebsiella pneumoniae strain DA48896 plasmid p48896_1, complete sequence	79409-79441	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP024237	Escherichia coli O6:H16 strain 2014EL-1346-6 plasmid unnamed5, complete sequence	95152-95184	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP050367	Klebsiella pneumoniae strain 47733 plasmid p47733_NDM_5, complete sequence	83607-83639	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP018973	Escherichia coli strain Ecol_545 plasmid pEC545_3, complete sequence	36295-36327	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP026158	Klebsiella pneumoniae strain F93-2 plasmid pF93-2_1, complete sequence	56466-56498	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_LS992194	Escherichia coli isolate Escherichia coli str. TO217 plasmid 3, complete sequence	42446-42478	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	CP049174	Shigella sonnei strain 19.0820.1561 plasmid p19-0820-1561, complete sequence	61949-61981	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP023959	Escherichia coli strain FDAARGOS_448 plasmid unnamed1, complete sequence	35487-35519	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP043407	Escherichia coli strain NMBU-W13E19 plasmid pNMBU-W13E19_01, complete sequence	57520-57552	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	CP054450	Escherichia coli strain SCU-488 plasmid pSCU-488-1, complete sequence	147584-147616	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NC_013507	Escherichia coli ETEC H10407 plasmid pEntH10407, complete sequence	51591-51623	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP011418	Escherichia coli strain CFSAN029787 plasmid pCFSAN029787_02, complete sequence	7569-7601	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP048648	Escherichia coli strain GW-AmxH19 plasmid unnamed, complete sequence	68342-68374	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP034396	Escherichia coli strain CRE1 plasmid pCRE1.1, complete sequence	35036-35068	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP035722	Escherichia coli strain U15A plasmid pU15A_B, complete sequence	29655-29687	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP050384	Escherichia coli strain 52148 plasmid p52148_NDM_5, complete sequence	29464-29496	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP024268	Escherichia coli O6:H16 strain F6699 plasmid unnamed2	55099-55131	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NC_013542	Klebsiella pneumoniae plasmid pKF3-70, complete sequence	24984-25016	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP010239	Escherichia coli strain S50 plasmid A, complete sequence	105063-105095	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP021871	Escherichia coli strain H105 plasmid pH105, complete sequence	67180-67212	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	MN823989	Klebsiella pneumoniae strain 283149 plasmid p283149-FII, complete sequence	116671-116703	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	CP049172	Shigella sonnei strain 0401930105 plasmid p0401930105	33219-33251	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP043949	Escherichia coli strain AR202.2 plasmid pMPCMY-2, complete sequence	18881-18913	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	CP049168	Shigella sonnei strain 09163633 plasmid p09163633, complete sequence	20801-20833	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	AP023220	Escherichia coli M505 plasmid pM505-NDM5 DNA, complete genome	69441-69473	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	AP023221	Escherichia coli M505 plasmid pM505-a DNA, complete genome	6371-6403	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP014112	Escherichia coli strain FDAARGOS_144 plasmid unnamed2, complete sequence	31622-31654	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP021938	Escherichia coli strain AR_0055 plasmid unitig_4, complete sequence	37437-37469	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP024291	Escherichia coli O178:H19 strain 2012C-4431 plasmid unnamed2, complete sequence	73192-73224	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	CP049166	Shigella sonnei strain 0401952027 plasmid p0401952027, complete sequence	27010-27042	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP010184	Escherichia coli strain M3 plasmid A, complete sequence	140435-140467	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP023164	Escherichia coli O22:H8 strain RM10809-3 plasmid pRM10809-3, complete sequence	53496-53528	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP029974	Escherichia coli strain 51008369SK1 plasmid p51008369SK1_A, complete sequence	43906-43938	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP050735	Salmonella enterica subsp. enterica serovar Typhimurium strain ST90 plasmid pST90-1, complete sequence	65714-65746	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	LC520280	Escherichia coli H0106 plasmid pH0106 DNA, complete sequence	63179-63211	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	LC520281	Escherichia coli H0130 plasmid pH0130 DNA, complete sequence	99731-99763	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	LC520283	Escherichia coli I0128 plasmid pI0128 DNA, complete sequence	78367-78399	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	LC520284	Escherichia coli HP003 plasmid pHP003 DNA, complete sequence	67896-67928	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	LC520285	Escherichia coli HP030 plasmid pHP030 DNA, complete sequence	77859-77891	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	LC520286	Escherichia coli HP050 plasmid pHP050 DNA, complete sequence	58107-58139	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	LC520287	Escherichia coli HP129 plasmid pHP129 DNA, complete sequence	77850-77882	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	LC520289	Escherichia coli HP243 plasmid pHP243 DNA, complete sequence	41867-41899	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NC_013951	Klebsiella pneumoniae plasmid pKF3-140, complete sequence	76097-76129	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP040454	Escherichia coli strain UPEC132 plasmid unnamed1, complete sequence	51571-51603	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP015836	Escherichia coli strain MS6198 plasmid pMS6198B, complete sequence	122103-122135	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	CP049610	Escherichia coli strain 06-3538 plasmid p06-3538-1	8950-8982	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	CP049615	Escherichia coli O157:H7 strain K1516 plasmid pK1516-3, complete sequence	63268-63300	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	LC520268	Escherichia coli C0044 plasmid pC0044 DNA, complete sequence	27081-27113	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	LC520269	Escherichia coli A0084 plasmid pA0084 DNA, complete sequence	67025-67057	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	LC520270	Escherichia coli A0086 plasmid pA0086 DNA, complete sequence	77823-77855	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	LC520271	Escherichia coli A0140 plasmid pA0140 DNA, complete sequence	59240-59272	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	LC520272	Escherichia coli A0145 plasmid pA0145 DNA, complete sequence	87520-87552	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	LC520273	Escherichia coli A0150 plasmid pA0150 DNA, complete sequence	67036-67068	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	LC520275	Escherichia coli C0122 plasmid pC0122 DNA, complete sequence	48104-48136	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	LC520276	Escherichia coli F0090 plasmid pF0090 DNA, complete sequence	42188-42220	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	LC520277	Escherichia coli G0138 plasmid pG0138 DNA, complete sequence	62917-62949	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	LC520278	Escherichia coli H0005 plasmid pH0005 DNA, complete sequence	51532-51564	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP054355	Escherichia coli strain SCU-172 plasmid pSCU-172-2, complete sequence	56796-56828	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP043229	Escherichia coli strain Ec-050 plasmid pEc-050-CMY-2, complete sequence	7167-7199	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP033881	Escherichia coli strain 50579417 plasmid p50579417_4, complete sequence	44187-44219	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP034214	Escherichia albertii strain NCTC 9362 plasmid pNCTC_9362	20760-20792	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP050770	Salmonella enterica subsp. enterica serovar Indiana strain SI108 plasmid pSI108-1, complete sequence	78396-78428	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP020340	Shigella flexneri 4c strain 0702 plasmid unnamed1, complete sequence	50632-50664	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_AP014804	Escherichia coli O119:H6 strain EC404/03 plasmid pEC404/03-1, complete sequence	69504-69536	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_LR213461	Shigella sonnei strain AUSMDU00008333 isolate AUSMDU00008333 plasmid 4	35944-35976	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP033761	Escherichia coli strain FDAARGOS_536 plasmid unnamed1, complete sequence	5559-5591	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP044149	Escherichia coli O157 strain AR-0427 plasmid pAR-0427-1	32933-32965	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP019910	Escherichia coli strain MDR_56 plasmid unnamed4, complete sequence	45130-45162	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP019009	Escherichia coli strain Ecol_AZ161 plasmid pECAZ161_3, complete sequence	34839-34871	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP014320	Escherichia coli JJ1887 plasmid pJJ1887-5, complete sequence	14257-14289	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_LT985265	Escherichia coli strain 364 plasmid RCS57TR364_p, complete sequence	31543-31575	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_LT985304	Escherichia coli strain ECOR 31 plasmid RCS89_p, complete sequence	51276-51308	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_LT985214	Escherichia coli strain 649 plasmid RCS101_p, complete sequence	41887-41919	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_LT985267	Escherichia coli strain 637 plasmid RCS61_p, complete sequence	29896-29928	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_LT985272	Escherichia coli strain 506 plasmid RCS62_pI, complete sequence	29430-29462	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_LT985309	Escherichia coli strain CIP106223 plasmid RCS93_pI, complete sequence	24890-24922	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_LT985277	Escherichia coli strain 522 plasmid RCS65_p, complete sequence	50516-50548	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP018954	Escherichia coli strain Ecol_316 plasmid pEC316_3, complete sequence	13899-13931	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_MK291500	Escherichia coli strain 15978 plasmid pHN15978-1, complete sequence	35488-35520	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_MK797990	Salmonella enterica subsp. enterica serovar Wien strain ZM3 plasmid pZM3, complete sequence	83107-83139	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_AP018939	Escherichia coli strain JSWP006 plasmid pJSWP006_1, complete sequence	99036-99068	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_MH917279	Klebsiella pneumoniae strain A1706 plasmid pA1706-NDM, complete sequence	82020-82052	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_MH626559	Salmonella enterica subsp. enterica serovar Typhimurium strain ST1007 plasmid pST1007-1C, complete sequence	7925-7957	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_MH626558	Salmonella enterica subsp. enterica serovar Typhimurium strain ST1007 plasmid pST1007-1B, complete sequence	7925-7957	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_MK048477	Escherichia coli strain U-5227 plasmid pUB_DHA-1, complete sequence	33501-33533	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NC_017722	Escherichia coli ETEC H10407 plasmid p666, complete sequence	13371-13403	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_MG904998	Escherichia coli strain 15OD0495 plasmid p15ODTXV, complete sequence	106437-106469	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_MG656414	Escherichia coli strain 15-50 plasmid pEC15-MCR-50, complete sequence	161184-161216	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_MH257753	Salmonella enterica subsp. enterica serovar Typhimurium strain 1007 plasmid pST1007-1A, complete sequence	7925-7957	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_MH648141	Salmonella enterica subsp. enterica serovar Typhimurium strain ST1007 plasmid pST1007-1D, complete sequence	7925-7957	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP023816	Escherichia coli strain IMT16316 plasmid pEcIMT16316, complete sequence	135437-135469	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP023828	Escherichia coli strain 4/4 plasmid p4_4.2, complete sequence	690-722	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	MN694298	Marine virus AFVG_250M557, complete genome	18990-19022	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP015086	Escherichia coli O25b:H4 plasmid unnamed, complete sequence	87674-87706	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_KU987452	Citrobacter freundii strain AC2901 plasmid AC2901, complete sequence	70793-70825	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_KX683283	Escherichia coli strain EcU443 plasmid pECSE_01, complete sequence	95429-95461	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_KY751926	Klebsiella pneumoniae strain HK02-026 plasmid pHK02-026, complete sequence	36975-37007	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_KY288024	Klebsiella pneumoniae strain ST709 plasmid pCC1410-2, complete sequence	39696-39728	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP025626	Escherichia coli strain SCEC020007 plasmid pNDM5_020007, complete sequence	129904-129936	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	MN783745	Escherichia coli plasmid pFII-FIB, complete sequence	103048-103080	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_KU288634	Escherichia coli strain FAM22321 plasmid pFAM22321, complete sequence	69037-69069	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_KU043115	Escherichia coli strain Y5 plasmid pECY55, complete sequence	5028-5060	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_KX839209	Klebsiella pneumoniae strain KP1814 plasmid pKP1814-3, complete sequence	81663-81695	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_KT818627	Klebsiella pneumoniae strain U25 plasmid U25P002, complete sequence	7224-7256	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_KT725788	Klebsiella pneumoniae strain ST147 plasmid pCC1410-1, complete sequence	54403-54435	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_KT725789	Klebsiella pneumoniae strain ST147 plasmid pCC1409-1, complete sequence	54403-54435	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_KR078259	Escherichia coli strain YD472 plasmid pYHCC, complete sequence	69457-69489	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	AP019526	Escherichia coli O25b:H4-ST131 B0018 plasmid pB0018 DNA, complete sequence	23855-23887	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP042629	Escherichia coli strain NCYU-25-82 plasmid pNCYU-25-82-2, complete sequence	138485-138517	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP048368	Escherichia coli strain 163 plasmid pC-F-164_A-OXA140, complete sequence	117131-117163	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP042338	Escherichia coli strain GZ04-0086 plasmid pNDM5-GZ04_B, complete sequence	57780-57812	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NC_014232	Escherichia coli ETEC 1392/75 plasmid p1081, complete sequence	25848-25880	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP028484	Escherichia coli strain E41-1 plasmid p1, complete sequence	121097-121129	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP025852	Escherichia coli strain 510016 plasmid p510016_29, complete sequence	10793-10825	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP035479	Escherichia coli strain U13A plasmid pU13A_B, complete sequence	65520-65552	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_KX646543	Shigella boydii strain 2246 plasmid p2246-CTXM, complete sequence	101326-101358	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NC_020278	Escherichia coli strain 3A11 plasmid pHN3A11, complete sequence	66647-66679	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP018113	Escherichia coli strain MRSN346595 plasmid pMRSN346595_62.2, complete sequence	51079-51111	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP042601	Escherichia coli strain NCYU-29-69 plasmid pNCYU-29-69-2, complete sequence	67298-67330	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	KY130431	Klebsiella pneumoniae plasmid pABC143C-NDM, complete sequence	76569-76601	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP010174	Escherichia coli strain H8 plasmid B, complete sequence	92182-92214	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP053734	Escherichia coli strain CP55_Sichuan plasmid pCP55-IncFII, complete sequence	60032-60064	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_MK878892	Escherichia coli strain J53 plasmid pMG333, complete sequence	36040-36072	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP034964	Escherichia coli strain WCHEC020032 plasmid pCTXM3_020032, complete sequence	76966-76998	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP053737	Escherichia coli strain CP8-3_Sichuan plasmid pCP8-3-IncFII, complete sequence	76360-76392	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	MT077885	Escherichia coli plasmid p37, complete sequence	64264-64296	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	MT077889	Escherichia coli plasmid p77, complete sequence	59531-59563	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	MN007141	Escherichia coli strain 91 plasmid p91_NDM5, complete sequence	112082-112114	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_LS992182	Escherichia coli isolate Escherichia coli str. TO124 plasmid 3, complete sequence	118808-118840	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP051433	Escherichia sp. SCLE84 plasmid pSCLE3, complete sequence	85703-85735	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP024475	Shigella flexneri 7b strain 94-3007 plasmid unnamed2, complete sequence	68884-68916	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_LR130558	Escherichia coli strain MS14385 isolate MS14385 plasmid 4	42087-42119	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP048296	Escherichia coli strain CVM N18EC0432 plasmid pN18EC0432-2, complete sequence	61194-61226	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	CP046678	Escherichia coli strain 152661 plasmid p152661_p2, complete sequence	42233-42265	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP033629	Klebsiella pneumoniae strain 4743 plasmid unnamed4, complete sequence	57111-57143	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP049078	Escherichia coli strain p11A plasmid p11A_p1, complete sequence	18965-18997	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP024284	Escherichia albertii strain 2014C-4356 plasmid unnamed2, complete sequence	6409-6441	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP019244	Escherichia coli strain Combat2C1 plasmid pCombat2C1-1, complete sequence	62267-62299	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP036244	Escherichia coli strain S65EC plasmid pS65EC, complete sequence	81455-81487	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP012139	Shigella flexneri 2a strain 981 plasmid 981p2, complete sequence	75699-75731	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NC_018998	Escherichia coli F18+ plasmid pTC1, complete sequence	79457-79489	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP021180	Escherichia coli strain 81009 plasmid pEC-81009, complete sequence	108444-108476	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP041957	Escherichia coli strain EC2 plasmid pEC2_2, complete sequence	73460-73492	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP041948	Klebsiella pneumoniae strain KP2 plasmid pKP2_2, complete sequence	65119-65151	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP047381	Escherichia coli strain CAU16175 plasmid pCAU16175_3, complete sequence	66585-66617	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NC_008460	Escherichia coli plasmid pO86A1, complete sequence	90935-90967	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP040922	Escherichia coli strain FC853_EC plasmid p853EC3, complete sequence	26711-26743	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP030329	Escherichia coli strain AR_452 plasmid unnamed1, complete sequence	108587-108619	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP015503	Klebsiella pneumoniae strain SKGH01 plasmid unnamed 3, complete sequence	32689-32721	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP029577	Escherichia coli strain DA33135 plasmid pDA33135-139, complete sequence	15345-15377	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP029578	Escherichia coli strain DA33135 plasmid pDA33135-70, complete sequence	15332-15364	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP024652	Escherichia coli strain BH100 substr. MG2014 plasmid pBH100-1, complete sequence	81313-81345	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP016389	Salmonella enterica subsp. enterica serovar Typhimurium strain 13-931 plasmid pESBL931, complete sequence	4-36	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP024888	Escherichia coli strain AR_0019 plasmid tig00000138_pilon, complete sequence	21773-21805	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP037912	Escherichia coli strain YSP8-1 plasmid pYSP8-1-CTX-M-14, complete sequence	106210-106242	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP010882	Escherichia coli strain MNCRE44 plasmid pMNCRE44_6, complete sequence	57472-57504	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_LT985217	Escherichia coli strain 715 plasmid RCS103_p, complete sequence	33191-33223	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	KU318420	Klebsiella pneumoniae strain KP04 plasmid pKP04CTXM, complete sequence	59545-59577	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	AP014876	Escherichia coli plasmid pV021-b DNA, complete sequence, strain: V021	60503-60535	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP046261	Escherichia coli strain ECO2947 plasmid p2947-NDM5, complete sequence	55297-55329	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP039513	Salmonella enterica subsp. enterica serovar Worthington strain 7102.58 plasmid p7102_58-6, complete sequence	70859-70891	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP040265	Escherichia coli strain 631 plasmid pEc631_2, complete sequence	64396-64428	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP021684	Escherichia coli strain AR_0162 plasmid tig00008015, complete sequence	83742-83774	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP027311	Escherichia coli strain 2014C-4135 plasmid unnamed, complete sequence	32103-32135	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP031804	Klebsiella pneumoniae strain MSB1_8A-sc-2280397 plasmid unnamed4, complete sequence	58875-58907	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP032202	Escherichia coli strain AR_0086 plasmid unnamed1, complete sequence	4316-4348	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP009233	Escherichia coli strain CA08 plasmid pCA08, complete sequence	48174-48206	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP021203	Escherichia coli strain Z1002 plasmid p1002-1, complete sequence	165220-165252	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP031852	Klebsiella pneumoniae strain 121 plasmid pKP121-3, complete sequence	56010-56042	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP035470	Escherichia coli strain U12A plasmid pU12A_C, complete sequence	65520-65552	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_AP019677	Escherichia coli strain GSH8M-2 plasmid pGSH8M-2-2, complete sequence	66167-66199	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP051696	Escherichia coli strain SCU-313 plasmid pSCU-313-2, complete sequence	56100-56132	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	CP052528	Klebsiella pneumoniae strain B16KP0177 plasmid pB16KP0177-4, complete sequence	60488-60520	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_AP018811	Escherichia coli strain E2865 plasmid pE2865-3, complete sequence	65991-66023	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_AP018785	Escherichia coli strain SK1144 plasmid pSK1144	639-671	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_AP018785	Escherichia coli strain SK1144 plasmid pSK1144	69432-69464	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NC_019071	Escherichia coli plasmid pHK09, complete sequence	60327-60359	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NC_019072	Escherichia coli plasmid pHK08, complete sequence	59941-59973	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NC_019095	Escherichia coli plasmid pXZ, complete sequence	66393-66425	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP024975	Escherichia coli strain CV839-15 plasmid pCV839-15-p1, complete sequence	53894-53926	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	KU932024	Escherichia coli plasmid pEC13, complete sequence	61530-61562	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP024157	Escherichia coli strain 14EC047 plasmid p14EC047b, complete sequence	24189-24221	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP024158	Escherichia coli strain 14EC047 plasmid p14EC047c, complete sequence	75326-75358	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP017287	Klebsiella variicola strain GJ3 plasmid pKPGJ-3c, complete sequence	66041-66073	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NC_025177	Escherichia coli plasmid pH1519-76, complete sequence	33150-33182	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP019444	Salmonella enterica subsp. enterica serovar Typhimurium strain 81741 plasmid unnamed2, complete sequence	70515-70547	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP023733	Escherichia coli strain FORC 064 plasmid pFORC64.2, complete sequence	60270-60302	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP026403	Escherichia coli strain ECONIH4 plasmid pECO-816c, complete sequence	67096-67128	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP029113	Escherichia coli strain AR435 plasmid unnamed1, complete sequence	42270-42302	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP018982	Escherichia coli strain Ecol_867 plasmid pEC867_1, complete sequence	51035-51067	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP018952	Escherichia coli strain Ecol_276 plasmid pEC276_1, complete sequence	105317-105349	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP015388	Klebsiella pneumoniae strain NY9 plasmid pNY9_3, complete sequence	79668-79700	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_KJ201887	Shigella flexneri 4c strain 072 plasmid pSF07201, complete sequence	56963-56995	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_KX008967	Shigella sonnei strain 183660 plasmid p183660, complete sequence	1-31	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	LC163971	Escherichia coli O145:NM str. 12E70 plasmid pSTEC-O145-12E70-1 DNA, complete sequence, strain: 12E70	60335-60367	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP013657	Escherichia coli strain uk_P46212 plasmid unnamed, complete sequence	105529-105561	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP037947	Escherichia coli strain CFSAN027346 plasmid pCFSAN027346-2, complete sequence	61852-61884	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP023895	Escherichia coli strain FDAARGOS_433 plasmid unnamed2, complete sequence	19778-19810	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	CP025891	Escherichia coli strain 503046 plasmid p503046_32, complete sequence	12837-12869	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP032165	Klebsiella pneumoniae strain XJ-K1 plasmid unnamed2, complete sequence	31524-31556	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	CP042972	Escherichia coli strain CFSAN061769 plasmid pCFSAN061769_03, complete sequence	57704-57736	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	CP054381	Escherichia coli strain SCU-175 plasmid pSCU-175-2, complete sequence	60871-60903	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NC_019424	Escherichia coli plasmid pFOS-HK151325, complete sequence	59807-59839	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP015140	Escherichia coli strain Ecol_732 plasmid pEC732_2, complete sequence	107209-107241	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP050372	Klebsiella pneumoniae strain 50595 plasmid p50595_ERM, complete sequence	21039-21071	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NC_019057	Escherichia coli plasmid pHK01, complete sequence	60328-60360	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP041363	Citrobacter amalonaticus strain 133355-SW-C4-Cam plasmid p133355_SW_C4_Cam-1, complete sequence	70968-71000	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP041358	Escherichia coli strain U1 plasmid unnamed1, complete sequence	79093-79125	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_LS992169	Escherichia coli isolate Escherichia coli str. TO60 plasmid 2, complete sequence	73239-73271	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP023918	Klebsiella pneumoniae strain FDAARGOS_439 plasmid unnamed	45340-45372	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP042887	Escherichia coli O10:H32 strain NMBU-W12E19 plasmid pNMBU-W12E19_03, complete sequence	57890-57922	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP043408	Escherichia coli strain NMBU-W13E19 plasmid pNMBU-W13E19_02, complete sequence	56315-56347	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NC_002134	Shigella flexneri 2b plasmid R100 DNA, complete sequence	78092-78124	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	CP045934	Shigella sonnei strain AUSMDU00010534 plasmid pAUSMDU00010534_02, complete sequence	70133-70165	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP032205	Escherichia coli strain AR_0013 plasmid unnamed, complete sequence	66337-66369	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	CP049186	Shigella sonnei strain 19.0821.3486 plasmid p19-0821-3486, complete sequence	78298-78330	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_LS992191	Escherichia coli isolate Escherichia coli str. TO148 plasmid 2, complete sequence	118808-118840	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NC_016039	Escherichia coli plasmid pHK17a, complete sequence	60189-60221	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP023361	Escherichia coli strain 1943 plasmid p80, complete sequence	9159-9191	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP032836	Klebsiella pneumoniae strain INF237 plasmid pINF237_03, complete sequence	65434-65466	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	MN823993	Klebsiella pneumoniae strain 20130907-4 plasmid p309074-2FII, complete sequence	58639-58671	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	MN822124	Escherichia coli strain 14E509 plasmid p14E509-1FII, complete sequence	55352-55384	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_HG941719	Escherichia coli O25b:H4-ST131 strain EC958 plasmid pEC958, complete sequence	58362-58394	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NC_009133	Escherichia coli plasmid NR1, complete sequence	78091-78123	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP032258	Escherichia coli strain AR_0067 plasmid unnamed1, complete sequence	121741-121773	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP032262	Escherichia coli strain AR_0067 plasmid unnamed4, complete sequence	34528-34560	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP021711	Klebsiella pneumoniae strain AR_0143 plasmid tig00000856, complete sequence	17457-17489	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	MF353155	Escherichia coli plasmid pLZ135-CTX, complete sequence	122536-122568	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	CP049170	Shigella sonnei strain 19.1125.3493 plasmid p19-1125-3493, complete sequence	29250-29282	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	AP019705	Escherichia coli O145:H28 10942 plasmid pO145_10942_2 DNA, complete genome	61341-61373	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP025139	Escherichia coli strain BH100L substr. MG2017 plasmid pBH100alpha, complete sequence	87016-87048	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_LR740760	Escherichia coli strain BEN5202 isolate laying hen 51 weeks old plasmid pbAPEC5202	11593-11625	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_LR740760	Escherichia coli strain BEN5202 isolate laying hen 51 weeks old plasmid pbAPEC5202	85740-85772	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	AP023231	Escherichia coli YJ4 plasmid pYJ4-NDM5 DNA, complete genome	32432-32464	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	AP023232	Escherichia coli YJ4 plasmid pYJ4-a DNA, complete genome	33486-33518	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	AP023236	Escherichia coli YJ6 plasmid pYJ6-NDM5 DNA, complete genome	84407-84439	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NC_013727	Shigella sonnei plasmid pEG356 complete sequence	60341-60373	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NC_019090	Escherichia coli plasmid pHK23a, complete sequence	63646-63678	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	LT174531	Shigella sonnei plasmid pEG430-2, strain EG0430	57778-57810	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP033634	Escherichia coli isolate ECCNB12-2 plasmid pTB-nb3, complete sequence	955-987	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP023145	Escherichia coli strain CFSAN061770 plasmid pEGY3, complete sequence	84897-84929	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP020117	Escherichia coli strain AR_0104 plasmid unitig_5, complete sequence	24428-24460	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	AP018354	Escherichia coli plasmid pVE155 DNA, complete genome, strain: E155	78304-78336	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	AP022354	Escherichia coli E033 plasmid pE033_IMP6 DNA, complete sequence	1843-1875	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	AP022355	Escherichia coli E034 plasmid pE034_IMP6 DNA, complete sequence	38261-38293	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	AP022359	Escherichia coli E294 plasmid pE294_IMP6 DNA, complete sequence	69392-69424	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP028322	Escherichia coli O18:H1 strain CFSAN067215 plasmid p0.1229_2, complete sequence	13297-13329	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	LC520279	Escherichia coli H0063 plasmid pH0063 DNA, complete sequence	71142-71174	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_AP018799	Escherichia coli strain E2855 plasmid pE2855-3, complete sequence	81085-81117	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP034056	Klebsiella pneumoniae strain KP_NORM_BLD_2015_112126 plasmid unnamed3, complete sequence	78230-78262	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	LC520274	Escherichia coli C0079 plasmid pC0079 DNA, complete sequence	47899-47931	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP054356	Escherichia coli strain SCU-172 plasmid pSCU-172-3, complete sequence	64770-64802	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP018107	Escherichia coli strain MRSN352231 plasmid pMR0716_IncFII, complete sequence	51079-51111	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_AP018833	Escherichia coli strain M309 plasmid pM309-NDM5, complete sequence	123186-123218	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NC_011812	Escherichia coli plasmid pO26-L, complete sequence	57523-57555	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP043945	Escherichia coli strain AR216.2b plasmid pMPCMY-2, complete sequence	56439-56471	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP034048	Klebsiella pneumoniae strain KP_NORM_BLD_2014_104014 plasmid unnamed3, complete sequence	66279-66311	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	CP027581	Escherichia coli strain 2013C-4282 plasmid unnamed2, complete sequence	112230-112262	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	CP027674	Escherichia coli strain 2014C-3003 plasmid unnamed2, complete sequence	103963-103995	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP025253	Escherichia coli strain BH100 substr. MG2017 plasmid pBH100-1, complete sequence	81320-81352	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_AP018136	Escherichia coli strain M105 isolate M105 plasmid pM105_FII, complete sequence	73368-73400	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_AP018138	Escherichia coli strain M107 isolate M107 plasmid pM107_FII, complete sequence	76813-76845	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_AP018144	Escherichia coli strain M214 isolate M214 plasmid pM214_FII, complete sequence	83887-83919	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	CP052261	Klebsiella pneumoniae strain E16KP0290 plasmid pE16KP0290-3, complete sequence	57579-57611	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP021737	Escherichia coli strain AR_0150 plasmid tig00000255, complete sequence	5217-5249	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	MK295824	Escherichia coli O25b:H4-ST131 strain 26 plasmid p26, complete sequence	34499-34531	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	MK295825	Escherichia coli O25b:H4-ST131 strain U1 plasmid pU1, complete sequence	54505-54537	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	MK295827	Escherichia coli O25b:H4-ST131 strain U17 plasmid pU17, complete sequence	23970-24002	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	MK295828	Escherichia coli O25b:H4-ST131 strain U23 plasmid pU23, complete sequence	36444-36476	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	MK295829	Escherichia coli O25b:H4-ST131 strain 13.1 plasmid p131, complete sequence	45892-45924	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	MK295830	Escherichia coli O25b:H4-ST131 strain 425 plasmid p425, complete sequence	36211-36243	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	MK295832	Escherichia coli O25b:H4-ST131 strain B14 plasmid pB14, complete sequence	34586-34618	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	MK295834	Escherichia coli O25b:H4-ST131 strain 56 plasmid p56, complete sequence	48309-48341	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP026931	Escherichia coli strain CFS3246 plasmid pCFS3246-2, complete sequence	51167-51199	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	JX127248	Uncultured bacterium plasmid pRSB225, complete sequence	52690-52722	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP025254	Escherichia coli strain BH100L substr. MG2014 plasmid pBH100alpha, complete sequence	81310-81342	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_LT985219	Escherichia coli strain 497 plasmid RCS21_p, complete sequence	55098-55130	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_LT985226	Escherichia coli strain 525 plasmid RCS27_p, complete sequence	55068-55100	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_LT985274	Escherichia coli strain 723 plasmid RCS66_p, complete sequence	29666-29698	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	MK295819	Escherichia coli O25b:H4-ST131 strain U10 plasmid pU10, complete sequence	35035-35067	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	MK295820	Escherichia coli O25b:H4-ST131 strain B28 plasmid pB28, complete sequence	51082-51114	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP047637	Klebsiella pneumoniae strain K2606 plasmid unnamed4, complete sequence	60483-60515	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_MK878893	Escherichia coli strain J53 plasmid pMG335, complete sequence	36040-36072	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_MN101852	Escherichia coli strain 13ZX28-TC-98 plasmid p13ZX28-TC-98, complete sequence	88026-88058	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_MN101854	Escherichia coli strain 13ZX36 plasmid p13ZX36-70, complete sequence	49641-49673	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_MN101850	Escherichia coli strain 13ZX28 plasmid p13ZX28-272, complete sequence	184829-184861	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_MN328348	Salmonella enterica subsp. enterica serovar Enteritidis strain S14 plasmid pTS14, complete sequence	108782-108814	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NC_005327	Escherichia coli plasmid pC15-1a, complete sequence	77637-77669	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP041393	Escherichia coli strain ECOL-18-VL-LA-PA-Ryan-0026 plasmid p45407_1, complete sequence	31427-31459	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP045943	Shigella flexneri 2a strain AUSMDU00010535 plasmid pAUSMDU00010535_02, complete sequence	72721-72753	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_MH316135	Salmonella enterica subsp. enterica serovar Indiana strain GDD25-16 plasmid pGDD25-16, complete sequence	118651-118683	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_MH316136	Salmonella enterica subsp. enterica serovar Indiana strain GDD25-21 plasmid pGDD25-21, complete sequence	119990-120022	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_MH909349	Klebsiella pneumoniae strain A1705 plasmid pA1705-NDM, complete sequence	61447-61479	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_MH909349	Klebsiella pneumoniae strain A1705 plasmid pA1705-NDM, complete sequence	131115-131147	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_MH316133	Salmonella enterica subsp. enterica serovar Indiana strain GDD25-3 plasmid pGDD25-3, complete sequence	116930-116962	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_MH316134	Salmonella enterica subsp. enterica serovar Indiana strain GDD25-5 plasmid pGDD25-5, complete sequence	90131-90163	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_MH257956	Escherichia coli strain 104 plasmid pHXH-4, complete sequence	66531-66563	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_MN197360	Escherichia coli strain 5P plasmid pVSI_NDM_5, complete sequence	129245-129277	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_MN218686	Escherichia coli strain 5M plasmid pISV_IncFII_NDM-5, complete sequence	107569-107601	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_MN537908	Escherichia coli strain E.coli4feg plasmid pIV_IncFII_DHA, complete sequence	67291-67323	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_MG886288	Escherichia coli strain MO plasmid pMO, complete sequence	119780-119812	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_MF156713	Escherichia coli strain 06028078 plasmid p28078-NDM, complete sequence	54340-54372	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_MG825370	Escherichia coli strain 974 plasmid p974-NDM, complete sequence	63396-63428	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_MF156697	Escherichia coli strain BTR plasmid pBTR-CTXM, complete sequence	136306-136338	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_MG764548	Escherichia coli strain 11011 plasmid p11011-fosA, complete sequence	89867-89899	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_MG677985	Escherichia coli strain LN310P plasmid pEC12, complete sequence	60573-60605	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP029422	Escherichia coli strain 3385 plasmid unnamed2, complete sequence	74076-74108	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP032226	Klebsiella pneumoniae strain AR_0046 plasmid unnamed4, complete sequence	33883-33915	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_KY706108	Escherichia coli strain pAA-ST131 plasmid ESBL20150001, complete sequence	127274-127306	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_LC506716	Klebsiella pneumoniae strain JUNP053 plasmid pJUNP53, complete sequence	78447-78479	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_KY865320	Escherichia coli strain SH21G plasmid pEC295cfr, complete sequence	58043-58075	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_LC506719	Klebsiella pneumoniae strain JUNP254 plasmid pJUNP254, complete sequence	77465-77497	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_LC506717	Klebsiella pneumoniae strain JUNP054 plasmid pJUNP054, complete sequence	88836-88868	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_LC506718	Klebsiella pneumoniae strain JUNP055 plasmid pJUNP055, complete sequence	88836-88868	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_LC506720	Klebsiella pneumoniae strain JUNP268 plasmid pJUNP268, complete sequence	88836-88868	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_MG288681	Klebsiella aerogenes strain E20 plasmid pE20-FIIA, complete sequence	94556-94588	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP048362	Escherichia coli strain 53 plasmid p53_C, complete sequence	58818-58850	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP011064	Escherichia coli str. Sanji plasmid pSJ_94, complete sequence	57870-57902	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP011065	Escherichia coli str. Sanji plasmid pSJ_82, complete sequence	72259-72291	7	0.788
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	MG592444	Vibrio phage 1.067.O._10N.261.52.C9, partial genome	27295-27327	7	0.788
NC_013928_1	1.15\|645162\|33\|NC_013928\|PILER-CR	645162-645194	33	MK972710	Salmonella phage SI22, complete genome	21572-21604	7	0.788
NC_013928_1	1.15\|645162\|33\|NC_013928\|PILER-CR	645162-645194	33	NC_049459	Salmonella phage SW9, complete genome	21585-21617	7	0.788
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP015086	Escherichia coli O25b:H4 plasmid unnamed, complete sequence	87675-87706	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_KU987452	Citrobacter freundii strain AC2901 plasmid AC2901, complete sequence	70794-70825	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_KX928752	Klebsiella pneumoniae strain CRKP-59-KPC plasmid pCRKP-59-KPC, complete sequence	143649-143680	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_KX683283	Escherichia coli strain EcU443 plasmid pECSE_01, complete sequence	95430-95461	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_KY751926	Klebsiella pneumoniae strain HK02-026 plasmid pHK02-026, complete sequence	36976-37007	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_KY288024	Klebsiella pneumoniae strain ST709 plasmid pCC1410-2, complete sequence	39697-39728	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NC_017627	Escherichia coli 042 plasmid pAA, complete sequence	57658-57689	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP025626	Escherichia coli strain SCEC020007 plasmid pNDM5_020007, complete sequence	129905-129936	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	AP018456	Escherichia coli O25b:H4-ST131 plasmid pMRY09-581ECO_1 MRY09-581 DNA, complete sequence	88425-88456	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	AP018457	Escherichia coli O25b:H4-ST131 plasmid pMRY09-592ECO_1 MRY09-592 DNA, complete sequence	30122-30153	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	AP018458	Escherichia coli O25b:H4-ST131 plasmid pMRY09-597ECO_1 MRY09-597 DNA, complete sequence	46677-46708	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	MN783745	Escherichia coli plasmid pFII-FIB, complete sequence	103049-103080	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_LR213453	Shigella flexneri strain AUSMDU00008355 isolate AUSMDU00008355 plasmid 2	35944-35975	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_KT988018	Escherichia coli strain V282 plasmid pEcoV282, complete sequence	36487-36518	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_KU288634	Escherichia coli strain FAM22321 plasmid pFAM22321, complete sequence	69038-69069	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_KU043115	Escherichia coli strain Y5 plasmid pECY55, complete sequence	5029-5060	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_KX839209	Klebsiella pneumoniae strain KP1814 plasmid pKP1814-3, complete sequence	81664-81695	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP015077	Escherichia coli strain Ecol_448 plasmid pEC448_1, complete sequence	108075-108106	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP015070	Escherichia coli strain Ecol_743 plasmid pEC743_1, complete sequence	52220-52251	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP015072	Escherichia coli strain Ecol_743 plasmid pEC743_3, complete sequence	20703-20734	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_KT818627	Klebsiella pneumoniae strain U25 plasmid U25P002, complete sequence	7225-7256	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_KT725788	Klebsiella pneumoniae strain ST147 plasmid pCC1410-1, complete sequence	54404-54435	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_KT725789	Klebsiella pneumoniae strain ST147 plasmid pCC1409-1, complete sequence	54404-54435	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_KT845955	Escherichia coli strain EP28 plasmid pHNEP28_cfr, complete sequence	47226-47257	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_KR078259	Escherichia coli strain YD472 plasmid pYHCC, complete sequence	69458-69489	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	AP019526	Escherichia coli O25b:H4-ST131 B0018 plasmid pB0018 DNA, complete sequence	23856-23887	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP042629	Escherichia coli strain NCYU-25-82 plasmid pNCYU-25-82-2, complete sequence	138486-138517	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP041339	Escherichia coli strain CCUG 73778 plasmid pSUH-2, complete sequence	73862-73893	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP035517	Escherichia coli strain U14A plasmid pU14A_A, complete sequence	121767-121798	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP035518	Escherichia coli strain U14A plasmid pU14A_B, complete sequence	60292-60323	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP048368	Escherichia coli strain 163 plasmid pC-F-164_A-OXA140, complete sequence	117132-117163	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP040995	Klebsiella pneumoniae strain FDAARGOS_775 plasmid unnamed3, complete sequence	55976-56007	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_LR130565	Escherichia coli strain MS14387 isolate MS14387 plasmid 2	74816-74847	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP042338	Escherichia coli strain GZ04-0086 plasmid pNDM5-GZ04_B, complete sequence	57781-57812	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NC_014232	Escherichia coli ETEC 1392/75 plasmid p1081, complete sequence	25849-25880	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	CP022460	Shigella sonnei strain 2015C-3807 plasmid unnamed1, complete sequence	55265-55296	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP028484	Escherichia coli strain E41-1 plasmid p1, complete sequence	121098-121129	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP025857	Escherichia coli strain 504838 plasmid p504838_108, complete sequence	14184-14215	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP025852	Escherichia coli strain 510016 plasmid p510016_29, complete sequence	10794-10825	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP035478	Escherichia coli strain U13A plasmid pU13A_A, complete sequence	16496-16527	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP035479	Escherichia coli strain U13A plasmid pU13A_B, complete sequence	65521-65552	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP034401	Escherichia coli strain CRE10 plasmid pCRE10.1, complete sequence	115311-115342	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP014493	Escherichia coli strain MVAST0167 plasmid pMVAST0167_1, complete sequence	10792-10823	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_KX646543	Shigella boydii strain 2246 plasmid p2246-CTXM, complete sequence	101327-101358	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NC_020278	Escherichia coli strain 3A11 plasmid pHN3A11, complete sequence	66648-66679	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP018113	Escherichia coli strain MRSN346595 plasmid pMRSN346595_62.2, complete sequence	51080-51111	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP042601	Escherichia coli strain NCYU-29-69 plasmid pNCYU-29-69-2, complete sequence	67299-67330	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	KY130431	Klebsiella pneumoniae plasmid pABC143C-NDM, complete sequence	76570-76601	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_KT754164	Shigella dysenteriae 1 strain 3099-85 plasmid p3099-85, complete sequence	42582-42613	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP011135	Escherichia coli VR50 plasmid pVR50A, complete sequence	762-793	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP011136	Escherichia coli VR50 plasmid pVR50B, complete sequence	89028-89059	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP048338	Escherichia coli strain 142 plasmid p142_A-OXA181, complete sequence	88638-88669	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP010174	Escherichia coli strain H8 plasmid B, complete sequence	92183-92214	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_LS992188	Escherichia coli isolate Escherichia coli str. 3426 plasmid 4, complete sequence	5775-5806	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_LS992188	Escherichia coli isolate Escherichia coli str. 3426 plasmid 4, complete sequence	86655-86686	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP053732	Escherichia coli strain CP55_Sichuan plasmid pCP55-IncFIB, complete sequence	95968-95999	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP053734	Escherichia coli strain CP55_Sichuan plasmid pCP55-IncFII, complete sequence	60033-60064	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_MK878892	Escherichia coli strain J53 plasmid pMG333, complete sequence	36041-36072	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP021289	Escherichia coli strain PA45B plasmid pPA45B, complete sequence	62556-62587	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP029734	Citrobacter sp. CRE-46 strain AR_0157 plasmid unnamed6, complete sequence	54766-54797	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP034964	Escherichia coli strain WCHEC020032 plasmid pCTXM3_020032, complete sequence	76967-76998	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP053737	Escherichia coli strain CP8-3_Sichuan plasmid pCP8-3-IncFII, complete sequence	76361-76392	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_LN824138	Klebsiella pneumoniae genome assembly MS6671.v1, plasmid : _Plasmid_E_Kpneumoniae_MS6671	33106-33137	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	MT077882	Escherichia coli plasmid p4, complete sequence	35228-35259	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	MT077885	Escherichia coli plasmid p37, complete sequence	64265-64296	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	MT077887	Escherichia coli plasmid p62, complete sequence	22028-22059	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	MT077889	Escherichia coli plasmid p77, complete sequence	59532-59563	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	MN007141	Escherichia coli strain 91 plasmid p91_NDM5, complete sequence	112083-112114	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_LS992181	Escherichia coli isolate Escherichia coli str. TO124 plasmid 2, complete sequence	89022-89053	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_LS992182	Escherichia coli isolate Escherichia coli str. TO124 plasmid 3, complete sequence	118809-118840	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP051433	Escherichia sp. SCLE84 plasmid pSCLE3, complete sequence	85704-85735	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP024475	Shigella flexneri 7b strain 94-3007 plasmid unnamed2, complete sequence	68885-68916	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_LR213457	Shigella flexneri strain AUSMDU00008332 isolate AUSMDU00008332 plasmid 3	32333-32364	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP044156	Shigella flexneri strain AR-0424 plasmid pAR-0424-1, complete sequence	49081-49112	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_LR130556	Escherichia coli strain MS14385 isolate MS14385 plasmid 2	67656-67687	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_LR130558	Escherichia coli strain MS14385 isolate MS14385 plasmid 4	42088-42119	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP048296	Escherichia coli strain CVM N18EC0432 plasmid pN18EC0432-2, complete sequence	61195-61226	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	CP046678	Escherichia coli strain 152661 plasmid p152661_p2, complete sequence	42234-42265	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP026724	Escherichia coli strain 266917_2 plasmid p266917_2_01, complete sequence	53454-53485	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP020517	Escherichia coli strain 222 plasmid unnamed3, complete sequence	69857-69888	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP033629	Klebsiella pneumoniae strain 4743 plasmid unnamed4, complete sequence	57112-57143	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP049078	Escherichia coli strain p11A plasmid p11A_p1, complete sequence	18966-18997	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP030770	Escherichia coli strain 2017C-4173W12 plasmid p2017C-4173W12, complete sequence	31163-31194	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP024284	Escherichia albertii strain 2014C-4356 plasmid unnamed2, complete sequence	6410-6441	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP019244	Escherichia coli strain Combat2C1 plasmid pCombat2C1-1, complete sequence	62268-62299	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP031548	Escherichia coli strain cq9 plasmid unnamed2, complete sequence	91028-91059	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP036244	Escherichia coli strain S65EC plasmid pS65EC, complete sequence	81456-81487	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP012139	Shigella flexneri 2a strain 981 plasmid 981p2, complete sequence	75700-75731	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NC_018998	Escherichia coli F18+ plasmid pTC1, complete sequence	79458-79489	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP045279	Escherichia coli strain LAU-OXA plasmid pLAU-OXA2, complete sequence	26277-26308	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP027375	Escherichia coli strain 05-3629 plasmid unnamed2, complete sequence	108059-108090	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP021180	Escherichia coli strain 81009 plasmid pEC-81009, complete sequence	108445-108476	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP041957	Escherichia coli strain EC2 plasmid pEC2_2, complete sequence	73461-73492	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP041948	Klebsiella pneumoniae strain KP2 plasmid pKP2_2, complete sequence	65120-65151	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP023350	Escherichia coli strain ETEC-2264 plasmid unnamed1, complete sequence	84808-84839	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP023351	Escherichia coli strain ETEC-2264 plasmid unnamed2, complete sequence	11408-11439	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP027385	Escherichia coli strain 2013C-3250 plasmid unnamed5, complete sequence	86194-86225	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP012632	Escherichia coli strain SF-173 plasmid pSF-173-1, complete sequence	83192-83223	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP015160	Escherichia coli strain Eco889 plasmid pECO-fce, complete sequence	85816-85847	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP015160	Escherichia coli strain Eco889 plasmid pECO-fce, complete sequence	153190-153221	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP047381	Escherichia coli strain CAU16175 plasmid pCAU16175_3, complete sequence	66586-66617	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	CP045525	Shigella sonnei strain 6904.27 plasmid p6904-27	80629-80660	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NC_008460	Escherichia coli plasmid pO86A1, complete sequence	90936-90967	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP040922	Escherichia coli strain FC853_EC plasmid p853EC3, complete sequence	26712-26743	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP029580	Escherichia coli strain DA33137 plasmid pDA33137-178, complete sequence	120241-120272	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP030329	Escherichia coli strain AR_452 plasmid unnamed1, complete sequence	108588-108619	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP014498	Escherichia coli strain ZH193 plasmid pZH193, complete sequence	11747-11778	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP053248	Escherichia coli strain SCU-482 plasmid pSCU-482-1, complete sequence	86466-86497	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP015503	Klebsiella pneumoniae strain SKGH01 plasmid unnamed 3, complete sequence	32690-32721	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP013834	Escherichia coli strain JJ2434 plasmid pJJ2434_2, complete sequence	50411-50442	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP029577	Escherichia coli strain DA33135 plasmid pDA33135-139, complete sequence	15346-15377	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP029578	Escherichia coli strain DA33135 plasmid pDA33135-70, complete sequence	15333-15364	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP024652	Escherichia coli strain BH100 substr. MG2014 plasmid pBH100-1, complete sequence	81314-81345	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP016389	Salmonella enterica subsp. enterica serovar Typhimurium strain 13-931 plasmid pESBL931, complete sequence	5-36	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP024888	Escherichia coli strain AR_0019 plasmid tig00000138_pilon, complete sequence	21774-21805	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP037912	Escherichia coli strain YSP8-1 plasmid pYSP8-1-CTX-M-14, complete sequence	106211-106242	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP028193	Escherichia coli strain CFSAN018748 plasmid pGMI14-004_2, complete sequence	7236-7267	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP010882	Escherichia coli strain MNCRE44 plasmid pMNCRE44_6, complete sequence	57473-57504	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP011019	Escherichia coli strain CI5 plasmid unnamed, complete sequence	103566-103597	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_LT985217	Escherichia coli strain 715 plasmid RCS103_p, complete sequence	33192-33223	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	KU318420	Klebsiella pneumoniae strain KP04 plasmid pKP04CTXM, complete sequence	59546-59577	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	CP053755	Shigella sonnei strain 506 plasmid pMHMC-004, complete sequence	455-486	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	AP014876	Escherichia coli plasmid pV021-b DNA, complete sequence, strain: V021	60504-60535	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP015131	Klebsiella pneumoniae strain Kpn555 plasmid pKPN-7c3, complete sequence	137912-137943	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP010123	Escherichia coli strain C5 plasmid A, complete genome	35267-35298	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP046261	Escherichia coli strain ECO2947 plasmid p2947-NDM5, complete sequence	55298-55329	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP034932	Shigella flexneri strain 2013C-3749 plasmid p2013C-3749-1, complete sequence	35370-35401	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP039513	Salmonella enterica subsp. enterica serovar Worthington strain 7102.58 plasmid p7102_58-6, complete sequence	70860-70891	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP010181	Escherichia coli strain M1 plasmid A, complete sequence	141436-141467	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP008715	Escherichia coli strain ST648 plasmid pEC648_1, complete sequence	108690-108721	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP040265	Escherichia coli strain 631 plasmid pEc631_2, complete sequence	64397-64428	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP021684	Escherichia coli strain AR_0162 plasmid tig00008015, complete sequence	83743-83774	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP024836	Klebsiella pneumoniae strain CRKP-2297 plasmid pCRKP-2297_2, complete sequence	82927-82958	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP027311	Escherichia coli strain 2014C-4135 plasmid unnamed, complete sequence	32104-32135	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP031804	Klebsiella pneumoniae strain MSB1_8A-sc-2280397 plasmid unnamed4, complete sequence	58876-58907	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP032202	Escherichia coli strain AR_0086 plasmid unnamed1, complete sequence	4317-4348	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP009233	Escherichia coli strain CA08 plasmid pCA08, complete sequence	48175-48206	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP021203	Escherichia coli strain Z1002 plasmid p1002-1, complete sequence	165221-165252	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP021210	Escherichia coli strain strain Z247 plasmid p2474-NDM1, complete sequence	65724-65755	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP031852	Klebsiella pneumoniae strain 121 plasmid pKP121-3, complete sequence	56011-56042	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP035468	Escherichia coli strain U12A plasmid pU12A_A, complete sequence	16496-16527	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP035470	Escherichia coli strain U12A plasmid pU12A_C, complete sequence	65521-65552	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP051701	Escherichia coli strain SCU-125 plasmid pSCU-125-1, complete sequence	61489-61520	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_AP019677	Escherichia coli strain GSH8M-2 plasmid pGSH8M-2-2, complete sequence	66168-66199	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP029104	Escherichia coli strain AR437 plasmid unnamed2, complete sequence	48036-48067	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP033159	Escherichia coli strain CM IVRI KOL-1 plasmid p1ESCUMpO83_CORR	78428-78459	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP051696	Escherichia coli strain SCU-313 plasmid pSCU-313-2, complete sequence	56101-56132	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP051689	Escherichia coli strain SCU-387 plasmid pSCU-387-1, complete sequence	84593-84624	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP051690	Escherichia coli strain SCU-387 plasmid pSCU-387-2, complete sequence	19910-19941	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP051739	Escherichia coli strain SCU-105 plasmid pSCU-105-1, complete sequence	58846-58877	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP051739	Escherichia coli strain SCU-105 plasmid pSCU-105-1, complete sequence	149953-149984	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP051726	Escherichia coli strain SCU-112 plasmid pSCU-112-1, complete sequence	63027-63058	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP051721	Escherichia coli strain SCU-116 plasmid pSCU-116-2, complete sequence	22729-22760	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	CP052528	Klebsiella pneumoniae strain B16KP0177 plasmid pB16KP0177-4, complete sequence	60489-60520	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_AP018811	Escherichia coli strain E2865 plasmid pE2865-3, complete sequence	65992-66023	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_AP018785	Escherichia coli strain SK1144 plasmid pSK1144	640-671	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_AP018785	Escherichia coli strain SK1144 plasmid pSK1144	69433-69464	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NC_019071	Escherichia coli plasmid pHK09, complete sequence	60328-60359	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NC_019072	Escherichia coli plasmid pHK08, complete sequence	59942-59973	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NC_019095	Escherichia coli plasmid pXZ, complete sequence	66394-66425	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP021690	Escherichia coli strain AR_0058 plasmid tig00007555j7554, complete sequence	151209-151240	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP024975	Escherichia coli strain CV839-15 plasmid pCV839-15-p1, complete sequence	53895-53926	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	KU932024	Escherichia coli plasmid pEC13, complete sequence	61531-61562	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP024157	Escherichia coli strain 14EC047 plasmid p14EC047b, complete sequence	24190-24221	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP024158	Escherichia coli strain 14EC047 plasmid p14EC047c, complete sequence	75327-75358	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP009860	Escherichia coli strain ECONIH1 plasmid pECO-824, complete sequence	89074-89105	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP017852	Klebsiella variicola strain GJ2 plasmid pKPGJ-2c, complete sequence	35156-35187	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP017287	Klebsiella variicola strain GJ3 plasmid pKPGJ-3c, complete sequence	66042-66073	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NC_025177	Escherichia coli plasmid pH1519-76, complete sequence	33151-33182	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP019444	Salmonella enterica subsp. enterica serovar Typhimurium strain 81741 plasmid unnamed2, complete sequence	70516-70547	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP024150	Escherichia coli strain 14EC033 plasmid p14EC033c, complete sequence	93065-93096	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_LR025102	Escherichia coli isolate EC-1639 plasmid 2, complete sequence	73904-73935	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP051734	Escherichia coli strain SCU-109 plasmid pSCU-109-1, complete sequence	51837-51868	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP023733	Escherichia coli strain FORC 064 plasmid pFORC64.2, complete sequence	60271-60302	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP024258	Escherichia coli O25:H16 strain F5505-C1 plasmid unnamed1, complete sequence	15948-15979	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP024840	Klebsiella pneumoniae strain CRKP-1215 plasmid pCRKP-1215_2, complete sequence	7441-7472	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP026403	Escherichia coli strain ECONIH4 plasmid pECO-816c, complete sequence	67097-67128	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP027536	Escherichia coli strain AR_0081 plasmid unnamed3, complete sequence	60451-60482	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP027537	Escherichia coli strain AR_0081 plasmid unnamed2, complete sequence	77859-77890	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP029113	Escherichia coli strain AR435 plasmid unnamed1, complete sequence	42271-42302	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP018982	Escherichia coli strain Ecol_867 plasmid pEC867_1, complete sequence	51036-51067	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP018952	Escherichia coli strain Ecol_276 plasmid pEC276_1, complete sequence	105318-105349	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP042879	Escherichia coli strain NMBU_W05E18 plasmid pNMBU-W05E18_01, complete sequence	79039-79070	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP024241	Escherichia coli O114:H49 strain 90-9280 plasmid unnamed1	83080-83111	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP024242	Escherichia coli O114:H49 strain 90-9280 plasmid unnamed2, complete sequence	41591-41622	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP019076	Escherichia coli strain CRE1493 plasmid p1493-5, complete sequence	767-798	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP015388	Klebsiella pneumoniae strain NY9 plasmid pNY9_3, complete sequence	79669-79700	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_KJ201887	Shigella flexneri 4c strain 072 plasmid pSF07201, complete sequence	56964-56995	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	LC163971	Escherichia coli O145:NM str. 12E70 plasmid pSTEC-O145-12E70-1 DNA, complete sequence, strain: 12E70	60336-60367	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP013657	Escherichia coli strain uk_P46212 plasmid unnamed, complete sequence	105530-105561	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP037947	Escherichia coli strain CFSAN027346 plasmid pCFSAN027346-2, complete sequence	61853-61884	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP023895	Escherichia coli strain FDAARGOS_433 plasmid unnamed2, complete sequence	19779-19810	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	CP025927	Escherichia coli strain 520873 plasmid p520873_29, complete sequence	18119-18150	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	CP025891	Escherichia coli strain 503046 plasmid p503046_32, complete sequence	12838-12869	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	CP025880	Escherichia coli strain 503458 plasmid p503458_46, complete sequence	27655-27686	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP032165	Klebsiella pneumoniae strain XJ-K1 plasmid unnamed2, complete sequence	31525-31556	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	CP042972	Escherichia coli strain CFSAN061769 plasmid pCFSAN061769_03, complete sequence	57705-57736	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP027458	Escherichia coli strain 88-3493 plasmid unnamed, complete sequence	88618-88649	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP016498	Escherichia coli strain UPEC 26-1 plasmid unnamed1, complete sequence	90096-90127	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP024238	Escherichia coli O15:H11 strain 90-9272 plasmid unnamed	84320-84351	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP024238	Escherichia coli O15:H11 strain 90-9272 plasmid unnamed	180032-180063	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP024430	Klebsiella pneumoniae strain DA48896 plasmid p48896_1, complete sequence	79409-79440	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	CP054381	Escherichia coli strain SCU-175 plasmid pSCU-175-2, complete sequence	60872-60903	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NC_019424	Escherichia coli plasmid pFOS-HK151325, complete sequence	59808-59839	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP024237	Escherichia coli O6:H16 strain 2014EL-1346-6 plasmid unnamed5, complete sequence	95152-95183	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP015140	Escherichia coli strain Ecol_732 plasmid pEC732_2, complete sequence	107210-107241	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP050372	Klebsiella pneumoniae strain 50595 plasmid p50595_ERM, complete sequence	21040-21071	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP050367	Klebsiella pneumoniae strain 47733 plasmid p47733_NDM_5, complete sequence	83607-83638	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NC_019057	Escherichia coli plasmid pHK01, complete sequence	60329-60360	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP041363	Citrobacter amalonaticus strain 133355-SW-C4-Cam plasmid p133355_SW_C4_Cam-1, complete sequence	70969-71000	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP041358	Escherichia coli strain U1 plasmid unnamed1, complete sequence	79094-79125	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP018973	Escherichia coli strain Ecol_545 plasmid pEC545_3, complete sequence	36295-36326	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP026158	Klebsiella pneumoniae strain F93-2 plasmid pF93-2_1, complete sequence	56466-56497	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_LS992194	Escherichia coli isolate Escherichia coli str. TO217 plasmid 3, complete sequence	42446-42477	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_LS992169	Escherichia coli isolate Escherichia coli str. TO60 plasmid 2, complete sequence	73240-73271	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	CP049174	Shigella sonnei strain 19.0820.1561 plasmid p19-0820-1561, complete sequence	61949-61980	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP023918	Klebsiella pneumoniae strain FDAARGOS_439 plasmid unnamed	45341-45372	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP023959	Escherichia coli strain FDAARGOS_448 plasmid unnamed1, complete sequence	35487-35518	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP042887	Escherichia coli O10:H32 strain NMBU-W12E19 plasmid pNMBU-W12E19_03, complete sequence	57891-57922	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP043407	Escherichia coli strain NMBU-W13E19 plasmid pNMBU-W13E19_01, complete sequence	57520-57551	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP043408	Escherichia coli strain NMBU-W13E19 plasmid pNMBU-W13E19_02, complete sequence	56316-56347	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	CP054450	Escherichia coli strain SCU-488 plasmid pSCU-488-1, complete sequence	147584-147615	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NC_013507	Escherichia coli ETEC H10407 plasmid pEntH10407, complete sequence	51591-51622	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NC_002134	Shigella flexneri 2b plasmid R100 DNA, complete sequence	78093-78124	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	CP045934	Shigella sonnei strain AUSMDU00010534 plasmid pAUSMDU00010534_02, complete sequence	70134-70165	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP011418	Escherichia coli strain CFSAN029787 plasmid pCFSAN029787_02, complete sequence	7569-7600	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP027554	Escherichia coli strain 2013C-3513 plasmid unnamed1	65968-65999	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP032205	Escherichia coli strain AR_0013 plasmid unnamed, complete sequence	66338-66369	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP048648	Escherichia coli strain GW-AmxH19 plasmid unnamed, complete sequence	68342-68373	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP034396	Escherichia coli strain CRE1 plasmid pCRE1.1, complete sequence	35036-35067	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP035722	Escherichia coli strain U15A plasmid pU15A_B, complete sequence	29655-29686	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP050384	Escherichia coli strain 52148 plasmid p52148_NDM_5, complete sequence	29464-29495	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP024268	Escherichia coli O6:H16 strain F6699 plasmid unnamed2	55099-55130	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	CP049186	Shigella sonnei strain 19.0821.3486 plasmid p19-0821-3486, complete sequence	78299-78330	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_LS992191	Escherichia coli isolate Escherichia coli str. TO148 plasmid 2, complete sequence	118809-118840	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NC_013542	Klebsiella pneumoniae plasmid pKF3-70, complete sequence	24984-25015	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NC_016039	Escherichia coli plasmid pHK17a, complete sequence	60190-60221	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP023361	Escherichia coli strain 1943 plasmid p80, complete sequence	9160-9191	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP032836	Klebsiella pneumoniae strain INF237 plasmid pINF237_03, complete sequence	65435-65466	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	MN823993	Klebsiella pneumoniae strain 20130907-4 plasmid p309074-2FII, complete sequence	58640-58671	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	MN822124	Escherichia coli strain 14E509 plasmid p14E509-1FII, complete sequence	55353-55384	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_HG941719	Escherichia coli O25b:H4-ST131 strain EC958 plasmid pEC958, complete sequence	58363-58394	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NC_009133	Escherichia coli plasmid NR1, complete sequence	78092-78123	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP010239	Escherichia coli strain S50 plasmid A, complete sequence	105063-105094	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP021871	Escherichia coli strain H105 plasmid pH105, complete sequence	67180-67211	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP032258	Escherichia coli strain AR_0067 plasmid unnamed1, complete sequence	121742-121773	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP032262	Escherichia coli strain AR_0067 plasmid unnamed4, complete sequence	34529-34560	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	MN823989	Klebsiella pneumoniae strain 283149 plasmid p283149-FII, complete sequence	116671-116702	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	CP049172	Shigella sonnei strain 0401930105 plasmid p0401930105	33219-33250	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP021711	Klebsiella pneumoniae strain AR_0143 plasmid tig00000856, complete sequence	17458-17489	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	MF353155	Escherichia coli plasmid pLZ135-CTX, complete sequence	122537-122568	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	CP049170	Shigella sonnei strain 19.1125.3493 plasmid p19-1125-3493, complete sequence	29251-29282	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP043949	Escherichia coli strain AR202.2 plasmid pMPCMY-2, complete sequence	18881-18912	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	AP019705	Escherichia coli O145:H28 10942 plasmid pO145_10942_2 DNA, complete genome	61342-61373	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP025139	Escherichia coli strain BH100L substr. MG2017 plasmid pBH100alpha, complete sequence	87017-87048	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	CP049168	Shigella sonnei strain 09163633 plasmid p09163633, complete sequence	20801-20832	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_LR740760	Escherichia coli strain BEN5202 isolate laying hen 51 weeks old plasmid pbAPEC5202	11594-11625	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_LR740760	Escherichia coli strain BEN5202 isolate laying hen 51 weeks old plasmid pbAPEC5202	85741-85772	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	AP023220	Escherichia coli M505 plasmid pM505-NDM5 DNA, complete genome	69441-69472	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	AP023221	Escherichia coli M505 plasmid pM505-a DNA, complete genome	6371-6402	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	AP023231	Escherichia coli YJ4 plasmid pYJ4-NDM5 DNA, complete genome	32433-32464	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	AP023232	Escherichia coli YJ4 plasmid pYJ4-a DNA, complete genome	33487-33518	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	AP023236	Escherichia coli YJ6 plasmid pYJ6-NDM5 DNA, complete genome	84408-84439	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NC_013727	Shigella sonnei plasmid pEG356 complete sequence	60342-60373	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NC_019090	Escherichia coli plasmid pHK23a, complete sequence	63647-63678	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	LT174531	Shigella sonnei plasmid pEG430-2, strain EG0430	57779-57810	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP014112	Escherichia coli strain FDAARGOS_144 plasmid unnamed2, complete sequence	31622-31653	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP021938	Escherichia coli strain AR_0055 plasmid unitig_4, complete sequence	37437-37468	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP024291	Escherichia coli O178:H19 strain 2012C-4431 plasmid unnamed2, complete sequence	73192-73223	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP033634	Escherichia coli isolate ECCNB12-2 plasmid pTB-nb3, complete sequence	956-987	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	CP049166	Shigella sonnei strain 0401952027 plasmid p0401952027, complete sequence	27010-27041	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP010184	Escherichia coli strain M3 plasmid A, complete sequence	140435-140466	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP023164	Escherichia coli O22:H8 strain RM10809-3 plasmid pRM10809-3, complete sequence	53496-53527	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP023145	Escherichia coli strain CFSAN061770 plasmid pEGY3, complete sequence	84898-84929	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP020117	Escherichia coli strain AR_0104 plasmid unitig_5, complete sequence	24429-24460	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	AP018354	Escherichia coli plasmid pVE155 DNA, complete genome, strain: E155	78305-78336	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	AP022354	Escherichia coli E033 plasmid pE033_IMP6 DNA, complete sequence	1844-1875	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	AP022355	Escherichia coli E034 plasmid pE034_IMP6 DNA, complete sequence	38262-38293	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	AP022359	Escherichia coli E294 plasmid pE294_IMP6 DNA, complete sequence	69393-69424	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP029974	Escherichia coli strain 51008369SK1 plasmid p51008369SK1_A, complete sequence	43906-43937	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP050735	Salmonella enterica subsp. enterica serovar Typhimurium strain ST90 plasmid pST90-1, complete sequence	65714-65745	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP028322	Escherichia coli O18:H1 strain CFSAN067215 plasmid p0.1229_2, complete sequence	13298-13329	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	LC520279	Escherichia coli H0063 plasmid pH0063 DNA, complete sequence	71143-71174	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	LC520280	Escherichia coli H0106 plasmid pH0106 DNA, complete sequence	63179-63210	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	LC520281	Escherichia coli H0130 plasmid pH0130 DNA, complete sequence	99731-99762	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	LC520283	Escherichia coli I0128 plasmid pI0128 DNA, complete sequence	78367-78398	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	LC520284	Escherichia coli HP003 plasmid pHP003 DNA, complete sequence	67896-67927	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	LC520285	Escherichia coli HP030 plasmid pHP030 DNA, complete sequence	77859-77890	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	LC520286	Escherichia coli HP050 plasmid pHP050 DNA, complete sequence	58107-58138	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	LC520287	Escherichia coli HP129 plasmid pHP129 DNA, complete sequence	77850-77881	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	LC520289	Escherichia coli HP243 plasmid pHP243 DNA, complete sequence	41867-41898	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_AP018799	Escherichia coli strain E2855 plasmid pE2855-3, complete sequence	81086-81117	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NC_013951	Klebsiella pneumoniae plasmid pKF3-140, complete sequence	76097-76128	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP040454	Escherichia coli strain UPEC132 plasmid unnamed1, complete sequence	51571-51602	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP015836	Escherichia coli strain MS6198 plasmid pMS6198B, complete sequence	122103-122134	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP034056	Klebsiella pneumoniae strain KP_NORM_BLD_2015_112126 plasmid unnamed3, complete sequence	78231-78262	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	CP049610	Escherichia coli strain 06-3538 plasmid p06-3538-1	8950-8981	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	CP049615	Escherichia coli O157:H7 strain K1516 plasmid pK1516-3, complete sequence	63268-63299	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	LC520268	Escherichia coli C0044 plasmid pC0044 DNA, complete sequence	27081-27112	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	LC520269	Escherichia coli A0084 plasmid pA0084 DNA, complete sequence	67025-67056	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	LC520270	Escherichia coli A0086 plasmid pA0086 DNA, complete sequence	77823-77854	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	LC520271	Escherichia coli A0140 plasmid pA0140 DNA, complete sequence	59240-59271	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	LC520272	Escherichia coli A0145 plasmid pA0145 DNA, complete sequence	87520-87551	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	LC520273	Escherichia coli A0150 plasmid pA0150 DNA, complete sequence	67036-67067	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	LC520274	Escherichia coli C0079 plasmid pC0079 DNA, complete sequence	47900-47931	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	LC520275	Escherichia coli C0122 plasmid pC0122 DNA, complete sequence	48104-48135	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	LC520276	Escherichia coli F0090 plasmid pF0090 DNA, complete sequence	42188-42219	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	LC520277	Escherichia coli G0138 plasmid pG0138 DNA, complete sequence	62917-62948	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	LC520278	Escherichia coli H0005 plasmid pH0005 DNA, complete sequence	51532-51563	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP054355	Escherichia coli strain SCU-172 plasmid pSCU-172-2, complete sequence	56796-56827	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP054356	Escherichia coli strain SCU-172 plasmid pSCU-172-3, complete sequence	64771-64802	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP018107	Escherichia coli strain MRSN352231 plasmid pMR0716_IncFII, complete sequence	51080-51111	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_AP018833	Escherichia coli strain M309 plasmid pM309-NDM5, complete sequence	123187-123218	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP043229	Escherichia coli strain Ec-050 plasmid pEc-050-CMY-2, complete sequence	7167-7198	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NC_011812	Escherichia coli plasmid pO26-L, complete sequence	57524-57555	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP043945	Escherichia coli strain AR216.2b plasmid pMPCMY-2, complete sequence	56440-56471	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP033881	Escherichia coli strain 50579417 plasmid p50579417_4, complete sequence	44187-44218	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP034048	Klebsiella pneumoniae strain KP_NORM_BLD_2014_104014 plasmid unnamed3, complete sequence	66280-66311	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP034214	Escherichia albertii strain NCTC 9362 plasmid pNCTC_9362	20760-20791	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP050770	Salmonella enterica subsp. enterica serovar Indiana strain SI108 plasmid pSI108-1, complete sequence	78396-78427	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP020340	Shigella flexneri 4c strain 0702 plasmid unnamed1, complete sequence	50632-50663	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	CP027581	Escherichia coli strain 2013C-4282 plasmid unnamed2, complete sequence	112231-112262	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	CP027674	Escherichia coli strain 2014C-3003 plasmid unnamed2, complete sequence	103964-103995	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP025253	Escherichia coli strain BH100 substr. MG2017 plasmid pBH100-1, complete sequence	81321-81352	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_AP014804	Escherichia coli O119:H6 strain EC404/03 plasmid pEC404/03-1, complete sequence	69504-69535	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_AP018136	Escherichia coli strain M105 isolate M105 plasmid pM105_FII, complete sequence	73369-73400	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_AP018138	Escherichia coli strain M107 isolate M107 plasmid pM107_FII, complete sequence	76814-76845	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_AP018144	Escherichia coli strain M214 isolate M214 plasmid pM214_FII, complete sequence	83888-83919	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	CP052261	Klebsiella pneumoniae strain E16KP0290 plasmid pE16KP0290-3, complete sequence	57580-57611	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_LR213461	Shigella sonnei strain AUSMDU00008333 isolate AUSMDU00008333 plasmid 4	35944-35975	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP033761	Escherichia coli strain FDAARGOS_536 plasmid unnamed1, complete sequence	5559-5590	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP044149	Escherichia coli O157 strain AR-0427 plasmid pAR-0427-1	32933-32964	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP021737	Escherichia coli strain AR_0150 plasmid tig00000255, complete sequence	5218-5249	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP019910	Escherichia coli strain MDR_56 plasmid unnamed4, complete sequence	45130-45161	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP019009	Escherichia coli strain Ecol_AZ161 plasmid pECAZ161_3, complete sequence	34839-34870	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	MK295824	Escherichia coli O25b:H4-ST131 strain 26 plasmid p26, complete sequence	34500-34531	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	MK295825	Escherichia coli O25b:H4-ST131 strain U1 plasmid pU1, complete sequence	54506-54537	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	MK295827	Escherichia coli O25b:H4-ST131 strain U17 plasmid pU17, complete sequence	23971-24002	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	MK295828	Escherichia coli O25b:H4-ST131 strain U23 plasmid pU23, complete sequence	36445-36476	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	MK295829	Escherichia coli O25b:H4-ST131 strain 13.1 plasmid p131, complete sequence	45893-45924	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	MK295830	Escherichia coli O25b:H4-ST131 strain 425 plasmid p425, complete sequence	36212-36243	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	MK295832	Escherichia coli O25b:H4-ST131 strain B14 plasmid pB14, complete sequence	34587-34618	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	MK295834	Escherichia coli O25b:H4-ST131 strain 56 plasmid p56, complete sequence	48310-48341	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP026931	Escherichia coli strain CFS3246 plasmid pCFS3246-2, complete sequence	51168-51199	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	JX127248	Uncultured bacterium plasmid pRSB225, complete sequence	52691-52722	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP025254	Escherichia coli strain BH100L substr. MG2014 plasmid pBH100alpha, complete sequence	81311-81342	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP014320	Escherichia coli JJ1887 plasmid pJJ1887-5, complete sequence	14257-14288	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_LT985265	Escherichia coli strain 364 plasmid RCS57TR364_p, complete sequence	31543-31574	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_LT985219	Escherichia coli strain 497 plasmid RCS21_p, complete sequence	55099-55130	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_LT985304	Escherichia coli strain ECOR 31 plasmid RCS89_p, complete sequence	51276-51307	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_LT985214	Escherichia coli strain 649 plasmid RCS101_p, complete sequence	41887-41918	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_LT985226	Escherichia coli strain 525 plasmid RCS27_p, complete sequence	55069-55100	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_LT985274	Escherichia coli strain 723 plasmid RCS66_p, complete sequence	29667-29698	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_LT985267	Escherichia coli strain 637 plasmid RCS61_p, complete sequence	29896-29927	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_LT985272	Escherichia coli strain 506 plasmid RCS62_pI, complete sequence	29430-29461	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_LT985309	Escherichia coli strain CIP106223 plasmid RCS93_pI, complete sequence	24890-24921	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_LT985277	Escherichia coli strain 522 plasmid RCS65_p, complete sequence	50516-50547	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP018954	Escherichia coli strain Ecol_316 plasmid pEC316_3, complete sequence	13899-13930	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	MK295819	Escherichia coli O25b:H4-ST131 strain U10 plasmid pU10, complete sequence	35036-35067	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	MK295820	Escherichia coli O25b:H4-ST131 strain B28 plasmid pB28, complete sequence	51083-51114	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP047637	Klebsiella pneumoniae strain K2606 plasmid unnamed4, complete sequence	60484-60515	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_MK291500	Escherichia coli strain 15978 plasmid pHN15978-1, complete sequence	35488-35519	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_MK878893	Escherichia coli strain J53 plasmid pMG335, complete sequence	36041-36072	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_MK878893	Escherichia coli strain J53 plasmid pMG335, complete sequence	36119-36150	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_MN101852	Escherichia coli strain 13ZX28-TC-98 plasmid p13ZX28-TC-98, complete sequence	88027-88058	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_MN101854	Escherichia coli strain 13ZX36 plasmid p13ZX36-70, complete sequence	49642-49673	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_MN101850	Escherichia coli strain 13ZX28 plasmid p13ZX28-272, complete sequence	184830-184861	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_MK797990	Salmonella enterica subsp. enterica serovar Wien strain ZM3 plasmid pZM3, complete sequence	83107-83138	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_MN328348	Salmonella enterica subsp. enterica serovar Enteritidis strain S14 plasmid pTS14, complete sequence	108783-108814	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_AP018939	Escherichia coli strain JSWP006 plasmid pJSWP006_1, complete sequence	99036-99067	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NC_005327	Escherichia coli plasmid pC15-1a, complete sequence	77638-77669	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP041393	Escherichia coli strain ECOL-18-VL-LA-PA-Ryan-0026 plasmid p45407_1, complete sequence	31428-31459	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP045943	Shigella flexneri 2a strain AUSMDU00010535 plasmid pAUSMDU00010535_02, complete sequence	72722-72753	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_MH316135	Salmonella enterica subsp. enterica serovar Indiana strain GDD25-16 plasmid pGDD25-16, complete sequence	118652-118683	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_MH316136	Salmonella enterica subsp. enterica serovar Indiana strain GDD25-21 plasmid pGDD25-21, complete sequence	119991-120022	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_MH917279	Klebsiella pneumoniae strain A1706 plasmid pA1706-NDM, complete sequence	82020-82051	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_MH909349	Klebsiella pneumoniae strain A1705 plasmid pA1705-NDM, complete sequence	61448-61479	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_MH909349	Klebsiella pneumoniae strain A1705 plasmid pA1705-NDM, complete sequence	131116-131147	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_MH316133	Salmonella enterica subsp. enterica serovar Indiana strain GDD25-3 plasmid pGDD25-3, complete sequence	116931-116962	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_MH626559	Salmonella enterica subsp. enterica serovar Typhimurium strain ST1007 plasmid pST1007-1C, complete sequence	7925-7956	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_MH316134	Salmonella enterica subsp. enterica serovar Indiana strain GDD25-5 plasmid pGDD25-5, complete sequence	90132-90163	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_MH626558	Salmonella enterica subsp. enterica serovar Typhimurium strain ST1007 plasmid pST1007-1B, complete sequence	7925-7956	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_MH257956	Escherichia coli strain 104 plasmid pHXH-4, complete sequence	66532-66563	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_MK048477	Escherichia coli strain U-5227 plasmid pUB_DHA-1, complete sequence	33501-33532	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_MN197360	Escherichia coli strain 5P plasmid pVSI_NDM_5, complete sequence	129246-129277	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_MN218686	Escherichia coli strain 5M plasmid pISV_IncFII_NDM-5, complete sequence	107570-107601	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_MN537908	Escherichia coli strain E.coli4feg plasmid pIV_IncFII_DHA, complete sequence	67292-67323	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NC_017722	Escherichia coli ETEC H10407 plasmid p666, complete sequence	13371-13402	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_MG886288	Escherichia coli strain MO plasmid pMO, complete sequence	119781-119812	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_MG904998	Escherichia coli strain 15OD0495 plasmid p15ODTXV, complete sequence	106437-106468	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_MF156713	Escherichia coli strain 06028078 plasmid p28078-NDM, complete sequence	54341-54372	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_MG825370	Escherichia coli strain 974 plasmid p974-NDM, complete sequence	63397-63428	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_MF156697	Escherichia coli strain BTR plasmid pBTR-CTXM, complete sequence	136307-136338	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_MG764548	Escherichia coli strain 11011 plasmid p11011-fosA, complete sequence	89868-89899	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_MG677985	Escherichia coli strain LN310P plasmid pEC12, complete sequence	60574-60605	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_MG656414	Escherichia coli strain 15-50 plasmid pEC15-MCR-50, complete sequence	161184-161215	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_MH257753	Salmonella enterica subsp. enterica serovar Typhimurium strain 1007 plasmid pST1007-1A, complete sequence	7925-7956	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_MH648141	Salmonella enterica subsp. enterica serovar Typhimurium strain ST1007 plasmid pST1007-1D, complete sequence	7925-7956	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP029422	Escherichia coli strain 3385 plasmid unnamed2, complete sequence	74077-74108	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP032226	Klebsiella pneumoniae strain AR_0046 plasmid unnamed4, complete sequence	33884-33915	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_KY706108	Escherichia coli strain pAA-ST131 plasmid ESBL20150001, complete sequence	127275-127306	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_LC506716	Klebsiella pneumoniae strain JUNP053 plasmid pJUNP53, complete sequence	78448-78479	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_KY865320	Escherichia coli strain SH21G plasmid pEC295cfr, complete sequence	58044-58075	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_LC506719	Klebsiella pneumoniae strain JUNP254 plasmid pJUNP254, complete sequence	77466-77497	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_LC506719	Klebsiella pneumoniae strain JUNP254 plasmid pJUNP254, complete sequence	77557-77588	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_LC506717	Klebsiella pneumoniae strain JUNP054 plasmid pJUNP054, complete sequence	88837-88868	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_LC506718	Klebsiella pneumoniae strain JUNP055 plasmid pJUNP055, complete sequence	88837-88868	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_LC506720	Klebsiella pneumoniae strain JUNP268 plasmid pJUNP268, complete sequence	88837-88868	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_MG288681	Klebsiella aerogenes strain E20 plasmid pE20-FIIA, complete sequence	94557-94588	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP023816	Escherichia coli strain IMT16316 plasmid pEcIMT16316, complete sequence	135437-135468	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP048362	Escherichia coli strain 53 plasmid p53_C, complete sequence	58819-58850	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP011064	Escherichia coli str. Sanji plasmid pSJ_94, complete sequence	57871-57902	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP011065	Escherichia coli str. Sanji plasmid pSJ_82, complete sequence	72260-72291	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP023828	Escherichia coli strain 4/4 plasmid p4_4.2, complete sequence	690-721	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	MG592444	Vibrio phage 1.067.O._10N.261.52.C9, partial genome	27295-27326	7	0.781
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP046054	Methylocystis heyeri strain H2 plasmid unnamed2, complete sequence	13466-13497	7	0.781
NC_013928_1	1.29\|644919\|32\|NC_013928\|CRISPRCasFinder,CRT	644919-644950	32	NZ_CP021875	Enterococcus wangshanyuanii strain MN05 plasmid unnamed2	18995-19026	7	0.781
NC_013928_1	1.29\|644919\|32\|NC_013928\|CRISPRCasFinder,CRT	644919-644950	32	NZ_CP021876	Enterococcus wangshanyuanii strain MN05 plasmid unnamed3	17553-17584	7	0.781
NC_013928_1	1.29\|644919\|32\|NC_013928\|CRISPRCasFinder,CRT	644919-644950	32	NZ_CP021876	Enterococcus wangshanyuanii strain MN05 plasmid unnamed3	94334-94365	7	0.781
NC_013928_1	1.29\|644919\|32\|NC_013928\|CRISPRCasFinder,CRT	644919-644950	32	NZ_CP021876	Enterococcus wangshanyuanii strain MN05 plasmid unnamed3	183489-183520	7	0.781
NC_013928_1	1.29\|644919\|32\|NC_013928\|CRISPRCasFinder,CRT	644919-644950	32	NZ_CP021877	Enterococcus wangshanyuanii strain MN05 plasmid unnamed4	6101-6132	7	0.781
NC_013928_1	1.33\|645163\|32\|NC_013928\|CRISPRCasFinder,CRT	645163-645194	32	NC_014825	Ruminococcus albus 7 = DSM 20455 plasmid pRUMAL02, complete sequence	133777-133808	7	0.781
NC_013928_2	2.7\|744423\|30\|NC_013928\|CRISPRCasFinder,CRT	744423-744452	30	KJ094022	Listeria phage LP-030-3, complete genome	19344-19373	7	0.767
NC_013928_2	2.10\|744621\|30\|NC_013928\|CRISPRCasFinder,CRT	744621-744650	30	NZ_LN832560	Paracoccus aminovorans isolate JCM7685 plasmid II, complete sequence	692-721	7	0.767
NC_013928_2	2.11\|744687\|30\|NC_013928\|CRISPRCasFinder,CRT	744687-744716	30	NC_031922	Synechococcus phage S-CAM9 isolate 1109NB16, complete genome	154039-154068	7	0.767
NC_013928_2	2.11\|744687\|30\|NC_013928\|CRISPRCasFinder,CRT	744687-744716	30	KU686204	Synechococcus phage S-CAM9 isolate 0808SB05, complete genome	154021-154050	7	0.767
NC_013928_2	2.11\|744687\|30\|NC_013928\|CRISPRCasFinder,CRT	744687-744716	30	KU686205	Synechococcus phage S-CAM9 isolate 0908SB82, complete genome	153868-153897	7	0.767
NC_013928_2	2.11\|744687\|30\|NC_013928\|CRISPRCasFinder,CRT	744687-744716	30	MH629685	Synechococcus virus S-PRM1, complete genome	74995-75024	7	0.767
NC_013928_2	2.13\|744819\|30\|NC_013928\|CRISPRCasFinder,CRT	744819-744848	30	MH617537	Phage sp. isolate ctcb314, complete genome	10788-10817	7	0.767
NC_013928_2	2.22\|745413\|30\|NC_013928\|CRISPRCasFinder,CRT	745413-745442	30	NC_023610	Erwinia phage PhiEaH1, complete genome	129262-129291	7	0.767
NC_013928_2	2.25\|745611\|30\|NC_013928\|CRISPRCasFinder,CRT	745611-745640	30	MH884508	Bacillus phage vB_BcoS-136, complete genome	43180-43209	7	0.767
NC_013928_2	2.32\|746073\|30\|NC_013928\|CRISPRCasFinder,CRT	746073-746102	30	MT661596	Proteus phage 10, complete genome	118445-118474	7	0.767
NC_013928_2	2.41\|746667\|30\|NC_013928\|CRISPRCasFinder,CRT	746667-746696	30	NZ_CP032054	Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence	303668-303697	7	0.767
NC_013928_2	2.41\|746667\|30\|NC_013928\|CRISPRCasFinder,CRT	746667-746696	30	NZ_CP032054	Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence	747791-747820	7	0.767
NC_013928_2	2.41\|746667\|30\|NC_013928\|CRISPRCasFinder,CRT	746667-746696	30	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	1146061-1146090	7	0.767
NC_013928_2	2.41\|746667\|30\|NC_013928\|CRISPRCasFinder,CRT	746667-746696	30	NZ_CP016560	Streptomyces clavuligerus strain F613-1 plasmid pSCL4, complete sequence	405047-405076	7	0.767
NC_013928_2	2.48\|747130\|30\|NC_013928\|CRISPRCasFinder,CRT,PILER-CR	747130-747159	30	KC595513	Bacillus phage Shanette, complete genome	18357-18386	7	0.767
NC_013928_2	2.48\|747130\|30\|NC_013928\|CRISPRCasFinder,CRT,PILER-CR	747130-747159	30	NC_028982	Bacillus phage JL, complete genome	18178-18207	7	0.767
NC_013928_2	2.52\|747394\|30\|NC_013928\|CRISPRCasFinder,CRT,PILER-CR	747394-747423	30	NZ_CP031070	Bacillus sp. JAS24-2 plasmid pl278, complete sequence	209444-209473	7	0.767
NC_013928_2	2.52\|747394\|30\|NC_013928\|CRISPRCasFinder,CRT,PILER-CR	747394-747423	30	MN693411	Marine virus AFVG_25M210, complete genome	10411-10440	7	0.767
NC_013928_2	2.55\|747592\|30\|NC_013928\|CRISPRCasFinder,CRT,PILER-CR	747592-747621	30	NZ_CP048281	Rhizobium leguminosarum bv. viciae 248 plasmid pRle248e, complete sequence	582484-582513	7	0.767
NC_013928_2	2.55\|747592\|30\|NC_013928\|CRISPRCasFinder,CRT,PILER-CR	747592-747621	30	NZ_CP031652	Pantoea agglomerans strain TH81 plasmid unnamed3, complete sequence	53301-53330	7	0.767
NC_013928_2	2.57\|747724\|30\|NC_013928\|CRISPRCasFinder,CRT,PILER-CR	747724-747753	30	NZ_CP048281	Rhizobium leguminosarum bv. viciae 248 plasmid pRle248e, complete sequence	582484-582513	7	0.767
NC_013928_2	2.57\|747724\|30\|NC_013928\|CRISPRCasFinder,CRT,PILER-CR	747724-747753	30	NZ_CP031652	Pantoea agglomerans strain TH81 plasmid unnamed3, complete sequence	53301-53330	7	0.767
NC_013928_2	2.61\|747988\|30\|NC_013928\|CRISPRCasFinder,CRT,PILER-CR	747988-748017	30	NZ_CP045721	Pantoea eucalypti strain LMG 24197 plasmid unnamed1, complete sequence	208019-208048	7	0.767
NC_013928_2	2.61\|747988\|30\|NC_013928\|CRISPRCasFinder,CRT,PILER-CR	747988-748017	30	MN693547	Marine virus AFVG_25M424, complete genome	14992-15021	7	0.767
NC_013928_2	2.61\|747988\|30\|NC_013928\|CRISPRCasFinder,CRT,PILER-CR	747988-748017	30	MN693297	Marine virus AFVG_25M423, complete genome	11085-11114	7	0.767
NC_013928_2	2.61\|747988\|30\|NC_013928\|CRISPRCasFinder,CRT,PILER-CR	747988-748017	30	MN693353	Marine virus AFVG_25M425, complete genome	15737-15766	7	0.767
NC_013928_2	2.61\|747988\|30\|NC_013928\|CRISPRCasFinder,CRT,PILER-CR	747988-748017	30	NC_014633	Ilyobacter polytropus DSM 2926 plasmid pILYOP01, complete sequence	79713-79742	7	0.767
NC_013928_2	2.61\|747988\|30\|NC_013928\|CRISPRCasFinder,CRT,PILER-CR	747988-748017	30	CP024913	Cyanobacterium sp. HL-69 plasmid pCHL69-1, complete sequence	79004-79033	7	0.767
NC_013928_2	2.62\|748054\|30\|NC_013928\|CRISPRCasFinder,CRT,PILER-CR	748054-748083	30	NZ_CP009368	Bacillus cereus strain FM1 plasmid unnamed, complete sequence	365341-365370	7	0.767
NC_013928_2	2.62\|748054\|30\|NC_013928\|CRISPRCasFinder,CRT,PILER-CR	748054-748083	30	NZ_KR611317	Rickettsia endosymbiont of Ixodes pacificus strain Humboldt plasmid pREIP, complete sequence	11088-11117	7	0.767
NC_013928_2	2.62\|748054\|30\|NC_013928\|CRISPRCasFinder,CRT,PILER-CR	748054-748083	30	NZ_KR611317	Rickettsia endosymbiont of Ixodes pacificus strain Humboldt plasmid pREIP, complete sequence	47176-47205	7	0.767
NC_013928_2	2.62\|748054\|30\|NC_013928\|CRISPRCasFinder,CRT,PILER-CR	748054-748083	30	NZ_KR611317	Rickettsia endosymbiont of Ixodes pacificus strain Humboldt plasmid pREIP, complete sequence	52983-53012	7	0.767
NC_013928_2	2.62\|748054\|30\|NC_013928\|CRISPRCasFinder,CRT,PILER-CR	748054-748083	30	NZ_KR611317	Rickettsia endosymbiont of Ixodes pacificus strain Humboldt plasmid pREIP, complete sequence	63163-63192	7	0.767
NC_013928_2	2.62\|748054\|30\|NC_013928\|CRISPRCasFinder,CRT,PILER-CR	748054-748083	30	NZ_KR611317	Rickettsia endosymbiont of Ixodes pacificus strain Humboldt plasmid pREIP, complete sequence	68970-68999	7	0.767
NC_013928_2	2.62\|748054\|30\|NC_013928\|CRISPRCasFinder,CRT,PILER-CR	748054-748083	30	NZ_KR611317	Rickettsia endosymbiont of Ixodes pacificus strain Humboldt plasmid pREIP, complete sequence	113379-113408	7	0.767
NC_013928_2	2.62\|748054\|30\|NC_013928\|CRISPRCasFinder,CRT,PILER-CR	748054-748083	30	NZ_CP013134	Rickettsia rhipicephali strain HJ#5 plasmid pHJ51, complete sequence	610-639	7	0.767
NC_013928_2	2.62\|748054\|30\|NC_013928\|CRISPRCasFinder,CRT,PILER-CR	748054-748083	30	NZ_CP013134	Rickettsia rhipicephali strain HJ#5 plasmid pHJ51, complete sequence	4838-4867	7	0.767
NC_013928_2	2.62\|748054\|30\|NC_013928\|CRISPRCasFinder,CRT,PILER-CR	748054-748083	30	NZ_AP018261	Calothrix sp. NIES-4071 plasmid plasmid6 DNA, complete genome	1958-1987	7	0.767
NC_013928_2	2.65\|748252\|31\|NC_013928\|CRISPRCasFinder,CRT,PILER-CR	748252-748282	31	NC_008271	Rhodococcus jostii RHA1 plasmid pRHL3, complete sequence	276663-276693	7	0.774
NC_013928_2	2.68\|748451\|30\|NC_013928\|CRISPRCasFinder,CRT,PILER-CR	748451-748480	30	NZ_CP031992	Acinetobacter haemolyticus strain 2126ch plasmid pAhaem2126chf, complete sequence	56744-56773	7	0.767
NC_013928_2	2.68\|748451\|30\|NC_013928\|CRISPRCasFinder,CRT,PILER-CR	748451-748480	30	NZ_CP026415	Acinetobacter sp. ACNIH2 plasmid pACI-55cf, complete sequence	57293-57322	7	0.767
NC_013928_2	2.69\|748517\|30\|NC_013928\|CRISPRCasFinder,CRT,PILER-CR	748517-748546	30	NZ_CP031992	Acinetobacter haemolyticus strain 2126ch plasmid pAhaem2126chf, complete sequence	56744-56773	7	0.767
NC_013928_2	2.69\|748517\|30\|NC_013928\|CRISPRCasFinder,CRT,PILER-CR	748517-748546	30	NZ_CP026415	Acinetobacter sp. ACNIH2 plasmid pACI-55cf, complete sequence	57293-57322	7	0.767
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_KX008967	Shigella sonnei strain 183660 plasmid p183660, complete sequence	88885-88917	8	0.758
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP027554	Escherichia coli strain 2013C-3513 plasmid unnamed1	65967-65999	8	0.758
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_LC506719	Klebsiella pneumoniae strain JUNP254 plasmid pJUNP254, complete sequence	77556-77588	8	0.758
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP023471	Salmonella enterica subsp. enterica strain BAA-1672 plasmid pSalSendai, complete sequence	11393-11425	8	0.758
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP046054	Methylocystis heyeri strain H2 plasmid unnamed2, complete sequence	13465-13497	8	0.758
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	MG592454	Vibrio phage 1.079.O._10N.286.45.E9, partial genome	12822-12854	8	0.758
NC_013928_1	1.15\|645162\|33\|NC_013928\|PILER-CR	645162-645194	33	NC_014825	Ruminococcus albus 7 = DSM 20455 plasmid pRUMAL02, complete sequence	133777-133809	8	0.758
NC_013928_1	1.21\|644430\|32\|NC_013928\|CRISPRCasFinder,CRT	644430-644461	32	MN444876	Streptomyces phage Daubenski, complete genome	70286-70317	8	0.75
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_KJ201887	Shigella flexneri 4c strain 072 plasmid pSF07201, complete sequence	57010-57041	8	0.75
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_KX008967	Shigella sonnei strain 183660 plasmid p183660, complete sequence	88886-88917	8	0.75
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP044550	Hydrogenophaga sp. BPS33 plasmid pBPS33-1, complete sequence	323414-323445	8	0.75
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP023471	Salmonella enterica subsp. enterica strain BAA-1672 plasmid pSalSendai, complete sequence	11393-11424	8	0.75
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	MG592454	Vibrio phage 1.079.O._10N.286.45.E9, partial genome	12823-12854	8	0.75
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	MT511058	Escherichia phage vB_EcoD_SU57, complete genome	29506-29537	8	0.75
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP026096	Bacillus asahii strain OM18 plasmid pOM18, complete sequence	2502-2533	8	0.75
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP016596	Bacillus cereus strain K8 plasmid pBCM301, complete sequence	300217-300248	8	0.75
NC_013928_2	2.10\|744621\|30\|NC_013928\|CRISPRCasFinder,CRT	744621-744650	30	NZ_CP035092	Paracoccus denitrificans strain ATCC 19367 plasmid unnamed1, complete sequence	298567-298596	8	0.733
NC_013928_2	2.10\|744621\|30\|NC_013928\|CRISPRCasFinder,CRT	744621-744650	30	NC_008688	Paracoccus denitrificans PD1222 plasmid 1, complete sequence	545915-545944	8	0.733
NC_013928_2	2.11\|744687\|30\|NC_013928\|CRISPRCasFinder,CRT	744687-744716	30	MN657033	Psychrobacter sp. strain ANT_P15B plasmid pA15BP3, complete sequence	7806-7835	8	0.733
NC_013928_2	2.12\|744753\|30\|NC_013928\|CRISPRCasFinder,CRT	744753-744782	30	NZ_CP040783	Bacillus thuringiensis strain HM-311 plasmid p1, complete sequence	299439-299468	8	0.733
NC_013928_2	2.12\|744753\|30\|NC_013928\|CRISPRCasFinder,CRT	744753-744782	30	NC_020394	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-233, complete sequence	22211-22240	8	0.733
NC_013928_2	2.12\|744753\|30\|NC_013928\|CRISPRCasFinder,CRT	744753-744782	30	NZ_CP016596	Bacillus cereus strain K8 plasmid pBCM301, complete sequence	61886-61915	8	0.733
NC_013928_2	2.12\|744753\|30\|NC_013928\|CRISPRCasFinder,CRT	744753-744782	30	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	192191-192220	8	0.733
NC_013928_2	2.12\|744753\|30\|NC_013928\|CRISPRCasFinder,CRT	744753-744782	30	NZ_CP007616	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence	294754-294783	8	0.733
NC_013928_2	2.12\|744753\|30\|NC_013928\|CRISPRCasFinder,CRT	744753-744782	30	NZ_CP007513	Bacillus bombysepticus plasmid pBb, complete genome	455149-455178	8	0.733
NC_013928_2	2.12\|744753\|30\|NC_013928\|CRISPRCasFinder,CRT	744753-744782	30	NZ_AP014865	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK1, complete sequence	158025-158054	8	0.733
NC_013928_2	2.12\|744753\|30\|NC_013928\|CRISPRCasFinder,CRT	744753-744782	30	NZ_CP053952	Bacillus cereus strain FDAARGOS_798 plasmid unnamed1, complete sequence	34546-34575	8	0.733
NC_013928_2	2.12\|744753\|30\|NC_013928\|CRISPRCasFinder,CRT	744753-744782	30	NZ_CP011154	Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence	84400-84429	8	0.733
NC_013928_2	2.12\|744753\|30\|NC_013928\|CRISPRCasFinder,CRT	744753-744782	30	CP020755	Bacillus thuringiensis strain ATCC 10792 plasmid pLDW-16, complete sequence	252011-252040	8	0.733
NC_013928_2	2.12\|744753\|30\|NC_013928\|CRISPRCasFinder,CRT	744753-744782	30	NZ_CP021062	Bacillus thuringiensis strain ATCC 10792 plasmid poh1, complete sequence	467448-467477	8	0.733
NC_013928_2	2.12\|744753\|30\|NC_013928\|CRISPRCasFinder,CRT	744753-744782	30	NZ_CP053949	Bacillus cereus strain FDAARGOS_799 plasmid unnamed1, complete sequence	164696-164725	8	0.733
NC_013928_2	2.12\|744753\|30\|NC_013928\|CRISPRCasFinder,CRT	744753-744782	30	NZ_CP004877	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence	63420-63449	8	0.733
NC_013928_2	2.12\|744753\|30\|NC_013928\|CRISPRCasFinder,CRT	744753-744782	30	NZ_CP004860	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence	83671-83700	8	0.733
NC_013928_2	2.12\|744753\|30\|NC_013928\|CRISPRCasFinder,CRT	744753-744782	30	NZ_CP010112	Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-6, complete sequence	69091-69120	8	0.733
NC_013928_2	2.12\|744753\|30\|NC_013928\|CRISPRCasFinder,CRT	744753-744782	30	NZ_CP042875	Bacillus cereus strain 09 plasmid unnamed1, complete sequence	462196-462225	8	0.733
NC_013928_2	2.12\|744753\|30\|NC_013928\|CRISPRCasFinder,CRT	744753-744782	30	NZ_CP011152	Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence	462486-462515	8	0.733
NC_013928_2	2.12\|744753\|30\|NC_013928\|CRISPRCasFinder,CRT	744753-744782	30	NZ_CP045607	Bacillus cereus strain SB1 plasmid p1, complete sequence	196705-196734	8	0.733
NC_013928_2	2.12\|744753\|30\|NC_013928\|CRISPRCasFinder,CRT	744753-744782	30	NZ_CP015730	Bacillus cereus strain A1 plasmid pBCA1, complete sequence	8301-8330	8	0.733
NC_013928_2	2.12\|744753\|30\|NC_013928\|CRISPRCasFinder,CRT	744753-744782	30	NZ_CP050184	Bacillus thuringiensis strain HER1410 plasmid pLUSID1, complete sequence	62147-62176	8	0.733
NC_013928_2	2.12\|744753\|30\|NC_013928\|CRISPRCasFinder,CRT	744753-744782	30	NZ_CP010090	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB426, complete sequence	67190-67219	8	0.733
NC_013928_2	2.20\|745281\|30\|NC_013928\|CRISPRCasFinder,CRT	745281-745310	30	MK448662	Streptococcus satellite phage Javan97, complete genome	2182-2211	8	0.733
NC_013928_2	2.20\|745281\|30\|NC_013928\|CRISPRCasFinder,CRT	745281-745310	30	MK448350	Streptococcus satellite phage Javan19, complete genome	2115-2144	8	0.733
NC_013928_2	2.20\|745281\|30\|NC_013928\|CRISPRCasFinder,CRT	745281-745310	30	NZ_AP018727	Streptococcus dysgalactiae strain Kdys0611 plasmid pFGCSD1, complete sequence	20874-20903	8	0.733
NC_013928_2	2.20\|745281\|30\|NC_013928\|CRISPRCasFinder,CRT	745281-745310	30	NZ_AP018728	Streptococcus dysgalactiae strain Kdys0611 plasmid pFGCSD2, complete sequence	9850-9879	8	0.733
NC_013928_2	2.20\|745281\|30\|NC_013928\|CRISPRCasFinder,CRT	745281-745310	30	NZ_AP018730	Streptococcus dysgalactiae strain Kdys0611 plasmid pFGCSD4, complete sequence	8318-8347	8	0.733
NC_013928_2	2.20\|745281\|30\|NC_013928\|CRISPRCasFinder,CRT	745281-745310	30	NZ_CP026413	Acinetobacter sp. ACNIH2 plasmid pACI-35f6, complete sequence	6582-6611	8	0.733
NC_013928_2	2.20\|745281\|30\|NC_013928\|CRISPRCasFinder,CRT	745281-745310	30	NZ_CP044467	Acinetobacter schindleri strain HZE23-1 plasmid pHZE23-1-4, complete sequence	8372-8401	8	0.733
NC_013928_2	2.20\|745281\|30\|NC_013928\|CRISPRCasFinder,CRT	745281-745310	30	NZ_CP044448	Acinetobacter indicus strain CMG3-2 plasmid pCMG3-2-3, complete sequence	3162-3191	8	0.733
NC_013928_2	2.20\|745281\|30\|NC_013928\|CRISPRCasFinder,CRT	745281-745310	30	NZ_CP033126	Acinetobacter wuhouensis strain WCHAW010062 plasmid p6_010062, complete sequence	10312-10341	8	0.733
NC_013928_2	2.28\|745809\|30\|NC_013928\|CRISPRCasFinder,CRT	745809-745838	30	NC_007949	Polaromonas sp. JS666 plasmid 1, complete sequence	170215-170244	8	0.733
NC_013928_2	2.31\|746007\|30\|NC_013928\|CRISPRCasFinder,CRT	746007-746036	30	NZ_CP007544	Synechocystis sp. PCC 6714 plasmid pSYLB, complete sequence	19309-19338	8	0.733
NC_013928_2	2.31\|746007\|30\|NC_013928\|CRISPRCasFinder,CRT	746007-746036	30	NZ_CP015111	Acinetobacter sp. TGL-Y2 plasmid unnamed1, complete sequence	3793-3822	8	0.733
NC_013928_2	2.31\|746007\|30\|NC_013928\|CRISPRCasFinder,CRT	746007-746036	30	NC_049466	Escherichia phage vB_EcoM_4HA13, complete genome	21363-21392	8	0.733
NC_013928_2	2.34\|746205\|30\|NC_013928\|CRISPRCasFinder,CRT	746205-746234	30	NZ_CP031851	Klebsiella pneumoniae strain 121 plasmid pKP121-2, complete sequence	24796-24825	8	0.733
NC_013928_2	2.37\|746403\|30\|NC_013928\|CRISPRCasFinder,CRT	746403-746432	30	NZ_CP041514	Klebsiella michiganensis strain KNU07 plasmid unnamed, complete sequence	123822-123851	8	0.733
NC_013928_2	2.39\|746535\|30\|NC_013928\|CRISPRCasFinder,CRT	746535-746564	30	NZ_CP016288	Rhizobium leguminosarum strain Vaf10 plasmid unnamed7, complete sequence	65937-65966	8	0.733
NC_013928_2	2.49\|747196\|30\|NC_013928\|CRISPRCasFinder,CRT,PILER-CR	747196-747225	30	NC_014661	Acinetobacter phage Acj61, complete genome	157664-157693	8	0.733
NC_013928_2	2.53\|747460\|30\|NC_013928\|CRISPRCasFinder,CRT,PILER-CR	747460-747489	30	MN692973	Marine virus AFVG_117M33, complete genome	8087-8116	8	0.733
NC_013928_2	2.56\|747658\|30\|NC_013928\|CRISPRCasFinder,CRT,PILER-CR	747658-747687	30	NZ_CP021147	Vibrio campbellii strain LA16-V1 plasmid pLA16-1, complete sequence	16533-16562	8	0.733
NC_013928_2	2.65\|748252\|31\|NC_013928\|CRISPRCasFinder,CRT,PILER-CR	748252-748282	31	NC_010553	Burkholderia ambifaria MC40-6 plasmid pBMC401, complete sequence	217501-217531	8	0.742
NC_013928_2	2.67\|748385\|30\|NC_013928\|CRISPRCasFinder,CRT,PILER-CR	748385-748414	30	NC_011783	Borreliella burgdorferi ZS7 plasmid ZS7_lp25, complete sequence	464-493	8	0.733
NC_013928_1	1.3\|644429\|33\|NC_013928\|PILER-CR	644429-644461	33	MN444876	Streptomyces phage Daubenski, complete genome	70285-70317	9	0.727
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP044550	Hydrogenophaga sp. BPS33 plasmid pBPS33-1, complete sequence	323414-323446	9	0.727
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_AP018684	Vibrio casei strain DSM 22364 plasmid 3, complete sequence	6088-6119	9	0.719
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP013482	Pandoraea apista strain DSM 16535 plasmid pPA35, complete sequence	109-140	9	0.719
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	NZ_CP013482	Pandoraea apista strain DSM 16535 plasmid pPA35, complete sequence	61255-61286	9	0.719
NC_013928_1	1.23\|644552\|32\|NC_013928\|CRISPRCasFinder,CRT	644552-644583	32	AP013406	Uncultured Mediterranean phage uvMED DNA, complete genome, group G15, isolate: uvMED-CGR-U-MedDCM-OCT-S46-C34	453-484	9	0.719
NC_013928_1	1.26\|644735\|32\|NC_013928\|CRISPRCasFinder,CRT	644735-644766	32	NC_029094	Pseudoalteromonas phage H101, complete genome	754-785	9	0.719
NC_013928_1	1.33\|645163\|32\|NC_013928\|CRISPRCasFinder,CRT	645163-645194	32	MK972710	Salmonella phage SI22, complete genome	21572-21603	9	0.719
NC_013928_1	1.33\|645163\|32\|NC_013928\|CRISPRCasFinder,CRT	645163-645194	32	NC_049459	Salmonella phage SW9, complete genome	21585-21616	9	0.719
NC_013928_1	1.34\|645224\|32\|NC_013928\|CRISPRCasFinder,CRT	645224-645255	32	MN234206	Arthrobacter phage Racecar, complete genome	141673-141704	9	0.719
NC_013928_1	1.34\|645224\|32\|NC_013928\|CRISPRCasFinder,CRT	645224-645255	32	MN234211	Arthrobacter phage Mimi, complete genome	140038-140069	9	0.719
NC_013928_2	2.6\|744357\|30\|NC_013928\|CRISPRCasFinder,CRT	744357-744386	30	KF669662	Bacillus phage Spock, complete genome	85418-85447	9	0.7
NC_013928_2	2.6\|744357\|30\|NC_013928\|CRISPRCasFinder,CRT	744357-744386	30	KY888882	Bacillus phage Flapjack, complete genome	85684-85713	9	0.7
NC_013928_2	2.12\|744753\|30\|NC_013928\|CRISPRCasFinder,CRT	744753-744782	30	NC_013940	Deferribacter desulfuricans SSM1 megaplasmid pDF308, complete sequence	128389-128418	9	0.7
NC_013928_2	2.15\|744951\|30\|NC_013928\|CRISPRCasFinder,CRT	744951-744980	30	MN882542	Escherichia phage JN01,complete genome	14036-14065	9	0.7
NC_013928_2	2.18\|745149\|30\|NC_013928\|CRISPRCasFinder,CRT	745149-745178	30	CP044351	Escherichia coli strain 194195 plasmid p194195_1, complete sequence	68078-68107	9	0.7
NC_013928_2	2.18\|745149\|30\|NC_013928\|CRISPRCasFinder,CRT	745149-745178	30	NZ_AP023206	Escherichia coli strain TUM18781 plasmid pMTY18781-1_lncX3, complete sequence	363921-363950	9	0.7
NC_013928_2	2.23\|745479\|30\|NC_013928\|CRISPRCasFinder,CRT	745479-745508	30	MN694079	Marine virus AFVG_250M40, complete genome	34657-34686	9	0.7
NC_013928_2	2.28\|745809\|30\|NC_013928\|CRISPRCasFinder,CRT	745809-745838	30	NZ_CP025014	Rhizobium leguminosarum strain Norway plasmid pRLN2, complete sequence	100551-100580	9	0.7
NC_013928_2	2.29\|745875\|30\|NC_013928\|CRISPRCasFinder,CRT	745875-745904	30	AP013675	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C49-MedDCM-OCT-S27-C43, * SEQUENCING IN PROGRESS *	8595-8624	9	0.7
NC_013928_2	2.31\|746007\|30\|NC_013928\|CRISPRCasFinder,CRT	746007-746036	30	NZ_CP007544	Synechocystis sp. PCC 6714 plasmid pSYLB, complete sequence	18382-18411	9	0.7
NC_013928_2	2.31\|746007\|30\|NC_013928\|CRISPRCasFinder,CRT	746007-746036	30	NZ_CP007544	Synechocystis sp. PCC 6714 plasmid pSYLB, complete sequence	18691-18720	9	0.7
NC_013928_2	2.31\|746007\|30\|NC_013928\|CRISPRCasFinder,CRT	746007-746036	30	NZ_CP007544	Synechocystis sp. PCC 6714 plasmid pSYLB, complete sequence	19000-19029	9	0.7
NC_013928_2	2.31\|746007\|30\|NC_013928\|CRISPRCasFinder,CRT	746007-746036	30	NZ_CP007544	Synechocystis sp. PCC 6714 plasmid pSYLB, complete sequence	19618-19647	9	0.7
NC_013928_2	2.33\|746139\|30\|NC_013928\|CRISPRCasFinder,CRT	746139-746168	30	MK765570	Tortoise microvirus 20 isolate 20_SP_90, complete genome	3220-3249	9	0.7
NC_013928_2	2.41\|746667\|30\|NC_013928\|CRISPRCasFinder,CRT	746667-746696	30	NZ_KU130294	Pseudomonas putida strain 12969 plasmid p12969-DIM, complete sequence	62682-62711	9	0.7
NC_013928_2	2.41\|746667\|30\|NC_013928\|CRISPRCasFinder,CRT	746667-746696	30	NZ_CP039989	Pseudomonas aeruginosa strain T2436 plasmid pBT2436, complete sequence	59842-59871	9	0.7
NC_013928_2	2.41\|746667\|30\|NC_013928\|CRISPRCasFinder,CRT	746667-746696	30	NZ_CP039991	Pseudomonas aeruginosa strain T2101 plasmid pBT2101, complete sequence	60009-60038	9	0.7
NC_013928_2	2.41\|746667\|30\|NC_013928\|CRISPRCasFinder,CRT	746667-746696	30	NZ_MN433457	Pseudomonas aeruginosa strain PAB546 plasmid pNK546-KPC, complete sequence	112149-112178	9	0.7
NC_013928_2	2.41\|746667\|30\|NC_013928\|CRISPRCasFinder,CRT	746667-746696	30	NZ_CP029096	Pseudomonas aeruginosa strain AR439 plasmid unnamed2, complete sequence	76457-76486	9	0.7
NC_013928_2	2.41\|746667\|30\|NC_013928\|CRISPRCasFinder,CRT	746667-746696	30	NZ_CP045003	Pseudomonas aeruginosa strain PAG5 plasmid pPAG5, complete sequence	385481-385510	9	0.7
NC_013928_2	2.41\|746667\|30\|NC_013928\|CRISPRCasFinder,CRT	746667-746696	30	NZ_CP045917	Pseudomonas aeruginosa strain CF39S plasmid pCF39S, complete sequence	63258-63287	9	0.7
NC_013928_2	2.41\|746667\|30\|NC_013928\|CRISPRCasFinder,CRT	746667-746696	30	MF344571	Pseudomonas aeruginosa plasmid pR31014-IMP, complete sequence	63040-63069	9	0.7
NC_013928_2	2.41\|746667\|30\|NC_013928\|CRISPRCasFinder,CRT	746667-746696	30	MF344568	Pseudomonas aeruginosa plasmid p727-IMP, complete sequence	61436-61465	9	0.7
NC_013928_2	2.41\|746667\|30\|NC_013928\|CRISPRCasFinder,CRT	746667-746696	30	MF344569	Pseudomonas aeruginosa plasmid p12939-PER, complete sequence	61187-61216	9	0.7
NC_013928_2	2.41\|746667\|30\|NC_013928\|CRISPRCasFinder,CRT	746667-746696	30	MF344570	Pseudomonas aeruginosa plasmid pA681-IMP, complete sequence	64039-64068	9	0.7
NC_013928_2	2.41\|746667\|30\|NC_013928\|CRISPRCasFinder,CRT	746667-746696	30	NZ_CP039294	Pseudomonas aeruginosa strain PABL048 plasmid pPABL048, complete sequence	286789-286818	9	0.7
NC_013928_2	2.41\|746667\|30\|NC_013928\|CRISPRCasFinder,CRT	746667-746696	30	CP027478	Pseudomonas koreensis strain P19E3 plasmid p1, complete sequence	137750-137779	9	0.7
NC_013928_2	2.41\|746667\|30\|NC_013928\|CRISPRCasFinder,CRT	746667-746696	30	NZ_CP027170	Pseudomonas aeruginosa strain AR_0356 plasmid unnamed2, complete sequence	345585-345614	9	0.7
NC_013928_2	2.41\|746667\|30\|NC_013928\|CRISPRCasFinder,CRT	746667-746696	30	NZ_CP015879	Pseudomonas citronellolis strain SJTE-3 plasmid pRBL16, complete sequence	363469-363498	9	0.7
NC_013928_2	2.41\|746667\|30\|NC_013928\|CRISPRCasFinder,CRT	746667-746696	30	NZ_KY883660	Pseudomonas putida strain SY153 plasmid pSY153-MDR, complete sequence	65260-65289	9	0.7
NC_013928_2	2.41\|746667\|30\|NC_013928\|CRISPRCasFinder,CRT	746667-746696	30	NZ_KY494864	Pseudomonas aeruginosa strain FFUP_PS_37 plasmid pJB37, complete sequence	177205-177234	9	0.7
NC_013928_2	2.41\|746667\|30\|NC_013928\|CRISPRCasFinder,CRT	746667-746696	30	NZ_LT969519	Pseudomonas aeruginosa isolate RW109 genome assembly, plasmid: RW109 plasmid 1	227253-227282	9	0.7
NC_013928_2	2.41\|746667\|30\|NC_013928\|CRISPRCasFinder,CRT	746667-746696	30	NZ_CP009975	Pseudomonas putida S12 plasmid pTTS12, complete sequence	174102-174131	9	0.7
NC_013928_2	2.41\|746667\|30\|NC_013928\|CRISPRCasFinder,CRT	746667-746696	30	NZ_CP029094	Pseudomonas aeruginosa strain AR441 plasmid unnamed3, complete sequence	13361-13390	9	0.7
NC_013928_2	2.41\|746667\|30\|NC_013928\|CRISPRCasFinder,CRT	746667-746696	30	NZ_CP040126	Pseudomonas aeruginosa strain PA298 plasmid pBM908, complete sequence	171053-171082	9	0.7
NC_013928_2	2.41\|746667\|30\|NC_013928\|CRISPRCasFinder,CRT	746667-746696	30	NZ_CP016215	Pseudomonas aeruginosa strain PA121617 plasmid pBM413, complete sequence	243475-243504	9	0.7
NC_013928_2	2.46\|746998\|30\|NC_013928\|CRISPRCasFinder,CRT	746998-747027	30	NC_007765	Rhizobium etli CFN 42 plasmid p42e, complete sequence	309953-309982	9	0.7
NC_013928_2	2.46\|746998\|30\|NC_013928\|CRISPRCasFinder,CRT	746998-747027	30	NZ_CP020909	Rhizobium etli strain NXC12 plasmid pRetNXC12c, complete sequence	310388-310417	9	0.7
NC_013928_2	2.46\|746998\|30\|NC_013928\|CRISPRCasFinder,CRT	746998-747027	30	NC_021908	Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1d, complete sequence	316391-316420	9	0.7
NC_013928_2	2.49\|747196\|30\|NC_013928\|CRISPRCasFinder,CRT,PILER-CR	747196-747225	30	MG592458	Vibrio phage 1.083.O._10N.286.52.B9, partial genome	29830-29859	9	0.7
NC_013928_2	2.61\|747988\|30\|NC_013928\|CRISPRCasFinder,CRT,PILER-CR	747988-748017	30	MF417944	Uncultured Caudovirales phage clone 7F_3, partial genome	15161-15190	9	0.7
NC_013928_2	2.67\|748385\|30\|NC_013928\|CRISPRCasFinder,CRT,PILER-CR	748385-748414	30	NC_001850	Borreliella burgdorferi B31 plasmid lp25, complete sequence	439-468	9	0.7
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP013482	Pandoraea apista strain DSM 16535 plasmid pPA35, complete sequence	108-140	10	0.697
NC_013928_1	1.5\|644551\|33\|NC_013928\|PILER-CR	644551-644583	33	NZ_CP013482	Pandoraea apista strain DSM 16535 plasmid pPA35, complete sequence	61254-61286	10	0.697

1. spacer 2.37|746403|30|NC_013928|CRISPRCasFinder,CRT matches to DQ386162 (Streptococcus phage M102AD, complete genome) position: , mismatch: 0, identity: 1.0

ttctggctgtctttcagagtgataagcgca	CRISPR spacer
ttctggctgtctttcagagtgataagcgca	Protospacer
******************************

2. spacer 2.42|746733|30|NC_013928|CRISPRCasFinder,CRT matches to NC_029030 (Streptococcus phage APCM01, complete genome) position: , mismatch: 0, identity: 1.0

gcactacaagacggctattgctgatgaagt	CRISPR spacer
gcactacaagacggctattgctgatgaagt	Protospacer
******************************

3. spacer 2.66|748319|30|NC_013928|CRISPRCasFinder,CRT,PILER-CR matches to AM749121 (Streptococcus phage M102 complete genome) position: , mismatch: 0, identity: 1.0

tgcaaaagatggcctcgagcaattatcgca	CRISPR spacer
tgcaaaagatggcctcgagcaattatcgca	Protospacer
******************************

4. spacer 2.66|748319|30|NC_013928|CRISPRCasFinder,CRT,PILER-CR matches to NC_012884 (Streptococcus phage M102, complete genome) position: , mismatch: 0, identity: 1.0

tgcaaaagatggcctcgagcaattatcgca	CRISPR spacer
tgcaaaagatggcctcgagcaattatcgca	Protospacer
******************************

5. spacer 1.1|644307|33|NC_013928|PILER-CR matches to NC_029030 (Streptococcus phage APCM01, complete genome) position: , mismatch: 1, identity: 0.97

tgggtctgacacccagtcacccaaagctttgag	CRISPR spacer
tgggtctgacacccaatcacccaaagctttgag	Protospacer
***************.*****************

6. spacer 1.19|644308|32|NC_013928|CRISPRCasFinder,CRT matches to NC_029030 (Streptococcus phage APCM01, complete genome) position: , mismatch: 1, identity: 0.969

gggtctgacacccagtcacccaaagctttgag	CRISPR spacer
gggtctgacacccaatcacccaaagctttgag	Protospacer
**************.*****************

7. spacer 2.8|744489|30|NC_013928|CRISPRCasFinder,CRT matches to DQ386162 (Streptococcus phage M102AD, complete genome) position: , mismatch: 1, identity: 0.967

tggtccaaagtgcagagccaaagaaaaaca	CRISPR spacer
tggttcaaagtgcagagccaaagaaaaaca	Protospacer
****.*************************

8. spacer 2.17|745083|30|NC_013928|CRISPRCasFinder,CRT matches to NC_029030 (Streptococcus phage APCM01, complete genome) position: , mismatch: 1, identity: 0.967

gcttgaatataattgtgtatccgccaatga	CRISPR spacer
gcttgaatataattgtgtatccgccaatgt	Protospacer
*****************************

9. spacer 2.17|745083|30|NC_013928|CRISPRCasFinder,CRT matches to MT430910 (Streptococcus phage smHBZ8, complete genome) position: , mismatch: 1, identity: 0.967

gcttgaatataattgtgtatccgccaatga	CRISPR spacer
gcttgaatataattgtgtattcgccaatga	Protospacer
********************.*********

10. spacer 2.29|745875|30|NC_013928|CRISPRCasFinder,CRT matches to MT430910 (Streptococcus phage smHBZ8, complete genome) position: , mismatch: 1, identity: 0.967

agttattaatatctatgacagtctcaaaga	CRISPR spacer
agttattaatatctatgatagtctcaaaga	Protospacer
******************.***********

11. spacer 2.30|745941|30|NC_013928|CRISPRCasFinder,CRT matches to NC_029030 (Streptococcus phage APCM01, complete genome) position: , mismatch: 1, identity: 0.967

cggatatagcctagcatataatcgcgtgtg	CRISPR spacer
cggatatagcctagcatgtaatcgcgtgtg	Protospacer
*****************.************

12. spacer 2.36|746337|30|NC_013928|CRISPRCasFinder,CRT matches to NC_029030 (Streptococcus phage APCM01, complete genome) position: , mismatch: 1, identity: 0.967

taatattattgagcaaaaatcctttaactc	CRISPR spacer
taatattattgaacaaaaatcctttaactc	Protospacer
************.*****************

13. spacer 2.43|746799|30|NC_013928|CRISPRCasFinder,CRT matches to MT430910 (Streptococcus phage smHBZ8, complete genome) position: , mismatch: 1, identity: 0.967

gcaatttagttttattccgtgggagcagca	CRISPR spacer
gcaatttagttttattccgtgggaacagca	Protospacer
************************.*****

14. spacer 2.45|746932|30|NC_013928|CRISPRCasFinder,CRT matches to NC_029030 (Streptococcus phage APCM01, complete genome) position: , mismatch: 1, identity: 0.967

aattgttactcccaacttcagcattgacca	CRISPR spacer
aattgttactgccaacttcagcattgacca	Protospacer
********** *******************

15. spacer 2.49|747196|30|NC_013928|CRISPRCasFinder,CRT,PILER-CR matches to NC_029030 (Streptococcus phage APCM01, complete genome) position: , mismatch: 1, identity: 0.967

cgcaacaatgactattaatatcaacggtgg	CRISPR spacer
cgcaacaatgactattaatatcaacggcgg	Protospacer
***************************.**

16. spacer 2.56|747658|30|NC_013928|CRISPRCasFinder,CRT,PILER-CR matches to MT430910 (Streptococcus phage smHBZ8, complete genome) position: , mismatch: 1, identity: 0.967

aatcgcttctttgctaaccacaatttgtgc	CRISPR spacer
aattgcttctttgctaaccacaatttgtgc	Protospacer
***.**************************

17. spacer 2.64|748186|30|NC_013928|CRISPRCasFinder,CRT,PILER-CR matches to MT430910 (Streptococcus phage smHBZ8, complete genome) position: , mismatch: 1, identity: 0.967

tagagctcttagttttttacgcgttgggcc	CRISPR spacer
tagagctcttagttttttacgcgttgggct	Protospacer
*****************************.

18. spacer 1.4|644490|33|NC_013928|PILER-CR matches to MT430910 (Streptococcus phage smHBZ8, complete genome) position: , mismatch: 2, identity: 0.939

tacttgacagcgcagtgcgcgctgttgaatagc	CRISPR spacer
tacttgacagcgcagtgtgcgttgttgaatagc	Protospacer
*****************.***.***********

19. spacer 1.7|644673|33|NC_013928|PILER-CR matches to AM749121 (Streptococcus phage M102 complete genome) position: , mismatch: 2, identity: 0.939

tcatgcgccagtatattatcaggtcgtggaata	CRISPR spacer
tcatgcgctagtatattatcaggacgtggaata	Protospacer
********.************** *********

20. spacer 1.7|644673|33|NC_013928|PILER-CR matches to NC_012884 (Streptococcus phage M102, complete genome) position: , mismatch: 2, identity: 0.939

tcatgcgccagtatattatcaggtcgtggaata	CRISPR spacer
tcatgcgctagtatattatcaggacgtggaata	Protospacer
********.************** *********

21. spacer 1.7|644673|33|NC_013928|PILER-CR matches to DQ386162 (Streptococcus phage M102AD, complete genome) position: , mismatch: 2, identity: 0.939

tcatgcgccagtatattatcaggtcgtggaata	CRISPR spacer
tcatgcgctagtatattatcaggacgtggaata	Protospacer
********.************** *********

22. spacer 1.19|644308|32|NC_013928|CRISPRCasFinder,CRT matches to AM749121 (Streptococcus phage M102 complete genome) position: , mismatch: 2, identity: 0.938

gggtctgacacccagtcacccaaagctttgag	CRISPR spacer
gggtccgaaacccagtcacccaaagctttgag	Protospacer
*****.** ***********************

23. spacer 1.19|644308|32|NC_013928|CRISPRCasFinder,CRT matches to NC_012884 (Streptococcus phage M102, complete genome) position: , mismatch: 2, identity: 0.938

gggtctgacacccagtcacccaaagctttgag	CRISPR spacer
gggtccgaaacccagtcacccaaagctttgag	Protospacer
*****.** ***********************

24. spacer 1.19|644308|32|NC_013928|CRISPRCasFinder,CRT matches to DQ386162 (Streptococcus phage M102AD, complete genome) position: , mismatch: 2, identity: 0.938

gggtctgacacccagtcacccaaagctttgag	CRISPR spacer
gggtccgaaacccagtcacccaaagctttgag	Protospacer
*****.** ***********************

25. spacer 1.22|644491|32|NC_013928|CRISPRCasFinder,CRT matches to MT430910 (Streptococcus phage smHBZ8, complete genome) position: , mismatch: 2, identity: 0.938

acttgacagcgcagtgcgcgctgttgaatagc	CRISPR spacer
acttgacagcgcagtgtgcgttgttgaatagc	Protospacer
****************.***.***********

26. spacer 1.25|644674|32|NC_013928|CRISPRCasFinder,CRT matches to AM749121 (Streptococcus phage M102 complete genome) position: , mismatch: 2, identity: 0.938

catgcgccagtatattatcaggtcgtggaata	CRISPR spacer
catgcgctagtatattatcaggacgtggaata	Protospacer
*******.************** *********

27. spacer 1.25|644674|32|NC_013928|CRISPRCasFinder,CRT matches to NC_012884 (Streptococcus phage M102, complete genome) position: , mismatch: 2, identity: 0.938

catgcgccagtatattatcaggtcgtggaata	CRISPR spacer
catgcgctagtatattatcaggacgtggaata	Protospacer
*******.************** *********

28. spacer 1.25|644674|32|NC_013928|CRISPRCasFinder,CRT matches to DQ386162 (Streptococcus phage M102AD, complete genome) position: , mismatch: 2, identity: 0.938

catgcgccagtatattatcaggtcgtggaata	CRISPR spacer
catgcgctagtatattatcaggacgtggaata	Protospacer
*******.************** *********

29. spacer 1.27|644796|33|NC_013928|CRISPRCasFinder,CRT matches to DQ386162 (Streptococcus phage M102AD, complete genome) position: , mismatch: 2, identity: 0.939

ttgattttcattatcgcggtctgatggcttaaa	CRISPR spacer
ttgattttcattatcgcggtctgatggtttgaa	Protospacer
***************************.**.**

30. spacer 1.36|645346|32|NC_013928|CRISPRCasFinder,CRT matches to NC_029030 (Streptococcus phage APCM01, complete genome) position: , mismatch: 2, identity: 0.938

gccgttgggtcaatgccgttagcttttaaaga	CRISPR spacer
gccgttgggtcaatgccgttagctttcaaagc	Protospacer
**************************.****

31. spacer 2.2|744093|30|NC_013928|PILER-CR,CRISPRCasFinder,CRT matches to AM749121 (Streptococcus phage M102 complete genome) position: , mismatch: 2, identity: 0.933

gattgtgcccgctagtaaaccgcctcgcgc	CRISPR spacer
gattgtgccagctaataaaccgcctcgcgc	Protospacer
********* ****.***************

32. spacer 2.2|744093|30|NC_013928|PILER-CR,CRISPRCasFinder,CRT matches to NC_012884 (Streptococcus phage M102, complete genome) position: , mismatch: 2, identity: 0.933

gattgtgcccgctagtaaaccgcctcgcgc	CRISPR spacer
gattgtgccagctaataaaccgcctcgcgc	Protospacer
********* ****.***************

33. spacer 2.2|744093|30|NC_013928|PILER-CR,CRISPRCasFinder,CRT matches to DQ386162 (Streptococcus phage M102AD, complete genome) position: , mismatch: 2, identity: 0.933

gattgtgcccgctagtaaaccgcctcgcgc	CRISPR spacer
gattgtgccagctaataaaccgcctcgcgc	Protospacer
********* ****.***************

34. spacer 2.6|744357|30|NC_013928|CRISPRCasFinder,CRT matches to DQ386162 (Streptococcus phage M102AD, complete genome) position: , mismatch: 2, identity: 0.933

gattgtatcagtaatcgaacttctgcttat	CRISPR spacer
gattgtatcagtaattgaacttctgctgat	Protospacer
***************.*********** **

35. spacer 2.8|744489|30|NC_013928|CRISPRCasFinder,CRT matches to AM749121 (Streptococcus phage M102 complete genome) position: , mismatch: 2, identity: 0.933

tggtccaaagtgcagagccaaagaaaaaca	CRISPR spacer
ttgtccaaagtgcagagccaaagaaaaata	Protospacer
* **************************.*

36. spacer 2.8|744489|30|NC_013928|CRISPRCasFinder,CRT matches to NC_012884 (Streptococcus phage M102, complete genome) position: , mismatch: 2, identity: 0.933

tggtccaaagtgcagagccaaagaaaaaca	CRISPR spacer
ttgtccaaagtgcagagccaaagaaaaata	Protospacer
* **************************.*

37. spacer 2.13|744819|30|NC_013928|CRISPRCasFinder,CRT matches to NC_029030 (Streptococcus phage APCM01, complete genome) position: , mismatch: 2, identity: 0.933

tggcaatttaccagcacagcaattgctggc	CRISPR spacer
tggcaattcaccagcacagcgattgctggc	Protospacer
********.***********.*********

38. spacer 2.23|745479|30|NC_013928|CRISPRCasFinder,CRT matches to NC_029030 (Streptococcus phage APCM01, complete genome) position: , mismatch: 2, identity: 0.933

aaaaagaaacgccttttgatttgaccaatc	CRISPR spacer
aaaaagaaacgccttttgatttgacaaacc	Protospacer
************************* **.*

39. spacer 2.23|745479|30|NC_013928|CRISPRCasFinder,CRT matches to MT430910 (Streptococcus phage smHBZ8, complete genome) position: , mismatch: 2, identity: 0.933

aaaaagaaacgccttttgatttgaccaatc	CRISPR spacer
aaaaagaaacgccttttgacctgaccaatc	Protospacer
*******************..*********

40. spacer 2.29|745875|30|NC_013928|CRISPRCasFinder,CRT matches to AM749121 (Streptococcus phage M102 complete genome) position: , mismatch: 2, identity: 0.933

agttattaatatctatgacagtctcaaaga	CRISPR spacer
agttattaatatctatgacagcctgaaaga	Protospacer
*********************.** *****

41. spacer 2.29|745875|30|NC_013928|CRISPRCasFinder,CRT matches to NC_012884 (Streptococcus phage M102, complete genome) position: , mismatch: 2, identity: 0.933

agttattaatatctatgacagtctcaaaga	CRISPR spacer
agttattaatatctatgacagcctgaaaga	Protospacer
*********************.** *****

42. spacer 2.29|745875|30|NC_013928|CRISPRCasFinder,CRT matches to DQ386162 (Streptococcus phage M102AD, complete genome) position: , mismatch: 2, identity: 0.933

agttattaatatctatgacagtctcaaaga	CRISPR spacer
agttattaatatctatgacagcctgaaaga	Protospacer
*********************.** *****

43. spacer 2.32|746073|30|NC_013928|CRISPRCasFinder,CRT matches to NC_029030 (Streptococcus phage APCM01, complete genome) position: , mismatch: 2, identity: 0.933

aatgtatgcaccgcgttttttaacaaaata	CRISPR spacer
aatgtatgcaccacgttttttaacgaaata	Protospacer
************.***********.*****

44. spacer 2.32|746073|30|NC_013928|CRISPRCasFinder,CRT matches to MT430910 (Streptococcus phage smHBZ8, complete genome) position: , mismatch: 2, identity: 0.933

aatgtatgcaccgcgttttttaacaaaata	CRISPR spacer
aatgtatgcgccgcgttttttaacgaaata	Protospacer
*********.**************.*****

45. spacer 2.33|746139|30|NC_013928|CRISPRCasFinder,CRT matches to NC_029030 (Streptococcus phage APCM01, complete genome) position: , mismatch: 2, identity: 0.933

gtttgcttttgtttttgccttgtgtgtttc	CRISPR spacer
gtttgctttcgtttttgctttgtgtgtttc	Protospacer
*********.********.***********

46. spacer 2.33|746139|30|NC_013928|CRISPRCasFinder,CRT matches to MT430910 (Streptococcus phage smHBZ8, complete genome) position: , mismatch: 2, identity: 0.933

gtttgcttttgtttttgccttgtgtgtttc	CRISPR spacer
gtctgctttagtttttgccttgtgtgtttc	Protospacer
**.****** ********************

47. spacer 2.37|746403|30|NC_013928|CRISPRCasFinder,CRT matches to NC_029030 (Streptococcus phage APCM01, complete genome) position: , mismatch: 2, identity: 0.933

ttctggctgtctttcagagtgataagcgca	CRISPR spacer
ttctgactgtctttcagagtaataagcgca	Protospacer
*****.**************.*********

48. spacer 2.37|746403|30|NC_013928|CRISPRCasFinder,CRT matches to AM749121 (Streptococcus phage M102 complete genome) position: , mismatch: 2, identity: 0.933

ttctggctgtctttcagagtgataagcgca	CRISPR spacer
ttctggctgtctttcagagtaataagtgca	Protospacer
********************.*****.***

49. spacer 2.37|746403|30|NC_013928|CRISPRCasFinder,CRT matches to NC_012884 (Streptococcus phage M102, complete genome) position: , mismatch: 2, identity: 0.933

ttctggctgtctttcagagtgataagcgca	CRISPR spacer
ttctggctgtctttcagagtaataagtgca	Protospacer
********************.*****.***

50. spacer 2.40|746601|30|NC_013928|CRISPRCasFinder,CRT matches to AM749121 (Streptococcus phage M102 complete genome) position: , mismatch: 2, identity: 0.933

tgcaagttatcttgctatgtggacgaattg	CRISPR spacer
tgcaagttatctcgctatgtggactaattg	Protospacer
************.*********** *****

51. spacer 2.40|746601|30|NC_013928|CRISPRCasFinder,CRT matches to NC_012884 (Streptococcus phage M102, complete genome) position: , mismatch: 2, identity: 0.933

tgcaagttatcttgctatgtggacgaattg	CRISPR spacer
tgcaagttatctcgctatgtggactaattg	Protospacer
************.*********** *****

52. spacer 2.42|746733|30|NC_013928|CRISPRCasFinder,CRT matches to MT430910 (Streptococcus phage smHBZ8, complete genome) position: , mismatch: 2, identity: 0.933

gcactacaagacggctattgctgatgaagt	CRISPR spacer
acactacaagacagctattgctgatgaagt	Protospacer
.***********.*****************

53. spacer 2.43|746799|30|NC_013928|CRISPRCasFinder,CRT matches to DQ386162 (Streptococcus phage M102AD, complete genome) position: , mismatch: 2, identity: 0.933

gcaatttagttttattccgtgggagcagca	CRISPR spacer
gcaatttagttttatcccttgggagcagca	Protospacer
***************.** ***********

54. spacer 2.48|747130|30|NC_013928|CRISPRCasFinder,CRT,PILER-CR matches to DQ386162 (Streptococcus phage M102AD, complete genome) position: , mismatch: 2, identity: 0.933

agagtatagccagtgttttcaaggccttta	CRISPR spacer
agagtatagccagcgttttcaaggccttca	Protospacer
*************.**************.*

55. spacer 2.49|747196|30|NC_013928|CRISPRCasFinder,CRT,PILER-CR matches to AM749121 (Streptococcus phage M102 complete genome) position: , mismatch: 2, identity: 0.933

cgcaacaatgactattaatatcaacggtgg	CRISPR spacer
cgcaacaatgactattactatcaacggcgg	Protospacer
***************** *********.**

56. spacer 2.49|747196|30|NC_013928|CRISPRCasFinder,CRT,PILER-CR matches to NC_012884 (Streptococcus phage M102, complete genome) position: , mismatch: 2, identity: 0.933

cgcaacaatgactattaatatcaacggtgg	CRISPR spacer
cgcaacaatgactattactatcaacggcgg	Protospacer
***************** *********.**

57. spacer 2.49|747196|30|NC_013928|CRISPRCasFinder,CRT,PILER-CR matches to DQ386162 (Streptococcus phage M102AD, complete genome) position: , mismatch: 2, identity: 0.933

cgcaacaatgactattaatatcaacggtgg	CRISPR spacer
cgcaacaatgactattagtatcaacggcgg	Protospacer
*****************.*********.**

58. spacer 2.56|747658|30|NC_013928|CRISPRCasFinder,CRT,PILER-CR matches to DQ386162 (Streptococcus phage M102AD, complete genome) position: , mismatch: 2, identity: 0.933

aatcgcttctttgctaaccacaatttgtgc	CRISPR spacer
aatcgcttctttgctgactacaatttgtgc	Protospacer
***************.**.***********

59. spacer 2.60|747922|30|NC_013928|CRISPRCasFinder,CRT,PILER-CR matches to AM749121 (Streptococcus phage M102 complete genome) position: , mismatch: 2, identity: 0.933

aaatgctcttgaagaacctgatagatgaca	CRISPR spacer
aaatgctcttaaagaacctgatagatgata	Protospacer
**********.*****************.*

60. spacer 2.60|747922|30|NC_013928|CRISPRCasFinder,CRT,PILER-CR matches to NC_012884 (Streptococcus phage M102, complete genome) position: , mismatch: 2, identity: 0.933

aaatgctcttgaagaacctgatagatgaca	CRISPR spacer
aaatgctcttaaagaacctgatagatgata	Protospacer
**********.*****************.*

61. spacer 2.60|747922|30|NC_013928|CRISPRCasFinder,CRT,PILER-CR matches to DQ386162 (Streptococcus phage M102AD, complete genome) position: , mismatch: 2, identity: 0.933

aaatgctcttgaagaacctgatagatgaca	CRISPR spacer
aaatgctcttaaagaacctgatagatgata	Protospacer
**********.*****************.*

62. spacer 2.60|747922|30|NC_013928|CRISPRCasFinder,CRT,PILER-CR matches to MT430910 (Streptococcus phage smHBZ8, complete genome) position: , mismatch: 2, identity: 0.933

aaatgctcttgaagaacctgatagatgaca	CRISPR spacer
aaatgctcttgaaaaacttgatagatgaca	Protospacer
*************.***.************

63. spacer 1.1|644307|33|NC_013928|PILER-CR matches to AM749121 (Streptococcus phage M102 complete genome) position: , mismatch: 3, identity: 0.909

tgggtctgacacccagtcacccaaagctttgag	CRISPR spacer
cgggtccgaaacccagtcacccaaagctttgag	Protospacer
.*****.** ***********************

64. spacer 1.1|644307|33|NC_013928|PILER-CR matches to NC_012884 (Streptococcus phage M102, complete genome) position: , mismatch: 3, identity: 0.909

tgggtctgacacccagtcacccaaagctttgag	CRISPR spacer
cgggtccgaaacccagtcacccaaagctttgag	Protospacer
.*****.** ***********************

65. spacer 1.1|644307|33|NC_013928|PILER-CR matches to DQ386162 (Streptococcus phage M102AD, complete genome) position: , mismatch: 3, identity: 0.909

tgggtctgacacccagtcacccaaagctttgag	CRISPR spacer
cgggtccgaaacccagtcacccaaagctttgag	Protospacer
.*****.** ***********************

66. spacer 1.9|644795|34|NC_013928|PILER-CR matches to DQ386162 (Streptococcus phage M102AD, complete genome) position: , mismatch: 3, identity: 0.912

tttgattttcattatcgcggtctgatggcttaaa	CRISPR spacer
attgattttcattatcgcggtctgatggtttgaa	Protospacer
 ***************************.**.**

67. spacer 1.18|645345|33|NC_013928|PILER-CR matches to NC_029030 (Streptococcus phage APCM01, complete genome) position: , mismatch: 3, identity: 0.909

tgccgttgggtcaatgccgttagcttttaaaga	CRISPR spacer
cgccgttgggtcaatgccgttagctttcaaagc	Protospacer
.**************************.****

68. spacer 2.3|744159|30|NC_013928|PILER-CR,CRISPRCasFinder,CRT matches to MT430910 (Streptococcus phage smHBZ8, complete genome) position: , mismatch: 3, identity: 0.9

ccaagctatgcagtcacgcctgaccctgtg	CRISPR spacer
ccaagctatgcagtgacgcctgaccctatt	Protospacer
************** ************.*

69. spacer 2.12|744753|30|NC_013928|CRISPRCasFinder,CRT matches to MT430910 (Streptococcus phage smHBZ8, complete genome) position: , mismatch: 3, identity: 0.9

gagcaaaatcaactatctcaaagcttagtt	CRISPR spacer
gagcaaaaccagctatctcaaagcttagtc	Protospacer
********.**.*****************.

70. spacer 2.13|744819|30|NC_013928|CRISPRCasFinder,CRT matches to MT430910 (Streptococcus phage smHBZ8, complete genome) position: , mismatch: 3, identity: 0.9

tggcaatttaccagcacagcaattgctggc	CRISPR spacer
tggcaattcaccagcacagcgattgctggt	Protospacer
********.***********.********.

71. spacer 2.16|745017|30|NC_013928|CRISPRCasFinder,CRT matches to NC_029030 (Streptococcus phage APCM01, complete genome) position: , mismatch: 3, identity: 0.9

caggtttcatcttaggaaacgtattgatga	CRISPR spacer
caggtttcattttaggaaacgtgttgataa	Protospacer
**********.***********.*****.*

72. spacer 2.17|745083|30|NC_013928|CRISPRCasFinder,CRT matches to AM749121 (Streptococcus phage M102 complete genome) position: , mismatch: 3, identity: 0.9

gcttgaatataattgtgtatccgccaatga	CRISPR spacer
gcttggatataattgtgtatccgccagtgc	Protospacer
*****.********************.**

73. spacer 2.17|745083|30|NC_013928|CRISPRCasFinder,CRT matches to NC_012884 (Streptococcus phage M102, complete genome) position: , mismatch: 3, identity: 0.9

gcttgaatataattgtgtatccgccaatga	CRISPR spacer
gcttggatataattgtgtatccgccagtgc	Protospacer
*****.********************.**

74. spacer 2.17|745083|30|NC_013928|CRISPRCasFinder,CRT matches to DQ386162 (Streptococcus phage M102AD, complete genome) position: , mismatch: 3, identity: 0.9

gcttgaatataattgtgtatccgccaatga	CRISPR spacer
gcttggatataattgtgtatccgccagtgc	Protospacer
*****.********************.**

75. spacer 2.23|745479|30|NC_013928|CRISPRCasFinder,CRT matches to AM749121 (Streptococcus phage M102 complete genome) position: , mismatch: 3, identity: 0.9

aaaaagaaacgccttttgatttgaccaatc	CRISPR spacer
aaaaagaaacgccttttgatttaacaaacc	Protospacer
**********************.** **.*

76. spacer 2.23|745479|30|NC_013928|CRISPRCasFinder,CRT matches to NC_012884 (Streptococcus phage M102, complete genome) position: , mismatch: 3, identity: 0.9

aaaaagaaacgccttttgatttgaccaatc	CRISPR spacer
aaaaagaaacgccttttgatttaacaaacc	Protospacer
**********************.** **.*

77. spacer 2.23|745479|30|NC_013928|CRISPRCasFinder,CRT matches to DQ386162 (Streptococcus phage M102AD, complete genome) position: , mismatch: 3, identity: 0.9

aaaaagaaacgccttttgatttgaccaatc	CRISPR spacer
agaaagaaacgccttttgatttaaccaacc	Protospacer
*.********************.*****.*

78. spacer 2.30|745941|30|NC_013928|CRISPRCasFinder,CRT matches to MT430910 (Streptococcus phage smHBZ8, complete genome) position: , mismatch: 3, identity: 0.9

cggatatagcctagcatataatcgcgtgtg	CRISPR spacer
cggatatagcctaacatataatcgcgcgtc	Protospacer
*************.************.**

79. spacer 2.48|747130|30|NC_013928|CRISPRCasFinder,CRT,PILER-CR matches to AM749121 (Streptococcus phage M102 complete genome) position: , mismatch: 3, identity: 0.9

agagtatagccagtgttttcaaggccttta	CRISPR spacer
agagtatagccagcgttttcaagaccttca	Protospacer
*************.*********.****.*

80. spacer 2.48|747130|30|NC_013928|CRISPRCasFinder,CRT,PILER-CR matches to NC_012884 (Streptococcus phage M102, complete genome) position: , mismatch: 3, identity: 0.9

agagtatagccagtgttttcaaggccttta	CRISPR spacer
agagtatagccagcgttttcaagaccttca	Protospacer
*************.*********.****.*

81. spacer 2.49|747196|30|NC_013928|CRISPRCasFinder,CRT,PILER-CR matches to MT430910 (Streptococcus phage smHBZ8, complete genome) position: , mismatch: 3, identity: 0.9

cgcaacaatgactattaatatcaacggtgg	CRISPR spacer
tgcaacaatgaccattaatattaacggtgg	Protospacer
.***********.********.********

82. spacer 2.60|747922|30|NC_013928|CRISPRCasFinder,CRT,PILER-CR matches to NC_029030 (Streptococcus phage APCM01, complete genome) position: , mismatch: 3, identity: 0.9

aaatgctcttgaagaacctgatagatgaca	CRISPR spacer
aaatgctcttgaagaacttgatagacgata	Protospacer
*****************.*******.**.*

83. spacer 1.10|644857|33|NC_013928|PILER-CR matches to MT430910 (Streptococcus phage smHBZ8, complete genome) position: , mismatch: 4, identity: 0.879

ccggctgacaagcctaaaattgttaatgttttc	CRISPR spacer
ctagctgataaacctaaaattgttaatgttttc	Protospacer
*..*****.**.*********************

84. spacer 1.28|644858|32|NC_013928|CRISPRCasFinder,CRT matches to MT430910 (Streptococcus phage smHBZ8, complete genome) position: , mismatch: 4, identity: 0.875

cggctgacaagcctaaaattgttaatgttttc	CRISPR spacer
tagctgataaacctaaaattgttaatgttttc	Protospacer
..*****.**.*********************

85. spacer 2.7|744423|30|NC_013928|CRISPRCasFinder,CRT matches to NC_029030 (Streptococcus phage APCM01, complete genome) position: , mismatch: 4, identity: 0.867

gttgcttatgcagatgataacacaggcgca	CRISPR spacer
attgcttatgcagatgatgacaaaggcgct	Protospacer
.*****************.*** ******

86. spacer 2.7|744423|30|NC_013928|CRISPRCasFinder,CRT matches to MT430910 (Streptococcus phage smHBZ8, complete genome) position: , mismatch: 4, identity: 0.867

gttgcttatgcagatgataacacaggcgca	CRISPR spacer
atagcttatgctgatgatgacacaggcgca	Protospacer
.* ******** ******.***********

87. spacer 2.13|744819|30|NC_013928|CRISPRCasFinder,CRT matches to AM749121 (Streptococcus phage M102 complete genome) position: , mismatch: 4, identity: 0.867

tggcaatttaccagcacagcaattgctggc	CRISPR spacer
tggcaattcaccagcacagcgattgctagt	Protospacer
********.***********.******.*.

88. spacer 2.13|744819|30|NC_013928|CRISPRCasFinder,CRT matches to NC_012884 (Streptococcus phage M102, complete genome) position: , mismatch: 4, identity: 0.867

tggcaatttaccagcacagcaattgctggc	CRISPR spacer
tggcaattcaccagcacagcgattgctagt	Protospacer
********.***********.******.*.

89. spacer 2.13|744819|30|NC_013928|CRISPRCasFinder,CRT matches to DQ386162 (Streptococcus phage M102AD, complete genome) position: , mismatch: 4, identity: 0.867

tggcaatttaccagcacagcaattgctggc	CRISPR spacer
tggcaattcaccagcacagcgattgctagt	Protospacer
********.***********.******.*.

90. spacer 2.33|746139|30|NC_013928|CRISPRCasFinder,CRT matches to AM749121 (Streptococcus phage M102 complete genome) position: , mismatch: 4, identity: 0.867

gtttgcttttgtttttgccttgtgtgtttc	CRISPR spacer
gtccgctttagtttttgctttgtgtgtttc	Protospacer
**..***** ********.***********

91. spacer 2.33|746139|30|NC_013928|CRISPRCasFinder,CRT matches to NC_012884 (Streptococcus phage M102, complete genome) position: , mismatch: 4, identity: 0.867

gtttgcttttgtttttgccttgtgtgtttc	CRISPR spacer
gtccgctttagtttttgctttgtgtgtttc	Protospacer
**..***** ********.***********

92. spacer 2.33|746139|30|NC_013928|CRISPRCasFinder,CRT matches to DQ386162 (Streptococcus phage M102AD, complete genome) position: , mismatch: 4, identity: 0.867

gtttgcttttgtttttgccttgtgtgtttc	CRISPR spacer
gtccgctttagtttttgctttgtgtgtttc	Protospacer
**..***** ********.***********

93. spacer 2.41|746667|30|NC_013928|CRISPRCasFinder,CRT matches to KX853513 (Uncultured virus isolate Rctr41k, partial genome) position: , mismatch: 4, identity: 0.867

tgacggaaacagagacggaacggca-actgt	CRISPR spacer
tgacgcaaacagagacggaactacatactg-	Protospacer
***** *************** .** ****

94. spacer 2.62|748054|30|NC_013928|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP015592 (Bacillus cereus strain AR156 plasmid pAR460, complete sequence) position: , mismatch: 4, identity: 0.867

tattaaattacttgtaattacaaagcctaa-	CRISPR spacer
tattaaataacttgtaatta-aaaacttaat	Protospacer
******** *********** ***.*.***

95. spacer 2.64|748186|30|NC_013928|CRISPRCasFinder,CRT,PILER-CR matches to DQ386162 (Streptococcus phage M102AD, complete genome) position: , mismatch: 4, identity: 0.867

tagagctcttagttttttacgcgttgggcc	CRISPR spacer
tggagctcttaattttttacgcgtcgggtc	Protospacer
*.*********.************.***.*

96. spacer 1.10|644857|33|NC_013928|PILER-CR matches to AM749121 (Streptococcus phage M102 complete genome) position: , mismatch: 5, identity: 0.848

ccggctgacaagcctaaaattgttaatgttttc	CRISPR spacer
ctagctgacaaacctaaaattgctaatgttttt	Protospacer
*..********.**********.*********.

97. spacer 1.10|644857|33|NC_013928|PILER-CR matches to NC_012884 (Streptococcus phage M102, complete genome) position: , mismatch: 5, identity: 0.848

ccggctgacaagcctaaaattgttaatgttttc	CRISPR spacer
ctagctgacaaacctaaaattgctaatgttttt	Protospacer
*..********.**********.*********.

98. spacer 1.10|644857|33|NC_013928|PILER-CR matches to DQ386162 (Streptococcus phage M102AD, complete genome) position: , mismatch: 5, identity: 0.848

ccggctgacaagcctaaaattgttaatgttttc	CRISPR spacer
ctagctgacaaacctaaaattgctaatgttttt	Protospacer
*..********.**********.*********.

99. spacer 1.28|644858|32|NC_013928|CRISPRCasFinder,CRT matches to AM749121 (Streptococcus phage M102 complete genome) position: , mismatch: 5, identity: 0.844

cggctgacaagcctaaaattgttaatgttttc	CRISPR spacer
tagctgacaaacctaaaattgctaatgttttt	Protospacer
..********.**********.*********.

100. spacer 1.28|644858|32|NC_013928|CRISPRCasFinder,CRT matches to NC_012884 (Streptococcus phage M102, complete genome) position: , mismatch: 5, identity: 0.844

cggctgacaagcctaaaattgttaatgttttc	CRISPR spacer
tagctgacaaacctaaaattgctaatgttttt	Protospacer
..********.**********.*********.

101. spacer 1.28|644858|32|NC_013928|CRISPRCasFinder,CRT matches to DQ386162 (Streptococcus phage M102AD, complete genome) position: , mismatch: 5, identity: 0.844

cggctgacaagcctaaaattgttaatgttttc	CRISPR spacer
tagctgacaaacctaaaattgctaatgttttt	Protospacer
..********.**********.*********.

102. spacer 2.5|744291|30|NC_013928|PILER-CR,CRISPRCasFinder,CRT matches to NC_018686 (Bacillus thuringiensis MC28 plasmid pMC183, complete sequence) position: , mismatch: 5, identity: 0.833

taatacttcctcaattataaattcaattct--	CRISPR spacer
caattcttcctcaataataaattc--ttctag	Protospacer
.*** ********** ********  ****

103. spacer 2.13|744819|30|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP032703 (Pantoea dispersa strain DSM 32899 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

--tggcaatttaccagcacagcaattgctggc	CRISPR spacer
ggtggcg--ttacccgcacagctattgctggc	Protospacer
  ****.  ***** ******* *********

104. spacer 2.27|745743|30|NC_013928|CRISPRCasFinder,CRT matches to MT084350 (Xylella phage Xfas53, complete genome) position: , mismatch: 5, identity: 0.833

cgttactg-gtgttcacggcgacagcatgga	CRISPR spacer
-gctgatgcgtgtgcacggcgacagcatgga	Protospacer
 *.*. ** **** *****************

105. spacer 2.61|747988|30|NC_013928|CRISPRCasFinder,CRT,PILER-CR matches to NC_010096 (Streptococcus agalactiae plasmid pMV158, complete sequence) position: , mismatch: 5, identity: 0.833

tcagataaagatttttttggaaagtacaat	CRISPR spacer
tctgataaagatttttttgaaaagttggat	Protospacer
** ****************.*****  .**

106. spacer 2.61|747988|30|NC_013928|CRISPRCasFinder,CRT,PILER-CR matches to HG796317 (Uncultured bacterium plasmid pRGI00402) position: , mismatch: 5, identity: 0.833

tcagataaagatttttttggaaagtacaat	CRISPR spacer
tctgataaagatttttttgaaaagttggat	Protospacer
** ****************.*****  .**

107. spacer 1.3|644429|33|NC_013928|PILER-CR matches to NC_029030 (Streptococcus phage APCM01, complete genome) position: , mismatch: 6, identity: 0.818

tgcttggaaagattgaccacacagggtcaggcg	CRISPR spacer
tagatggaaagattgaccacacggggtcgggag	Protospacer
*.  ******************.*****.** *

108. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP023350 (Escherichia coli strain ETEC-2264 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.818

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caaccacaacagccacaacagccacaacagcca	Protospacer
**.*. *******.********.********.*

109. spacer 1.5|644551|33|NC_013928|PILER-CR matches to MG592390 (Vibrio phage 1.003.O._10N.286.48.A2, partial genome) position: , mismatch: 6, identity: 0.818

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caataccaacagcaacaacagcaacaacagcca	Protospacer
**.. ******** ******** ********.*

110. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP051696 (Escherichia coli strain SCU-313 plasmid pSCU-313-2, complete sequence) position: , mismatch: 6, identity: 0.818

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caaccacaacagccacaacagccacaacagcca	Protospacer
**.*. *******.********.********.*

111. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_MG515250 (Escherichia coli strain 16-50 plasmid pNDM-EC16-50, complete sequence) position: , mismatch: 6, identity: 0.818

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctcaacagccacaacagccacaacagcca	Protospacer
*** ..*******.********.********.*

112. spacer 1.21|644430|32|NC_013928|CRISPRCasFinder,CRT matches to NC_029030 (Streptococcus phage APCM01, complete genome) position: , mismatch: 6, identity: 0.812

gcttggaaagattgaccacacagggtcaggcg	CRISPR spacer
agatggaaagattgaccacacggggtcgggag	Protospacer
.  ******************.*****.** *

113. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP023350 (Escherichia coli strain ETEC-2264 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.812

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aaccacaacagccacaacagccacaacagcca	Protospacer
*.*. *******.********.********.*

114. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP051696 (Escherichia coli strain SCU-313 plasmid pSCU-313-2, complete sequence) position: , mismatch: 6, identity: 0.812

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aaccacaacagccacaacagccacaacagcca	Protospacer
*.*. *******.********.********.*

115. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_KX008967 (Shigella sonnei strain 183660 plasmid p183660, complete sequence) position: , mismatch: 6, identity: 0.812

agctccaacagctacaacagctacaacagcta	CRISPR spacer
-gccacaacagccacaacagccacaacagcca	Protospacer
 **. *******.********.********.*

116. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to MN823989 (Klebsiella pneumoniae strain 283149 plasmid p283149-FII, complete sequence) position: , mismatch: 6, identity: 0.812

-agctccaacagctacaacagctacaacagcta	CRISPR spacer
cagccac-acagccacaacagccacaacagcca	Protospacer
 ***. * *****.********.********.*

117. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_MG515250 (Escherichia coli strain 16-50 plasmid pNDM-EC16-50, complete sequence) position: , mismatch: 6, identity: 0.812

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctcaacagccacaacagccacaacagcca	Protospacer
** ..*******.********.********.*

118. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_MG288681 (Klebsiella aerogenes strain E20 plasmid pE20-FIIA, complete sequence) position: , mismatch: 6, identity: 0.812

agctccaacagctacaacagctacaacagcta	CRISPR spacer
agccagaacagccacaacagccacaacagcca	Protospacer
***.  ******.********.********.*

119. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to MG592390 (Vibrio phage 1.003.O._10N.286.48.A2, partial genome) position: , mismatch: 6, identity: 0.812

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aataccaacagcaacaacagcaacaacagcca	Protospacer
*.. ******** ******** ********.*

120. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to MN694298 (Marine virus AFVG_250M557, complete genome) position: , mismatch: 6, identity: 0.812

agctccaacagctacaacagctacaacagcta	CRISPR spacer
tgcaacaacagcaacaacagcaacaacagcaa	Protospacer
 **  ******* ******** ******** *

121. spacer 2.2|744093|30|NC_013928|PILER-CR,CRISPRCasFinder,CRT matches to NC_047962 (Xanthomonas phage Carpasina, complete genome) position: , mismatch: 6, identity: 0.8

gattgtgcccgctagtaaaccgcctcgcgc	CRISPR spacer
gaaactgcccgcaagtaaatcgcctcgcgg	Protospacer
**   ******* ******.*********

122. spacer 2.9|744555|30|NC_013928|CRISPRCasFinder,CRT matches to NC_007491 (Rhodococcus erythropolis PR4 plasmid pREL1, complete sequence) position: , mismatch: 6, identity: 0.8

attgtcaatcgccgttctgcgcttgcgacg-	CRISPR spacer
tgggtcaatcgccgctctgcgctggc-acgt	Protospacer
   ***********.******** ** ***

123. spacer 2.11|744687|30|NC_013928|CRISPRCasFinder,CRT matches to NC_025440 (Listeria phage WIL-1, complete genome) position: , mismatch: 6, identity: 0.8

tcattgctcttgacatcaataactttttca	CRISPR spacer
acaaagctcttcacatcaataactatttcg	Protospacer
 **  ****** ************ ****.

124. spacer 2.11|744687|30|NC_013928|CRISPRCasFinder,CRT matches to MK792752 (UNVERIFIED: Listera phage vB-LmoM-SH3-3, complete genome) position: , mismatch: 6, identity: 0.8

tcattgctcttgacatcaataactttttca	CRISPR spacer
acaaagctcttcacatcaataactatttcg	Protospacer
 **  ****** ************ ****.

125. spacer 2.11|744687|30|NC_013928|CRISPRCasFinder,CRT matches to KJ535721 (Listeria phage List-36, complete genome) position: , mismatch: 6, identity: 0.8

tcattgctcttgacatcaataactttttca	CRISPR spacer
acaaagctcttcacatcaataactatttcg	Protospacer
 **  ****** ************ ****.

126. spacer 2.11|744687|30|NC_013928|CRISPRCasFinder,CRT matches to KT319598 (UNVERIFIED: Listeria phage WIL-2 genomic sequence) position: , mismatch: 6, identity: 0.8

tcattgctcttgacatcaataactttttca	CRISPR spacer
acaaagctcttcacatcaataactatttcg	Protospacer
 **  ****** ************ ****.

127. spacer 2.11|744687|30|NC_013928|CRISPRCasFinder,CRT matches to MN172529 (Listeria phage LP-039, complete genome) position: , mismatch: 6, identity: 0.8

tcattgctcttgacatcaataactttttca	CRISPR spacer
acaaagctcttcacatcaataactatttcg	Protospacer
 **  ****** ************ ****.

128. spacer 2.11|744687|30|NC_013928|CRISPRCasFinder,CRT matches to MT668624 (Listeria phage LP-Mix_6.2, complete genome) position: , mismatch: 6, identity: 0.8

tcattgctcttgacatcaataactttttca	CRISPR spacer
acaaagctcttcacatcaataactatttcg	Protospacer
 **  ****** ************ ****.

129. spacer 2.11|744687|30|NC_013928|CRISPRCasFinder,CRT matches to MT178766 (Listeria virus P100plus, complete genome) position: , mismatch: 6, identity: 0.8

tcattgctcttgacatcaataactttttca	CRISPR spacer
acaaagctcttcacatcaataactatttcg	Protospacer
 **  ****** ************ ****.

130. spacer 2.11|744687|30|NC_013928|CRISPRCasFinder,CRT matches to MT178767 (Listeria virus P200, complete genome) position: , mismatch: 6, identity: 0.8

tcattgctcttgacatcaataactttttca	CRISPR spacer
acaaagctcttcacatcaataactatttcg	Protospacer
 **  ****** ************ ****.

131. spacer 2.11|744687|30|NC_013928|CRISPRCasFinder,CRT matches to DQ004855 (Listeria bacteriophage P100, complete genome) position: , mismatch: 6, identity: 0.8

tcattgctcttgacatcaataactttttca	CRISPR spacer
acaaagctcttcacatcaataactatttcg	Protospacer
 **  ****** ************ ****.

132. spacer 2.11|744687|30|NC_013928|CRISPRCasFinder,CRT matches to KJ591604 (Listeria phage LMTA-148, complete genome) position: , mismatch: 6, identity: 0.8

tcattgctcttgacatcaataactttttca	CRISPR spacer
acaaagctcttcacatcaataactatttcg	Protospacer
 **  ****** ************ ****.

133. spacer 2.11|744687|30|NC_013928|CRISPRCasFinder,CRT matches to KJ094033 (Listeria phage LP-048, complete genome) position: , mismatch: 6, identity: 0.8

tcattgctcttgacatcaataactttttca	CRISPR spacer
acaaagctcttcacatcaataactatttcg	Protospacer
 **  ****** ************ ****.

134. spacer 2.11|744687|30|NC_013928|CRISPRCasFinder,CRT matches to MN128594 (Listeria phage LP-066, complete genome) position: , mismatch: 6, identity: 0.8

tcattgctcttgacatcaataactttttca	CRISPR spacer
acaaagctcttcacatcaataactatttcg	Protospacer
 **  ****** ************ ****.

135. spacer 2.11|744687|30|NC_013928|CRISPRCasFinder,CRT matches to NC_041862 (Listeria phage LP-064, complete genome) position: , mismatch: 6, identity: 0.8

tcattgctcttgacatcaataactttttca	CRISPR spacer
acaaagctcttcacatcaataactatttcg	Protospacer
 **  ****** ************ ****.

136. spacer 2.11|744687|30|NC_013928|CRISPRCasFinder,CRT matches to KJ094030 (Listeria phage LP-083-2, complete genome) position: , mismatch: 6, identity: 0.8

tcattgctcttgacatcaataactttttca	CRISPR spacer
acaaagctcttcacatcaataactatttcg	Protospacer
 **  ****** ************ ****.

137. spacer 2.11|744687|30|NC_013928|CRISPRCasFinder,CRT matches to JX126918 (Listeria phage LP-125, complete genome) position: , mismatch: 6, identity: 0.8

tcattgctcttgacatcaataactttttca	CRISPR spacer
acaaagctcttcacatcaataactatttcg	Protospacer
 **  ****** ************ ****.

138. spacer 2.11|744687|30|NC_013928|CRISPRCasFinder,CRT matches to KJ094031 (Listeria phage LP-124, complete genome) position: , mismatch: 6, identity: 0.8

tcattgctcttgacatcaataactttttca	CRISPR spacer
acaaagctcttcacatcaataactatttcg	Protospacer
 **  ****** ************ ****.

139. spacer 2.11|744687|30|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP026738 (Bacillus megaterium strain YC4-R4 plasmid unnamed2) position: , mismatch: 6, identity: 0.8

tcattgctcttgacatcaataactttttca	CRISPR spacer
tcattgctcttgacttcaatatttgctcca	Protospacer
************** ****** .* .*.**

140. spacer 2.17|745083|30|NC_013928|CRISPRCasFinder,CRT matches to MK448895 (Streptococcus phage Javan274, complete genome) position: , mismatch: 6, identity: 0.8

gcttgaatataattgtgtatccgccaatga	CRISPR spacer
gaacgaatatagttgtgtatgcgccaatgc	Protospacer
*  .*******.******** ********

141. spacer 2.18|745149|30|NC_013928|CRISPRCasFinder,CRT matches to DQ386162 (Streptococcus phage M102AD, complete genome) position: , mismatch: 6, identity: 0.8

accttgtggtccgtcttctccgccactttc	CRISPR spacer
accttgaggaccgtcttctccgcctgactc	Protospacer
****** ** **************   .**

142. spacer 2.20|745281|30|NC_013928|CRISPRCasFinder,CRT matches to NC_005871 (Photobacterium profundum SS9 plasmid pPBPR1, complete sequence) position: , mismatch: 6, identity: 0.8

gattaaaaacatagatgaaaacggctattt	CRISPR spacer
ggtgaaaaacaaagatgaaaacggcttcct	Protospacer
*.* ******* ************** ..*

143. spacer 2.23|745479|30|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP013578 (Rhizobium phaseoli strain N671 plasmid pRphaN671d, complete sequence) position: , mismatch: 6, identity: 0.8

aaaaagaaacgccttttgatttga--ccaatc	CRISPR spacer
aaaaagaaacgccttctgattcaacgccag--	Protospacer
***************.*****..*  ***.

144. spacer 2.23|745479|30|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP013572 (Rhizobium phaseoli strain N771 plasmid pRphaN671d, complete sequence) position: , mismatch: 6, identity: 0.8

aaaaagaaacgccttttgatttga--ccaatc	CRISPR spacer
aaaaagaaacgccttctgattcaacgccag--	Protospacer
***************.*****..*  ***.

145. spacer 2.33|746139|30|NC_013928|CRISPRCasFinder,CRT matches to MH616851 (Microviridae sp. isolate ctbg673, complete genome) position: , mismatch: 6, identity: 0.8

gtttgcttttgtttttgccttgtgtgtttc	CRISPR spacer
gtttgcttttgtagttgccttgtgagataa	Protospacer
************  ********** * *

146. spacer 2.40|746601|30|NC_013928|CRISPRCasFinder,CRT matches to MT430910 (Streptococcus phage smHBZ8, complete genome) position: , mismatch: 6, identity: 0.8

tgcaagttatcttgctatgtggacgaattg	CRISPR spacer
ctcagcttatctcgctatgtggaccaattg	Protospacer
. **. ******.*********** *****

147. spacer 2.48|747130|30|NC_013928|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP025613 (Niveispirillum cyanobacteriorum strain TH16 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

agagtatagccagtgttttcaaggccttta	CRISPR spacer
gcagcatagccagtgtgttcaaggcctgtg	Protospacer
. **.*********** ********** *.

148. spacer 2.62|748054|30|NC_013928|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP026317 (Vibrio campbellii strain BoB-90 plasmid unnamed 1, complete sequence) position: , mismatch: 6, identity: 0.8

---tattaaattacttgtaattacaaagcctaa	CRISPR spacer
gatcgttaa---acttgtaattacaaaccctaa	Protospacer
   ..****   *************** *****

149. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_KX928752 (Klebsiella pneumoniae strain CRKP-59-KPC plasmid pCRKP-59-KPC, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

150. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NC_017627 (Escherichia coli 042 plasmid pAA, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

151. spacer 1.5|644551|33|NC_013928|PILER-CR matches to AP018456 (Escherichia coli O25b:H4-ST131 plasmid pMRY09-581ECO_1 MRY09-581 DNA, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

152. spacer 1.5|644551|33|NC_013928|PILER-CR matches to AP018457 (Escherichia coli O25b:H4-ST131 plasmid pMRY09-592ECO_1 MRY09-592 DNA, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

153. spacer 1.5|644551|33|NC_013928|PILER-CR matches to AP018458 (Escherichia coli O25b:H4-ST131 plasmid pMRY09-597ECO_1 MRY09-597 DNA, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

154. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_LR213453 (Shigella flexneri strain AUSMDU00008355 isolate AUSMDU00008355 plasmid 2) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

155. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_KT988018 (Escherichia coli strain V282 plasmid pEcoV282, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

156. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP015077 (Escherichia coli strain Ecol_448 plasmid pEC448_1, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

157. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP015070 (Escherichia coli strain Ecol_743 plasmid pEC743_1, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

158. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP015072 (Escherichia coli strain Ecol_743 plasmid pEC743_3, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

159. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_KT845955 (Escherichia coli strain EP28 plasmid pHNEP28_cfr, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

160. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP041339 (Escherichia coli strain CCUG 73778 plasmid pSUH-2, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

161. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP035517 (Escherichia coli strain U14A plasmid pU14A_A, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

162. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP035518 (Escherichia coli strain U14A plasmid pU14A_B, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

163. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP040995 (Klebsiella pneumoniae strain FDAARGOS_775 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

164. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_LR130565 (Escherichia coli strain MS14387 isolate MS14387 plasmid 2) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

165. spacer 1.5|644551|33|NC_013928|PILER-CR matches to CP022460 (Shigella sonnei strain 2015C-3807 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

166. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP025857 (Escherichia coli strain 504838 plasmid p504838_108, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

167. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP035478 (Escherichia coli strain U13A plasmid pU13A_A, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

168. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP034401 (Escherichia coli strain CRE10 plasmid pCRE10.1, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

169. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP014493 (Escherichia coli strain MVAST0167 plasmid pMVAST0167_1, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

170. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_KT754164 (Shigella dysenteriae 1 strain 3099-85 plasmid p3099-85, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

171. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP011135 (Escherichia coli VR50 plasmid pVR50A, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

172. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP011136 (Escherichia coli VR50 plasmid pVR50B, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

173. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP048338 (Escherichia coli strain 142 plasmid p142_A-OXA181, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

174. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_LS992188 (Escherichia coli isolate Escherichia coli str. 3426 plasmid 4, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

175. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_LS992188 (Escherichia coli isolate Escherichia coli str. 3426 plasmid 4, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

176. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP053732 (Escherichia coli strain CP55_Sichuan plasmid pCP55-IncFIB, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

177. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP021289 (Escherichia coli strain PA45B plasmid pPA45B, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

178. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP029734 (Citrobacter sp. CRE-46 strain AR_0157 plasmid unnamed6, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

179. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_LN824138 (Klebsiella pneumoniae genome assembly MS6671.v1, plasmid : _Plasmid_E_Kpneumoniae_MS6671) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

180. spacer 1.5|644551|33|NC_013928|PILER-CR matches to MT077882 (Escherichia coli plasmid p4, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

181. spacer 1.5|644551|33|NC_013928|PILER-CR matches to MT077887 (Escherichia coli plasmid p62, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

182. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_LS992181 (Escherichia coli isolate Escherichia coli str. TO124 plasmid 2, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

183. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_LR213457 (Shigella flexneri strain AUSMDU00008332 isolate AUSMDU00008332 plasmid 3) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

184. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP044156 (Shigella flexneri strain AR-0424 plasmid pAR-0424-1, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

185. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_LR130556 (Escherichia coli strain MS14385 isolate MS14385 plasmid 2) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

186. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP026724 (Escherichia coli strain 266917_2 plasmid p266917_2_01, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

187. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP020517 (Escherichia coli strain 222 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

188. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP030770 (Escherichia coli strain 2017C-4173W12 plasmid p2017C-4173W12, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

189. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP031548 (Escherichia coli strain cq9 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

190. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP045279 (Escherichia coli strain LAU-OXA plasmid pLAU-OXA2, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

191. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP027375 (Escherichia coli strain 05-3629 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

192. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP023350 (Escherichia coli strain ETEC-2264 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

193. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP023351 (Escherichia coli strain ETEC-2264 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

194. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP027385 (Escherichia coli strain 2013C-3250 plasmid unnamed5, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

195. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP012632 (Escherichia coli strain SF-173 plasmid pSF-173-1, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

196. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP015160 (Escherichia coli strain Eco889 plasmid pECO-fce, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

197. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP015160 (Escherichia coli strain Eco889 plasmid pECO-fce, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

198. spacer 1.5|644551|33|NC_013928|PILER-CR matches to CP045525 (Shigella sonnei strain 6904.27 plasmid p6904-27) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

199. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP029580 (Escherichia coli strain DA33137 plasmid pDA33137-178, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

200. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP014498 (Escherichia coli strain ZH193 plasmid pZH193, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

201. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP053248 (Escherichia coli strain SCU-482 plasmid pSCU-482-1, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

202. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP013834 (Escherichia coli strain JJ2434 plasmid pJJ2434_2, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

203. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP028193 (Escherichia coli strain CFSAN018748 plasmid pGMI14-004_2, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

204. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP011019 (Escherichia coli strain CI5 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

205. spacer 1.5|644551|33|NC_013928|PILER-CR matches to CP053755 (Shigella sonnei strain 506 plasmid pMHMC-004, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

206. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP015131 (Klebsiella pneumoniae strain Kpn555 plasmid pKPN-7c3, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

207. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP010123 (Escherichia coli strain C5 plasmid A, complete genome) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

208. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP034932 (Shigella flexneri strain 2013C-3749 plasmid p2013C-3749-1, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

209. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP010181 (Escherichia coli strain M1 plasmid A, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

210. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP008715 (Escherichia coli strain ST648 plasmid pEC648_1, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

211. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP024836 (Klebsiella pneumoniae strain CRKP-2297 plasmid pCRKP-2297_2, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

212. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP021210 (Escherichia coli strain strain Z247 plasmid p2474-NDM1, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

213. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP035468 (Escherichia coli strain U12A plasmid pU12A_A, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

214. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP051701 (Escherichia coli strain SCU-125 plasmid pSCU-125-1, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

215. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP029104 (Escherichia coli strain AR437 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

216. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP033159 (Escherichia coli strain CM IVRI KOL-1 plasmid p1ESCUMpO83_CORR) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

217. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP051689 (Escherichia coli strain SCU-387 plasmid pSCU-387-1, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

218. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP051690 (Escherichia coli strain SCU-387 plasmid pSCU-387-2, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

219. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP051739 (Escherichia coli strain SCU-105 plasmid pSCU-105-1, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

220. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP051739 (Escherichia coli strain SCU-105 plasmid pSCU-105-1, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

221. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP051726 (Escherichia coli strain SCU-112 plasmid pSCU-112-1, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

222. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP051721 (Escherichia coli strain SCU-116 plasmid pSCU-116-2, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

223. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP021690 (Escherichia coli strain AR_0058 plasmid tig00007555j7554, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

224. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP009860 (Escherichia coli strain ECONIH1 plasmid pECO-824, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

225. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP017852 (Klebsiella variicola strain GJ2 plasmid pKPGJ-2c, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

226. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP024150 (Escherichia coli strain 14EC033 plasmid p14EC033c, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

227. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_LR025102 (Escherichia coli isolate EC-1639 plasmid 2, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

228. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP051734 (Escherichia coli strain SCU-109 plasmid pSCU-109-1, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

229. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP024258 (Escherichia coli O25:H16 strain F5505-C1 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

230. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP024840 (Klebsiella pneumoniae strain CRKP-1215 plasmid pCRKP-1215_2, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

231. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP027536 (Escherichia coli strain AR_0081 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

232. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP027537 (Escherichia coli strain AR_0081 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

233. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP042879 (Escherichia coli strain NMBU_W05E18 plasmid pNMBU-W05E18_01, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

234. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP024241 (Escherichia coli O114:H49 strain 90-9280 plasmid unnamed1) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

235. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP024242 (Escherichia coli O114:H49 strain 90-9280 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

236. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP019076 (Escherichia coli strain CRE1493 plasmid p1493-5, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

237. spacer 1.5|644551|33|NC_013928|PILER-CR matches to CP025927 (Escherichia coli strain 520873 plasmid p520873_29, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

238. spacer 1.5|644551|33|NC_013928|PILER-CR matches to CP025880 (Escherichia coli strain 503458 plasmid p503458_46, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

239. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP027458 (Escherichia coli strain 88-3493 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

240. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP016498 (Escherichia coli strain UPEC 26-1 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

241. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP024238 (Escherichia coli O15:H11 strain 90-9272 plasmid unnamed) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

242. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP024238 (Escherichia coli O15:H11 strain 90-9272 plasmid unnamed) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

243. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP024430 (Klebsiella pneumoniae strain DA48896 plasmid p48896_1, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

244. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP024237 (Escherichia coli O6:H16 strain 2014EL-1346-6 plasmid unnamed5, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

245. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP050367 (Klebsiella pneumoniae strain 47733 plasmid p47733_NDM_5, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

246. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP018973 (Escherichia coli strain Ecol_545 plasmid pEC545_3, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

247. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP026158 (Klebsiella pneumoniae strain F93-2 plasmid pF93-2_1, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

248. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_LS992194 (Escherichia coli isolate Escherichia coli str. TO217 plasmid 3, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

249. spacer 1.5|644551|33|NC_013928|PILER-CR matches to CP049174 (Shigella sonnei strain 19.0820.1561 plasmid p19-0820-1561, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

250. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP023959 (Escherichia coli strain FDAARGOS_448 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

251. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP043407 (Escherichia coli strain NMBU-W13E19 plasmid pNMBU-W13E19_01, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

252. spacer 1.5|644551|33|NC_013928|PILER-CR matches to CP054450 (Escherichia coli strain SCU-488 plasmid pSCU-488-1, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

253. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NC_013507 (Escherichia coli ETEC H10407 plasmid pEntH10407, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

254. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP011418 (Escherichia coli strain CFSAN029787 plasmid pCFSAN029787_02, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

255. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP048648 (Escherichia coli strain GW-AmxH19 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

256. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP034396 (Escherichia coli strain CRE1 plasmid pCRE1.1, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

257. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP035722 (Escherichia coli strain U15A plasmid pU15A_B, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

258. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP050384 (Escherichia coli strain 52148 plasmid p52148_NDM_5, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

259. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP024268 (Escherichia coli O6:H16 strain F6699 plasmid unnamed2) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

260. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NC_013542 (Klebsiella pneumoniae plasmid pKF3-70, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

261. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP010239 (Escherichia coli strain S50 plasmid A, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

262. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP021871 (Escherichia coli strain H105 plasmid pH105, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

263. spacer 1.5|644551|33|NC_013928|PILER-CR matches to MN823989 (Klebsiella pneumoniae strain 283149 plasmid p283149-FII, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

264. spacer 1.5|644551|33|NC_013928|PILER-CR matches to CP049172 (Shigella sonnei strain 0401930105 plasmid p0401930105) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

265. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP043949 (Escherichia coli strain AR202.2 plasmid pMPCMY-2, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

266. spacer 1.5|644551|33|NC_013928|PILER-CR matches to CP049168 (Shigella sonnei strain 09163633 plasmid p09163633, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

267. spacer 1.5|644551|33|NC_013928|PILER-CR matches to AP023220 (Escherichia coli M505 plasmid pM505-NDM5 DNA, complete genome) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

268. spacer 1.5|644551|33|NC_013928|PILER-CR matches to AP023221 (Escherichia coli M505 plasmid pM505-a DNA, complete genome) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

269. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP014112 (Escherichia coli strain FDAARGOS_144 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

270. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP021938 (Escherichia coli strain AR_0055 plasmid unitig_4, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

271. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP024291 (Escherichia coli O178:H19 strain 2012C-4431 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

272. spacer 1.5|644551|33|NC_013928|PILER-CR matches to CP049166 (Shigella sonnei strain 0401952027 plasmid p0401952027, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

273. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP010184 (Escherichia coli strain M3 plasmid A, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

274. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP023164 (Escherichia coli O22:H8 strain RM10809-3 plasmid pRM10809-3, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

275. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP029974 (Escherichia coli strain 51008369SK1 plasmid p51008369SK1_A, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

276. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP050735 (Salmonella enterica subsp. enterica serovar Typhimurium strain ST90 plasmid pST90-1, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

277. spacer 1.5|644551|33|NC_013928|PILER-CR matches to LC520280 (Escherichia coli H0106 plasmid pH0106 DNA, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

278. spacer 1.5|644551|33|NC_013928|PILER-CR matches to LC520281 (Escherichia coli H0130 plasmid pH0130 DNA, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

279. spacer 1.5|644551|33|NC_013928|PILER-CR matches to LC520283 (Escherichia coli I0128 plasmid pI0128 DNA, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

280. spacer 1.5|644551|33|NC_013928|PILER-CR matches to LC520284 (Escherichia coli HP003 plasmid pHP003 DNA, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

281. spacer 1.5|644551|33|NC_013928|PILER-CR matches to LC520285 (Escherichia coli HP030 plasmid pHP030 DNA, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

282. spacer 1.5|644551|33|NC_013928|PILER-CR matches to LC520286 (Escherichia coli HP050 plasmid pHP050 DNA, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

283. spacer 1.5|644551|33|NC_013928|PILER-CR matches to LC520287 (Escherichia coli HP129 plasmid pHP129 DNA, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

284. spacer 1.5|644551|33|NC_013928|PILER-CR matches to LC520289 (Escherichia coli HP243 plasmid pHP243 DNA, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

285. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NC_013951 (Klebsiella pneumoniae plasmid pKF3-140, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

286. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP040454 (Escherichia coli strain UPEC132 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

287. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP015836 (Escherichia coli strain MS6198 plasmid pMS6198B, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

288. spacer 1.5|644551|33|NC_013928|PILER-CR matches to CP049610 (Escherichia coli strain 06-3538 plasmid p06-3538-1) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

289. spacer 1.5|644551|33|NC_013928|PILER-CR matches to CP049615 (Escherichia coli O157:H7 strain K1516 plasmid pK1516-3, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

290. spacer 1.5|644551|33|NC_013928|PILER-CR matches to LC520268 (Escherichia coli C0044 plasmid pC0044 DNA, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

291. spacer 1.5|644551|33|NC_013928|PILER-CR matches to LC520269 (Escherichia coli A0084 plasmid pA0084 DNA, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

292. spacer 1.5|644551|33|NC_013928|PILER-CR matches to LC520270 (Escherichia coli A0086 plasmid pA0086 DNA, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

293. spacer 1.5|644551|33|NC_013928|PILER-CR matches to LC520271 (Escherichia coli A0140 plasmid pA0140 DNA, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

294. spacer 1.5|644551|33|NC_013928|PILER-CR matches to LC520272 (Escherichia coli A0145 plasmid pA0145 DNA, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

295. spacer 1.5|644551|33|NC_013928|PILER-CR matches to LC520273 (Escherichia coli A0150 plasmid pA0150 DNA, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

296. spacer 1.5|644551|33|NC_013928|PILER-CR matches to LC520275 (Escherichia coli C0122 plasmid pC0122 DNA, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

297. spacer 1.5|644551|33|NC_013928|PILER-CR matches to LC520276 (Escherichia coli F0090 plasmid pF0090 DNA, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

298. spacer 1.5|644551|33|NC_013928|PILER-CR matches to LC520277 (Escherichia coli G0138 plasmid pG0138 DNA, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

299. spacer 1.5|644551|33|NC_013928|PILER-CR matches to LC520278 (Escherichia coli H0005 plasmid pH0005 DNA, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

300. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP054355 (Escherichia coli strain SCU-172 plasmid pSCU-172-2, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

301. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP043229 (Escherichia coli strain Ec-050 plasmid pEc-050-CMY-2, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

302. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP033881 (Escherichia coli strain 50579417 plasmid p50579417_4, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

303. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP034214 (Escherichia albertii strain NCTC 9362 plasmid pNCTC_9362) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

304. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP050770 (Salmonella enterica subsp. enterica serovar Indiana strain SI108 plasmid pSI108-1, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

305. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP020340 (Shigella flexneri 4c strain 0702 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

306. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_AP014804 (Escherichia coli O119:H6 strain EC404/03 plasmid pEC404/03-1, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

307. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_LR213461 (Shigella sonnei strain AUSMDU00008333 isolate AUSMDU00008333 plasmid 4) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

308. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP033761 (Escherichia coli strain FDAARGOS_536 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

309. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP044149 (Escherichia coli O157 strain AR-0427 plasmid pAR-0427-1) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

310. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP019910 (Escherichia coli strain MDR_56 plasmid unnamed4, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

311. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP019009 (Escherichia coli strain Ecol_AZ161 plasmid pECAZ161_3, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

312. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP014320 (Escherichia coli JJ1887 plasmid pJJ1887-5, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

313. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_LT985265 (Escherichia coli strain 364 plasmid RCS57TR364_p, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

314. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_LT985304 (Escherichia coli strain ECOR 31 plasmid RCS89_p, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

315. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_LT985214 (Escherichia coli strain 649 plasmid RCS101_p, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

316. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_LT985267 (Escherichia coli strain 637 plasmid RCS61_p, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

317. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_LT985272 (Escherichia coli strain 506 plasmid RCS62_pI, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

318. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_LT985309 (Escherichia coli strain CIP106223 plasmid RCS93_pI, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

319. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_LT985277 (Escherichia coli strain 522 plasmid RCS65_p, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

320. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP018954 (Escherichia coli strain Ecol_316 plasmid pEC316_3, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

321. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_MK291500 (Escherichia coli strain 15978 plasmid pHN15978-1, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

322. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_MK797990 (Salmonella enterica subsp. enterica serovar Wien strain ZM3 plasmid pZM3, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

323. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_AP018939 (Escherichia coli strain JSWP006 plasmid pJSWP006_1, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

324. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_MH917279 (Klebsiella pneumoniae strain A1706 plasmid pA1706-NDM, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

325. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_MH626559 (Salmonella enterica subsp. enterica serovar Typhimurium strain ST1007 plasmid pST1007-1C, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

326. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_MH626558 (Salmonella enterica subsp. enterica serovar Typhimurium strain ST1007 plasmid pST1007-1B, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

327. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_MK048477 (Escherichia coli strain U-5227 plasmid pUB_DHA-1, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

328. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NC_017722 (Escherichia coli ETEC H10407 plasmid p666, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

329. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_MG904998 (Escherichia coli strain 15OD0495 plasmid p15ODTXV, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

330. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_MG656414 (Escherichia coli strain 15-50 plasmid pEC15-MCR-50, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

331. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_MH257753 (Salmonella enterica subsp. enterica serovar Typhimurium strain 1007 plasmid pST1007-1A, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

332. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_MH648141 (Salmonella enterica subsp. enterica serovar Typhimurium strain ST1007 plasmid pST1007-1D, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

333. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP023816 (Escherichia coli strain IMT16316 plasmid pEcIMT16316, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

334. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP023828 (Escherichia coli strain 4/4 plasmid p4_4.2, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

335. spacer 1.5|644551|33|NC_013928|PILER-CR matches to MN694298 (Marine virus AFVG_250M557, complete genome) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
gtgcaacaacagcaacaacagcaacaacagcaa	Protospacer
  **  ******* ******** ******** *

336. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP015086 (Escherichia coli O25b:H4 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

337. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_KU987452 (Citrobacter freundii strain AC2901 plasmid AC2901, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

338. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_KX683283 (Escherichia coli strain EcU443 plasmid pECSE_01, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

339. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_KY751926 (Klebsiella pneumoniae strain HK02-026 plasmid pHK02-026, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

340. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_KY288024 (Klebsiella pneumoniae strain ST709 plasmid pCC1410-2, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

341. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP025626 (Escherichia coli strain SCEC020007 plasmid pNDM5_020007, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

342. spacer 1.5|644551|33|NC_013928|PILER-CR matches to MN783745 (Escherichia coli plasmid pFII-FIB, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

343. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_KU288634 (Escherichia coli strain FAM22321 plasmid pFAM22321, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

344. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_KU043115 (Escherichia coli strain Y5 plasmid pECY55, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

345. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_KX839209 (Klebsiella pneumoniae strain KP1814 plasmid pKP1814-3, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

346. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_KT818627 (Klebsiella pneumoniae strain U25 plasmid U25P002, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

347. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_KT725788 (Klebsiella pneumoniae strain ST147 plasmid pCC1410-1, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

348. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_KT725789 (Klebsiella pneumoniae strain ST147 plasmid pCC1409-1, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

349. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_KR078259 (Escherichia coli strain YD472 plasmid pYHCC, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

350. spacer 1.5|644551|33|NC_013928|PILER-CR matches to AP019526 (Escherichia coli O25b:H4-ST131 B0018 plasmid pB0018 DNA, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

351. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP042629 (Escherichia coli strain NCYU-25-82 plasmid pNCYU-25-82-2, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

352. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP048368 (Escherichia coli strain 163 plasmid pC-F-164_A-OXA140, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

353. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP042338 (Escherichia coli strain GZ04-0086 plasmid pNDM5-GZ04_B, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

354. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NC_014232 (Escherichia coli ETEC 1392/75 plasmid p1081, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

355. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP028484 (Escherichia coli strain E41-1 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

356. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP025852 (Escherichia coli strain 510016 plasmid p510016_29, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

357. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP035479 (Escherichia coli strain U13A plasmid pU13A_B, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

358. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_KX646543 (Shigella boydii strain 2246 plasmid p2246-CTXM, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

359. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NC_020278 (Escherichia coli strain 3A11 plasmid pHN3A11, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

360. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP018113 (Escherichia coli strain MRSN346595 plasmid pMRSN346595_62.2, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

361. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP042601 (Escherichia coli strain NCYU-29-69 plasmid pNCYU-29-69-2, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

362. spacer 1.5|644551|33|NC_013928|PILER-CR matches to KY130431 (Klebsiella pneumoniae plasmid pABC143C-NDM, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

363. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP010174 (Escherichia coli strain H8 plasmid B, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

364. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP053734 (Escherichia coli strain CP55_Sichuan plasmid pCP55-IncFII, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

365. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_MK878892 (Escherichia coli strain J53 plasmid pMG333, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

366. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP034964 (Escherichia coli strain WCHEC020032 plasmid pCTXM3_020032, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

367. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP053737 (Escherichia coli strain CP8-3_Sichuan plasmid pCP8-3-IncFII, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

368. spacer 1.5|644551|33|NC_013928|PILER-CR matches to MT077885 (Escherichia coli plasmid p37, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

369. spacer 1.5|644551|33|NC_013928|PILER-CR matches to MT077889 (Escherichia coli plasmid p77, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

370. spacer 1.5|644551|33|NC_013928|PILER-CR matches to MN007141 (Escherichia coli strain 91 plasmid p91_NDM5, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

371. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_LS992182 (Escherichia coli isolate Escherichia coli str. TO124 plasmid 3, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

372. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP051433 (Escherichia sp. SCLE84 plasmid pSCLE3, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

373. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP024475 (Shigella flexneri 7b strain 94-3007 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

374. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_LR130558 (Escherichia coli strain MS14385 isolate MS14385 plasmid 4) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

375. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP048296 (Escherichia coli strain CVM N18EC0432 plasmid pN18EC0432-2, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

376. spacer 1.5|644551|33|NC_013928|PILER-CR matches to CP046678 (Escherichia coli strain 152661 plasmid p152661_p2, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

377. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP033629 (Klebsiella pneumoniae strain 4743 plasmid unnamed4, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

378. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP049078 (Escherichia coli strain p11A plasmid p11A_p1, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

379. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP024284 (Escherichia albertii strain 2014C-4356 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

380. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP019244 (Escherichia coli strain Combat2C1 plasmid pCombat2C1-1, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

381. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP036244 (Escherichia coli strain S65EC plasmid pS65EC, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

382. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP012139 (Shigella flexneri 2a strain 981 plasmid 981p2, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

383. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NC_018998 (Escherichia coli F18+ plasmid pTC1, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

384. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP021180 (Escherichia coli strain 81009 plasmid pEC-81009, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

385. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP041957 (Escherichia coli strain EC2 plasmid pEC2_2, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

386. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP041948 (Klebsiella pneumoniae strain KP2 plasmid pKP2_2, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

387. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP047381 (Escherichia coli strain CAU16175 plasmid pCAU16175_3, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

388. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NC_008460 (Escherichia coli plasmid pO86A1, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

389. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP040922 (Escherichia coli strain FC853_EC plasmid p853EC3, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

390. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP030329 (Escherichia coli strain AR_452 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

391. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP015503 (Klebsiella pneumoniae strain SKGH01 plasmid unnamed 3, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

392. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP029577 (Escherichia coli strain DA33135 plasmid pDA33135-139, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

393. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP029578 (Escherichia coli strain DA33135 plasmid pDA33135-70, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

394. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP024652 (Escherichia coli strain BH100 substr. MG2014 plasmid pBH100-1, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

395. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP016389 (Salmonella enterica subsp. enterica serovar Typhimurium strain 13-931 plasmid pESBL931, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

396. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP024888 (Escherichia coli strain AR_0019 plasmid tig00000138_pilon, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

397. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP037912 (Escherichia coli strain YSP8-1 plasmid pYSP8-1-CTX-M-14, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

398. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP010882 (Escherichia coli strain MNCRE44 plasmid pMNCRE44_6, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

399. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_LT985217 (Escherichia coli strain 715 plasmid RCS103_p, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

400. spacer 1.5|644551|33|NC_013928|PILER-CR matches to KU318420 (Klebsiella pneumoniae strain KP04 plasmid pKP04CTXM, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

401. spacer 1.5|644551|33|NC_013928|PILER-CR matches to AP014876 (Escherichia coli plasmid pV021-b DNA, complete sequence, strain: V021) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

402. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP046261 (Escherichia coli strain ECO2947 plasmid p2947-NDM5, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

403. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP039513 (Salmonella enterica subsp. enterica serovar Worthington strain 7102.58 plasmid p7102_58-6, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

404. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP040265 (Escherichia coli strain 631 plasmid pEc631_2, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

405. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP021684 (Escherichia coli strain AR_0162 plasmid tig00008015, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

406. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP027311 (Escherichia coli strain 2014C-4135 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

407. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP031804 (Klebsiella pneumoniae strain MSB1_8A-sc-2280397 plasmid unnamed4, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

408. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP032202 (Escherichia coli strain AR_0086 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

409. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP009233 (Escherichia coli strain CA08 plasmid pCA08, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

410. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP021203 (Escherichia coli strain Z1002 plasmid p1002-1, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

411. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP031852 (Klebsiella pneumoniae strain 121 plasmid pKP121-3, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

412. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP035470 (Escherichia coli strain U12A plasmid pU12A_C, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

413. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_AP019677 (Escherichia coli strain GSH8M-2 plasmid pGSH8M-2-2, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

414. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP051696 (Escherichia coli strain SCU-313 plasmid pSCU-313-2, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

415. spacer 1.5|644551|33|NC_013928|PILER-CR matches to CP052528 (Klebsiella pneumoniae strain B16KP0177 plasmid pB16KP0177-4, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

416. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_AP018811 (Escherichia coli strain E2865 plasmid pE2865-3, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

417. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_AP018785 (Escherichia coli strain SK1144 plasmid pSK1144) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

418. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_AP018785 (Escherichia coli strain SK1144 plasmid pSK1144) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

419. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NC_019071 (Escherichia coli plasmid pHK09, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

420. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NC_019072 (Escherichia coli plasmid pHK08, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

421. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NC_019095 (Escherichia coli plasmid pXZ, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

422. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP024975 (Escherichia coli strain CV839-15 plasmid pCV839-15-p1, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

423. spacer 1.5|644551|33|NC_013928|PILER-CR matches to KU932024 (Escherichia coli plasmid pEC13, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

424. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP024157 (Escherichia coli strain 14EC047 plasmid p14EC047b, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

425. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP024158 (Escherichia coli strain 14EC047 plasmid p14EC047c, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

426. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP017287 (Klebsiella variicola strain GJ3 plasmid pKPGJ-3c, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

427. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NC_025177 (Escherichia coli plasmid pH1519-76, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

428. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP019444 (Salmonella enterica subsp. enterica serovar Typhimurium strain 81741 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

429. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP023733 (Escherichia coli strain FORC 064 plasmid pFORC64.2, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

430. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP026403 (Escherichia coli strain ECONIH4 plasmid pECO-816c, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

431. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP029113 (Escherichia coli strain AR435 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

432. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP018982 (Escherichia coli strain Ecol_867 plasmid pEC867_1, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

433. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP018952 (Escherichia coli strain Ecol_276 plasmid pEC276_1, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

434. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP015388 (Klebsiella pneumoniae strain NY9 plasmid pNY9_3, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

435. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_KJ201887 (Shigella flexneri 4c strain 072 plasmid pSF07201, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

436. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_KX008967 (Shigella sonnei strain 183660 plasmid p183660, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
--gccacaacagccacaacagccacaacagcca	Protospacer
  **. *******.********.********.*

437. spacer 1.5|644551|33|NC_013928|PILER-CR matches to LC163971 (Escherichia coli O145:NM str. 12E70 plasmid pSTEC-O145-12E70-1 DNA, complete sequence, strain: 12E70) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

438. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP013657 (Escherichia coli strain uk_P46212 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

439. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP037947 (Escherichia coli strain CFSAN027346 plasmid pCFSAN027346-2, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

440. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP023895 (Escherichia coli strain FDAARGOS_433 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

441. spacer 1.5|644551|33|NC_013928|PILER-CR matches to CP025891 (Escherichia coli strain 503046 plasmid p503046_32, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

442. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP032165 (Klebsiella pneumoniae strain XJ-K1 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

443. spacer 1.5|644551|33|NC_013928|PILER-CR matches to CP042972 (Escherichia coli strain CFSAN061769 plasmid pCFSAN061769_03, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

444. spacer 1.5|644551|33|NC_013928|PILER-CR matches to CP054381 (Escherichia coli strain SCU-175 plasmid pSCU-175-2, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

445. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NC_019424 (Escherichia coli plasmid pFOS-HK151325, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

446. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP015140 (Escherichia coli strain Ecol_732 plasmid pEC732_2, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

447. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP050372 (Klebsiella pneumoniae strain 50595 plasmid p50595_ERM, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

448. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NC_019057 (Escherichia coli plasmid pHK01, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

449. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP041363 (Citrobacter amalonaticus strain 133355-SW-C4-Cam plasmid p133355_SW_C4_Cam-1, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

450. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP041358 (Escherichia coli strain U1 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

451. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_LS992169 (Escherichia coli isolate Escherichia coli str. TO60 plasmid 2, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

452. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP023918 (Klebsiella pneumoniae strain FDAARGOS_439 plasmid unnamed) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

453. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP042887 (Escherichia coli O10:H32 strain NMBU-W12E19 plasmid pNMBU-W12E19_03, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

454. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP043408 (Escherichia coli strain NMBU-W13E19 plasmid pNMBU-W13E19_02, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

455. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NC_002134 (Shigella flexneri 2b plasmid R100 DNA, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

456. spacer 1.5|644551|33|NC_013928|PILER-CR matches to CP045934 (Shigella sonnei strain AUSMDU00010534 plasmid pAUSMDU00010534_02, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

457. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP032205 (Escherichia coli strain AR_0013 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

458. spacer 1.5|644551|33|NC_013928|PILER-CR matches to CP049186 (Shigella sonnei strain 19.0821.3486 plasmid p19-0821-3486, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

459. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_LS992191 (Escherichia coli isolate Escherichia coli str. TO148 plasmid 2, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

460. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NC_016039 (Escherichia coli plasmid pHK17a, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

461. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP023361 (Escherichia coli strain 1943 plasmid p80, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

462. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP032836 (Klebsiella pneumoniae strain INF237 plasmid pINF237_03, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

463. spacer 1.5|644551|33|NC_013928|PILER-CR matches to MN823993 (Klebsiella pneumoniae strain 20130907-4 plasmid p309074-2FII, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

464. spacer 1.5|644551|33|NC_013928|PILER-CR matches to MN822124 (Escherichia coli strain 14E509 plasmid p14E509-1FII, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

465. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_HG941719 (Escherichia coli O25b:H4-ST131 strain EC958 plasmid pEC958, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

466. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NC_009133 (Escherichia coli plasmid NR1, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

467. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP032258 (Escherichia coli strain AR_0067 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

468. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP032262 (Escherichia coli strain AR_0067 plasmid unnamed4, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

469. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP021711 (Klebsiella pneumoniae strain AR_0143 plasmid tig00000856, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

470. spacer 1.5|644551|33|NC_013928|PILER-CR matches to MF353155 (Escherichia coli plasmid pLZ135-CTX, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

471. spacer 1.5|644551|33|NC_013928|PILER-CR matches to CP049170 (Shigella sonnei strain 19.1125.3493 plasmid p19-1125-3493, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

472. spacer 1.5|644551|33|NC_013928|PILER-CR matches to AP019705 (Escherichia coli O145:H28 10942 plasmid pO145_10942_2 DNA, complete genome) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

473. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP025139 (Escherichia coli strain BH100L substr. MG2017 plasmid pBH100alpha, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

474. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_LR740760 (Escherichia coli strain BEN5202 isolate laying hen 51 weeks old plasmid pbAPEC5202) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

475. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_LR740760 (Escherichia coli strain BEN5202 isolate laying hen 51 weeks old plasmid pbAPEC5202) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

476. spacer 1.5|644551|33|NC_013928|PILER-CR matches to AP023231 (Escherichia coli YJ4 plasmid pYJ4-NDM5 DNA, complete genome) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

477. spacer 1.5|644551|33|NC_013928|PILER-CR matches to AP023232 (Escherichia coli YJ4 plasmid pYJ4-a DNA, complete genome) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

478. spacer 1.5|644551|33|NC_013928|PILER-CR matches to AP023236 (Escherichia coli YJ6 plasmid pYJ6-NDM5 DNA, complete genome) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

479. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NC_013727 (Shigella sonnei plasmid pEG356 complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

480. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NC_019090 (Escherichia coli plasmid pHK23a, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

481. spacer 1.5|644551|33|NC_013928|PILER-CR matches to LT174531 (Shigella sonnei plasmid pEG430-2, strain EG0430) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

482. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP033634 (Escherichia coli isolate ECCNB12-2 plasmid pTB-nb3, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

483. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP023145 (Escherichia coli strain CFSAN061770 plasmid pEGY3, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

484. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP020117 (Escherichia coli strain AR_0104 plasmid unitig_5, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

485. spacer 1.5|644551|33|NC_013928|PILER-CR matches to AP018354 (Escherichia coli plasmid pVE155 DNA, complete genome, strain: E155) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

486. spacer 1.5|644551|33|NC_013928|PILER-CR matches to AP022354 (Escherichia coli E033 plasmid pE033_IMP6 DNA, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

487. spacer 1.5|644551|33|NC_013928|PILER-CR matches to AP022355 (Escherichia coli E034 plasmid pE034_IMP6 DNA, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

488. spacer 1.5|644551|33|NC_013928|PILER-CR matches to AP022359 (Escherichia coli E294 plasmid pE294_IMP6 DNA, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

489. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP028322 (Escherichia coli O18:H1 strain CFSAN067215 plasmid p0.1229_2, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

490. spacer 1.5|644551|33|NC_013928|PILER-CR matches to LC520279 (Escherichia coli H0063 plasmid pH0063 DNA, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

491. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_AP018799 (Escherichia coli strain E2855 plasmid pE2855-3, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

492. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP034056 (Klebsiella pneumoniae strain KP_NORM_BLD_2015_112126 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

493. spacer 1.5|644551|33|NC_013928|PILER-CR matches to LC520274 (Escherichia coli C0079 plasmid pC0079 DNA, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

494. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP054356 (Escherichia coli strain SCU-172 plasmid pSCU-172-3, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

495. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP018107 (Escherichia coli strain MRSN352231 plasmid pMR0716_IncFII, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

496. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_AP018833 (Escherichia coli strain M309 plasmid pM309-NDM5, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

497. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NC_011812 (Escherichia coli plasmid pO26-L, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

498. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP043945 (Escherichia coli strain AR216.2b plasmid pMPCMY-2, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

499. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP034048 (Klebsiella pneumoniae strain KP_NORM_BLD_2014_104014 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

500. spacer 1.5|644551|33|NC_013928|PILER-CR matches to CP027581 (Escherichia coli strain 2013C-4282 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

501. spacer 1.5|644551|33|NC_013928|PILER-CR matches to CP027674 (Escherichia coli strain 2014C-3003 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

502. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP025253 (Escherichia coli strain BH100 substr. MG2017 plasmid pBH100-1, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

503. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_AP018136 (Escherichia coli strain M105 isolate M105 plasmid pM105_FII, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

504. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_AP018138 (Escherichia coli strain M107 isolate M107 plasmid pM107_FII, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

505. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_AP018144 (Escherichia coli strain M214 isolate M214 plasmid pM214_FII, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

506. spacer 1.5|644551|33|NC_013928|PILER-CR matches to CP052261 (Klebsiella pneumoniae strain E16KP0290 plasmid pE16KP0290-3, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

507. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP021737 (Escherichia coli strain AR_0150 plasmid tig00000255, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

508. spacer 1.5|644551|33|NC_013928|PILER-CR matches to MK295824 (Escherichia coli O25b:H4-ST131 strain 26 plasmid p26, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

509. spacer 1.5|644551|33|NC_013928|PILER-CR matches to MK295825 (Escherichia coli O25b:H4-ST131 strain U1 plasmid pU1, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

510. spacer 1.5|644551|33|NC_013928|PILER-CR matches to MK295827 (Escherichia coli O25b:H4-ST131 strain U17 plasmid pU17, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

511. spacer 1.5|644551|33|NC_013928|PILER-CR matches to MK295828 (Escherichia coli O25b:H4-ST131 strain U23 plasmid pU23, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

512. spacer 1.5|644551|33|NC_013928|PILER-CR matches to MK295829 (Escherichia coli O25b:H4-ST131 strain 13.1 plasmid p131, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

513. spacer 1.5|644551|33|NC_013928|PILER-CR matches to MK295830 (Escherichia coli O25b:H4-ST131 strain 425 plasmid p425, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

514. spacer 1.5|644551|33|NC_013928|PILER-CR matches to MK295832 (Escherichia coli O25b:H4-ST131 strain B14 plasmid pB14, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

515. spacer 1.5|644551|33|NC_013928|PILER-CR matches to MK295834 (Escherichia coli O25b:H4-ST131 strain 56 plasmid p56, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

516. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP026931 (Escherichia coli strain CFS3246 plasmid pCFS3246-2, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

517. spacer 1.5|644551|33|NC_013928|PILER-CR matches to JX127248 (Uncultured bacterium plasmid pRSB225, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

518. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP025254 (Escherichia coli strain BH100L substr. MG2014 plasmid pBH100alpha, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

519. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_LT985219 (Escherichia coli strain 497 plasmid RCS21_p, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

520. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_LT985226 (Escherichia coli strain 525 plasmid RCS27_p, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

521. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_LT985274 (Escherichia coli strain 723 plasmid RCS66_p, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

522. spacer 1.5|644551|33|NC_013928|PILER-CR matches to MK295819 (Escherichia coli O25b:H4-ST131 strain U10 plasmid pU10, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

523. spacer 1.5|644551|33|NC_013928|PILER-CR matches to MK295820 (Escherichia coli O25b:H4-ST131 strain B28 plasmid pB28, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

524. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP047637 (Klebsiella pneumoniae strain K2606 plasmid unnamed4, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

525. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_MK878893 (Escherichia coli strain J53 plasmid pMG335, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

526. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_MN101852 (Escherichia coli strain 13ZX28-TC-98 plasmid p13ZX28-TC-98, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

527. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_MN101854 (Escherichia coli strain 13ZX36 plasmid p13ZX36-70, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

528. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_MN101850 (Escherichia coli strain 13ZX28 plasmid p13ZX28-272, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

529. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_MN328348 (Salmonella enterica subsp. enterica serovar Enteritidis strain S14 plasmid pTS14, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

530. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NC_005327 (Escherichia coli plasmid pC15-1a, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

531. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP041393 (Escherichia coli strain ECOL-18-VL-LA-PA-Ryan-0026 plasmid p45407_1, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

532. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP045943 (Shigella flexneri 2a strain AUSMDU00010535 plasmid pAUSMDU00010535_02, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

533. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_MH316135 (Salmonella enterica subsp. enterica serovar Indiana strain GDD25-16 plasmid pGDD25-16, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

534. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_MH316136 (Salmonella enterica subsp. enterica serovar Indiana strain GDD25-21 plasmid pGDD25-21, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

535. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_MH909349 (Klebsiella pneumoniae strain A1705 plasmid pA1705-NDM, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

536. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_MH909349 (Klebsiella pneumoniae strain A1705 plasmid pA1705-NDM, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

537. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_MH316133 (Salmonella enterica subsp. enterica serovar Indiana strain GDD25-3 plasmid pGDD25-3, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

538. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_MH316134 (Salmonella enterica subsp. enterica serovar Indiana strain GDD25-5 plasmid pGDD25-5, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

539. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_MH257956 (Escherichia coli strain 104 plasmid pHXH-4, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

540. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_MN197360 (Escherichia coli strain 5P plasmid pVSI_NDM_5, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

541. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_MN218686 (Escherichia coli strain 5M plasmid pISV_IncFII_NDM-5, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

542. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_MN537908 (Escherichia coli strain E.coli4feg plasmid pIV_IncFII_DHA, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

543. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_MG886288 (Escherichia coli strain MO plasmid pMO, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

544. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_MF156713 (Escherichia coli strain 06028078 plasmid p28078-NDM, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

545. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_MG825370 (Escherichia coli strain 974 plasmid p974-NDM, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

546. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_MF156697 (Escherichia coli strain BTR plasmid pBTR-CTXM, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

547. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_MG764548 (Escherichia coli strain 11011 plasmid p11011-fosA, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

548. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_MG677985 (Escherichia coli strain LN310P plasmid pEC12, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

549. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP029422 (Escherichia coli strain 3385 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

550. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP032226 (Klebsiella pneumoniae strain AR_0046 plasmid unnamed4, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

551. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_KY706108 (Escherichia coli strain pAA-ST131 plasmid ESBL20150001, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

552. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_LC506716 (Klebsiella pneumoniae strain JUNP053 plasmid pJUNP53, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

553. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_KY865320 (Escherichia coli strain SH21G plasmid pEC295cfr, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

554. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_LC506719 (Klebsiella pneumoniae strain JUNP254 plasmid pJUNP254, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

555. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_LC506717 (Klebsiella pneumoniae strain JUNP054 plasmid pJUNP054, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

556. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_LC506718 (Klebsiella pneumoniae strain JUNP055 plasmid pJUNP055, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

557. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_LC506720 (Klebsiella pneumoniae strain JUNP268 plasmid pJUNP268, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

558. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_MG288681 (Klebsiella aerogenes strain E20 plasmid pE20-FIIA, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

559. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP048362 (Escherichia coli strain 53 plasmid p53_C, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

560. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP011064 (Escherichia coli str. Sanji plasmid pSJ_94, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

561. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP011065 (Escherichia coli str. Sanji plasmid pSJ_82, complete sequence) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagcca	Protospacer
*** .. ******.********.********.*

562. spacer 1.5|644551|33|NC_013928|PILER-CR matches to MG592444 (Vibrio phage 1.067.O._10N.261.52.C9, partial genome) position: , mismatch: 7, identity: 0.788

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caataccaacagcaacaacagcaacaacagcag	Protospacer
**.. ******** ******** ******** .

563. spacer 1.15|645162|33|NC_013928|PILER-CR matches to MK972710 (Salmonella phage SI22, complete genome) position: , mismatch: 7, identity: 0.788

--tgacctcagttgctatcctcttttttattgttg	CRISPR spacer
gttggc--gaattgctaaccccttttttattgttg	Protospacer
  **.*   *.****** **.**************

564. spacer 1.15|645162|33|NC_013928|PILER-CR matches to NC_049459 (Salmonella phage SW9, complete genome) position: , mismatch: 7, identity: 0.788

--tgacctcagttgctatcctcttttttattgttg	CRISPR spacer
gttggc--gaattgctaaccccttttttattgttg	Protospacer
  **.*   *.****** **.**************

565. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP015086 (Escherichia coli O25b:H4 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

566. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_KU987452 (Citrobacter freundii strain AC2901 plasmid AC2901, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

567. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_KX928752 (Klebsiella pneumoniae strain CRKP-59-KPC plasmid pCRKP-59-KPC, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

568. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_KX683283 (Escherichia coli strain EcU443 plasmid pECSE_01, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

569. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_KY751926 (Klebsiella pneumoniae strain HK02-026 plasmid pHK02-026, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

570. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_KY288024 (Klebsiella pneumoniae strain ST709 plasmid pCC1410-2, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

571. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NC_017627 (Escherichia coli 042 plasmid pAA, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

572. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP025626 (Escherichia coli strain SCEC020007 plasmid pNDM5_020007, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

573. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to AP018456 (Escherichia coli O25b:H4-ST131 plasmid pMRY09-581ECO_1 MRY09-581 DNA, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

574. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to AP018457 (Escherichia coli O25b:H4-ST131 plasmid pMRY09-592ECO_1 MRY09-592 DNA, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

575. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to AP018458 (Escherichia coli O25b:H4-ST131 plasmid pMRY09-597ECO_1 MRY09-597 DNA, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

576. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to MN783745 (Escherichia coli plasmid pFII-FIB, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

577. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_LR213453 (Shigella flexneri strain AUSMDU00008355 isolate AUSMDU00008355 plasmid 2) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

578. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_KT988018 (Escherichia coli strain V282 plasmid pEcoV282, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

579. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_KU288634 (Escherichia coli strain FAM22321 plasmid pFAM22321, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

580. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_KU043115 (Escherichia coli strain Y5 plasmid pECY55, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

581. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_KX839209 (Klebsiella pneumoniae strain KP1814 plasmid pKP1814-3, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

582. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP015077 (Escherichia coli strain Ecol_448 plasmid pEC448_1, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

583. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP015070 (Escherichia coli strain Ecol_743 plasmid pEC743_1, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

584. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP015072 (Escherichia coli strain Ecol_743 plasmid pEC743_3, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

585. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_KT818627 (Klebsiella pneumoniae strain U25 plasmid U25P002, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

586. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_KT725788 (Klebsiella pneumoniae strain ST147 plasmid pCC1410-1, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

587. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_KT725789 (Klebsiella pneumoniae strain ST147 plasmid pCC1409-1, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

588. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_KT845955 (Escherichia coli strain EP28 plasmid pHNEP28_cfr, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

589. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_KR078259 (Escherichia coli strain YD472 plasmid pYHCC, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

590. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to AP019526 (Escherichia coli O25b:H4-ST131 B0018 plasmid pB0018 DNA, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

591. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP042629 (Escherichia coli strain NCYU-25-82 plasmid pNCYU-25-82-2, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

592. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP041339 (Escherichia coli strain CCUG 73778 plasmid pSUH-2, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

593. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP035517 (Escherichia coli strain U14A plasmid pU14A_A, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

594. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP035518 (Escherichia coli strain U14A plasmid pU14A_B, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

595. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP048368 (Escherichia coli strain 163 plasmid pC-F-164_A-OXA140, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

596. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP040995 (Klebsiella pneumoniae strain FDAARGOS_775 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

597. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_LR130565 (Escherichia coli strain MS14387 isolate MS14387 plasmid 2) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

598. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP042338 (Escherichia coli strain GZ04-0086 plasmid pNDM5-GZ04_B, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

599. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NC_014232 (Escherichia coli ETEC 1392/75 plasmid p1081, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

600. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to CP022460 (Shigella sonnei strain 2015C-3807 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

601. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP028484 (Escherichia coli strain E41-1 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

602. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP025857 (Escherichia coli strain 504838 plasmid p504838_108, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

603. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP025852 (Escherichia coli strain 510016 plasmid p510016_29, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

604. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP035478 (Escherichia coli strain U13A plasmid pU13A_A, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

605. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP035479 (Escherichia coli strain U13A plasmid pU13A_B, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

606. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP034401 (Escherichia coli strain CRE10 plasmid pCRE10.1, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

607. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP014493 (Escherichia coli strain MVAST0167 plasmid pMVAST0167_1, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

608. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_KX646543 (Shigella boydii strain 2246 plasmid p2246-CTXM, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

609. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NC_020278 (Escherichia coli strain 3A11 plasmid pHN3A11, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

610. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP018113 (Escherichia coli strain MRSN346595 plasmid pMRSN346595_62.2, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

611. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP042601 (Escherichia coli strain NCYU-29-69 plasmid pNCYU-29-69-2, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

612. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to KY130431 (Klebsiella pneumoniae plasmid pABC143C-NDM, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

613. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_KT754164 (Shigella dysenteriae 1 strain 3099-85 plasmid p3099-85, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

614. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP011135 (Escherichia coli VR50 plasmid pVR50A, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

615. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP011136 (Escherichia coli VR50 plasmid pVR50B, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

616. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP048338 (Escherichia coli strain 142 plasmid p142_A-OXA181, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

617. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP010174 (Escherichia coli strain H8 plasmid B, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

618. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_LS992188 (Escherichia coli isolate Escherichia coli str. 3426 plasmid 4, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

619. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_LS992188 (Escherichia coli isolate Escherichia coli str. 3426 plasmid 4, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

620. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP053732 (Escherichia coli strain CP55_Sichuan plasmid pCP55-IncFIB, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

621. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP053734 (Escherichia coli strain CP55_Sichuan plasmid pCP55-IncFII, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

622. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_MK878892 (Escherichia coli strain J53 plasmid pMG333, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

623. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP021289 (Escherichia coli strain PA45B plasmid pPA45B, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

624. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP029734 (Citrobacter sp. CRE-46 strain AR_0157 plasmid unnamed6, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

625. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP034964 (Escherichia coli strain WCHEC020032 plasmid pCTXM3_020032, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

626. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP053737 (Escherichia coli strain CP8-3_Sichuan plasmid pCP8-3-IncFII, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

627. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_LN824138 (Klebsiella pneumoniae genome assembly MS6671.v1, plasmid : _Plasmid_E_Kpneumoniae_MS6671) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

628. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to MT077882 (Escherichia coli plasmid p4, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

629. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to MT077885 (Escherichia coli plasmid p37, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

630. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to MT077887 (Escherichia coli plasmid p62, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

631. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to MT077889 (Escherichia coli plasmid p77, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

632. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to MN007141 (Escherichia coli strain 91 plasmid p91_NDM5, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

633. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_LS992181 (Escherichia coli isolate Escherichia coli str. TO124 plasmid 2, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

634. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_LS992182 (Escherichia coli isolate Escherichia coli str. TO124 plasmid 3, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

635. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP051433 (Escherichia sp. SCLE84 plasmid pSCLE3, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

636. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP024475 (Shigella flexneri 7b strain 94-3007 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

637. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_LR213457 (Shigella flexneri strain AUSMDU00008332 isolate AUSMDU00008332 plasmid 3) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

638. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP044156 (Shigella flexneri strain AR-0424 plasmid pAR-0424-1, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

639. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_LR130556 (Escherichia coli strain MS14385 isolate MS14385 plasmid 2) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

640. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_LR130558 (Escherichia coli strain MS14385 isolate MS14385 plasmid 4) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

641. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP048296 (Escherichia coli strain CVM N18EC0432 plasmid pN18EC0432-2, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

642. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to CP046678 (Escherichia coli strain 152661 plasmid p152661_p2, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

643. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP026724 (Escherichia coli strain 266917_2 plasmid p266917_2_01, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

644. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP020517 (Escherichia coli strain 222 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

645. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP033629 (Klebsiella pneumoniae strain 4743 plasmid unnamed4, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

646. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP049078 (Escherichia coli strain p11A plasmid p11A_p1, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

647. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP030770 (Escherichia coli strain 2017C-4173W12 plasmid p2017C-4173W12, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

648. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP024284 (Escherichia albertii strain 2014C-4356 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

649. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP019244 (Escherichia coli strain Combat2C1 plasmid pCombat2C1-1, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

650. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP031548 (Escherichia coli strain cq9 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

651. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP036244 (Escherichia coli strain S65EC plasmid pS65EC, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

652. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP012139 (Shigella flexneri 2a strain 981 plasmid 981p2, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

653. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NC_018998 (Escherichia coli F18+ plasmid pTC1, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

654. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP045279 (Escherichia coli strain LAU-OXA plasmid pLAU-OXA2, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

655. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP027375 (Escherichia coli strain 05-3629 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

656. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP021180 (Escherichia coli strain 81009 plasmid pEC-81009, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

657. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP041957 (Escherichia coli strain EC2 plasmid pEC2_2, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

658. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP041948 (Klebsiella pneumoniae strain KP2 plasmid pKP2_2, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

659. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP023350 (Escherichia coli strain ETEC-2264 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

660. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP023351 (Escherichia coli strain ETEC-2264 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

661. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP027385 (Escherichia coli strain 2013C-3250 plasmid unnamed5, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

662. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP012632 (Escherichia coli strain SF-173 plasmid pSF-173-1, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

663. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP015160 (Escherichia coli strain Eco889 plasmid pECO-fce, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

664. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP015160 (Escherichia coli strain Eco889 plasmid pECO-fce, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

665. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP047381 (Escherichia coli strain CAU16175 plasmid pCAU16175_3, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

666. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to CP045525 (Shigella sonnei strain 6904.27 plasmid p6904-27) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

667. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NC_008460 (Escherichia coli plasmid pO86A1, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

668. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP040922 (Escherichia coli strain FC853_EC plasmid p853EC3, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

669. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP029580 (Escherichia coli strain DA33137 plasmid pDA33137-178, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

670. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP030329 (Escherichia coli strain AR_452 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

671. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP014498 (Escherichia coli strain ZH193 plasmid pZH193, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

672. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP053248 (Escherichia coli strain SCU-482 plasmid pSCU-482-1, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

673. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP015503 (Klebsiella pneumoniae strain SKGH01 plasmid unnamed 3, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

674. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP013834 (Escherichia coli strain JJ2434 plasmid pJJ2434_2, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

675. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP029577 (Escherichia coli strain DA33135 plasmid pDA33135-139, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

676. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP029578 (Escherichia coli strain DA33135 plasmid pDA33135-70, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

677. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP024652 (Escherichia coli strain BH100 substr. MG2014 plasmid pBH100-1, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

678. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP016389 (Salmonella enterica subsp. enterica serovar Typhimurium strain 13-931 plasmid pESBL931, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

679. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP024888 (Escherichia coli strain AR_0019 plasmid tig00000138_pilon, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

680. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP037912 (Escherichia coli strain YSP8-1 plasmid pYSP8-1-CTX-M-14, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

681. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP028193 (Escherichia coli strain CFSAN018748 plasmid pGMI14-004_2, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

682. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP010882 (Escherichia coli strain MNCRE44 plasmid pMNCRE44_6, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

683. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP011019 (Escherichia coli strain CI5 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

684. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_LT985217 (Escherichia coli strain 715 plasmid RCS103_p, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

685. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to KU318420 (Klebsiella pneumoniae strain KP04 plasmid pKP04CTXM, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

686. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to CP053755 (Shigella sonnei strain 506 plasmid pMHMC-004, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

687. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to AP014876 (Escherichia coli plasmid pV021-b DNA, complete sequence, strain: V021) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

688. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP015131 (Klebsiella pneumoniae strain Kpn555 plasmid pKPN-7c3, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

689. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP010123 (Escherichia coli strain C5 plasmid A, complete genome) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

690. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP046261 (Escherichia coli strain ECO2947 plasmid p2947-NDM5, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

691. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP034932 (Shigella flexneri strain 2013C-3749 plasmid p2013C-3749-1, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

692. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP039513 (Salmonella enterica subsp. enterica serovar Worthington strain 7102.58 plasmid p7102_58-6, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

693. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP010181 (Escherichia coli strain M1 plasmid A, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

694. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP008715 (Escherichia coli strain ST648 plasmid pEC648_1, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

695. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP040265 (Escherichia coli strain 631 plasmid pEc631_2, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

696. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP021684 (Escherichia coli strain AR_0162 plasmid tig00008015, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

697. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP024836 (Klebsiella pneumoniae strain CRKP-2297 plasmid pCRKP-2297_2, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

698. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP027311 (Escherichia coli strain 2014C-4135 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

699. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP031804 (Klebsiella pneumoniae strain MSB1_8A-sc-2280397 plasmid unnamed4, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

700. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP032202 (Escherichia coli strain AR_0086 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

701. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP009233 (Escherichia coli strain CA08 plasmid pCA08, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

702. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP021203 (Escherichia coli strain Z1002 plasmid p1002-1, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

703. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP021210 (Escherichia coli strain strain Z247 plasmid p2474-NDM1, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

704. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP031852 (Klebsiella pneumoniae strain 121 plasmid pKP121-3, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

705. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP035468 (Escherichia coli strain U12A plasmid pU12A_A, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

706. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP035470 (Escherichia coli strain U12A plasmid pU12A_C, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

707. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP051701 (Escherichia coli strain SCU-125 plasmid pSCU-125-1, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

708. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_AP019677 (Escherichia coli strain GSH8M-2 plasmid pGSH8M-2-2, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

709. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP029104 (Escherichia coli strain AR437 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

710. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP033159 (Escherichia coli strain CM IVRI KOL-1 plasmid p1ESCUMpO83_CORR) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

711. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP051696 (Escherichia coli strain SCU-313 plasmid pSCU-313-2, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

712. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP051689 (Escherichia coli strain SCU-387 plasmid pSCU-387-1, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

713. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP051690 (Escherichia coli strain SCU-387 plasmid pSCU-387-2, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

714. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP051739 (Escherichia coli strain SCU-105 plasmid pSCU-105-1, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

715. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP051739 (Escherichia coli strain SCU-105 plasmid pSCU-105-1, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

716. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP051726 (Escherichia coli strain SCU-112 plasmid pSCU-112-1, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

717. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP051721 (Escherichia coli strain SCU-116 plasmid pSCU-116-2, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

718. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to CP052528 (Klebsiella pneumoniae strain B16KP0177 plasmid pB16KP0177-4, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

719. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_AP018811 (Escherichia coli strain E2865 plasmid pE2865-3, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

720. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_AP018785 (Escherichia coli strain SK1144 plasmid pSK1144) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

721. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_AP018785 (Escherichia coli strain SK1144 plasmid pSK1144) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

722. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NC_019071 (Escherichia coli plasmid pHK09, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

723. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NC_019072 (Escherichia coli plasmid pHK08, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

724. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NC_019095 (Escherichia coli plasmid pXZ, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

725. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP021690 (Escherichia coli strain AR_0058 plasmid tig00007555j7554, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

726. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP024975 (Escherichia coli strain CV839-15 plasmid pCV839-15-p1, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

727. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to KU932024 (Escherichia coli plasmid pEC13, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

728. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP024157 (Escherichia coli strain 14EC047 plasmid p14EC047b, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

729. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP024158 (Escherichia coli strain 14EC047 plasmid p14EC047c, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

730. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP009860 (Escherichia coli strain ECONIH1 plasmid pECO-824, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

731. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP017852 (Klebsiella variicola strain GJ2 plasmid pKPGJ-2c, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

732. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP017287 (Klebsiella variicola strain GJ3 plasmid pKPGJ-3c, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

733. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NC_025177 (Escherichia coli plasmid pH1519-76, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

734. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP019444 (Salmonella enterica subsp. enterica serovar Typhimurium strain 81741 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

735. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP024150 (Escherichia coli strain 14EC033 plasmid p14EC033c, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

736. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_LR025102 (Escherichia coli isolate EC-1639 plasmid 2, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

737. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP051734 (Escherichia coli strain SCU-109 plasmid pSCU-109-1, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

738. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP023733 (Escherichia coli strain FORC 064 plasmid pFORC64.2, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

739. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP024258 (Escherichia coli O25:H16 strain F5505-C1 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

740. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP024840 (Klebsiella pneumoniae strain CRKP-1215 plasmid pCRKP-1215_2, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

741. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP026403 (Escherichia coli strain ECONIH4 plasmid pECO-816c, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

742. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP027536 (Escherichia coli strain AR_0081 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

743. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP027537 (Escherichia coli strain AR_0081 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

744. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP029113 (Escherichia coli strain AR435 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

745. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP018982 (Escherichia coli strain Ecol_867 plasmid pEC867_1, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

746. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP018952 (Escherichia coli strain Ecol_276 plasmid pEC276_1, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

747. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP042879 (Escherichia coli strain NMBU_W05E18 plasmid pNMBU-W05E18_01, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

748. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP024241 (Escherichia coli O114:H49 strain 90-9280 plasmid unnamed1) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

749. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP024242 (Escherichia coli O114:H49 strain 90-9280 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

750. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP019076 (Escherichia coli strain CRE1493 plasmid p1493-5, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

751. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP015388 (Klebsiella pneumoniae strain NY9 plasmid pNY9_3, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

752. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_KJ201887 (Shigella flexneri 4c strain 072 plasmid pSF07201, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

753. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to LC163971 (Escherichia coli O145:NM str. 12E70 plasmid pSTEC-O145-12E70-1 DNA, complete sequence, strain: 12E70) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

754. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP013657 (Escherichia coli strain uk_P46212 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

755. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP037947 (Escherichia coli strain CFSAN027346 plasmid pCFSAN027346-2, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

756. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP023895 (Escherichia coli strain FDAARGOS_433 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

757. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to CP025927 (Escherichia coli strain 520873 plasmid p520873_29, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

758. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to CP025891 (Escherichia coli strain 503046 plasmid p503046_32, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

759. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to CP025880 (Escherichia coli strain 503458 plasmid p503458_46, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

760. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP032165 (Klebsiella pneumoniae strain XJ-K1 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

761. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to CP042972 (Escherichia coli strain CFSAN061769 plasmid pCFSAN061769_03, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

762. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP027458 (Escherichia coli strain 88-3493 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

763. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP016498 (Escherichia coli strain UPEC 26-1 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

764. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP024238 (Escherichia coli O15:H11 strain 90-9272 plasmid unnamed) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

765. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP024238 (Escherichia coli O15:H11 strain 90-9272 plasmid unnamed) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

766. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP024430 (Klebsiella pneumoniae strain DA48896 plasmid p48896_1, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

767. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to CP054381 (Escherichia coli strain SCU-175 plasmid pSCU-175-2, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

768. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NC_019424 (Escherichia coli plasmid pFOS-HK151325, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

769. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP024237 (Escherichia coli O6:H16 strain 2014EL-1346-6 plasmid unnamed5, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

770. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP015140 (Escherichia coli strain Ecol_732 plasmid pEC732_2, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

771. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP050372 (Klebsiella pneumoniae strain 50595 plasmid p50595_ERM, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

772. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP050367 (Klebsiella pneumoniae strain 47733 plasmid p47733_NDM_5, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

773. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NC_019057 (Escherichia coli plasmid pHK01, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

774. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP041363 (Citrobacter amalonaticus strain 133355-SW-C4-Cam plasmid p133355_SW_C4_Cam-1, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

775. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP041358 (Escherichia coli strain U1 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

776. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP018973 (Escherichia coli strain Ecol_545 plasmid pEC545_3, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

777. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP026158 (Klebsiella pneumoniae strain F93-2 plasmid pF93-2_1, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

778. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_LS992194 (Escherichia coli isolate Escherichia coli str. TO217 plasmid 3, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

779. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_LS992169 (Escherichia coli isolate Escherichia coli str. TO60 plasmid 2, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

780. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to CP049174 (Shigella sonnei strain 19.0820.1561 plasmid p19-0820-1561, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

781. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP023918 (Klebsiella pneumoniae strain FDAARGOS_439 plasmid unnamed) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

782. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP023959 (Escherichia coli strain FDAARGOS_448 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

783. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP042887 (Escherichia coli O10:H32 strain NMBU-W12E19 plasmid pNMBU-W12E19_03, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

784. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP043407 (Escherichia coli strain NMBU-W13E19 plasmid pNMBU-W13E19_01, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

785. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP043408 (Escherichia coli strain NMBU-W13E19 plasmid pNMBU-W13E19_02, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

786. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to CP054450 (Escherichia coli strain SCU-488 plasmid pSCU-488-1, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

787. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NC_013507 (Escherichia coli ETEC H10407 plasmid pEntH10407, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

788. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NC_002134 (Shigella flexneri 2b plasmid R100 DNA, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

789. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to CP045934 (Shigella sonnei strain AUSMDU00010534 plasmid pAUSMDU00010534_02, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

790. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP011418 (Escherichia coli strain CFSAN029787 plasmid pCFSAN029787_02, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

791. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP027554 (Escherichia coli strain 2013C-3513 plasmid unnamed1) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
acacacaacagccacaacagccacaacagcca	Protospacer
*  . *******.********.********.*

792. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP032205 (Escherichia coli strain AR_0013 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

793. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP048648 (Escherichia coli strain GW-AmxH19 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

794. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP034396 (Escherichia coli strain CRE1 plasmid pCRE1.1, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

795. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP035722 (Escherichia coli strain U15A plasmid pU15A_B, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

796. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP050384 (Escherichia coli strain 52148 plasmid p52148_NDM_5, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

797. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP024268 (Escherichia coli O6:H16 strain F6699 plasmid unnamed2) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

798. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to CP049186 (Shigella sonnei strain 19.0821.3486 plasmid p19-0821-3486, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

799. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_LS992191 (Escherichia coli isolate Escherichia coli str. TO148 plasmid 2, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

800. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NC_013542 (Klebsiella pneumoniae plasmid pKF3-70, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

801. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NC_016039 (Escherichia coli plasmid pHK17a, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

802. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP023361 (Escherichia coli strain 1943 plasmid p80, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

803. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP032836 (Klebsiella pneumoniae strain INF237 plasmid pINF237_03, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

804. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to MN823993 (Klebsiella pneumoniae strain 20130907-4 plasmid p309074-2FII, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

805. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to MN822124 (Escherichia coli strain 14E509 plasmid p14E509-1FII, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

806. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_HG941719 (Escherichia coli O25b:H4-ST131 strain EC958 plasmid pEC958, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

807. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NC_009133 (Escherichia coli plasmid NR1, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

808. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP010239 (Escherichia coli strain S50 plasmid A, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

809. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP021871 (Escherichia coli strain H105 plasmid pH105, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

810. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP032258 (Escherichia coli strain AR_0067 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

811. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP032262 (Escherichia coli strain AR_0067 plasmid unnamed4, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

812. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to MN823989 (Klebsiella pneumoniae strain 283149 plasmid p283149-FII, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

813. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to CP049172 (Shigella sonnei strain 0401930105 plasmid p0401930105) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

814. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP021711 (Klebsiella pneumoniae strain AR_0143 plasmid tig00000856, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

815. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to MF353155 (Escherichia coli plasmid pLZ135-CTX, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

816. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to CP049170 (Shigella sonnei strain 19.1125.3493 plasmid p19-1125-3493, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

817. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP043949 (Escherichia coli strain AR202.2 plasmid pMPCMY-2, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

818. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to AP019705 (Escherichia coli O145:H28 10942 plasmid pO145_10942_2 DNA, complete genome) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

819. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP025139 (Escherichia coli strain BH100L substr. MG2017 plasmid pBH100alpha, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

820. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to CP049168 (Shigella sonnei strain 09163633 plasmid p09163633, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

821. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_LR740760 (Escherichia coli strain BEN5202 isolate laying hen 51 weeks old plasmid pbAPEC5202) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

822. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_LR740760 (Escherichia coli strain BEN5202 isolate laying hen 51 weeks old plasmid pbAPEC5202) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

823. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to AP023220 (Escherichia coli M505 plasmid pM505-NDM5 DNA, complete genome) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

824. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to AP023221 (Escherichia coli M505 plasmid pM505-a DNA, complete genome) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

825. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to AP023231 (Escherichia coli YJ4 plasmid pYJ4-NDM5 DNA, complete genome) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

826. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to AP023232 (Escherichia coli YJ4 plasmid pYJ4-a DNA, complete genome) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

827. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to AP023236 (Escherichia coli YJ6 plasmid pYJ6-NDM5 DNA, complete genome) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

828. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NC_013727 (Shigella sonnei plasmid pEG356 complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

829. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NC_019090 (Escherichia coli plasmid pHK23a, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

830. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to LT174531 (Shigella sonnei plasmid pEG430-2, strain EG0430) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

831. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP014112 (Escherichia coli strain FDAARGOS_144 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

832. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP021938 (Escherichia coli strain AR_0055 plasmid unitig_4, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

833. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP024291 (Escherichia coli O178:H19 strain 2012C-4431 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

834. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP033634 (Escherichia coli isolate ECCNB12-2 plasmid pTB-nb3, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

835. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to CP049166 (Shigella sonnei strain 0401952027 plasmid p0401952027, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

836. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP010184 (Escherichia coli strain M3 plasmid A, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

837. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP023164 (Escherichia coli O22:H8 strain RM10809-3 plasmid pRM10809-3, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

838. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP023145 (Escherichia coli strain CFSAN061770 plasmid pEGY3, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

839. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP020117 (Escherichia coli strain AR_0104 plasmid unitig_5, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

840. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to AP018354 (Escherichia coli plasmid pVE155 DNA, complete genome, strain: E155) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

841. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to AP022354 (Escherichia coli E033 plasmid pE033_IMP6 DNA, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

842. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to AP022355 (Escherichia coli E034 plasmid pE034_IMP6 DNA, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

843. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to AP022359 (Escherichia coli E294 plasmid pE294_IMP6 DNA, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

844. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP029974 (Escherichia coli strain 51008369SK1 plasmid p51008369SK1_A, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

845. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP050735 (Salmonella enterica subsp. enterica serovar Typhimurium strain ST90 plasmid pST90-1, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

846. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP028322 (Escherichia coli O18:H1 strain CFSAN067215 plasmid p0.1229_2, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

847. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to LC520279 (Escherichia coli H0063 plasmid pH0063 DNA, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

848. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to LC520280 (Escherichia coli H0106 plasmid pH0106 DNA, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

849. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to LC520281 (Escherichia coli H0130 plasmid pH0130 DNA, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

850. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to LC520283 (Escherichia coli I0128 plasmid pI0128 DNA, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

851. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to LC520284 (Escherichia coli HP003 plasmid pHP003 DNA, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

852. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to LC520285 (Escherichia coli HP030 plasmid pHP030 DNA, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

853. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to LC520286 (Escherichia coli HP050 plasmid pHP050 DNA, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

854. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to LC520287 (Escherichia coli HP129 plasmid pHP129 DNA, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

855. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to LC520289 (Escherichia coli HP243 plasmid pHP243 DNA, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

856. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_AP018799 (Escherichia coli strain E2855 plasmid pE2855-3, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

857. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NC_013951 (Klebsiella pneumoniae plasmid pKF3-140, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

858. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP040454 (Escherichia coli strain UPEC132 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

859. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP015836 (Escherichia coli strain MS6198 plasmid pMS6198B, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

860. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP034056 (Klebsiella pneumoniae strain KP_NORM_BLD_2015_112126 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

861. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to CP049610 (Escherichia coli strain 06-3538 plasmid p06-3538-1) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

862. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to CP049615 (Escherichia coli O157:H7 strain K1516 plasmid pK1516-3, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

863. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to LC520268 (Escherichia coli C0044 plasmid pC0044 DNA, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

864. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to LC520269 (Escherichia coli A0084 plasmid pA0084 DNA, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

865. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to LC520270 (Escherichia coli A0086 plasmid pA0086 DNA, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

866. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to LC520271 (Escherichia coli A0140 plasmid pA0140 DNA, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

867. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to LC520272 (Escherichia coli A0145 plasmid pA0145 DNA, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

868. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to LC520273 (Escherichia coli A0150 plasmid pA0150 DNA, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

869. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to LC520274 (Escherichia coli C0079 plasmid pC0079 DNA, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

870. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to LC520275 (Escherichia coli C0122 plasmid pC0122 DNA, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

871. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to LC520276 (Escherichia coli F0090 plasmid pF0090 DNA, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

872. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to LC520277 (Escherichia coli G0138 plasmid pG0138 DNA, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

873. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to LC520278 (Escherichia coli H0005 plasmid pH0005 DNA, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

874. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP054355 (Escherichia coli strain SCU-172 plasmid pSCU-172-2, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

875. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP054356 (Escherichia coli strain SCU-172 plasmid pSCU-172-3, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

876. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP018107 (Escherichia coli strain MRSN352231 plasmid pMR0716_IncFII, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

877. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_AP018833 (Escherichia coli strain M309 plasmid pM309-NDM5, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

878. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP043229 (Escherichia coli strain Ec-050 plasmid pEc-050-CMY-2, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

879. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NC_011812 (Escherichia coli plasmid pO26-L, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

880. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP043945 (Escherichia coli strain AR216.2b plasmid pMPCMY-2, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

881. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP033881 (Escherichia coli strain 50579417 plasmid p50579417_4, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

882. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP034048 (Klebsiella pneumoniae strain KP_NORM_BLD_2014_104014 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

883. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP034214 (Escherichia albertii strain NCTC 9362 plasmid pNCTC_9362) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

884. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP050770 (Salmonella enterica subsp. enterica serovar Indiana strain SI108 plasmid pSI108-1, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

885. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP020340 (Shigella flexneri 4c strain 0702 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

886. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to CP027581 (Escherichia coli strain 2013C-4282 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

887. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to CP027674 (Escherichia coli strain 2014C-3003 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

888. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP025253 (Escherichia coli strain BH100 substr. MG2017 plasmid pBH100-1, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

889. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_AP014804 (Escherichia coli O119:H6 strain EC404/03 plasmid pEC404/03-1, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

890. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_AP018136 (Escherichia coli strain M105 isolate M105 plasmid pM105_FII, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

891. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_AP018138 (Escherichia coli strain M107 isolate M107 plasmid pM107_FII, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

892. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_AP018144 (Escherichia coli strain M214 isolate M214 plasmid pM214_FII, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

893. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to CP052261 (Klebsiella pneumoniae strain E16KP0290 plasmid pE16KP0290-3, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

894. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_LR213461 (Shigella sonnei strain AUSMDU00008333 isolate AUSMDU00008333 plasmid 4) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

895. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP033761 (Escherichia coli strain FDAARGOS_536 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

896. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP044149 (Escherichia coli O157 strain AR-0427 plasmid pAR-0427-1) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

897. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP021737 (Escherichia coli strain AR_0150 plasmid tig00000255, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

898. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP019910 (Escherichia coli strain MDR_56 plasmid unnamed4, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

899. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP019009 (Escherichia coli strain Ecol_AZ161 plasmid pECAZ161_3, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

900. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to MK295824 (Escherichia coli O25b:H4-ST131 strain 26 plasmid p26, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

901. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to MK295825 (Escherichia coli O25b:H4-ST131 strain U1 plasmid pU1, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

902. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to MK295827 (Escherichia coli O25b:H4-ST131 strain U17 plasmid pU17, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

903. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to MK295828 (Escherichia coli O25b:H4-ST131 strain U23 plasmid pU23, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

904. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to MK295829 (Escherichia coli O25b:H4-ST131 strain 13.1 plasmid p131, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

905. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to MK295830 (Escherichia coli O25b:H4-ST131 strain 425 plasmid p425, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

906. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to MK295832 (Escherichia coli O25b:H4-ST131 strain B14 plasmid pB14, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

907. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to MK295834 (Escherichia coli O25b:H4-ST131 strain 56 plasmid p56, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

908. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP026931 (Escherichia coli strain CFS3246 plasmid pCFS3246-2, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

909. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to JX127248 (Uncultured bacterium plasmid pRSB225, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

910. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP025254 (Escherichia coli strain BH100L substr. MG2014 plasmid pBH100alpha, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

911. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP014320 (Escherichia coli JJ1887 plasmid pJJ1887-5, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

912. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_LT985265 (Escherichia coli strain 364 plasmid RCS57TR364_p, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

913. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_LT985219 (Escherichia coli strain 497 plasmid RCS21_p, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

914. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_LT985304 (Escherichia coli strain ECOR 31 plasmid RCS89_p, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

915. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_LT985214 (Escherichia coli strain 649 plasmid RCS101_p, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

916. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_LT985226 (Escherichia coli strain 525 plasmid RCS27_p, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

917. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_LT985274 (Escherichia coli strain 723 plasmid RCS66_p, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

918. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_LT985267 (Escherichia coli strain 637 plasmid RCS61_p, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

919. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_LT985272 (Escherichia coli strain 506 plasmid RCS62_pI, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

920. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_LT985309 (Escherichia coli strain CIP106223 plasmid RCS93_pI, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

921. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_LT985277 (Escherichia coli strain 522 plasmid RCS65_p, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

922. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP018954 (Escherichia coli strain Ecol_316 plasmid pEC316_3, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

923. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to MK295819 (Escherichia coli O25b:H4-ST131 strain U10 plasmid pU10, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

924. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to MK295820 (Escherichia coli O25b:H4-ST131 strain B28 plasmid pB28, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

925. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP047637 (Klebsiella pneumoniae strain K2606 plasmid unnamed4, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

926. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_MK291500 (Escherichia coli strain 15978 plasmid pHN15978-1, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

927. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_MK878893 (Escherichia coli strain J53 plasmid pMG335, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

928. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_MK878893 (Escherichia coli strain J53 plasmid pMG335, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aacagccacagccacaacagccacaacagcca	Protospacer
*.*  * *****.********.********.*

929. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_MN101852 (Escherichia coli strain 13ZX28-TC-98 plasmid p13ZX28-TC-98, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

930. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_MN101854 (Escherichia coli strain 13ZX36 plasmid p13ZX36-70, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

931. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_MN101850 (Escherichia coli strain 13ZX28 plasmid p13ZX28-272, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

932. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_MK797990 (Salmonella enterica subsp. enterica serovar Wien strain ZM3 plasmid pZM3, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

933. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_MN328348 (Salmonella enterica subsp. enterica serovar Enteritidis strain S14 plasmid pTS14, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

934. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_AP018939 (Escherichia coli strain JSWP006 plasmid pJSWP006_1, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

935. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NC_005327 (Escherichia coli plasmid pC15-1a, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

936. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP041393 (Escherichia coli strain ECOL-18-VL-LA-PA-Ryan-0026 plasmid p45407_1, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

937. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP045943 (Shigella flexneri 2a strain AUSMDU00010535 plasmid pAUSMDU00010535_02, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

938. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_MH316135 (Salmonella enterica subsp. enterica serovar Indiana strain GDD25-16 plasmid pGDD25-16, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

939. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_MH316136 (Salmonella enterica subsp. enterica serovar Indiana strain GDD25-21 plasmid pGDD25-21, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

940. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_MH917279 (Klebsiella pneumoniae strain A1706 plasmid pA1706-NDM, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

941. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_MH909349 (Klebsiella pneumoniae strain A1705 plasmid pA1705-NDM, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

942. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_MH909349 (Klebsiella pneumoniae strain A1705 plasmid pA1705-NDM, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

943. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_MH316133 (Salmonella enterica subsp. enterica serovar Indiana strain GDD25-3 plasmid pGDD25-3, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

944. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_MH626559 (Salmonella enterica subsp. enterica serovar Typhimurium strain ST1007 plasmid pST1007-1C, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

945. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_MH316134 (Salmonella enterica subsp. enterica serovar Indiana strain GDD25-5 plasmid pGDD25-5, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

946. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_MH626558 (Salmonella enterica subsp. enterica serovar Typhimurium strain ST1007 plasmid pST1007-1B, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

947. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_MH257956 (Escherichia coli strain 104 plasmid pHXH-4, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

948. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_MK048477 (Escherichia coli strain U-5227 plasmid pUB_DHA-1, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

949. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_MN197360 (Escherichia coli strain 5P plasmid pVSI_NDM_5, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

950. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_MN218686 (Escherichia coli strain 5M plasmid pISV_IncFII_NDM-5, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

951. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_MN537908 (Escherichia coli strain E.coli4feg plasmid pIV_IncFII_DHA, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

952. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NC_017722 (Escherichia coli ETEC H10407 plasmid p666, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

953. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_MG886288 (Escherichia coli strain MO plasmid pMO, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

954. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_MG904998 (Escherichia coli strain 15OD0495 plasmid p15ODTXV, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

955. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_MF156713 (Escherichia coli strain 06028078 plasmid p28078-NDM, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

956. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_MG825370 (Escherichia coli strain 974 plasmid p974-NDM, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

957. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_MF156697 (Escherichia coli strain BTR plasmid pBTR-CTXM, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

958. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_MG764548 (Escherichia coli strain 11011 plasmid p11011-fosA, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

959. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_MG677985 (Escherichia coli strain LN310P plasmid pEC12, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

960. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_MG656414 (Escherichia coli strain 15-50 plasmid pEC15-MCR-50, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

961. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_MH257753 (Salmonella enterica subsp. enterica serovar Typhimurium strain 1007 plasmid pST1007-1A, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

962. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_MH648141 (Salmonella enterica subsp. enterica serovar Typhimurium strain ST1007 plasmid pST1007-1D, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

963. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP029422 (Escherichia coli strain 3385 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

964. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP032226 (Klebsiella pneumoniae strain AR_0046 plasmid unnamed4, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

965. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_KY706108 (Escherichia coli strain pAA-ST131 plasmid ESBL20150001, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

966. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_LC506716 (Klebsiella pneumoniae strain JUNP053 plasmid pJUNP53, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

967. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_KY865320 (Escherichia coli strain SH21G plasmid pEC295cfr, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

968. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_LC506719 (Klebsiella pneumoniae strain JUNP254 plasmid pJUNP254, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

969. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_LC506719 (Klebsiella pneumoniae strain JUNP254 plasmid pJUNP254, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
gccacaaacagccacaacagccacaacagcca	Protospacer
. * * ******.********.********.*

970. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_LC506717 (Klebsiella pneumoniae strain JUNP054 plasmid pJUNP054, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

971. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_LC506718 (Klebsiella pneumoniae strain JUNP055 plasmid pJUNP055, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

972. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_LC506720 (Klebsiella pneumoniae strain JUNP268 plasmid pJUNP268, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

973. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_MG288681 (Klebsiella aerogenes strain E20 plasmid pE20-FIIA, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

974. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP023816 (Escherichia coli strain IMT16316 plasmid pEcIMT16316, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

975. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP048362 (Escherichia coli strain 53 plasmid p53_C, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

976. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP011064 (Escherichia coli str. Sanji plasmid pSJ_94, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

977. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP011065 (Escherichia coli str. Sanji plasmid pSJ_82, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

978. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP023828 (Escherichia coli strain 4/4 plasmid p4_4.2, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagcca	Protospacer
** .. ******.********.********.*

979. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to MG592444 (Vibrio phage 1.067.O._10N.261.52.C9, partial genome) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aataccaacagcaacaacagcaacaacagcag	Protospacer
*.. ******** ******** ******** .

980. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP046054 (Methylocystis heyeri strain H2 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.781

agctccaacagctacaacagctacaacagcta	CRISPR spacer
ggccgtatcagctacaagagctacaacggcta	Protospacer
.**. .* ********* *********.****

981. spacer 1.29|644919|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP021875 (Enterococcus wangshanyuanii strain MN05 plasmid unnamed2) position: , mismatch: 7, identity: 0.781

aactcgctagcttttttagatacatagctctt	CRISPR spacer
agctatctatcttttttagataaatagctgtg	Protospacer
*.**  *** ************ ****** *

982. spacer 1.29|644919|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP021876 (Enterococcus wangshanyuanii strain MN05 plasmid unnamed3) position: , mismatch: 7, identity: 0.781

aactcgctagcttttttagatacatagctctt	CRISPR spacer
agctatctatcttttttagataaatagctgtg	Protospacer
*.**  *** ************ ****** *

983. spacer 1.29|644919|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP021876 (Enterococcus wangshanyuanii strain MN05 plasmid unnamed3) position: , mismatch: 7, identity: 0.781

aactcgctagcttttttagatacatagctctt	CRISPR spacer
agctatctatcttttttagataaatagctgtg	Protospacer
*.**  *** ************ ****** *

984. spacer 1.29|644919|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP021876 (Enterococcus wangshanyuanii strain MN05 plasmid unnamed3) position: , mismatch: 7, identity: 0.781

aactcgctagcttttttagatacatagctctt	CRISPR spacer
agctatctatcttttttagataaatagctgtg	Protospacer
*.**  *** ************ ****** *

985. spacer 1.29|644919|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP021877 (Enterococcus wangshanyuanii strain MN05 plasmid unnamed4) position: , mismatch: 7, identity: 0.781

aactcgctagcttttttagatacatagctctt	CRISPR spacer
agctatctatcttttttagataaatagctgtg	Protospacer
*.**  *** ************ ****** *

986. spacer 1.33|645163|32|NC_013928|CRISPRCasFinder,CRT matches to NC_014825 (Ruminococcus albus 7 = DSM 20455 plasmid pRUMAL02, complete sequence) position: , mismatch: 7, identity: 0.781

gacctcagttgctatcctcttttttattgttg	CRISPR spacer
ctgccgagttgcagtcctcttttttattgttg	Protospacer
   *. ****** .******************

987. spacer 2.7|744423|30|NC_013928|CRISPRCasFinder,CRT matches to KJ094022 (Listeria phage LP-030-3, complete genome) position: , mismatch: 7, identity: 0.767

gttgcttatgcagatgataacacaggcgca	CRISPR spacer
gttgcttatgcagatgatatcaataggcta	Protospacer
******************* **  .*  .*

988. spacer 2.10|744621|30|NC_013928|CRISPRCasFinder,CRT matches to NZ_LN832560 (Paracoccus aminovorans isolate JCM7685 plasmid II, complete sequence) position: , mismatch: 7, identity: 0.767

ctctagcgcttatttcgaggacagcggagc	CRISPR spacer
cgtcagcgcgtatttcgaggacagcgcaaa	Protospacer
* ..***** **************** *.

989. spacer 2.11|744687|30|NC_013928|CRISPRCasFinder,CRT matches to NC_031922 (Synechococcus phage S-CAM9 isolate 1109NB16, complete genome) position: , mismatch: 7, identity: 0.767

tcattgctcttgacatcaataactttttca	CRISPR spacer
aatctacaattgacatcaataactttttca	Protospacer
   .*.*  *********************

990. spacer 2.11|744687|30|NC_013928|CRISPRCasFinder,CRT matches to KU686204 (Synechococcus phage S-CAM9 isolate 0808SB05, complete genome) position: , mismatch: 7, identity: 0.767

tcattgctcttgacatcaataactttttca	CRISPR spacer
aatctacaattgacatcaataactttttca	Protospacer
   .*.*  *********************

991. spacer 2.11|744687|30|NC_013928|CRISPRCasFinder,CRT matches to KU686205 (Synechococcus phage S-CAM9 isolate 0908SB82, complete genome) position: , mismatch: 7, identity: 0.767

tcattgctcttgacatcaataactttttca	CRISPR spacer
aatctacaattgacatcaataactttttca	Protospacer
   .*.*  *********************

992. spacer 2.11|744687|30|NC_013928|CRISPRCasFinder,CRT matches to MH629685 (Synechococcus virus S-PRM1, complete genome) position: , mismatch: 7, identity: 0.767

tcattgctcttgacatcaataactttttca	CRISPR spacer
tatctacgattgacatcaatgactttttca	Protospacer
*  .*.*  ***********.*********

993. spacer 2.13|744819|30|NC_013928|CRISPRCasFinder,CRT matches to MH617537 (Phage sp. isolate ctcb314, complete genome) position: , mismatch: 7, identity: 0.767

-tggcaatttaccagcacagcaattgctggc	CRISPR spacer
acagc-attcaccagcacagcaaatgctgca	Protospacer
 ..** ***.************* *****

994. spacer 2.22|745413|30|NC_013928|CRISPRCasFinder,CRT matches to NC_023610 (Erwinia phage PhiEaH1, complete genome) position: , mismatch: 7, identity: 0.767

ttgaccgtgataaagtgttcaaccacacgt	CRISPR spacer
tcgaccttgacaaagtgttcaaccagcatt	Protospacer
*.**** ***.**************    *

995. spacer 2.25|745611|30|NC_013928|CRISPRCasFinder,CRT matches to MH884508 (Bacillus phage vB_BcoS-136, complete genome) position: , mismatch: 7, identity: 0.767

ccactcttgctcctgattggtcaaatcaaa	CRISPR spacer
acattcttgctcctaattggtcaaatagct	Protospacer
 **.**********.*********** .

996. spacer 2.32|746073|30|NC_013928|CRISPRCasFinder,CRT matches to MT661596 (Proteus phage 10, complete genome) position: , mismatch: 7, identity: 0.767

aatgtatgcaccgcgttttttaacaaaata	CRISPR spacer
gttatacgcacagcgttttttaacaaagaa	Protospacer
. *.**.**** ***************. *

997. spacer 2.41|746667|30|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP032054 (Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence) position: , mismatch: 7, identity: 0.767

tgacggaaacagagacggaacggcaactgt	CRISPR spacer
ggacggaaacggaaacggaacggcgagggg	Protospacer
 *********.**.**********.*  *

998. spacer 2.41|746667|30|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP032054 (Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence) position: , mismatch: 7, identity: 0.767

tgacggaaacagagacggaacggcaactgt	CRISPR spacer
ggacggaaacggaaacggaacggcgagggc	Protospacer
 *********.**.**********.*  *.

999. spacer 2.41|746667|30|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 7, identity: 0.767

tgacggaaacagagacggaacggcaactgt	CRISPR spacer
ggacggaaacggaaacggaacggcgagggc	Protospacer
 *********.**.**********.*  *.

1000. spacer 2.41|746667|30|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP016560 (Streptomyces clavuligerus strain F613-1 plasmid pSCL4, complete sequence) position: , mismatch: 7, identity: 0.767

tgacggaaacagagacggaacggcaactgt	CRISPR spacer
ggacggaaacggaaacggaacggcgagggc	Protospacer
 *********.**.**********.*  *.

1001. spacer 2.48|747130|30|NC_013928|CRISPRCasFinder,CRT,PILER-CR matches to KC595513 (Bacillus phage Shanette, complete genome) position: , mismatch: 7, identity: 0.767

agagtatagccagtgttttca-----aggccttta	CRISPR spacer
agagtatagccagtgtcttcacgagtaagc-----	Protospacer
****************.****     *.**

1002. spacer 2.48|747130|30|NC_013928|CRISPRCasFinder,CRT,PILER-CR matches to NC_028982 (Bacillus phage JL, complete genome) position: , mismatch: 7, identity: 0.767

agagtatagccagtgttttca-----aggccttta	CRISPR spacer
agagtatagccagtgtcttcacgagtaagc-----	Protospacer
****************.****     *.**

1003. spacer 2.52|747394|30|NC_013928|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP031070 (Bacillus sp. JAS24-2 plasmid pl278, complete sequence) position: , mismatch: 7, identity: 0.767

cagtatacgccatattccatcaggatgact	CRISPR spacer
tagtatacgccattttcaatcaggaaaatc	Protospacer
.************ *** ******* .*..

1004. spacer 2.52|747394|30|NC_013928|CRISPRCasFinder,CRT,PILER-CR matches to MN693411 (Marine virus AFVG_25M210, complete genome) position: , mismatch: 7, identity: 0.767

cagtatacgccatattccatcaggatgact	CRISPR spacer
cttacttccccatattccatcaggctgact	Protospacer
*    * * *************** *****

1005. spacer 2.55|747592|30|NC_013928|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP048281 (Rhizobium leguminosarum bv. viciae 248 plasmid pRle248e, complete sequence) position: , mismatch: 7, identity: 0.767

ttaaaaagctgacaaaagacagcaatgaga	CRISPR spacer
ccaaaaagctgacaaaagacggcaagtacg	Protospacer
..******************.****  * .

1006. spacer 2.55|747592|30|NC_013928|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP031652 (Pantoea agglomerans strain TH81 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.767

ttaaaaagctgacaaaagacagcaatgaga	CRISPR spacer
ctaaaaaccttacaaaagacagcaagtgaa	Protospacer
.****** ** **************  ..*

1007. spacer 2.57|747724|30|NC_013928|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP048281 (Rhizobium leguminosarum bv. viciae 248 plasmid pRle248e, complete sequence) position: , mismatch: 7, identity: 0.767

ttaaaaagctgacaaaagacagcaatgaga	CRISPR spacer
ccaaaaagctgacaaaagacggcaagtacg	Protospacer
..******************.****  * .

1008. spacer 2.57|747724|30|NC_013928|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP031652 (Pantoea agglomerans strain TH81 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.767

ttaaaaagctgacaaaagacagcaatgaga	CRISPR spacer
ctaaaaaccttacaaaagacagcaagtgaa	Protospacer
.****** ** **************  ..*

1009. spacer 2.61|747988|30|NC_013928|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP045721 (Pantoea eucalypti strain LMG 24197 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

tcagataaagatttttttggaaagtacaat	CRISPR spacer
tgctttcaagattttttttgaaagtacaac	Protospacer
*    * *********** **********.

1010. spacer 2.61|747988|30|NC_013928|CRISPRCasFinder,CRT,PILER-CR matches to MN693547 (Marine virus AFVG_25M424, complete genome) position: , mismatch: 7, identity: 0.767

tcagataaagatttttttggaaagtacaat	CRISPR spacer
ccagataaatatttttttggcaagtctgtt	Protospacer
.******** ********** **** .. *

1011. spacer 2.61|747988|30|NC_013928|CRISPRCasFinder,CRT,PILER-CR matches to MN693297 (Marine virus AFVG_25M423, complete genome) position: , mismatch: 7, identity: 0.767

tcagataaagatttttttggaaagtacaat	CRISPR spacer
ccagataaatatttttttggcaagtctgtt	Protospacer
.******** ********** **** .. *

1012. spacer 2.61|747988|30|NC_013928|CRISPRCasFinder,CRT,PILER-CR matches to MN693353 (Marine virus AFVG_25M425, complete genome) position: , mismatch: 7, identity: 0.767

tcagataaagatttttttggaaagtacaat	CRISPR spacer
ccagataaatatttttttggcaagtctgtt	Protospacer
.******** ********** **** .. *

1013. spacer 2.61|747988|30|NC_013928|CRISPRCasFinder,CRT,PILER-CR matches to NC_014633 (Ilyobacter polytropus DSM 2926 plasmid pILYOP01, complete sequence) position: , mismatch: 7, identity: 0.767

tcagataaagatttttttggaaagtacaat	CRISPR spacer
gaagctaaagatttttttggaaaagagact	Protospacer
  ** ******************. * * *

1014. spacer 2.61|747988|30|NC_013928|CRISPRCasFinder,CRT,PILER-CR matches to CP024913 (Cyanobacterium sp. HL-69 plasmid pCHL69-1, complete sequence) position: , mismatch: 7, identity: 0.767

tcagataaagatttttttggaaagtacaat	CRISPR spacer
caggataatgatttttttgcaaagtatatt	Protospacer
. .***** ********** ******.* *

1015. spacer 2.62|748054|30|NC_013928|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP009368 (Bacillus cereus strain FM1 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

tattaaattacttgtaattacaaagcctaa	CRISPR spacer
tattaaataacttgtaattaaaaacttcat	Protospacer
******** *********** *** ...*

1016. spacer 2.62|748054|30|NC_013928|CRISPRCasFinder,CRT,PILER-CR matches to NZ_KR611317 (Rickettsia endosymbiont of Ixodes pacificus strain Humboldt plasmid pREIP, complete sequence) position: , mismatch: 7, identity: 0.767

tattaaattacttgtaattacaaagcctaa	CRISPR spacer
ttttaaattacttggaattacaacttatat	Protospacer
* ************ ********  . **

1017. spacer 2.62|748054|30|NC_013928|CRISPRCasFinder,CRT,PILER-CR matches to NZ_KR611317 (Rickettsia endosymbiont of Ixodes pacificus strain Humboldt plasmid pREIP, complete sequence) position: , mismatch: 7, identity: 0.767

tattaaattacttgtaattacaaagcctaa	CRISPR spacer
ttttaaattacttggaattacaacttatat	Protospacer
* ************ ********  . **

1018. spacer 2.62|748054|30|NC_013928|CRISPRCasFinder,CRT,PILER-CR matches to NZ_KR611317 (Rickettsia endosymbiont of Ixodes pacificus strain Humboldt plasmid pREIP, complete sequence) position: , mismatch: 7, identity: 0.767

tattaaattacttgtaattacaaagcctaa	CRISPR spacer
ttttaaattacttggaattacaacttatat	Protospacer
* ************ ********  . **

1019. spacer 2.62|748054|30|NC_013928|CRISPRCasFinder,CRT,PILER-CR matches to NZ_KR611317 (Rickettsia endosymbiont of Ixodes pacificus strain Humboldt plasmid pREIP, complete sequence) position: , mismatch: 7, identity: 0.767

tattaaattacttgtaattacaaagcctaa	CRISPR spacer
ttttaaattacttggaattacaacttatat	Protospacer
* ************ ********  . **

1020. spacer 2.62|748054|30|NC_013928|CRISPRCasFinder,CRT,PILER-CR matches to NZ_KR611317 (Rickettsia endosymbiont of Ixodes pacificus strain Humboldt plasmid pREIP, complete sequence) position: , mismatch: 7, identity: 0.767

tattaaattacttgtaattacaaagcctaa	CRISPR spacer
ttttaaattacttggaattacaacttatat	Protospacer
* ************ ********  . **

1021. spacer 2.62|748054|30|NC_013928|CRISPRCasFinder,CRT,PILER-CR matches to NZ_KR611317 (Rickettsia endosymbiont of Ixodes pacificus strain Humboldt plasmid pREIP, complete sequence) position: , mismatch: 7, identity: 0.767

tattaaattacttgtaattacaaagcctaa	CRISPR spacer
ttttaaattacttggaattacaacttatat	Protospacer
* ************ ********  . **

1022. spacer 2.62|748054|30|NC_013928|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013134 (Rickettsia rhipicephali strain HJ#5 plasmid pHJ51, complete sequence) position: , mismatch: 7, identity: 0.767

tattaaattacttgtaattacaaagcctaa	CRISPR spacer
ttttaaattacttggaattacaacttatat	Protospacer
* ************ ********  . **

1023. spacer 2.62|748054|30|NC_013928|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013134 (Rickettsia rhipicephali strain HJ#5 plasmid pHJ51, complete sequence) position: , mismatch: 7, identity: 0.767

tattaaattacttgtaattacaaagcctaa	CRISPR spacer
ttttaaattacttggaattacaacttatat	Protospacer
* ************ ********  . **

1024. spacer 2.62|748054|30|NC_013928|CRISPRCasFinder,CRT,PILER-CR matches to NZ_AP018261 (Calothrix sp. NIES-4071 plasmid plasmid6 DNA, complete genome) position: , mismatch: 7, identity: 0.767

tattaaattacttgtaattacaaagcctaa	CRISPR spacer
taaaaaattacttggaattacaaaggaaga	Protospacer
**  ********** **********   .*

1025. spacer 2.65|748252|31|NC_013928|CRISPRCasFinder,CRT,PILER-CR matches to NC_008271 (Rhodococcus jostii RHA1 plasmid pRHL3, complete sequence) position: , mismatch: 7, identity: 0.774

caaatttgccggcggggtcggtaaaacggtc	CRISPR spacer
ccagcgtctcggcggggtcggtgaaacggtc	Protospacer
* *.. * .*************.********

1026. spacer 2.68|748451|30|NC_013928|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP031992 (Acinetobacter haemolyticus strain 2126ch plasmid pAhaem2126chf, complete sequence) position: , mismatch: 7, identity: 0.767

ctgaccaagagaattaattctaaagataaa	CRISPR spacer
acaagtaatagaattaattctaaagatcaa	Protospacer
 ..* .** ****************** **

1027. spacer 2.68|748451|30|NC_013928|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP026415 (Acinetobacter sp. ACNIH2 plasmid pACI-55cf, complete sequence) position: , mismatch: 7, identity: 0.767

ctgaccaagagaattaattctaaagataaa	CRISPR spacer
acaagtaatagaattaattctaaagatcaa	Protospacer
 ..* .** ****************** **

1028. spacer 2.69|748517|30|NC_013928|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP031992 (Acinetobacter haemolyticus strain 2126ch plasmid pAhaem2126chf, complete sequence) position: , mismatch: 7, identity: 0.767

ctgaccaagagaattaattctaaagataaa	CRISPR spacer
acaagtaatagaattaattctaaagatcaa	Protospacer
 ..* .** ****************** **

1029. spacer 2.69|748517|30|NC_013928|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP026415 (Acinetobacter sp. ACNIH2 plasmid pACI-55cf, complete sequence) position: , mismatch: 7, identity: 0.767

ctgaccaagagaattaattctaaagataaa	CRISPR spacer
acaagtaatagaattaattctaaagatcaa	Protospacer
 ..* .** ****************** **

1030. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_KX008967 (Shigella sonnei strain 183660 plasmid p183660, complete sequence) position: , mismatch: 8, identity: 0.758

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagccg	Protospacer
*** .. ******.********.********..

1031. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP027554 (Escherichia coli strain 2013C-3513 plasmid unnamed1) position: , mismatch: 8, identity: 0.758

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
aacacacaacagccacaacagccacaacagcca	Protospacer
 *  . *******.********.********.*

1032. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_LC506719 (Klebsiella pneumoniae strain JUNP254 plasmid pJUNP254, complete sequence) position: , mismatch: 8, identity: 0.758

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
agccacaaacagccacaacagccacaacagcca	Protospacer
 . * * ******.********.********.*

1033. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP023471 (Salmonella enterica subsp. enterica strain BAA-1672 plasmid pSalSendai, complete sequence) position: , mismatch: 8, identity: 0.758

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caggctgaacagccacaacagccacaacagccg	Protospacer
*** .. ******.********.********..

1034. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP046054 (Methylocystis heyeri strain H2 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.758

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
gggccgtatcagctacaagagctacaacggcta	Protospacer
 .**. .* ********* *********.****

1035. spacer 1.5|644551|33|NC_013928|PILER-CR matches to MG592454 (Vibrio phage 1.079.O._10N.286.45.E9, partial genome) position: , mismatch: 8, identity: 0.758

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
caacaacaacagcaacaacagcaacaacagtat	Protospacer
**.*  ******* ******** *******.

1036. spacer 1.15|645162|33|NC_013928|PILER-CR matches to NC_014825 (Ruminococcus albus 7 = DSM 20455 plasmid pRUMAL02, complete sequence) position: , mismatch: 8, identity: 0.758

tgacctcagttgctatcctcttttttattgttg	CRISPR spacer
gctgccgagttgcagtcctcttttttattgttg	Protospacer
    *. ****** .******************

1037. spacer 1.21|644430|32|NC_013928|CRISPRCasFinder,CRT matches to MN444876 (Streptomyces phage Daubenski, complete genome) position: , mismatch: 8, identity: 0.75

gcttggaaagattgaccacacagggtcaggcg	CRISPR spacer
aaatgacaagattgaccacccaaggtcaggct	Protospacer
.  **. ************ **.********

1038. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_KJ201887 (Shigella flexneri 4c strain 072 plasmid pSF07201, complete sequence) position: , mismatch: 8, identity: 0.75

agctccaacagctacaacagctacaacagcta	CRISPR spacer
gccacacacagccacaacagccacaacagcca	Protospacer
. * *  *****.********.********.*

1039. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_KX008967 (Shigella sonnei strain 183660 plasmid p183660, complete sequence) position: , mismatch: 8, identity: 0.75

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagccg	Protospacer
** .. ******.********.********..

1040. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP044550 (Hydrogenophaga sp. BPS33 plasmid pBPS33-1, complete sequence) position: , mismatch: 8, identity: 0.75

agctccaacagctacaacagctacaacagcta	CRISPR spacer
agaagcaacaggtacaacaggtacaacaggag	Protospacer
**   ****** ******** ********  .

1041. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP023471 (Salmonella enterica subsp. enterica strain BAA-1672 plasmid pSalSendai, complete sequence) position: , mismatch: 8, identity: 0.75

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aggctgaacagccacaacagccacaacagccg	Protospacer
** .. ******.********.********..

1042. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to MG592454 (Vibrio phage 1.079.O._10N.286.45.E9, partial genome) position: , mismatch: 8, identity: 0.75

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aacaacaacagcaacaacagcaacaacagtat	Protospacer
*.*  ******* ******** *******.

1043. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to MT511058 (Escherichia phage vB_EcoD_SU57, complete genome) position: , mismatch: 8, identity: 0.75

agctccaacagctacaacagctacaacagcta	CRISPR spacer
cacaacaacagcaacaacagcaacaacaacaa	Protospacer
 .*  ******* ******** ******.* *

1044. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP026096 (Bacillus asahii strain OM18 plasmid pOM18, complete sequence) position: , mismatch: 8, identity: 0.75

agctccaacagctacaacagctacaacagcta	CRISPR spacer
tcctaataaagctacaacagctgcaatagcta	Protospacer
  **   * *************.***.*****

1045. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP016596 (Bacillus cereus strain K8 plasmid pBCM301, complete sequence) position: , mismatch: 8, identity: 0.75

agctccaacagctacaacagctacaacagcta	CRISPR spacer
agaacaaacagctccaacagctccaacaggat	Protospacer
**  * ******* ******** ******

1046. spacer 2.10|744621|30|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP035092 (Paracoccus denitrificans strain ATCC 19367 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ctctagcgcttatttcgaggacagcggagc	CRISPR spacer
ggtcagcgcgtatttcgaggacagcgcaaa	Protospacer
  ..***** **************** *.

1047. spacer 2.10|744621|30|NC_013928|CRISPRCasFinder,CRT matches to NC_008688 (Paracoccus denitrificans PD1222 plasmid 1, complete sequence) position: , mismatch: 8, identity: 0.733

ctctagcgcttatttcgaggacagcggagc	CRISPR spacer
ggtcagcgcgtatttcgaggacagcgcaaa	Protospacer
  ..***** **************** *.

1048. spacer 2.11|744687|30|NC_013928|CRISPRCasFinder,CRT matches to MN657033 (Psychrobacter sp. strain ANT_P15B plasmid pA15BP3, complete sequence) position: , mismatch: 8, identity: 0.733

tcattgctcttgacatcaataactttttca	CRISPR spacer
tattttctcttgtcatcaataactttgcgc	Protospacer
*  ** ****** ************* .

1049. spacer 2.12|744753|30|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP040783 (Bacillus thuringiensis strain HM-311 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.733

gagcaaaatcaactatctcaaagcttagtt	CRISPR spacer
ttataaattcaagtatctcaaagcttatgt	Protospacer
  ..*** **** **************  *

1050. spacer 2.12|744753|30|NC_013928|CRISPRCasFinder,CRT matches to NC_020394 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-233, complete sequence) position: , mismatch: 8, identity: 0.733

gagcaaaatcaactatctcaaagcttagtt	CRISPR spacer
ttataaattcaagtatctcaaagcttatgt	Protospacer
  ..*** **** **************  *

1051. spacer 2.12|744753|30|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP016596 (Bacillus cereus strain K8 plasmid pBCM301, complete sequence) position: , mismatch: 8, identity: 0.733

gagcaaaatcaactatctcaaagcttagtt	CRISPR spacer
ttataaattcaagtatctcaaagcttatgt	Protospacer
  ..*** **** **************  *

1052. spacer 2.12|744753|30|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 8, identity: 0.733

gagcaaaatcaactatctcaaagcttagtt	CRISPR spacer
ttataaattcaagtatctcaaagcttatgt	Protospacer
  ..*** **** **************  *

1053. spacer 2.12|744753|30|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP007616 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence) position: , mismatch: 8, identity: 0.733

gagcaaaatcaactatctcaaagcttagtt	CRISPR spacer
ttataaattcaagtatctcaaagcttatgt	Protospacer
  ..*** **** **************  *

1054. spacer 2.12|744753|30|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP007513 (Bacillus bombysepticus plasmid pBb, complete genome) position: , mismatch: 8, identity: 0.733

gagcaaaatcaactatctcaaagcttagtt	CRISPR spacer
ttataaattcaagtatctcaaagcttatgt	Protospacer
  ..*** **** **************  *

1055. spacer 2.12|744753|30|NC_013928|CRISPRCasFinder,CRT matches to NZ_AP014865 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK1, complete sequence) position: , mismatch: 8, identity: 0.733

gagcaaaatcaactatctcaaagcttagtt	CRISPR spacer
ttataaattcaagtatctcaaagcttatgt	Protospacer
  ..*** **** **************  *

1056. spacer 2.12|744753|30|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP053952 (Bacillus cereus strain FDAARGOS_798 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

gagcaaaatcaactatctcaaagcttagtt	CRISPR spacer
ttataaattcaagtatctcaaagcttatgt	Protospacer
  ..*** **** **************  *

1057. spacer 2.12|744753|30|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP011154 (Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence) position: , mismatch: 8, identity: 0.733

gagcaaaatcaactatctcaaagcttagtt	CRISPR spacer
ttataaattcaagtatctcaaagcttatgt	Protospacer
  ..*** **** **************  *

1058. spacer 2.12|744753|30|NC_013928|CRISPRCasFinder,CRT matches to CP020755 (Bacillus thuringiensis strain ATCC 10792 plasmid pLDW-16, complete sequence) position: , mismatch: 8, identity: 0.733

gagcaaaatcaactatctcaaagcttagtt	CRISPR spacer
ttataaattcaagtatctcaaagcttatgt	Protospacer
  ..*** **** **************  *

1059. spacer 2.12|744753|30|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP021062 (Bacillus thuringiensis strain ATCC 10792 plasmid poh1, complete sequence) position: , mismatch: 8, identity: 0.733

gagcaaaatcaactatctcaaagcttagtt	CRISPR spacer
ttataaattcaagtatctcaaagcttatgt	Protospacer
  ..*** **** **************  *

1060. spacer 2.12|744753|30|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP053949 (Bacillus cereus strain FDAARGOS_799 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

gagcaaaatcaactatctcaaagcttagtt	CRISPR spacer
ttataaattcaagtatctcaaagcttatgt	Protospacer
  ..*** **** **************  *

1061. spacer 2.12|744753|30|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP004877 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence) position: , mismatch: 8, identity: 0.733

gagcaaaatcaactatctcaaagcttagtt	CRISPR spacer
ttataaattcaagtatctcaaagcttatgt	Protospacer
  ..*** **** **************  *

1062. spacer 2.12|744753|30|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP004860 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence) position: , mismatch: 8, identity: 0.733

gagcaaaatcaactatctcaaagcttagtt	CRISPR spacer
ttataaattcaagtatctcaaagcttatgt	Protospacer
  ..*** **** **************  *

1063. spacer 2.12|744753|30|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP010112 (Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-6, complete sequence) position: , mismatch: 8, identity: 0.733

gagcaaaatcaactatctcaaagcttagtt	CRISPR spacer
ttataaattcaagtatctcaaagcttatgt	Protospacer
  ..*** **** **************  *

1064. spacer 2.12|744753|30|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP042875 (Bacillus cereus strain 09 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

gagcaaaatcaactatctcaaagcttagtt	CRISPR spacer
ttataaattcaagtatctcaaagcttatgt	Protospacer
  ..*** **** **************  *

1065. spacer 2.12|744753|30|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP011152 (Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence) position: , mismatch: 8, identity: 0.733

gagcaaaatcaactatctcaaagcttagtt	CRISPR spacer
ttataaattcaagtatctcaaagcttatgt	Protospacer
  ..*** **** **************  *

1066. spacer 2.12|744753|30|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP045607 (Bacillus cereus strain SB1 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.733

gagcaaaatcaactatctcaaagcttagtt	CRISPR spacer
ttataaattcaagtatctcaaagcttatgt	Protospacer
  ..*** **** **************  *

1067. spacer 2.12|744753|30|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP015730 (Bacillus cereus strain A1 plasmid pBCA1, complete sequence) position: , mismatch: 8, identity: 0.733

gagcaaaatcaactatctcaaagcttagtt	CRISPR spacer
ttataaattcaagtatctcaaagcttatgt	Protospacer
  ..*** **** **************  *

1068. spacer 2.12|744753|30|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP050184 (Bacillus thuringiensis strain HER1410 plasmid pLUSID1, complete sequence) position: , mismatch: 8, identity: 0.733

gagcaaaatcaactatctcaaagcttagtt	CRISPR spacer
ttataaattcaagtatctcaaagcttatgt	Protospacer
  ..*** **** **************  *

1069. spacer 2.12|744753|30|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP010090 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB426, complete sequence) position: , mismatch: 8, identity: 0.733

gagcaaaatcaactatctcaaagcttagtt	CRISPR spacer
ttataaattcaagtatctcaaagcttatgt	Protospacer
  ..*** **** **************  *

1070. spacer 2.20|745281|30|NC_013928|CRISPRCasFinder,CRT matches to MK448662 (Streptococcus satellite phage Javan97, complete genome) position: , mismatch: 8, identity: 0.733

gattaaaaacatagatgaaaacggctattt	CRISPR spacer
tattaaacacatagatgaaaacggtgtaga	Protospacer
 ****** ****************.

1071. spacer 2.20|745281|30|NC_013928|CRISPRCasFinder,CRT matches to MK448350 (Streptococcus satellite phage Javan19, complete genome) position: , mismatch: 8, identity: 0.733

gattaaaaacatagatgaaaacggctattt	CRISPR spacer
tattaaacacatagatgaaaacggtgtaga	Protospacer
 ****** ****************.

1072. spacer 2.20|745281|30|NC_013928|CRISPRCasFinder,CRT matches to NZ_AP018727 (Streptococcus dysgalactiae strain Kdys0611 plasmid pFGCSD1, complete sequence) position: , mismatch: 8, identity: 0.733

gattaaaaacatagatgaaaacggctattt	CRISPR spacer
tattaaacacatagatgaaaacggtgtaga	Protospacer
 ****** ****************.

1073. spacer 2.20|745281|30|NC_013928|CRISPRCasFinder,CRT matches to NZ_AP018728 (Streptococcus dysgalactiae strain Kdys0611 plasmid pFGCSD2, complete sequence) position: , mismatch: 8, identity: 0.733

gattaaaaacatagatgaaaacggctattt	CRISPR spacer
tattaaacacatagatgaaaacggtgtaga	Protospacer
 ****** ****************.

1074. spacer 2.20|745281|30|NC_013928|CRISPRCasFinder,CRT matches to NZ_AP018730 (Streptococcus dysgalactiae strain Kdys0611 plasmid pFGCSD4, complete sequence) position: , mismatch: 8, identity: 0.733

gattaaaaacatagatgaaaacggctattt	CRISPR spacer
tattaaacacatagatgaaaacggtgtaga	Protospacer
 ****** ****************.

1075. spacer 2.20|745281|30|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP026413 (Acinetobacter sp. ACNIH2 plasmid pACI-35f6, complete sequence) position: , mismatch: 8, identity: 0.733

gattaaaaacatagatgaaaacggctattt	CRISPR spacer
gattaaaaaaatagatgaaaaaagtcacca	Protospacer
********* *********** .*..*..

1076. spacer 2.20|745281|30|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP044467 (Acinetobacter schindleri strain HZE23-1 plasmid pHZE23-1-4, complete sequence) position: , mismatch: 8, identity: 0.733

gattaaaaacatagatgaaaacggctattt	CRISPR spacer
gattaaaaaaatagatgaaaaaagtcacca	Protospacer
********* *********** .*..*..

1077. spacer 2.20|745281|30|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP044448 (Acinetobacter indicus strain CMG3-2 plasmid pCMG3-2-3, complete sequence) position: , mismatch: 8, identity: 0.733

gattaaaaacatagatgaaaacggctattt	CRISPR spacer
gattaaaaaaatagatgaaaaaagtcacca	Protospacer
********* *********** .*..*..

1078. spacer 2.20|745281|30|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP033126 (Acinetobacter wuhouensis strain WCHAW010062 plasmid p6_010062, complete sequence) position: , mismatch: 8, identity: 0.733

gattaaaaacatagatgaaaacggctattt	CRISPR spacer
gattaaaaaaatagatgaaaaaagtcacca	Protospacer
********* *********** .*..*..

1079. spacer 2.28|745809|30|NC_013928|CRISPRCasFinder,CRT matches to NC_007949 (Polaromonas sp. JS666 plasmid 1, complete sequence) position: , mismatch: 8, identity: 0.733

atgaaaagcctcgtttctaaggcttttggt	CRISPR spacer
ccagaagccctcgtttcaaaggcttttgga	Protospacer
 ...**. ********* ***********

1080. spacer 2.31|746007|30|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP007544 (Synechocystis sp. PCC 6714 plasmid pSYLB, complete sequence) position: , mismatch: 8, identity: 0.733

ttcaatcggtgatgatattgtctgctatca	CRISPR spacer
catcatcggtgatgataatgtctgctactt	Protospacer
. . ************* *********..

1081. spacer 2.31|746007|30|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP015111 (Acinetobacter sp. TGL-Y2 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttcaatcggtgatgatattgtctgctatca	CRISPR spacer
ttcaatcggtgatgatactgttcacctaga	Protospacer
*****************.***...*.   *

1082. spacer 2.31|746007|30|NC_013928|CRISPRCasFinder,CRT matches to NC_049466 (Escherichia phage vB_EcoM_4HA13, complete genome) position: , mismatch: 8, identity: 0.733

ttcaatcggtgatgatattgtctgctatca	CRISPR spacer
gtttgtcggtgatgatatagtctgctctgc	Protospacer
 *. .************* ******* *

1083. spacer 2.34|746205|30|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP031851 (Klebsiella pneumoniae strain 121 plasmid pKP121-2, complete sequence) position: , mismatch: 8, identity: 0.733

ataaagacgaatataaagacccgagcactt	CRISPR spacer
attaagacgaatataaagaccgataccaat	Protospacer
** ****************** . .*   *

1084. spacer 2.37|746403|30|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP041514 (Klebsiella michiganensis strain KNU07 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

ttctggctgtctttcagagtgataagcgca	CRISPR spacer
ccttcgctgtctttcagggtgataagctgg	Protospacer
...* ************.*********  .

1085. spacer 2.39|746535|30|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP016288 (Rhizobium leguminosarum strain Vaf10 plasmid unnamed7, complete sequence) position: , mismatch: 8, identity: 0.733

cgccggttacaaccggttgaacgcctgcgt	CRISPR spacer
cgccgattacaagcggttgaacgatgtctc	Protospacer
*****.****** ********** .  * .

1086. spacer 2.49|747196|30|NC_013928|CRISPRCasFinder,CRT,PILER-CR matches to NC_014661 (Acinetobacter phage Acj61, complete genome) position: , mismatch: 8, identity: 0.733

cgcaacaatgactattaatatcaacggtgg	CRISPR spacer
ctatacaatgactgttgatatcaacggcac	Protospacer
*   *********.**.**********..

1087. spacer 2.53|747460|30|NC_013928|CRISPRCasFinder,CRT,PILER-CR matches to MN692973 (Marine virus AFVG_117M33, complete genome) position: , mismatch: 8, identity: 0.733

cgataaagctactgtagcaattaaaggcta	CRISPR spacer
ttttgaagcttctgtagcaattaaagctaa	Protospacer
.  *.***** *************** . *

1088. spacer 2.56|747658|30|NC_013928|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP021147 (Vibrio campbellii strain LA16-V1 plasmid pLA16-1, complete sequence) position: , mismatch: 8, identity: 0.733

aatcgcttctttgctaaccacaatttgtgc	CRISPR spacer
aatcgcttctttgccaaccactttgcagtc	Protospacer
**************.******  * ..  *

1089. spacer 2.65|748252|31|NC_013928|CRISPRCasFinder,CRT,PILER-CR matches to NC_010553 (Burkholderia ambifaria MC40-6 plasmid pBMC401, complete sequence) position: , mismatch: 8, identity: 0.742

caaatttgccggcggggtcggtaaaacggtc	CRISPR spacer
aaaatttgccggcgtggtcggcaagaggaaa	Protospacer
 ************* ******.**.* *.

1090. spacer 2.67|748385|30|NC_013928|CRISPRCasFinder,CRT,PILER-CR matches to NC_011783 (Borreliella burgdorferi ZS7 plasmid ZS7_lp25, complete sequence) position: , mismatch: 8, identity: 0.733

gaaaaggaaaatcttacttagctcatgagt	CRISPR spacer
aagtgataaaatcttccttagctaatgagt	Protospacer
.*. .. ******** ******* ******

1091. spacer 1.3|644429|33|NC_013928|PILER-CR matches to MN444876 (Streptomyces phage Daubenski, complete genome) position: , mismatch: 9, identity: 0.727

tgcttggaaagattgaccacacagggtcaggcg	CRISPR spacer
caaatgacaagattgaccacccaaggtcaggct	Protospacer
..  **. ************ **.********

1092. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP044550 (Hydrogenophaga sp. BPS33 plasmid pBPS33-1, complete sequence) position: , mismatch: 9, identity: 0.727

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
aagaagcaacaggtacaacaggtacaacaggag	Protospacer
 **   ****** ******** ********  .

1093. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_AP018684 (Vibrio casei strain DSM 22364 plasmid 3, complete sequence) position: , mismatch: 9, identity: 0.719

agctccaacagctacaacagctacaacagcta	CRISPR spacer
aatatagacagcaacaacagcaacaacagcaa	Protospacer
*.. . .***** ******** ******** *

1094. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP013482 (Pandoraea apista strain DSM 16535 plasmid pPA35, complete sequence) position: , mismatch: 9, identity: 0.719

agctccaacagctacaacagctacaacagcta	CRISPR spacer
caatccaacggctacaacagctacgacaatgc	Protospacer
 . ******.**************.***..

1095. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP013482 (Pandoraea apista strain DSM 16535 plasmid pPA35, complete sequence) position: , mismatch: 9, identity: 0.719

agctccaacagctacaacagctacaacagcta	CRISPR spacer
caatccaacggctacaacagctacgacaatgc	Protospacer
 . ******.**************.***..

1096. spacer 1.23|644552|32|NC_013928|CRISPRCasFinder,CRT matches to AP013406 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G15, isolate: uvMED-CGR-U-MedDCM-OCT-S46-C34) position: , mismatch: 9, identity: 0.719

agctccaacagctacaacagctacaacagcta	CRISPR spacer
taaaacaacaactacaacagctacaacaatca	Protospacer
 .   *****.*****************...*

1097. spacer 1.26|644735|32|NC_013928|CRISPRCasFinder,CRT matches to NC_029094 (Pseudoalteromonas phage H101, complete genome) position: , mismatch: 9, identity: 0.719

aaaatatacttcttttgtgaaagggttgagat	CRISPR spacer
ggtagaaacttcttttgtcaaagggttaagtg	Protospacer
.. * * *********** ********.**

1098. spacer 1.33|645163|32|NC_013928|CRISPRCasFinder,CRT matches to MK972710 (Salmonella phage SI22, complete genome) position: , mismatch: 9, identity: 0.719

gacctcagttgctatcctcttttttattgttg	CRISPR spacer
ttggcgaattgctaaccccttttttattgttg	Protospacer
    . *.****** **.**************

1099. spacer 1.33|645163|32|NC_013928|CRISPRCasFinder,CRT matches to NC_049459 (Salmonella phage SW9, complete genome) position: , mismatch: 9, identity: 0.719

gacctcagttgctatcctcttttttattgttg	CRISPR spacer
ttggcgaattgctaaccccttttttattgttg	Protospacer
    . *.****** **.**************

1100. spacer 1.34|645224|32|NC_013928|CRISPRCasFinder,CRT matches to MN234206 (Arthrobacter phage Racecar, complete genome) position: , mismatch: 9, identity: 0.719

gacggcaacgatagccctgagactgacaatcg	CRISPR spacer
cttgtcaacgatagccttgaaactgacatggg	Protospacer
  .* ***********.***.*******   *

1101. spacer 1.34|645224|32|NC_013928|CRISPRCasFinder,CRT matches to MN234211 (Arthrobacter phage Mimi, complete genome) position: , mismatch: 9, identity: 0.719

gacggcaacgatagccctgagactgacaatcg	CRISPR spacer
cttgtcaacgatagccttgaaactgacatggg	Protospacer
  .* ***********.***.*******   *

1102. spacer 2.6|744357|30|NC_013928|CRISPRCasFinder,CRT matches to KF669662 (Bacillus phage Spock, complete genome) position: , mismatch: 9, identity: 0.7

gattgtatcagtaatcgaacttctgcttat	CRISPR spacer
tatcgaatcagtaatcgaacttctaaaaga	Protospacer
 **.* ******************.   .

1103. spacer 2.6|744357|30|NC_013928|CRISPRCasFinder,CRT matches to KY888882 (Bacillus phage Flapjack, complete genome) position: , mismatch: 9, identity: 0.7

gattgtatcagtaatcgaacttctgcttat	CRISPR spacer
tatcgaatcagtaatcgaacttctaaaaga	Protospacer
 **.* ******************.   .

1104. spacer 2.12|744753|30|NC_013928|CRISPRCasFinder,CRT matches to NC_013940 (Deferribacter desulfuricans SSM1 megaplasmid pDF308, complete sequence) position: , mismatch: 9, identity: 0.7

gagcaaaatcaactatctcaaagcttagtt	CRISPR spacer
tttttaaatcaactatctgaaagtttagaa	Protospacer
   . ************* ****.****

1105. spacer 2.15|744951|30|NC_013928|CRISPRCasFinder,CRT matches to MN882542 (Escherichia phage JN01,complete genome) position: , mismatch: 9, identity: 0.7

aaagaataagttctctcacaatgtttgaaa	CRISPR spacer
tgttcataagttttctctcaatgtttgact	Protospacer
 .   *******.**** **********

1106. spacer 2.18|745149|30|NC_013928|CRISPRCasFinder,CRT matches to CP044351 (Escherichia coli strain 194195 plasmid p194195_1, complete sequence) position: , mismatch: 9, identity: 0.7

accttgtggtccgtcttctccgccactttc	CRISPR spacer
gggatgcggtccgtcttctccgccagcctg	Protospacer
.   **.****************** ..*

1107. spacer 2.18|745149|30|NC_013928|CRISPRCasFinder,CRT matches to NZ_AP023206 (Escherichia coli strain TUM18781 plasmid pMTY18781-1_lncX3, complete sequence) position: , mismatch: 9, identity: 0.7

accttgtggtccgtcttctccgccactttc	CRISPR spacer
gggatgcggtccgtcttctccgccagcctg	Protospacer
.   **.****************** ..*

1108. spacer 2.23|745479|30|NC_013928|CRISPRCasFinder,CRT matches to MN694079 (Marine virus AFVG_250M40, complete genome) position: , mismatch: 9, identity: 0.7

aaaaagaaacgccttttgatttgaccaatc	CRISPR spacer
gaaaagaaacgccttttgaatttgaagacg	Protospacer
.****************** ** .  .*.

1109. spacer 2.28|745809|30|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP025014 (Rhizobium leguminosarum strain Norway plasmid pRLN2, complete sequence) position: , mismatch: 9, identity: 0.7

atgaaaagcctcgtttctaaggcttttggt	CRISPR spacer
ccagaaagcccggtttctaaggcttttaag	Protospacer
 ...******. ***************..

1110. spacer 2.29|745875|30|NC_013928|CRISPRCasFinder,CRT matches to AP013675 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C49-MedDCM-OCT-S27-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 9, identity: 0.7

agttattaatatctatgacagtctcaaaga	CRISPR spacer
gccacctaatatttatgacactctcaaagc	Protospacer
. .  .******.******* ********

1111. spacer 2.31|746007|30|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP007544 (Synechocystis sp. PCC 6714 plasmid pSYLB, complete sequence) position: , mismatch: 9, identity: 0.7

ttcaatcggtgatgatattgtctgctatca	CRISPR spacer
catcatcggtgatgataatatctgctactt	Protospacer
. . ************* *.*******..

1112. spacer 2.31|746007|30|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP007544 (Synechocystis sp. PCC 6714 plasmid pSYLB, complete sequence) position: , mismatch: 9, identity: 0.7

ttcaatcggtgatgatattgtctgctatca	CRISPR spacer
catcatcggtgatgataatatctgctactt	Protospacer
. . ************* *.*******..

1113. spacer 2.31|746007|30|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP007544 (Synechocystis sp. PCC 6714 plasmid pSYLB, complete sequence) position: , mismatch: 9, identity: 0.7

ttcaatcggtgatgatattgtctgctatca	CRISPR spacer
catcatcggtgatgataatatctgctactt	Protospacer
. . ************* *.*******..

1114. spacer 2.31|746007|30|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP007544 (Synechocystis sp. PCC 6714 plasmid pSYLB, complete sequence) position: , mismatch: 9, identity: 0.7

ttcaatcggtgatgatattgtctgctatca	CRISPR spacer
catcatcggtgatgataatatctgctactt	Protospacer
. . ************* *.*******..

1115. spacer 2.33|746139|30|NC_013928|CRISPRCasFinder,CRT matches to MK765570 (Tortoise microvirus 20 isolate 20_SP_90, complete genome) position: , mismatch: 9, identity: 0.7

gtttgcttttgtttttgccttgtgtgtttc	CRISPR spacer
tatttcttttgttttcgccttgtgttgcag	Protospacer
  ** **********.*********  .

1116. spacer 2.41|746667|30|NC_013928|CRISPRCasFinder,CRT matches to NZ_KU130294 (Pseudomonas putida strain 12969 plasmid p12969-DIM, complete sequence) position: , mismatch: 9, identity: 0.7

tgacggaaacagagacggaacggcaactgt	CRISPR spacer
tagaagaaacagagaccgaacggcaataca	Protospacer
*.. .*********** *********.

1117. spacer 2.41|746667|30|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP039989 (Pseudomonas aeruginosa strain T2436 plasmid pBT2436, complete sequence) position: , mismatch: 9, identity: 0.7

tgacggaaacagagacggaacggcaactgt	CRISPR spacer
tagaagaaacagagaccgaacggcaataca	Protospacer
*.. .*********** *********.

1118. spacer 2.41|746667|30|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP039991 (Pseudomonas aeruginosa strain T2101 plasmid pBT2101, complete sequence) position: , mismatch: 9, identity: 0.7

tgacggaaacagagacggaacggcaactgt	CRISPR spacer
tagaagaaacagagaccgaacggcaataca	Protospacer
*.. .*********** *********.

1119. spacer 2.41|746667|30|NC_013928|CRISPRCasFinder,CRT matches to NZ_MN433457 (Pseudomonas aeruginosa strain PAB546 plasmid pNK546-KPC, complete sequence) position: , mismatch: 9, identity: 0.7

tgacggaaacagagacggaacggcaactgt	CRISPR spacer
tagaagaaacagagaccgaacggcaataca	Protospacer
*.. .*********** *********.

1120. spacer 2.41|746667|30|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP029096 (Pseudomonas aeruginosa strain AR439 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.7

tgacggaaacagagacggaacggcaactgt	CRISPR spacer
tagaagaaacagagaccgaacggcaataca	Protospacer
*.. .*********** *********.

1121. spacer 2.41|746667|30|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP045003 (Pseudomonas aeruginosa strain PAG5 plasmid pPAG5, complete sequence) position: , mismatch: 9, identity: 0.7

tgacggaaacagagacggaacggcaactgt	CRISPR spacer
tagaagaaacagagaccgaacggcaataca	Protospacer
*.. .*********** *********.

1122. spacer 2.41|746667|30|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP045917 (Pseudomonas aeruginosa strain CF39S plasmid pCF39S, complete sequence) position: , mismatch: 9, identity: 0.7

tgacggaaacagagacggaacggcaactgt	CRISPR spacer
tagaagaaacagagaccgaacggcaataca	Protospacer
*.. .*********** *********.

1123. spacer 2.41|746667|30|NC_013928|CRISPRCasFinder,CRT matches to MF344571 (Pseudomonas aeruginosa plasmid pR31014-IMP, complete sequence) position: , mismatch: 9, identity: 0.7

tgacggaaacagagacggaacggcaactgt	CRISPR spacer
tagaagaaacagagaccgaacggcaataca	Protospacer
*.. .*********** *********.

1124. spacer 2.41|746667|30|NC_013928|CRISPRCasFinder,CRT matches to MF344568 (Pseudomonas aeruginosa plasmid p727-IMP, complete sequence) position: , mismatch: 9, identity: 0.7

tgacggaaacagagacggaacggcaactgt	CRISPR spacer
tagaagaaacagagaccgaacggcaataca	Protospacer
*.. .*********** *********.

1125. spacer 2.41|746667|30|NC_013928|CRISPRCasFinder,CRT matches to MF344569 (Pseudomonas aeruginosa plasmid p12939-PER, complete sequence) position: , mismatch: 9, identity: 0.7

tgacggaaacagagacggaacggcaactgt	CRISPR spacer
tagaagaaacagagaccgaacggcaataca	Protospacer
*.. .*********** *********.

1126. spacer 2.41|746667|30|NC_013928|CRISPRCasFinder,CRT matches to MF344570 (Pseudomonas aeruginosa plasmid pA681-IMP, complete sequence) position: , mismatch: 9, identity: 0.7

tgacggaaacagagacggaacggcaactgt	CRISPR spacer
tagaagaaacagagaccgaacggcaataca	Protospacer
*.. .*********** *********.

1127. spacer 2.41|746667|30|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP039294 (Pseudomonas aeruginosa strain PABL048 plasmid pPABL048, complete sequence) position: , mismatch: 9, identity: 0.7

tgacggaaacagagacggaacggcaactgt	CRISPR spacer
tagaagaaacagagaccgaacggcaataca	Protospacer
*.. .*********** *********.

1128. spacer 2.41|746667|30|NC_013928|CRISPRCasFinder,CRT matches to CP027478 (Pseudomonas koreensis strain P19E3 plasmid p1, complete sequence) position: , mismatch: 9, identity: 0.7

tgacggaaacagagacggaacggcaactgt	CRISPR spacer
tagaagaaacagagaccgaacggcaataca	Protospacer
*.. .*********** *********.

1129. spacer 2.41|746667|30|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP027170 (Pseudomonas aeruginosa strain AR_0356 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.7

tgacggaaacagagacggaacggcaactgt	CRISPR spacer
tagaagaaacagagaccgaacggcaataca	Protospacer
*.. .*********** *********.

1130. spacer 2.41|746667|30|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP015879 (Pseudomonas citronellolis strain SJTE-3 plasmid pRBL16, complete sequence) position: , mismatch: 9, identity: 0.7

tgacggaaacagagacggaacggcaactgt	CRISPR spacer
tagaagaaacagagaccgaacggcaataca	Protospacer
*.. .*********** *********.

1131. spacer 2.41|746667|30|NC_013928|CRISPRCasFinder,CRT matches to NZ_KY883660 (Pseudomonas putida strain SY153 plasmid pSY153-MDR, complete sequence) position: , mismatch: 9, identity: 0.7

tgacggaaacagagacggaacggcaactgt	CRISPR spacer
tagaagaaacagagaccgaacggcaataca	Protospacer
*.. .*********** *********.

1132. spacer 2.41|746667|30|NC_013928|CRISPRCasFinder,CRT matches to NZ_KY494864 (Pseudomonas aeruginosa strain FFUP_PS_37 plasmid pJB37, complete sequence) position: , mismatch: 9, identity: 0.7

tgacggaaacagagacggaacggcaactgt	CRISPR spacer
tagaagaaacagagaccgaacggcaataca	Protospacer
*.. .*********** *********.

1133. spacer 2.41|746667|30|NC_013928|CRISPRCasFinder,CRT matches to NZ_LT969519 (Pseudomonas aeruginosa isolate RW109 genome assembly, plasmid: RW109 plasmid 1) position: , mismatch: 9, identity: 0.7

tgacggaaacagagacggaacggcaactgt	CRISPR spacer
tagaagaaacagagaccgaacggcaataca	Protospacer
*.. .*********** *********.

1134. spacer 2.41|746667|30|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP009975 (Pseudomonas putida S12 plasmid pTTS12, complete sequence) position: , mismatch: 9, identity: 0.7

tgacggaaacagagacggaacggcaactgt	CRISPR spacer
tagaagaaacagagaccgaacggcaataca	Protospacer
*.. .*********** *********.

1135. spacer 2.41|746667|30|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP029094 (Pseudomonas aeruginosa strain AR441 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.7

tgacggaaacagagacggaacggcaactgt	CRISPR spacer
tagaagaaacagagaccgaacggcaataca	Protospacer
*.. .*********** *********.

1136. spacer 2.41|746667|30|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP040126 (Pseudomonas aeruginosa strain PA298 plasmid pBM908, complete sequence) position: , mismatch: 9, identity: 0.7

tgacggaaacagagacggaacggcaactgt	CRISPR spacer
tagaagaaacagagaccgaacggcaataca	Protospacer
*.. .*********** *********.

1137. spacer 2.41|746667|30|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP016215 (Pseudomonas aeruginosa strain PA121617 plasmid pBM413, complete sequence) position: , mismatch: 9, identity: 0.7

tgacggaaacagagacggaacggcaactgt	CRISPR spacer
tagaagaaacagagaccgaacggcaataca	Protospacer
*.. .*********** *********.

1138. spacer 2.46|746998|30|NC_013928|CRISPRCasFinder,CRT matches to NC_007765 (Rhizobium etli CFN 42 plasmid p42e, complete sequence) position: , mismatch: 9, identity: 0.7

ctctgcgctttgcacgagcacagcgatatc	CRISPR spacer
ggtcgcgctttgcgcgagcacagcggtgct	Protospacer
  ..*********.***********.*...

1139. spacer 2.46|746998|30|NC_013928|CRISPRCasFinder,CRT matches to NZ_CP020909 (Rhizobium etli strain NXC12 plasmid pRetNXC12c, complete sequence) position: , mismatch: 9, identity: 0.7

ctctgcgctttgcacgagcacagcgatatc	CRISPR spacer
ggtcgcgctttgcgcgagcacagcggtgct	Protospacer
  ..*********.***********.*...

1140. spacer 2.46|746998|30|NC_013928|CRISPRCasFinder,CRT matches to NC_021908 (Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1d, complete sequence) position: , mismatch: 9, identity: 0.7

ctctgcgctttgcacgagcacagcgatatc	CRISPR spacer
ggtcgcgctttgcgcgagcacagcggtgct	Protospacer
  ..*********.***********.*...

1141. spacer 2.49|747196|30|NC_013928|CRISPRCasFinder,CRT,PILER-CR matches to MG592458 (Vibrio phage 1.083.O._10N.286.52.B9, partial genome) position: , mismatch: 9, identity: 0.7

cgcaacaatgactattaatatcaacggtgg	CRISPR spacer
atttaccatgactattactatcaacggcca	Protospacer
  . ** ********** *********. .

1142. spacer 2.61|747988|30|NC_013928|CRISPRCasFinder,CRT,PILER-CR matches to MF417944 (Uncultured Caudovirales phage clone 7F_3, partial genome) position: , mismatch: 9, identity: 0.7

tcagataaagatttttttggaaagtacaat	CRISPR spacer
aaagataaagcttttattggaaagttgtta	Protospacer
  ******** **** *********

1143. spacer 2.67|748385|30|NC_013928|CRISPRCasFinder,CRT,PILER-CR matches to NC_001850 (Borreliella burgdorferi B31 plasmid lp25, complete sequence) position: , mismatch: 9, identity: 0.7

gaaaaggaaaatcttacttagctcatgagt	CRISPR spacer
aggtgataaaatcttccttagctaatgagt	Protospacer
... .. ******** ******* ******

1144. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP013482 (Pandoraea apista strain DSM 16535 plasmid pPA35, complete sequence) position: , mismatch: 10, identity: 0.697

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
tcaatccaacggctacaacagctacgacaatgc	Protospacer
. . ******.**************.***..

1145. spacer 1.5|644551|33|NC_013928|PILER-CR matches to NZ_CP013482 (Pandoraea apista strain DSM 16535 plasmid pPA35, complete sequence) position: , mismatch: 10, identity: 0.697

cagctccaacagctacaacagctacaacagcta	CRISPR spacer
tcaatccaacggctacaacagctacgacaatgc	Protospacer
. . ******.**************.***..

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

235371 : 276468

Planktothrix_phage(33.33%)

tRNA,protease,bacteriocin

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002277679.1\|235371_237873_+\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	0.0e+00	64.8
WP_002271514.1\|238173_238977_+	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002277680.1\|239143_239986_+	MetQ/NlpA family ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_012997562.1\|240180_241554_+	M20/M25/M40 family metallo-hydrolase	NA	NA	NA	NA
WP_002277681.1\|241546_242611_+	methionine ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.6e-28	36.1
WP_002262134.1\|242612_243302_+	ABC transporter permease	NA	NA	NA	NA
WP_012997563.1\|243369_244146_+	carbon-nitrogen family hydrolase	NA	NA	NA	NA
WP_002265129.1\|244269_245115_+	S-adenosyl-l-methionine hydroxide adenosyltransferase family protein	NA	NA	NA	NA
WP_002265128.1\|245124_245670_+	ECF-type riboflavin transporter substrate-binding protein	NA	NA	NA	NA
WP_002277682.1\|245698_247375_+	ABC transporter ATP-binding protein	A0A2K9L3Z8	Tupanvirus	1.2e-19	24.4
WP_002270261.1\|247367_248201_+	energy-coupling factor transporter transmembrane protein EcfT	NA	NA	NA	NA
WP_002274870.1\|248424_249138_-	16S rRNA (guanine(527)-N(7))-methyltransferase RsmG	NA	NA	NA	NA
WP_002262127.1\|249225_249786_+	LemA family protein	NA	NA	NA	NA
WP_002262126.1\|249795_250695_+\|protease	zinc metalloprotease HtpX	NA	NA	NA	NA
WP_012997564.1\|250831_253444_-	ABC transporter permease	NA	NA	NA	NA
WP_002262124.1\|253445_254153_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.8e-30	38.1
WP_002274867.1\|254260_254836_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_002262122.1\|254828_255365_+	DUF177 domain-containing protein	NA	NA	NA	NA
WP_002262121.1\|255720_256413_+	response regulator transcription factor	W8CYM9	Bacillus_phage	5.9e-26	30.9
WP_002262120.1\|256782_257274_+	transcriptional repressor NrdR	NA	NA	NA	NA
WP_002262119.1\|257260_258430_+	DnaD domain protein	NA	NA	NA	NA
WP_002265120.1\|258430_259330_+	primosomal protein DnaI	S5MU12	Brevibacillus_phage	4.1e-27	31.2
WP_002277684.1\|259342_260653_+	ribosome biogenesis GTPase Der	NA	NA	NA	NA
WP_002277685.1\|260727_261354_+	hypothetical protein	NA	NA	NA	NA
WP_002262115.1\|261401_262040_+	VTT domain-containing protein	NA	NA	NA	NA
WP_012997565.1\|262504_263257_+	response regulator transcription factor	NA	NA	NA	NA
WP_041160308.1\|263253_264579_+	GHKL domain-containing protein	NA	NA	NA	NA
WP_012997567.1\|264720_264861_-\|bacteriocin	ComC/BlpC family leader-containing pheromone/bacteriocin	NA	NA	NA	NA
WP_012997568.1\|265127_265358_+\|bacteriocin	ComC/BlpC family leader-containing pheromone/bacteriocin	NA	NA	NA	NA
WP_002310604.1\|265488_265890_+	hypothetical protein	NA	NA	NA	NA
WP_002263913.1\|267269_267689_+	hypothetical protein	NA	NA	NA	NA
WP_002263912.1\|267835_268240_+	hypothetical protein	NA	NA	NA	NA
WP_002265308.1\|269014_269179_+	hypothetical protein	NA	NA	NA	NA
WP_002264173.1\|269583_269796_+	hypothetical protein	NA	NA	NA	NA
WP_002270918.1\|269959_270148_+\|bacteriocin	ComC/BlpC family leader-containing pheromone/bacteriocin	NA	NA	NA	NA
WP_002278096.1\|270633_271656_+	thiol reductase thioredoxin	NA	NA	NA	NA
WP_002263740.1\|271946_272090_+	hypothetical protein	NA	NA	NA	NA
WP_002278097.1\|272351_273365_-	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_024782145.1\|275983_276145_+\|bacteriocin	ComC/BlpC family leader-containing pheromone/bacteriocin	NA	NA	NA	NA
WP_002263346.1\|276282_276468_+\|bacteriocin	ComC/BlpC family leader-containing pheromone/bacteriocin	NA	NA	NA	NA

DBSCAN-SWA_2

482814 : 496657

Streptococcus_phage(78.57%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002262678.1\|482814_483579_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.6e-16	26.4
WP_002262679.1\|483578_484289_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	7.2e-19	28.9
WP_002264029.1\|484404_485064_+	CBS domain-containing protein	M1NSC5	Streptococcus_phage	8.6e-67	60.6
WP_002262681.1\|485139_485778_+	dTMP kinase	M1PSC7	Streptococcus_phage	3.4e-76	65.6
WP_002262682.1\|485790_486666_+	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	7.6e-79	54.1
WP_002264026.1\|486662_487469_+	signal peptidase II	NA	NA	NA	NA
WP_002262684.1\|487461_487794_+	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	6.1e-29	58.2
WP_002270502.1\|487799_488666_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	1.7e-115	73.9
WP_041160312.1\|488970_490206_+	ammonium transporter	H8ZJB2	Ostreococcus_tauri_virus	1.4e-33	29.9
WP_002264023.1\|490221_490563_+	P-II family nitrogen regulator	NA	NA	NA	NA
WP_002262688.1\|490782_491874_+	3-phosphoserine/phosphohydroxythreonine transaminase	M1Q1P2	Streptococcus_phage	1.2e-169	79.0
WP_002262689.1\|491991_492132_+	hypothetical protein	NA	NA	NA	NA
WP_002262690.1\|492282_492837_+	GNAT family N-acetyltransferase	M1PSC3	Streptococcus_phage	1.6e-50	64.4
WP_002274535.1\|492922_494104_+	3-phosphoglycerate dehydrogenase	M1NSB9	Streptococcus_phage	1.0e-179	79.6
WP_002262692.1\|494192_494687_+	methylated-DNA--[protein]-cysteine S-methyltransferase	M1PFU9	Streptococcus_phage	9.7e-47	56.1
WP_002262693.1\|494723_495077_+	arsenate reductase family protein	M1PLC0	Streptococcus_phage	4.8e-40	67.0
WP_002276927.1\|495141_495765_+	endonuclease III	NA	NA	NA	NA
WP_002262695.1\|495829_496657_-	exodeoxyribonuclease III	M1PSC0	Streptococcus_phage	2.1e-123	76.9

DBSCAN-SWA_3

995583 : 1004367

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002264270.1\|995583_996174_+	threonylcarbamoyl-AMP synthase	A0A291ATS8	Pandoravirus	1.1e-15	33.2
WP_002277382.1\|996183_997446_+	serine hydroxymethyltransferase	A0A219YB23	Aeromonas_phage	1.3e-98	52.1
WP_002264268.1\|997442_998420_+	nucleoid-associated protein	NA	NA	NA	NA
WP_002277383.1\|998421_999036_+	lysozyme family protein	A0A223LKM8	Bacillus_phage	7.1e-23	37.6
WP_002277384.1\|999045_1000779_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	4.0e-39	25.8
WP_002283054.1\|1000775_1002521_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.2e-53	29.2
WP_002264266.1\|1002651_1004367_-	phospho-sugar mutase	A0A1X9I671	Streptococcus_phage	7.5e-272	82.5

DBSCAN-SWA_4

1153132 : 1159872

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002275251.1\|1153132_1154887_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	6.1e-43	27.8
WP_012997819.1\|1154876_1156679_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.0e-32	24.7
WP_002263292.1\|1156682_1157117_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002278449.1\|1157558_1158212_+	7-cyano-7-deazaguanine synthase QueC	A0A2H4J8Q7	uncultured_Caudovirales_phage	5.9e-60	52.8
WP_002265145.1\|1158211_1158658_+	6-carboxytetrahydropterin synthase QueD	J9PV91	Bacillus_phage	2.9e-42	60.6
WP_002283353.1\|1158654_1159371_+	7-carboxy-7-deazaguanine synthase QueE	E7DN68	Pneumococcus_phage	8.2e-63	48.4
WP_002265143.1\|1159383_1159872_+	NADPH-dependent 7-cyano-7-deazaguanine reductase QueF	E7DN65	Pneumococcus_phage	5.6e-47	57.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_013928

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection