CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NC_014210	Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111 chromosome 1, complete sequence	24 crisprs	DEDDh,csa3,cas6e,cas8e,cas7,cas5,cas1,cas2,Cas14u_CAS-V,cas4,WYL,c2c9_V-U4,csx1,csm3gr7,csx25,cas10,DinG	5	92	1	0
NC_014211	Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111 chromosome 2, complete sequence	0 crisprs	c2c9_V-U4,DEDDh,cas3	0	0	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_014210_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_014210_1

437181-437278

Orphan

Consensus_repeat	Method
GACACCCGCCGCCTTCGCTGCCA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_014210_1

>merge|NC_014210|1|437181-437278|CRISPRCasFinder
GACACCCGCCGCCTTCGCTGCCACCGCAGCAGAGGTCGGCCATCTCCCAACCCCGGGCGTTGAACGGAACCCCCAGACACCCGCCGCCCTCGCTGCCA

>NC_014210|1|1|437181-437278|CRISPRCasFinder
GACACCCGCCGCCTTCGCTGCCA	CCGCAGCAGAGGTCGGCCATCTCCCAACCCCGGGCGTTGAACGGAACCCCCA
GACACCCGCCGCCCTCGCTGCCA

Protein	Signature genes	Signature genes Name	Protein_function
NC_014210.1\|WP_013151424.1\|449486_451379_-\|HtaA-domain-containing-protein	unknown	unknown	gnl\|CDD\|367875
NC_014210.1\|WP_013151420.1\|445898_446627_+\|cytidylate-kinase-like-family-protein	unknown	unknown	gnl\|CDD\|379060
NC_014210.1\|WP_013151410.1\|429930_431226_-\|cellulose-binding-protein	unknown	unknown	gnl\|CDD\|274008
NC_014210.1\|WP_013151414.1\|435459_436761_+\|HNH-endonuclease	unknown	unknown	gnl\|CDD\|367155
NC_014210.1\|WP_013151405.1\|425753_426431_-\|endonuclease-NucS	unknown	unknown	gnl\|CDD\|235114
NC_014210.1\|WP_013151412.1\|432270_433458_+\|acetyl-CoA-C-acetyltransferase	unknown	unknown	gnl\|CDD\|180261
NC_014210.1\|WP_013151418.1\|442874_444602_+\|methylmalonyl-CoA-mutase	unknown	unknown	gnl\|CDD\|239652
NC_014210.1\|WP_013151416.1\|439911_441591_-\|glycoside-hydrolase	unknown	unknown	gnl\|CDD\|119365
NC_014210.1\|WP_013151413.1\|433804_434761_+\|methylmalonyl-Co-A-mutase-associated-GTPase-MeaB	unknown	unknown	gnl\|CDD\|224617
NC_014210.1\|WP_013151419.1\|444784_445747_+\|tetratricopeptide-repeat-protein	unknown	unknown	gnl\|CDD\|225660
NC_014210.1\|WP_013151422.1\|448388_448967_+\|YqgE/AlgH-family-protein	unknown	unknown	gnl\|CDD\|234694
NC_014210.1\|WP_013151407.1\|427190_428402_+\|3-hydroxyacyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|180269
NC_014210.1\|WP_013151406.1\|426641_427028_+\|hypothetical-protein	unknown	unknown	unknown
NC_014210.1\|WP_013151421.1\|446929_448336_+\|NAD-dependent-malic-enzyme	unknown	unknown	gnl\|CDD\|223358
NC_014210.1\|WP_013151409.1\|428976_429717_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|225496
NC_014210.1\|WP_019608781.1\|428698_428944_+\|hypothetical-protein	unknown	unknown	unknown
NC_014210.1\|WP_013151415.1\|437529_439488_-\|glycoside-hydrolase	unknown	unknown	gnl\|CDD\|119365
NC_014210.1\|WP_041552213.1\|442281_442803_+\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197670
NC_014210.1\|WP_094805257.1\|431604_432069_-\|methylmalonyl-CoA-epimerase	unknown	unknown	gnl\|CDD\|213772
NC_014210.1\|WP_019611444.1\|449030_449273_+\|DUF3039-domain-containing-protein	unknown	unknown	gnl\|CDD\|378609

Protein	Function_ID	Function_description	E-value
NC_014210.1\|WP_013151424.1\|449486_451379_-\|HtaA-domain-containing-protein	gnl\|CDD\|367875	pfam04213, HtaA, Htaa. This domain is found in HtaA, a secreted protein implicated in iron acquisition and transport.	5.42767e-55
NC_014210.1\|WP_013151420.1\|445898_446627_+\|cytidylate-kinase-like-family-protein	gnl\|CDD\|379060	pfam13189, Cytidylate_kin2, Cytidylate kinase-like family. This family includes enzymes related to cytidylate kinase.	5.36442e-38
NC_014210.1\|WP_013151410.1\|429930_431226_-\|cellulose-binding-protein	gnl\|CDD\|274008	TIGR02168, Chromosome_partition_protein_Smc, chromosome segregation protein SMC, common bacterial type. SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins].	4.72879e-08
NC_014210.1\|WP_013151414.1\|435459_436761_+\|HNH-endonuclease	gnl\|CDD\|367155	pfam02720, DUF222, Domain of unknown function (DUF222). This family is often found associated to the N-terminus of the HNH endonuclease domain pfam01844. The function of this domain is uncertain. This family has been called the 13E12 repeat family.	1.66842e-16
NC_014210.1\|WP_013151405.1\|425753_426431_-\|endonuclease-NucS	gnl\|CDD\|235114	PRK03298, PRK03298, endonuclease NucS.	1.34536e-174
NC_014210.1\|WP_013151412.1\|432270_433458_+\|acetyl-CoA-C-acetyltransferase	gnl\|CDD\|180261	PRK05790, PRK05790, putative acyltransferase; Provisional.	0
NC_014210.1\|WP_013151418.1\|442874_444602_+\|methylmalonyl-CoA-mutase	gnl\|CDD\|239652	cd03680, MM_CoA_mutase_ICM_like, Coenzyme B12-dependent-methylmalonyl coenzyme A (CoA) mutase (MCM) family, isobutyryl-CoA mutase (ICM)-like subfamily; contains archaeal and bacterial proteins similar to the large subunit of Streptomyces cinnamonensis coenzyme B12-dependent ICM. ICM from S. cinnamonensis is comprised of a large and a small subunit. The holoenzyme appears to be an alpha2beta2 heterotetramer with up to 2 molecules of coenzyme B12 bound. The small subunit binds coenzyme B12. ICM catalyzes the reversible rearrangement of n-butyryl-CoA to isobutyryl-CoA, intermediates in fatty acid and valine catabolism, which in S. cinnamonensis can be converted to methylmalonyl-CoA and used in polyketide synthesis.	0
NC_014210.1\|WP_013151416.1\|439911_441591_-\|glycoside-hydrolase	gnl\|CDD\|119365	cd06548, GH18_chitinase, The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.	8.77721e-126
NC_014210.1\|WP_013151413.1\|433804_434761_+\|methylmalonyl-Co-A-mutase-associated-GTPase-MeaB	gnl\|CDD\|224617	COG1703, ArgK, Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism].	1.32491e-122
NC_014210.1\|WP_013151419.1\|444784_445747_+\|tetratricopeptide-repeat-protein	gnl\|CDD\|225660	COG3118, COG3118, Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones].	4.48941e-42
NC_014210.1\|WP_013151422.1\|448388_448967_+\|YqgE/AlgH-family-protein	gnl\|CDD\|234694	PRK00228, PRK00228, YqgE/AlgH family protein.	1.34671e-59
NC_014210.1\|WP_013151407.1\|427190_428402_+\|3-hydroxyacyl-CoA-dehydrogenase	gnl\|CDD\|180269	PRK05808, PRK05808, 3-hydroxybutyryl-CoA dehydrogenase; Validated.	1.17801e-129
NC_014210.1\|WP_013151421.1\|446929_448336_+\|NAD-dependent-malic-enzyme	gnl\|CDD\|223358	COG0281, SfcA, Malic enzyme [Energy production and conversion].	4.65875e-168
NC_014210.1\|WP_013151409.1\|428976_429717_+\|alpha/beta-hydrolase	gnl\|CDD\|225496	COG2945, COG2945, Predicted hydrolase of the alpha/beta superfamily [General function prediction only].	6.75461e-14
NC_014210.1\|WP_013151415.1\|437529_439488_-\|glycoside-hydrolase	gnl\|CDD\|119365	cd06548, GH18_chitinase, The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.	1.22086e-131
NC_014210.1\|WP_041552213.1\|442281_442803_+\|MarR-family-transcriptional-regulator	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	3.37927e-23
NC_014210.1\|WP_094805257.1\|431604_432069_-\|methylmalonyl-CoA-epimerase	gnl\|CDD\|213772	TIGR03081, Methylmalonyl-CoA_epimerase_mitochondrial, methylmalonyl-CoA epimerase. Members of this protein family are the enzyme methylmalonyl-CoA epimerase (EC 5.1.99.1), also called methylmalonyl-CoA racemase. This enzyme converts (2R)-methylmalonyl-CoA to (2S)-methylmalonyl-CoA, which is then a substrate for methylmalonyl-CoA mutase (TIGR00642). It is known in bacteria, archaea, and as a mitochondrial protein in animals. It is closely related to lactoylglutathione lyase (TIGR00068), which is also called glyoxylase I, and is also a homodimer.	4.18404e-50
NC_014210.1\|WP_019611444.1\|449030_449273_+\|DUF3039-domain-containing-protein	gnl\|CDD\|378609	pfam11238, DUF3039, Protein of unknown function (DUF3039). This family of proteins with unknown function appears to be restricted to Actinobacteria.	1.07931e-33

>NC_014210.1|WP_013151414.1|435459_436761_+|HNH-endonuclease
MIAAPKVAPGECSPAVAALAGAHKIIDQALNAEVPPGADETAAEEIAALWAQLDQIRYQALTRMARLYARGEVARYSGYSTLDKWITHHCKVPTAQAKDLARLAQHVQEETLPATAQAVAEGRVVLGEAVAIAKATDKAVQTRDEDHFPDEGEYRQGFEAALVAAKAERPALSVNQLQSVARQVAYRLDPHRLDRDHETAHAARGLTVHDTFQGSYQLQAWGGSGDALIVRAAIDTFTTPPGEGDTRSRSQREHDALIAALRFATTHTGCDNAPAPLAQIRIVVPVQTYLDAQGQEVPALDEHGRVIPVGLVHELAADSEVVRMLTAPPTGQVLDVGHSRRLASTRQRTAAFHGHATCAHPGGCEVPVALCQADHVQSFSRGGRTVVANLQPLCGPHNRAKYQRELRTHHQGRRRGRGGDHPPGGEPDPPPRE
>NC_014210.1|WP_013151413.1|433804_434761_+|methylmalonyl-Co-A-mutase-associated-GTPase-MeaB
MDTPRLVERVREGDRRALARAITLVENGAAALREIMAGLAPHTGRARVVGFTGSPGVGKSTTTNAVVRAARAKGLTVAVLAVDPSSPFTGGALLGDRVRMQEHATDPGVFIRSMANRGHLGGLSWATPHALRVLDAAGFDVILVETVGVGQAEVEIAGQADTTVVLCAPGMGDSVQAAKAGVLEVADVFAINKADREGAKSTLRELRQMIAMKDRTDQEWKPPIVMTVASRDEGVDELWERMDQHFAHLEASGDLARRRRARARDEVQAIVLDLLRSRMGGAGDDTGLDALAEDVAEGRRDPYAAADVVLKELGTDLG
>NC_014210.1|WP_013151412.1|432270_433458_+|acetyl-CoA-C-acetyltransferase
MPGSVIVGGARTPTGRLLGSLAGFSAADLGGFAIKAALERAGITGEQVGYVVMGQVLQAGAGQIPSRQAAVKAGIPMNVPSVTINKVCLSGLDAIALADQLISAGEFDVVVAGGMESMTNAPHLLPKSRKGYKYGSVEVLDATAHDGLTDAFEGDSMGASTERHNGKLGIGREEQDAFAARSHQRAAAAAAAGYFDAEIVPVQIPQRKGDPVVFFADEGVRADTTAESLARLRPAFDSEGTITAGSSSQISDGAAAVVVMSRAKAEELGATVLAEIGAHGNVAGPDNSLHSQPSNAIRHALGKAGRSVEDLDLIEINEAFAAVGLQSTRDLGVSEDIVNVNGGAIALGHPIGASGARIALHLVHELRRRGGGFGAAALCGGGGQGDALLFTVPAE
>NC_014210.1|WP_094805257.1|431604_432069_-|methylmalonyl-CoA-epimerase
MTRLDHVGIACRDLDASVAFYRSTYGFEVEHEEVNEEQGVREAMLRVNGTDDGGATYLQLLEPTRADSPVAKFLERNGEGVHHVAFGTADVAATAAGVGESGVRVLDARPRRGTAGSRIVFLHPKDCGGVLTELVQSADGAHEERDDNRPGISG
>NC_014210.1|WP_013151410.1|429930_431226_-|cellulose-binding-protein
MPSNNIDTQLNNIFDEDNTPHEFDVVLRGYDRTQVDDYAASLRNELKQYSKQVEKFKAELNAKNRQLQERERPSYSGLGSRIEELLRLAEEQANELVQSAQIDANDIRSAAKIEAADMRAAAESEATEVRALAQREADETRQTAESEAEEISTTARREADELTSTTEREVQKKRSAVDHEIAEKRATFEGEIAKLRTTTERECAQARAAAKRERDETIQSAKSQAEELRKNAERAYAESEARRTEAEDQFELQLADRRAEAERQDAERLAAAQAATQKMVNEAEERAASAEQRATKASQQAEQTRRDAENHAKQLVGNAKKNAAQIEAEAKSKAEHQLGDAKSEANRIMTAAKKEVDELNRQRDSIQSHLQQLRQLLGGGGPAAPAPVPAAPVAPAPAPAAIPQEPAPAAEETRQPVHSGKGADDEDWWQE
>NC_014210.1|WP_013151409.1|428976_429717_+|alpha/beta-hydrolase
MEIRATTVLPAVRRPVTLHTADGLELVGELALPEGRDPKATLVCLHPLPTAEGMMDSHVLRKASFRLPALADIAVLRFNTRGTGSRHGTSQGEFGEGETEKHDVLAAIEFTEFEGLPEPWLLGWSFGTELALKWGADPQVKGAILLSPPLHRAGEADMEVWARTGKPVVALVPEHDDYLRPDEARKRFEPLSQCEVVGVEGAKHLWVGEPYVRRVLDEIVKRVNPEAYPLPVEWDGPYEKDVQTLG
>NC_014210.1|WP_019608781.1|428698_428944_+|hypothetical-protein
MLRVTGGQRRETGPDGEWVTRRIPGAAATKVYRCPGCAQEIPTGMAHVVAWRPYGDGDDRRHWHSSCWDRRSHRAPRSPRR
>NC_014210.1|WP_013151407.1|427190_428402_+|3-hydroxyacyl-CoA-dehydrogenase
MVQEFDKVGVVGLGAMGAGIAEVFARAGFNVTGVEIDQAAVDRGRAHVDRSLSKAVDKGKLTEDERTGIDARLTFTTSREDLADADFVVEAVPERMDIKKDVFADLDRICPPGTILATNTSSLSVTEIAALTGRADKVVGLHFFNPAPVMKLVEVITTVSTSAETVDVVCEVAKRIGKTPVAVGDRAGFVANALLVPYINDAIRLYERKVATREEIDASVQKAAGLPMGPLALADLVGLDICLAVMDVLWEEYRDRRYAASPLLRRMVAAGRLGRKSGQGFYAGTDDAPEPRPTGRYAQMIQEEETLDLGEVLLAPQIDDAMRMVGDGYASARDVDTAMRFGCGYPKGPTELLEERGAEAVVTTLVAMGEYGLTDIPVPAPLLMDQLPDAPEGEGHGGCACHA
>NC_014210.1|WP_013151406.1|426641_427028_+|hypothetical-protein
MSLTVSPDLLEKAKHGPVEDADFIACIKDSLPYAWEVVSGLAEGARTAESGFETNEVPPPGEQERGQLLRLLASDAMRGAVERHFGLRLAFQNCHRVALFAPGAEEARAEFTSPRAQLLNQSPELVDC
>NC_014210.1|WP_013151405.1|425753_426431_-|endonuclease-NucS
MRLVIARCSVDYVGRLTAHLPMAPRLILIKADGSVSIHADDRAFKPLNWMNPPCKLREETVADGPDVWTVTHGKSGEKLVLTVEEVMHDSSHELGKDPGLQKDGVEAHLQELLAEHITTLGDGYTLIRREYPTAIGPVDILCRDGANATVAVELKRRGDIDGVEQLTRYLELLNRDPQLAPVRGVFAAQEIKPQARVLAEDRGIACVVLDYDELRGIEPDVLRLF
>NC_014210.1|WP_013151415.1|437529_439488_-|glycoside-hydrolase
MRARLRQRIAALAAAVVLPLALAPVPAASADTAGVTVTYVETSRWETGYGGQLTIANGSGSALTDWSIGFRLPSGTAITSLWNATLSRSGDAYTVTPPSWGASVPAGGSYSIGFNGTHGGGDTAPVDCTVNGGGCSGEPGEEDTEPPTAPTGLTVTGTTSTTVALQWGPADDNAGVAGYEVLSGGEVVRAVTGTTATVTGLAPQTEHTFTVRAYDTSNNRGPESGAVTATTDADGGGPTDPPQERRVAYFTQWGIYGRDYLVNDLVTSGTAEKLTHINYAFGNINANGECFMANQLGQGDAWADYGRSFGAADSVDGVGDTWDQDLRGNFNQLRELKEMYPDLKVNISLGGWTWSEHFSDAALTAESRERMVSSCIDQFLRGNLPVFDGAGGPGSAYGVFDGIDLDWEWPGSAGHEHNTVRPEDKENFTALVQEFRDQLDALEAETSRQYELTAFLPADPEKVELGFEMPQLMTDFDFITVQGYDYHGGWETTANHQSNLLLDPADPGPDLYSTETTVQAYLDRGVDPADMVLGVPFYGRGWTGVEPGPNGDGLFQSATGPAPGSYEAGIDDWKVLKDLVGTGGYELYRDDALGTAWLYNGSTFWTYDDEISMAQKTDWAQAQGLGGVMIWSVDGDDANGSLMNAIDTALAG
>NC_014210.1|WP_013151416.1|439911_441591_-|glycoside-hydrolase
MRARRFSTRLAAAAAAVLLAPLAVTAVPAAAAEETGPADLTVTYTESARWNTGYTGQITVHNASDTPVEDWAVEFSLPDGSRIHELWNATLAGTPGGYTITPPHWGASVPAGGSYSFGFNGLHSDGATDLVDCLVNGSPCAGDDGSGPSHDSYSVAYYTQWSAGERDYHVRDLVDSDSAEKLTHINYAFGNVTAEGVCATGDGTSQEGAVADYAHPVPAAESVDGTADDPDQELRGNFNQLRELKEMYPDLKVNISLGGWEWSRYFSDAALTEESRERLVSSCVDLYLRGNLPEVDGAGGEGAAYGVFDGIDLDWEWPGSDGHPHNTVRPEDKENFTALVQEFRDQLDAFGEETDRHYELTAFMPAGGWRLDAGYELDELMTDFDFVTVQGYDYHGTWESTTNHQSNLVVDARDPQPVISTELIVQAYLDRGVDPGKLVLGVPFYGQGWTGVEPGPDGDGLFQTATGPAQGAYAAGTEDWKVLEEKVESGEFEVFRNDGAGTAWIYDGQTLWNYDDETAMTQKTDWARDKGLGGVMIWSIDGDDAEGSLMAAIDTALSD
>NC_014210.1|WP_041552213.1|442281_442803_+|MarR-family-transcriptional-regulator
MNLPFDPIERAHDNWTRRWGPSPAMAAVTSVMRAQQILIGELDGALKPFGLTFARYEALVLLTFSGSGSLPLGKIGERLMVHPTSVTNTIDRLEGQGFVRRRPNPSDGRGVLAEITDAGRRVTEEATGALLSMDFGLGCYSDEELWRMHEMFTRLRVDFGDFPEPVAEAAEGR
>NC_014210.1|WP_013151418.1|442874_444602_+|methylmalonyl-CoA-mutase
MANTTSGPSGGGAREIEAGRERWQRRYDSARTRDADFTSLSGRTLEPVYGPRPGAEVPGFERIGWPGEYPYTRGLHATGYRGRAWTIRQFAGFGNARQTNERYKMILASGGGGLSVAFDMPTLMGHDSDSPHALGEVGHCGVAIDSVADMDLLFDGIPLGETTTSMTISGPAVPAFCMYLVAAERQGVDIRTLNGTLQTDIFKEYIAQKEWLYPPEPQLRLIGDLMEYCAADIPAYKPLSVSGYHIREAGATAAQELAFTLADGFGYVELGLSRGLDVDTFAPGLSFFFDAHIDFFEEIAKFRAARRIWARWLRDVYGARTEKAQWLRFHTQTAGVSLTAQQPYNNVVRTAVEALSAVLGGTNSLHTNALDETLALPTEQSAEIALRTQQVLMEETGIVNVADPLGGSWYLESLTDELEAEAERIFAHILRMGGGEGAEHAIGPMTSGILAGIENGYFSSEIAESAFQYQQALEKGDKKIVGVNCHTNTVSGELDILRISHEVEHEQKRALAERRAARDGAAVDRALAALLAGVRSGGGNLIPLIMDAARAEATLGEICATMGEEFGTYTEDPRF
>NC_014210.1|WP_013151419.1|444784_445747_+|tetratricopeptide-repeat-protein
MQPSDFSPNSAVDLGARKAAMEREAKQRAAESAGRSNPYAVNVDEATFQAQVLERSMSTPVVLAVLAGWSEQSKQVEDALDKISAASGGTWFLAKVDSEASPQLVQALRVPTTPMIVVVIQGQLLPGPAGPATEEQLTAWLVEAFAALKEQGALPPGHPGTITGEPGAEGAQGAQAAQPEEPQGRPVDIEAQEALDRGDFEAAAAVYAKAVEADSGDTESRAKLAQVRLVGRLQEVDAGAALQAAADRPEDVAAQTTAADVEMYGGRFEDAFARLVDTVRITSDEDRDRARTHLLGLFELLPPGDPRVNAARRKLTSALF
>NC_014210.1|WP_013151420.1|445898_446627_+|cytidylate-kinase-like-family-protein
MATDDTTDRRGGPLVTISATYGAGGSAVGPAVAARLGVAFLDRAVPSAVAARIGCSLDEALQRDDRAPGRLERLLSSAARLPTVTLGSVDTALIGSTDEEGRLLYDHEFVEQTERVLGEVARQGGVVLGRAGAVVLRDRPGALHVRLDGDPDARLRRARGLWESGDHGEWTGTDSDEPPNARLLDDNDRARAAYVRRFYRADPADPRHYHLVLDAVSLSLEACVDLVVRAARDRATVPSGGA
>NC_014210.1|WP_013151421.1|446929_448336_+|NAD-dependent-malic-enzyme
MATLPSVSYSITVRLELDAGGSAVGSLTNAVEQVGGMITALDVAAAGHERIRIDVTCAARDTEHAQAIVDALGAVEGVVVHKVSDRTFLMHLGGKIEMKSKVPLRNRDELSMAYTPGVARVSQAIAANKDDARRLTIKRNSVAVVTDGSAVLGLGNIGPEAAMPVMEGKAALFKRFADIDAWPIALDTQDVDEIVRTVQVLAPGFGGINLEDISAPRCFEVEARLRELLDIPVFHDDQHGTAIVVLAALRNALRVVGKKLGEVRIAMSGAGAAGTAILKLLMHAGARDVIVSDVHGAVHAGREDLDPNLRWIAEHTNPEGYSGDLRGAVAGADVFIGVSAPNLLNGDDIAEMNEDAIIFALANPDPEVDPDVAHLHASVVATGRSDYPNQINNVLVFPGFFRGLLDAQSHDVTSDMMVAAAEALADVVTEDELGPNYIIPSVFHSDLSTHVATAVREVAQRGQAAAQA
>NC_014210.1|WP_013151422.1|448388_448967_+|YqgE/AlgH-family-protein
MDQPMTGRLLVAAPMLQEDSFRRSVVFVVDDAADGTLGVILNRPLGMAVDEVVTDWGAYASEPAVMFSGGPVGLGSGIALGAAGPGEPPPGWSPLEGLDPHLGLDGIGVVDLDGPAQVLGGALGAFRLFAGYAGWSAGQLAGEIEEGAWYVVDAVADDVFTTAPEGLWSRVLRRQGGEMALLSTFPDDPAMN
>NC_014210.1|WP_019611444.1|449030_449273_+|DUF3039-domain-containing-protein
MAMDILNKVLPDSETKPDISHDGGDRERFAHYVQKDKITASAVTGDPVIALCGKVWVPNRDPKKFPVCPECKKVYEEMMK
>NC_014210.1|WP_013151424.1|449486_451379_-|HtaA-domain-containing-protein
MTTTPTRGSTAPGGLRRTLRLLTAYAGAAALGGTFAVAAAPTASADEVLPLTGGSASWGVKESFRNYVGSPIAHGGYEASDGATLLADGTVDFPTAGGTVSKEDASGDVSFSGTVVFSGHDYGQGPVLEVRVSDPRVVFEGDTATVFADVTSREFGGANPNLPPGGLVEYGEVAVTELTGAEVAVEGEEITFTSTAGTLHADAVEPFAGFYAAGAPMDPLSFTAGIDDVTDPGGPGEPVHDPRVTVAPASDLDPAGDTVTVEGTGFRPGQGVYAALTAVPQSADSYPAHHTGAVWLRGADAPGEDGSFSAELRVTGSYETDGTVHDCARTQCYVAVFNDHTDIANRDQDVWTPVSFTAVEEPTEEPTDPTDPTGEPTDPAEGPLTVHNGRADWGVKESFRDYITGSIARGEITPSDGASQNEDGTFAFTDGSGEVDLSASTADIAFEGTVLFEGHVHDGADPLLSMTVSDPRVTVDGAAGVLYADVTSKPLSGQEPVTYEDVALADLDLTGVDYTLEEGVLSWEPIPATLTAEGVPAFADFYAAGEQLDPVSLTVSVDEEVRVPGGGGDGGPTPGPGDGDGGGTPGLPNTGVALAGLLTAAAVAVGAGGAAVYAARRRGPAPDGDGESAV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_014210_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_014210_2

546339-546424

Orphan

Consensus_repeat	Method
GCTCCCCGCGCACGCGGGGATGGTC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_014210_2

>merge|NC_014210|2|546339-546424|CRISPRCasFinder
GCTCCCCGCGCACGCGGGGATGGTCCCTCGACACCGGCGTTGGGATACACGTCCGCCAGGTGCTCCCCGCGCACGCGGGGGTGGTC

>NC_014210|2|2|546339-546424|CRISPRCasFinder
GCTCCCCGCGCACGCGGGGATGGTC	CCTCGACACCGGCGTTGGGATACACGTCCGCCAGGT
GCTCCCCGCGCACGCGGGGGTGGTC

Protein	Signature genes	Signature genes Name	Protein_function
NC_014210.1\|WP_013151497.1\|535671_537597_+\|HAMP-domain-containing-protein	unknown	unknown	gnl\|CDD\|226702
NC_014210.1\|WP_013151509.1\|548734_549400_-\|DUF4097-family-beta-strand-repeat-protein	unknown	unknown	gnl\|CDD\|372574
NC_014210.1\|WP_013151501.1\|540101_540794_+\|haloacid-dehalogenase-type-II	unknown	unknown	gnl\|CDD\|319787
NC_014210.1\|WP_013151502.1\|541191_541569_+\|VOC-family-protein	unknown	unknown	gnl\|CDD\|380093
NC_014210.1\|WP_013151498.1\|537625_538060_+\|response-regulator	unknown	unknown	gnl\|CDD\|381108
NC_014210.1\|WP_013151510.1\|549643_550399_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|225382
NC_014210.1\|WP_013151503.1\|541780_542713_-\|zinc-binding-dehydrogenase	unknown	unknown	gnl\|CDD\|176231
NC_014210.1\|WP_013151515.1\|554854_555709_-\|SDR-family-NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|187632
NC_014210.1\|WP_019606686.1\|551594_551855_-\|DUF4873-domain-containing-protein	unknown	unknown	gnl\|CDD\|374407
NC_014210.1\|WP_013151507.1\|546546_547272_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|371572
NC_014210.1\|WP_013151516.1\|555825_556620_+\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133405
NC_014210.1\|WP_019606685.1\|550603_551488_-\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|131480
NC_014210.1\|WP_013151505.1\|543582_544674_+\|Gfo/Idh/MocA-family-oxidoreductase	unknown	unknown	gnl\|CDD\|183212
NC_014210.1\|WP_013151506.1\|544789_546157_+\|four-carbon-acid-sugar-kinase-family-protein	unknown	unknown	gnl\|CDD\|377757
NC_014210.1\|WP_013151504.1\|542861_543503_+\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|188483
NC_014210.1\|WP_013151508.1\|547460_548690_-\|serine-hydrolase	unknown	unknown	gnl\|CDD\|365903
NC_014210.1\|WP_013151500.1\|538866_539793_+\|phosphotransferase	unknown	unknown	gnl\|CDD\|225547
NC_014210.1\|WP_049800279.1\|552075_553611_-\|NAD(P)/FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|224983
NC_014210.1\|WP_013151514.1\|553928_554840_-\|diiron-oxygenase	unknown	unknown	gnl\|CDD\|378680
NC_014210.1\|WP_026337862.1\|538315_538843_+\|low-molecular-weight-phosphotyrosine-protein-phosphatase	unknown	unknown	gnl\|CDD\|319971

Protein	Function_ID	Function_description	E-value
NC_014210.1\|WP_013151497.1\|535671_537597_+\|HAMP-domain-containing-protein	gnl\|CDD\|226702	COG4251, COG4251, Bacteriophytochrome (light-regulated signal transduction histidine kinase) [Signal transduction mechanisms].	2.50717e-77
NC_014210.1\|WP_013151509.1\|548734_549400_-\|DUF4097-family-beta-strand-repeat-protein	gnl\|CDD\|372574	pfam13349, DUF4097, Putative adhesin. This has a putative all-beta structure with a twenty-residue repeat with a highly conserved repeating GD, gly-asp, motif. It may form part of a bacterial adhesin.	2.97167e-07
NC_014210.1\|WP_013151501.1\|540101_540794_+\|haloacid-dehalogenase-type-II	gnl\|CDD\|319787	cd02588, HAD_L2-DEX, L-2-haloacid dehalogenase. L-2-Haloacid dehalogenase catalyzes the hydrolytic dehalogenation of L-2-haloacids to produce the corresponding D-2-hydroxyacids with an inversion of the C2-configuration. 2-haloacid dehalogenases are of interest for their potential to degrade recalcitrant halogenated environmental pollutants and their use in the synthesis of industrial chemicals. This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	1.77207e-50
NC_014210.1\|WP_013151502.1\|541191_541569_+\|VOC-family-protein	gnl\|CDD\|380093	pfam18029, Glyoxalase_6, Glyoxalase-like domain. This entry comprises a diverse set of domains related to the Glyoxalase domain. The exact specificity of these proteins is uncertain.	2.54106e-27
NC_014210.1\|WP_013151498.1\|537625_538060_+\|response-regulator	gnl\|CDD\|381108	cd17557, REC_Rcp-like, phosphoacceptor receiver (REC) domain of cyanobacterial phytochrome response regulator Rcp and similar domains. This family is composed of response regulators (RRs) that are members of phytochrome-associated, light-sensing two-component signal transduction pathways such as Synechocystis sp. Rcp1, Tolypothrix sp. RcpA, and Agrobacterium tumefaciens bacteriophytochrome response regulator AtBRR. They are stand-alone RRs containing only a REC domain with no output/effector domain. The REC domain itself functions as an effector domain. Also included in this family us Methanosaeta harundinacea methanogenesis regulatory protein FilR2, also a stand-alone RR. REC domains function as phosphorylation-mediated switches within response regulators, but some also transfer phosphoryl groups in multistep phosphorelays.	3.91167e-74
NC_014210.1\|WP_013151510.1\|549643_550399_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|225382	COG2826, Tra8, Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair].	1.4104e-09
NC_014210.1\|WP_013151503.1\|541780_542713_-\|zinc-binding-dehydrogenase	gnl\|CDD\|176231	cd08270, MDR4, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines.	7.05634e-110
NC_014210.1\|WP_013151515.1\|554854_555709_-\|SDR-family-NAD(P)-dependent-oxidoreductase	gnl\|CDD\|187632	cd05374, 17beta-HSD-like_SDR_c, 17beta hydroxysteroid dehydrogenase-like, classical (c) SDRs. 17beta-hydroxysteroid dehydrogenases are a group of isozymes that catalyze activation and inactivation of estrogen and androgens. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	1.10282e-35
NC_014210.1\|WP_019606686.1\|551594_551855_-\|DUF4873-domain-containing-protein	gnl\|CDD\|374407	pfam16170, DUF4873, Domain of unknown function (DUF4873). This family consists mostly of short uncharacterized proteins found in various high GC Gram positive bacteria, primarily Mycobacterium species. However in some proteins, such as for instance Rv0943c proteins from Mycobacterium tuberculosis H37Rv, DUF4873 domain is found at the C-terminus, following the flavin-binding monooxygenase-like domain pfam00743, which is why probably many proteins with DUF4873 domains are annotated as monooxygenases. However these functions are not confirmed experimentally and the function of DUF4873 domain is still unknown.	2.85028e-25
NC_014210.1\|WP_013151507.1\|546546_547272_+\|hypothetical-protein	gnl\|CDD\|371572	pfam11512, Atu4866, Agrobacterium tumefaciens protein Atu4866. Atu4866 is a protein with unknown function from Agrobacterium tumefaciens however the structure has been determined. Atu4866 adopts a streptavidin-like fold and has a beta-barrel/sandwich which is formed by eight antiparallel beta-strands. Atu4866 has a potential ligand-binding site where is has a stretch of conserved residues on the surface.	3.80474e-43
NC_014210.1\|WP_013151516.1\|555825_556620_+\|MerR-family-transcriptional-regulator	gnl\|CDD\|133405	cd04778, HTH_MerR-like_sg2, Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily. Putative helix-turn-helix (HTH) MerR-like transcription regulators (subgroup 2). Based on sequence similarity, these proteins are predicted to function as transcription regulators that mediate responses to stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.	4.56352e-82
NC_014210.1\|WP_019606685.1\|550603_551488_-\|alpha/beta-fold-hydrolase	gnl\|CDD\|131480	TIGR02427, b-ketoadipate_enol-lactone_hydrolase, 3-oxoadipate enol-lactonase. Members of this family are 3-oxoadipate enol-lactonase. Note that the substrate is known as 3-oxoadipate enol-lactone, 2-oxo-2,3-dihydrofuran-5-acetate, 4,5-Dihydro-5-oxofuran-2-acetate, and 5-oxo-4,5-dihydrofuran-2-acetate. The enzyme the catalyzes the fourth step in the protocatechuate degradation to beta-ketoadipate and then to succinyl-CoA and acetyl-CoA. 4-hydroxybenzoate, 3-hydroxybenzoate, and vanillate all can be converted in one step to protocatechuate. This enzyme also acts in catechol degradation. In genomes that catabolize both catechol and protocatechuate, two forms of this enzyme may be found. All members of the seed alignment for this model were chosen from within protocatechuate degradation operons of at least three genes of the pathway, from genomes with the complete pathway through beta-ketoadipate. [Energy metabolism, Other].	5.69797e-25
NC_014210.1\|WP_013151505.1\|543582_544674_+\|Gfo/Idh/MocA-family-oxidoreductase	gnl\|CDD\|183212	PRK11579, PRK11579, putative oxidoreductase; Provisional.	5.42338e-96
NC_014210.1\|WP_013151506.1\|544789_546157_+\|four-carbon-acid-sugar-kinase-family-protein	gnl\|CDD\|377757	pfam07005, DUF1537, Putative sugar-binding N-terminal domain. This conserved region is found in proteins of unknown function in a range of Proteobacteria as well as the Gram-positive Oceanobacillus iheyensis. Structural analysis of the whole protein indicates the N- and C-termini interacting to produce an interacting surface into which a threonate-ADPcomplex is bound, suggesting that a sugar binding site is on the N-terminal domain here, and a nucleotide binding site is in the C-terminal domain (manuscript in preparation). There is a critical motif, DDXTG, at approximately residues 22-25.	5.78476e-56
NC_014210.1\|WP_013151504.1\|542861_543503_+\|TetR-family-transcriptional-regulator	gnl\|CDD\|188483	TIGR03968, transcriptional_regulator_TetR_family, mycofactocin system transcriptional regulator. Members of this family are TetR family putative transcriptional regulators that occur in genome contexts near proteins of the mycofactocin system. These include the precursor peptide (TIGR03969), a radical SAM peptide maturase (TIGR03962), and a putative carrier protein (TIGR03967). [Regulatory functions, DNA interactions].	6.08898e-13
NC_014210.1\|WP_013151508.1\|547460_548690_-\|serine-hydrolase	gnl\|CDD\|365903	pfam00144, Beta-lactamase, Beta-lactamase. This family appears to be distantly related to pfam00905 and PF00768 D-alanyl-D-alanine carboxypeptidase.	5.20162e-58
NC_014210.1\|WP_013151500.1\|538866_539793_+\|phosphotransferase	gnl\|CDD\|225547	COG3001, COG3001, Uncharacterized protein conserved in bacteria [Function unknown].	9.6093e-58
NC_014210.1\|WP_049800279.1\|552075_553611_-\|NAD(P)/FAD-dependent-oxidoreductase	gnl\|CDD\|224983	COG2072, TrkA, Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism].	5.771e-97
NC_014210.1\|WP_013151514.1\|553928_554840_-\|diiron-oxygenase	gnl\|CDD\|378680	pfam11583, AurF, P-aminobenzoate N-oxygenase AurF. This family is a metalloenzyme which is involved in the biosynthesis of antibiotic aureothin by catalyzing the formation of p-nitrobenzoic acid from p-aminobenzoic acid. AurF is a non-heme di-iron monooxygenase which creates nitroarenes via the sequential oxidation of aminoarenes.	1.58172e-113
NC_014210.1\|WP_026337862.1\|538315_538843_+\|low-molecular-weight-phosphotyrosine-protein-phosphatase	gnl\|CDD\|319971	cd16343, LMWPTP, Low molecular weight protein tyrosine phosphatase. Low molecular weight protein tyrosine phosphatases (LMW-PTP) are a family of small soluble single-domain enzymes that are characterized by a highly conserved active site motif (V/I)CXGNXCRS and share no sequence similarity with other types of protein tyrosine phosphatases (PTPs). LMW-PTPs play important roles in many biological processes and are widely distributed in prokaryotes and eukaryotes.	6.53631e-56

>NC_014210.1|WP_013151506.1|544789_546157_+|four-carbon-acid-sugar-kinase-family-protein
MAQVLVVADELTGANATGARFARTGMRVATVTPEHVSRVVGDYDVVVANLDSRHVPPEHAADLVTDVVEAVWPVGLVVKRTDSTLRGNIGAELEATYDAVRERVPAGTRVRVLFVPAFPSSGRITEDGLQFLNGVPLERTELADDPLCPMTTSSVADILAVQTDLPVRHVPVRQVTQTMLTAELLAGDEPVVVCDASTEQHLTDIAEAAAAAHHDTGIVWLAADPGPTGALLAYALRLRGQAGSRGPLLGVVGSTTELTRRQLATVARTGAVRFVDLDAVEFSVGDRADEVAEQTARELSEQLTSSGFPELCVLRVVTPSDRVRELPVQVRAELPGRIARLVADVVNEVADTTGAHALPSGLYLTGGDLVASLLDELDVHAFDVGGEIVPLTVHGHLSGGPLDGTPVVAKGGLVGDDITLVECLTKLRRAVQTRLHQVHSEVSEHVVPTPLRDTV
>NC_014210.1|WP_013151505.1|543582_544674_+|Gfo/Idh/MocA-family-oxidoreductase
MADAPEAQSTPEHDGPELHVALIGYGKGGEVFHAPLIDAVPGLRLSAVVTGNPDRRRAAEARYPGVTVYPNVAELWADAERYEIAVVTTPNDTHAPLAQAALEAGLAVVVDKPFALTALQARELTDLADKLGRVLTVYQNRRWDADFLTLWGLIEEGRLGRVHRFESRFERWRPQAKGTWRESGGVEAGAGLLYDLGPHLIDQAVNLFGPVSSVYAEIDARREGVNADDDVFLALDHARGTRSHLWMSALTAQGGPRFRVLGDEGAFTSHGMDGQEARLTAGERADADDWGVVPEADWGVLGVDGHTRPVPSARGAYPEFYAGVRDAVGEGEPLPVDPHEVIHGLEVIEAARRSARTRSVVDV
>NC_014210.1|WP_013151504.1|542861_543503_+|TetR-family-transcriptional-regulator
MASTRPRPAASEESLRERKKRRTRRALVDTALERFTRAGYDQVTLDEVCAEAEVSKRTFFRYFASKEELAMAPLQDLWGAFLRVLEEKGPDGRPLVELARDAILEAVEHVADREWTHAARLSLSLAGSTPAISAHNLQFCERTTVRALAVLGVGDQGDPRSRLALDMVASAARYALADWAAAPGTPTVPDLLARYRRAFDALPGGLTVSAPER
>NC_014210.1|WP_013151503.1|541780_542713_-|zinc-binding-dehydrogenase
MRALVVDRTAPHHLRLGEAPEPVAAPHQALVRVTATSLNFGEVSTVSHLPDGTVPGWDAAGFVERPAADGSGPAVGTAVVTLGAAGGWAELRAVDTASLGAAPEGADHGALSTVPVAATSALRALREVGFLLGRRILVTGATGGVGRYAVQLARMGGAHVTACTGGPRTHGAELRGLGAHEVVSQPGEPDYLFDGVVDCVGGPQLVTAFDRLNAGGTLVAVGHVTGQPEHFPLDAFLVDDGRHSRSITAFHLQNGVAPAGDLGWLAGRVASGDLDPGISWRGSWDRADEAVAALLERRLRGKAVLELTAG
>NC_014210.1|WP_013151502.1|541191_541569_+|VOC-family-protein
MACRISELVLSCRDPEVLARFWCEVLDFVVLDREEGCIEIGPREGFGGLQPTIILSRTEEPERAKPRLHIDVNATDRDQDAELERLLAAGAVFADIGQSGEEPWHVLADPEGNEFCLLRARLDRL
>NC_014210.1|WP_013151501.1|540101_540794_+|haloacid-dehalogenase-type-II
MTSPSDIDVIVFDVLGTMVDEPAGIGRGIRTLLPDIDDVRARELVQVWNRHVDEQQQEILAGRRPYANSTVIDLEAATRVAAEAGVDDADAIRSLAASAQRLAPWPDSASALDRIASYFPVVGLSNASHPALTRISAHAGLRWHQVLSAEDARGYKPHPDVYRLAIANADCPPDRLLMVAAHAWDLRGAQALGMRTAYVERPVGDPPRATDRFDLAVKSLDELAISLNAI
>NC_014210.1|WP_013151500.1|538866_539793_+|phosphotransferase
MRDFGGDGGDGHGEGRRRDPVNGTMAERLTVLLDRDVRRAARAGSSHDWDIYYAELTDGTRLFVKSLVRGAPPNGVLTAEARGLDWLGRTFGSPAVDVVAWDDRILVLPWIEEREPTAQAAERLGRQLAGMHLTGADHFGADWPGYIGPLTMDNTPSRDWPRFYAEQRLRPYLRQALDQGSLTPSDGRVVEKVVDAVADLAGEPEEPARVHGDLWSGNVLWRAQDAVVIDPAAHGGHREADLAMLALFGLPHLERVRDAYNEVAPLASGWRSRVALHQLHPLLVHVCLFGAAYRTTTLEAARTALRGG
>NC_014210.1|WP_026337862.1|538315_538843_+|low-molecular-weight-phosphotyrosine-protein-phosphatase
MSLPEPRDPAGPYRVSVVCLGNICRSPMAEKILAADLERAGMSDLVAVDSFGTGDWHVGGGMDPRAASTLRVHGYLTSHTARQFAHEVLADRDLVLAMDLDNVDEIRRIVDEYGEEYGFDMSRVRLFRSFAPGTGPNPEVPDPYYGGDDGFTAVLNMVESAAKGLTGELVTRLRR
>NC_014210.1|WP_013151498.1|537625_538060_+|response-regulator
MLVHPIEVLLVEDDPGDVLMTREAFEEHKLGNRLHVVSDGVEALRFLRREEEFADAPRPHLILLDLNLPRKDGREVLEEVKNDEDLAHIPVVVLTTSEAEEDVLRSYRLHANAYVPKPVDFDQFIRVVRQIDDFFVSVVRLPKG
>NC_014210.1|WP_013151497.1|535671_537597_+|HAMP-domain-containing-protein
METEGSGPAPDTGVHGAASTGGTHFVNGTNREGKRSAHQSWSLRRRVTSLLAVVAVVLVVAVSVITLAAFQARESLALQVDSLTPAVSAVEQTHSAYLTQDHALRGYILTQDREFLQPYVESQLTLTENQAVLAQLAEDNPEVATNVDDLLTAGRVWTEEFAEPALERVSGGQEVTQEELRRGRVLFLELSRISDATTSQLEAEIKEAREGLTLATQQVVALLVLVGLVVVFLSVFLWVMLQQWVLRPLEELAGHMRQVSEGYYAHRISLHGPPEIVRLGQDVDAMRERIVQDLDEVASARRKLQEQSVLMENQTEELRRSNLELEQFAYVASHDLQEPLRKVASFCQLLQRRYQGQLDERADAYIDFAVEGAKRMQTLINDLLAFSRVGRVRNFAPVALDDALDDALSSLSTRLEEADAEVTRDPLPTVQGDRTLLTQVFFNLVGNAVKFRGEEDPRVHISVERRGDEWVFCCSDNGIGIEPQYAERIFVIFQRLHTRDKYTGTGIGLAMCKKIVEFHGGRIWLETGSRDPGESETSGDRDSGRTGTRICWSLPADPAEDEDPAPDRGTAEPLAVDNGDEGTEDAETTPEDSAPTAARQPTGTDNPGEDGAEPGDRPGGVRSAQPDTGGGTVPPGHGAGP
>NC_014210.1|WP_013151507.1|546546_547272_+|hypothetical-protein
MSTTFFDEDLLRTVAAEPHRPLMFVNAAVYTFDPLIGDLTGADLLLDGKEIAGVGTGLHTAAEDDGAVVVDCSGLTVVPGVVENDTVAGLRRSPSDRVGTLAPGNPATFVVLSGHRPGTTALEQVVWSPERAAAVVIDGEFALFNGRRLVEPRTERFPGPMRTPADSPYLGMWIDETGFIHQELTADGRYDETRGGRPHAYQGSFWIEGDRIVYRDDLGFWAYGRFADDVLHHAGYVFHRG
>NC_014210.1|WP_013151508.1|547460_548690_-|serine-hydrolase
MENDNGRFSKAGLRRMRDVLTRHVESGRIPGLVALVSRGGETHVEAIGTMRHDGGAPMRRDTIFRMASTSKPVTMAAAMVLLDECGLRLDDLVEQWLPELADRQVLRRIDGPLDDTVPARRPITVRDVLTSTFGLGIDRSALGTPIMNALFAQGLTPDLPEPMPEPDEWMRRLGTLPLMHQPGEQWQYHVGNDLLGVLVSRVTGKSFDAFLRERVFEPLGMGDTGFHVPADKTDRLPPLYAPDPQTGEFHVWDPAEGGRHSQPPAFQGGGGGLVSTVDDYHAYFRMLLNQGMHGSERILSRPAVQLMTTNRLTPAQQAARNAMATENVHVSFGQGQHGGWGFGMAVRTYRGDYAPVGQFGWDGGSGTSTYADPENRLTGIVLTQVGMSVPDSARLIHDFWTTLYQAIDN
>NC_014210.1|WP_013151509.1|548734_549400_-|DUF4097-family-beta-strand-repeat-protein
MHTFPTPTAITTVLDIPAGRVQLIAADRTDTTVQVQPADPDKNRDVKAAQQTTVTYDDGVLRVQAPPAKNQAFGPSGSVEITVQLPTGSHLQATAASAGLRGVGRLGRVAFEAARGPVKLDEAASAHLTLQDGDVTLGRLGGPAQVSTARGDIVIAHATQGTVEVRTESGDITVSAAPGVSAALDAGTPHGRVHNALKNDGETTLDIRATTSHGDITARSL
>NC_014210.1|WP_013151510.1|549643_550399_+|helix-turn-helix-domain-containing-protein
MPGGRLTQSERQRIELGLAQGLAYARIAKDLDRPTSTVTREVTRNGGPTSYRADLAHRATQHRTRRRTRTATRAGQAPPQAYGRDAEAVREYEEAFTAVFMQSGLPKMTSRVLVSLYTTDEGSLTAAELVQRLQVSPASVSKAITFLEGQGLVRRERDERRRERYVVDDDVWYQSMLANARAEAHLVEAARQGVQVLGPGTPAAVRLENIARFVDFVRESIIRASEQAREVLHTKPEPVPDGADEPSPEPR
>NC_014210.1|WP_019606685.1|550603_551488_-|alpha/beta-fold-hydrolase
MGQVRELQVRSDDGTLLHVEVRGPEDGPTVVLAHCWATSLASWGPVVRELDPSLRVVLYDQRGHGRTQAPLTRAGYGARKLAEDLCAVLEATVPEGEKAVVAGHSMGGMTIMSAGAHPVFRERAAAVLLTNTGCKELPMRSTAIPLPGPLGTFGAQVFLRAPIPLGPRNALTTAVLKSMVMGRRADPRMVRLCMRMVHACGGVSRGAWGRVICTLEAEETARQISVPTVVMVGTDDKLTPPWHAHHIASLLKDCREVREIPGAGHMGPLEYPRALAETVDRLAAEHLEPRTRAA
>NC_014210.1|WP_019606686.1|551594_551855_-|DUF4873-domain-containing-protein
MRVQAHLAGHFSPLTGDYRWRGRLSPSPEVTAAFRAGARTVVVRTPDGFEGTGVLDEPNLWGGHPVNGAGSPPFAVPHVDIDASDD
>NC_014210.1|WP_049800279.1|552075_553611_-|NAD(P)/FAD-dependent-oxidoreductase
MAVIGSGFAGIGMAVRLKQAGLKDFVVLERADGIGGTWRDNSYPGAACDVPSHLYSFSFAPNPHWSRSFSPQPEIHDYMERVAGEHGVREHVRPDHDMRSAHWEPEGNRWRIETSRGTVTAQFLISAAGPLADPSYPDIKGLDTFEGTMFHSAAWDHDHDLTGRRIAVIGTGASAIQFVPRIQPKAGRLTLFQRTAPWVMFRHDRDITRLERWLYRNVPLTQQIARKSIYWGRETYVLGFAKNPRLLSIVEGLGRANIRRSVKDPELRAKLTPSFRAGCKRILMSNDYYPALARPNVDVVTDGIVEVRPHAVVTRDASGRETEHEVDTIILGTGFHVSDPPVARRIFNAEGRSLSDHWGTDMQAFRGTTVAGFPNAFVLAGPNTGLGHTSQLFMIEAQIRYTMQALKYLCRNGLDRMDVLPKAQRDYNEMVAKAMEGTVWVTGGCDSWYLNEQGRNTTLWPTFTWEFALRTRWFDPHNYDLRVDRSRGRGARRPAVRAEAAPEGERYERVR
>NC_014210.1|WP_013151514.1|553928_554840_-|diiron-oxygenase
MTAEITAKPKITDREDIAKRLLRGSAKASFDPLVEIDWDAPVDKDMWAIRPERLSLYGTYLWDRLTEEQRKELSRLEIASVATIGIWFETILMQMLVRHAYHHDPSTNHVQYAYTEIADECRHTVMFAKMVGKLGWQTHKLDPVAFHLGNLFKTIAHGPLIFAGALFVEEVLDQLQREAVPDEQILPLVRSVSRIHVVEEARHMRYAREEFQRDWATRGPLNRAYSRIILGLVTYYSATRLINPKVYAQVGLDPREASRVARDNPHWIGTKTWAARKVVSTLDTAGAITGLGRYFWKKAGLLG
>NC_014210.1|WP_013151515.1|554854_555709_-|SDR-family-NAD(P)-dependent-oxidoreductase
MRTPLPRHLRRLPGQNALVTGASGAFGSATVAVLRHLGVNVVGIDRKPAPGVVGCDITDDAQVREGVAEALDRLDGRLDLLIHYAGVGPAVDIGQAPDVHVHQALEVNLLGTWRVTAAAMPALLRSRGRVLVTASLLANLSLPFAGAYTVSKRALTAYADCLRAEYGSHIGVTTVHPGYVDTPIHNSSRATGVALDGLVPAESARDTVMAVVRAAGARYARRDTASTALGTAGLHLFRHFPGTTEQIVSLQVGLLLSDGAFGDAEIARGLHSRHANPLVRPDAS
>NC_014210.1|WP_013151516.1|555825_556620_+|MerR-family-transcriptional-regulator
MAEYRIDELARLADTTVRNVRVYQDRGLLAPPRREGRVGIYSEAHLARLRLIGQLLRRGYTFANIGEMFRVWERGGDLSDILGFESAIGDAWSDEIAGYLTMGDLRELFGHGVTPRTVKRSLDLGVLERDGLRFRVPSPRLLHAGVELVKLGMTVDSVLDIAENLRDKVGHVAEHMVRLVADHIIAEYAPGTVVRSEETAEMAELIRRVRPLAQQAVDAVLAQAMAENLTNVMGEHFALAMEYLDKEGADKEGVGGGAAAPPKG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_014210_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_014210_3

861030-861118

Orphan

Consensus_repeat	Method
CCGCCGGTCTGCTCGTACCCGGGCTGGCCGGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_014210_3

>merge|NC_014210|3|861030-861118|CRISPRCasFinder
CCGCCGGTCTGCTCGTACCCGGGCTGGCCGGGGTAGCCACCGGGCTGGTTCGGATATCCGCCGGTCTGCTCGTACCCGGGCTGGCCGGG

>NC_014210|3|3|861030-861118|CRISPRCasFinder
CCGCCGGTCTGCTCGTACCCGGGCTGGCCGGG	GTAGCCACCGGGCTGGTTCGGATAT
CCGCCGGTCTGCTCGTACCCGGGCTGGCCGGG

Protein	Signature genes	Signature genes Name	Protein_function
NC_014210.1\|WP_013151747.1\|856353_857955_-\|glycoside-hydrolase-family-13-protein	unknown	unknown	gnl\|CDD\|200471
NC_014210.1\|WP_013151746.1\|854430_855678_-\|maltose-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270304
NC_014210.1\|WP_041553046.1\|861306_861636_-\|DUF4870-domain-containing-protein	unknown	unknown	gnl\|CDD\|378240
NC_014210.1\|WP_013151755.1\|865972_866710_+\|16S-rRNA-(uracil(1498)-N(3))-methyltransferase	unknown	unknown	gnl\|CDD\|236959
NC_014210.1\|WP_013151752.1\|862797_863637_-\|DUF3097-domain-containing-protein	unknown	unknown	gnl\|CDD\|378628
NC_014210.1\|WP_013151760.1\|870399_870888_+\|rRNA-maturation-RNase-YbeY	unknown	unknown	gnl\|CDD\|234575
NC_014210.1\|WP_013151754.1\|864836_865976_+\|molecular-chaperone-DnaJ	unknown	unknown	gnl\|CDD\|237654
NC_014210.1\|WP_081461695.1\|846180_847134_-\|ComEA-family-DNA-binding-protein	unknown	unknown	gnl\|CDD\|224472
NC_014210.1\|WP_013151758.1\|868462_868813_+\|histidine-triad-nucleotide-binding-protein	unknown	unknown	gnl\|CDD\|238607
NC_014210.1\|WP_013151748.1\|858051_859125_+\|LacI-family-DNA-binding-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224525
NC_014210.1\|WP_013151744.1\|851915_852821_-\|sugar-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|226354
NC_014210.1\|WP_013151749.1\|859315_860548_+\|coproporphyrinogen-III-oxidase	unknown	unknown	gnl\|CDD\|180172
NC_014210.1\|WP_013151759.1\|869095_870205_+\|PhoH-family-protein	unknown	unknown	gnl\|CDD\|224616
NC_014210.1\|WP_013151757.1\|867606_868137_-\|SigE-family-RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|132028
NC_014210.1\|WP_013151756.1\|866848_867610_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|164795
NC_014210.1\|WP_013151741.1\|848100_848370_-\|30S-ribosomal-protein-S20	unknown	unknown	gnl\|CDD\|376586
NC_014210.1\|WP_013151745.1\|852820_854428_-\|ABC-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|236816
NC_014210.1\|WP_013151753.1\|863818_864832_+\|heat-inducible-transcriptional-repressor-HrcA	unknown	unknown	gnl\|CDD\|234621
NC_014210.1\|WP_013151743.1\|849975_851817_+\|elongation-factor-4	unknown	unknown	gnl\|CDD\|235462
NC_014210.1\|WP_013151742.1\|848696_849671_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NC_014210.1\|WP_013151747.1\|856353_857955_-\|glycoside-hydrolase-family-13-protein	gnl\|CDD\|200471	cd11332, AmyAc_OligoGlu_TS, Alpha amylase catalytic domain found in oligo-1,6-glucosidase (also called isomaltase; sucrase-isomaltase; alpha-limit dextrinase), trehalose synthase (also called maltose alpha-D-glucosyltransferase), and related proteins. Oligo-1,6-glucosidase (EC 3.2.1.10) hydrolyzes the alpha-1,6-glucosidic linkage of isomaltooligosaccharides, pannose, and dextran. Unlike alpha-1,4-glucosidases (EC 3.2.1.20), it fails to hydrolyze the alpha-1,4-glucosidic bonds of maltosaccharides. Trehalose synthase (EC 5.4.99.16) catalyzes the isomerization of maltose to produce trehalulose. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase.	0
NC_014210.1\|WP_013151746.1\|854430_855678_-\|maltose-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270304	cd13586, PBP2_Maltose_binding_like, The periplasmic-binding component of ABC transport systems specific for maltose and related polysaccharides; possess type 2 periplasmic binding fold. This subfamily represents the periplasmic binding component of ABC transport systems involved in uptake of polysaccharides including maltose, maltodextrin, and cyclodextrin. Members of this family belong to the type 2 periplasmic-binding fold superfamily. PBP2 is comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. The majority of PBP2 proteins function in the uptake of small soluble substrates in eubacteria and archaea. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.31318e-100
NC_014210.1\|WP_041553046.1\|861306_861636_-\|DUF4870-domain-containing-protein	gnl\|CDD\|378240	pfam09685, DUF4870, Domain of unknown function (DUF4870).	6.922e-23
NC_014210.1\|WP_013151755.1\|865972_866710_+\|16S-rRNA-(uracil(1498)-N(3))-methyltransferase	gnl\|CDD\|236959	PRK11713, PRK11713, 16S ribosomal RNA methyltransferase RsmE; Provisional.	7.9137e-76
NC_014210.1\|WP_013151752.1\|862797_863637_-\|DUF3097-domain-containing-protein	gnl\|CDD\|378628	pfam11296, DUF3097, Protein of unknown function (DUF3097). This family of proteins with unknown function appears to be restricted to Actinobacteria.	3.61513e-159
NC_014210.1\|WP_013151760.1\|870399_870888_+\|rRNA-maturation-RNase-YbeY	gnl\|CDD\|234575	PRK00016, PRK00016, metal-binding heat shock protein; Provisional.	5.11186e-73
NC_014210.1\|WP_013151754.1\|864836_865976_+\|molecular-chaperone-DnaJ	gnl\|CDD\|237654	PRK14278, PRK14278, chaperone protein DnaJ; Provisional.	0
NC_014210.1\|WP_081461695.1\|846180_847134_-\|ComEA-family-DNA-binding-protein	gnl\|CDD\|224472	COG1555, ComEA, DNA uptake protein and related DNA-binding proteins [DNA replication, recombination, and repair].	5.37916e-27
NC_014210.1\|WP_013151758.1\|868462_868813_+\|histidine-triad-nucleotide-binding-protein	gnl\|CDD\|238607	cd01276, PKCI_related, Protein Kinase C Interacting protein related (PKCI): PKCI and related proteins belong to the ubiquitous HIT family of hydrolases that act on alpha-phosphates of ribonucleotides. The members of this subgroup have a conserved HxHxHxx motif (x is a hydrophobic residue) that is a signature for this family. No enzymatic activity has been reported however, for PKCI and its related members.	5.85268e-53
NC_014210.1\|WP_013151748.1\|858051_859125_+\|LacI-family-DNA-binding-transcriptional-regulator	gnl\|CDD\|224525	COG1609, PurR, Transcriptional regulators [Transcription].	6.24088e-98
NC_014210.1\|WP_013151744.1\|851915_852821_-\|sugar-ABC-transporter-permease	gnl\|CDD\|226354	COG3833, MalG, ABC-type maltose transport systems, permease component [Carbohydrate transport and metabolism].	1.70834e-92
NC_014210.1\|WP_013151749.1\|859315_860548_+\|coproporphyrinogen-III-oxidase	gnl\|CDD\|180172	PRK05628, PRK05628, coproporphyrinogen III oxidase; Validated.	0
NC_014210.1\|WP_013151759.1\|869095_870205_+\|PhoH-family-protein	gnl\|CDD\|224616	COG1702, PhoH, Phosphate starvation-inducible protein PhoH, predicted ATPase [Signal transduction mechanisms].	1.1516e-137
NC_014210.1\|WP_013151757.1\|867606_868137_-\|SigE-family-RNA-polymerase-sigma-factor	gnl\|CDD\|132028	TIGR02983, putative_RNA_polymerase_ECF-subfamily_sigma_factor, RNA polymerase sigma-70 factor, sigma-E family. This group of similar sigma-70 factors includes the sigE factor from Streptomyces coelicolor. The family appears to include a paralagous expansion in the Streptomycetes lineage, while related Actinomycetales have at most two representatives.	4.39641e-50
NC_014210.1\|WP_013151741.1\|848100_848370_-\|30S-ribosomal-protein-S20	gnl\|CDD\|376586	pfam01649, Ribosomal_S20p, Ribosomal protein S20. Bacterial ribosomal protein S20 interacts with 16S rRNA.	7.17156e-24
NC_014210.1\|WP_013151745.1\|852820_854428_-\|ABC-transporter-permease-subunit	gnl\|CDD\|236816	PRK10999, malF, maltose ABC transporter permease MalF.	1.67755e-91
NC_014210.1\|WP_013151753.1\|863818_864832_+\|heat-inducible-transcriptional-repressor-HrcA	gnl\|CDD\|234621	PRK00082, hrcA, heat-inducible transcription repressor; Provisional.	3.25439e-148
NC_014210.1\|WP_013151743.1\|849975_851817_+\|elongation-factor-4	gnl\|CDD\|235462	PRK05433, PRK05433, GTP-binding protein LepA; Provisional.	0
NC_014210.1\|WP_013151756.1\|866848_867610_-\|hypothetical-protein	gnl\|CDD\|164795	PHA00370, III, attachment protein.	0.000154416

>NC_014210.1|WP_013151749.1|859315_860548_+|coproporphyrinogen-III-oxidase
MPSVALDGDPVPSTGELPGPSLAELGGRPLGFYVHVPFCVTRCGYCDFNTYTAEELVSRDGTATASRETYADQAIAEVALADRVLTGERPPVSTLFVGGGTPTLLSAEDLGRVVTAVRERFGFTPDAELTTEANPETVTPDYLARLREAGFTRVSFGMQSAREHVLRVLERGHTPGRPEQCAEWARRAGFEHVNLDLIYGTPGEGDEDWRASLEAAVSAGPDHVSAYSLIVEEGTRLAARVRRGELAEPDDDTMADRYLMAEEVLTAAGFSAYEVSNWARTEQGRSRHNLLYWTGGHWWGVGPGAHSHVGGTRWWNVKHPAAYAARLAAGHSPGLAREVLTEEERRFERVLLELRVEGGCPLDLLEPHGRDAAKRAVAEGLLDADAHEEGRAALTLRGRLLADAVVRDLT
>NC_014210.1|WP_013151748.1|858051_859125_+|LacI-family-DNA-binding-transcriptional-regulator
MGPRLADIARHAGVSEATVSRVLNDKPGVGSDTRKAVLTALDVLGYERPARLRQRSAGLVGMVIPELENPVFPMFAQAAEGALAQRGYTPVLCTQTPGGITEDEYVELLLERNVSGILFVSGRRADTTAPHERYHALVSRRLPIVLVNGYADAIPAAFISCDDREAGHLAVNHLVALGHTRIGFTSGPERYVPVRRKLDGYHRALAQHGLDGEDLVELSLFGVEGGHAAATRLIERGVTAMVCGSDMMALGAIRAARQRGLSVPRDFSVVGFDDSQLIAFTDPPLTTVRQPVNAMALAAVRALCDEIAGHPVSHTEYVFDPELVVRGSTAIAPARNHAPLTRVDAAPAHARAERPRV
>NC_014210.1|WP_013151747.1|856353_857955_-|glycoside-hydrolase-family-13-protein
MEPQSHWWRDAAIYQIYVRSFADSNGDGEGDLAGIRERLPHLAELGVDAIWLTPFYVSPLADGGYDVADYRDVDPRFGTLEDFDALLETAHGMGIRLIIDVVPNHSSSAHRWFKEAAAAEPGEHARSRYVFRDGRGPDGEEPPNNWKSIFGGPAWTRLKRPDGTPEQWYLHLFDPEQPDFDWTNQEVHDEFDDVLRFWLDRGVDGFRIDVAHGMVKDPAMPDIAEDAKADMLDGSTSLPYFDQDGVHEIYRRWARIAAEYPGDRALVAEAWVEDAQRVARYLRPDELHQAFNFEYLTAPWDAGRLREVIDVSLAANTAVGATTTWVLSNHDVTRHVTRFGGGEQGLRRARAATLLMLGLPGSVYLYQGEELGLPEVTDLPEDSLQDPTWERSGRTDRGRDGCRVPLPWGGDQAPYGFGPEGSVPWLPMPEGWGALSRAAQRGVEGSTLELYTKALRLRRELDALGDGSMAWLDAPGGVLYFEREPGVRVAVNLTGEAVELAADGEVLVASGPVGEPAGGTLSLPAETAVWLRG
>NC_014210.1|WP_013151746.1|854430_855678_-|maltose-ABC-transporter-substrate-binding-protein
MRFRSARAVTGIAAIALMATACSGGDEGGEAAAEGSLVIWSDPERADAIKAAAQEFAEANGIEVEVQGLTFGDIQGDVLNAHQAGNAPDVFIGAHDWTGNLVRNGAVQPIELPQDRASGLDETSLQALNYDGQLFGVPYSQENIFLMRNTDLAPDAPATFEEMVEVGTELKDSGETSEVLSMAVGQEGDPYRMNALFTSAGGYLFGQDEEGNWDPTDLGVGTDESIAAMEKVAEYGEAGEGVLRRSITLENDASLFYEGEAPFFVAGPWNVADANEAGVNYEISPIPGFEGEEPASPYIGYQAFFVTEGSANSALAQEFVTNYVTDTDFVLSLYEADPRMPVQTEALESVSADDPTIAAISEAEAGAEGMPMPSIPEMGETWEPLGIAQAAVIAGEDVREAMEATHETIASQIGE
>NC_014210.1|WP_013151745.1|852820_854428_-|ABC-transporter-permease-subunit
MASKKTAGAPSPGAPARTPLPGGRFAGSGSLAGQLVKIALLGLFTALGVWAVLPLYVAGSWWGIGLVVAVVGLVYWVYLSKRTVPVKYLVPGVLFLLTFQILPVLYTMSTSVTNLSDGHRGDKEQAIASIEAYSVSSPDGAQEYTLTVAVTGSPETGELVFLLTGPEGRAYAGTEEGLTELDGATVEPSGKVAEAFGYTILSPTQVNARSDELQAFAVPTGSGTGIRSSGLSTAFEGTATRAYDAGCDCITDAGTGIVYHADNERGAFYDEDGERLAQGWQVGVGFDNFARFLFNPTFASSFFSILVWNIAFAASVTFLVFVVGLAIALTLHVPRLRGRVVYRILVVLPYAMSSLAMFLLWRDMFNTDFGLFNRVLGLEVDWLGDAWSARAAVILANVWLGYPYMFLVATGALQAVPRELGQAAQIDGAGPWQAFRNVTLPLLMVAMTPILVSTFAFNFNNFNAVWLITQGGPFSPESPTAGATDLLITYTYRLAFNEATAQYGYAAALSVMIFLIVSVMSVVSLSRSKALKEVD
>NC_014210.1|WP_013151744.1|851915_852821_-|sugar-ABC-transporter-permease
MAVATPDAVRAPHRRGTGVRLGLWARRYGWRHVVMLVVVAFALFPVLFVVSAALNPLGTLSSAQLWPTGASLDNAVDLFSNTPFTTWYANSLFFAFTNAAVTVLLSALAAYAFSRMRFRGRRVGLIGLLVIQMFPQFLAIVAIYLMFSTIGEYYPAIGFDTRWGLLLVYLGGALSINTWLMKGFFDTVPKELDESAQMDGASHAQVFFRIMLPLVTPVLAIVGLLVFISTINEFLMASVFLRDTDAKTLGLGLYQLVASQRNANFGMFAVGAIMLSLPTLAVFWFLQRYITEGLTAGAVKG
>NC_014210.1|WP_013151743.1|849975_851817_+|elongation-factor-4
MAQPNWTDPALIRNFCIIAHIDHGKSTLADRMLQITGVVEDRQMRAQYLDRMDIERERGITIKSQAVRIPFTAVDDKTYTLDLIDTPGHVDFTYEVSRSLAACEGAVLLVDAAQGIEAQTLANLYMALENDLTIIPVLNKIDLPAAQPEKYAEELAGIIGCEPSDVLRVSAKTGEGVEELLNEIVNQIPQPVGDADAPARAMIFDSVYDTYRGVVTYVRVIDGKLSPRERIQMMSTRASHEILEIGVSSPEPTKCDGLGVGEVGYIITGVKDVRQSKVGDTITALNRPATEMLSGYREPKPMVFSGLYPIEGTDYPVLRDALEKLQLNDAALVFEPETSAALGFGFRCGFLGLLHLEITRARLEREFNLDLISTAPNVVYRVDMEDGTEHVVTNPSEFPAGKIDSIYEPMVKATVLSPADHIGQIMELCQERRGDLQGMDYLSEDRVEMRYTLPLAEIVFDFFDHLKSRTKGYASLDYEPTGEKASDLVKVDILLQGEAVDAFSAIVHKDKAYAYGVEMTKKLRELIPRQQFEVPIQAAIGARVIARENIRAIRKDVLSKCYGGDISRKRKLLEKQKEGKKRMKMVGRVEVPQEAFISALSTDTGGSDDKKKK
>NC_014210.1|WP_013151742.1|848696_849671_-|hypothetical-protein
MKWLLTRLLAGVAAIAVVVAGAGALLAFQFSGEPAPWAVSRGSDAAWVGSWEDTGPLARVLDTGGVDTVYVYAGEIDAEGAVERVEDTGSLLSWLEREYPDVRALAWLRHVESGSSLLRDRLDEQARAALAPAVAGVASDGFAGVHLEIRPVTVNDPSIPALMSMVREELGGEPVLSVQAHHVELVPGGRMPSFVMEREERYWSKGYLDRVTEHADEVVLPGVGAGMPGDALYGGFMVRQVTEAVTALRAREGVAVRFGLPTYGGGEWAPEEADESLATALEAVRLGVTEADPPEGMTLGVAFYLGDEATEEDVTAYTEGWLLS
>NC_014210.1|WP_013151741.1|848100_848370_-|30S-ribosomal-protein-S20
MANIKSQKKRIRQNEKARVRNQAVRSSLKTAVRKFREAAEAGDVEKATVAQRAAARALDKATSKGVIHQNQAANRKSAIAKRLHSLQSA
>NC_014210.1|WP_081461695.1|846180_847134_-|ComEA-family-DNA-binding-protein
MVNREGEATVPAPRTSGENRGARTAGPVKRDTGEEPDPGTALSARRAGTSEGAPGPEPWPDPAEGRHRRPERPPSGYAEFDPEPSGSLLERLALRWPPRAALSRRAVIVLAVLGALAVVLVLTLYHRPTTVPAPEMVTRAAPVPAAEGDGARSPALEAGAQAGDADAGAAGDAAPKDDLVVHVGGEVSAPGLYTLPSGSRVADAVEEAGGALPDADLDLLNLARPLVDGEQVLVGVPVPAGAGVTGSGPQGAGGLVDINRADRALLETLPGIGAVIADNIVSYREEHGPFRSVDDLLNVDRIGDKTLADLQPHVTVG
>NC_014210.1|WP_041553046.1|861306_861636_-|DUF4870-domain-containing-protein
MLAHLSGFVIACLGWIPPLAVYFAKRNQSPFVRHHAAEAANFQLTLLIPYLFAWVAFIGLGIFFPELSWIGSLLVALIWIVAIVFGVLGANGANKGTWYRYPVSIRLLK
>NC_014210.1|WP_013151752.1|862797_863637_-|DUF3097-domain-containing-protein
MATKGTGRYGRDVLAGDWRRPKKKAVREVPLERELVVEDAEEAFCGAVMAWDKATVTLEDRHGRRRVFDLAPAAFLVDGEPVTLVRPSAAPRGPLRSASGSVAVPGARARTARESRIYVEGVHDAELVEKVWGHDLRVEGVAVEFLEGVDDLPSIVAEFSPGPGRRLGVLVDHLVPGSKETRIAERVRGEHVLVAGHPYVDVWQAVRPGSVGIGAWPEVPRGVPWKEGVVSALGWRMETGEAWRRILGSVRTYADLEPALLGRVEELIDFVTGPHPDAP
>NC_014210.1|WP_013151753.1|863818_864832_+|heat-inducible-transcriptional-repressor-HrcA
MLDERKLAVLRAVVEDFVNTNEPVGSKALADRHRLGVSPATIRNDMVALEEDGYIAQPHTSAGRVPTDKGYRLFVDRLSSVKPLSSAERRAIESFLTGAVDLDEIVARTVRLLAQLTRQVAIVQYPSLTRSSVQHVELVPLGGQRIMMVVITNTGRVEQRVIDGLGEVHEAAVNDLRAMLNRAIAGRHLGDVPDAVEDLPPQVAPEHRQMAVSVLSVLLESLVERHEEKIVLAGTANLAAVDFAASLRDVLEALEENMVLIRLLGEAKDPSMLTVRIGAENFHEGLRSTSIVSADYGVGNQSLAKIGVVGPTRMDYPGTMGAVRAVARYVGQILAGQ
>NC_014210.1|WP_013151754.1|864836_865976_+|molecular-chaperone-DnaJ
MARDYYQVLGVRRDASKDEIKKAYRRLARELHPDINPDPATQERFKEVTQAYEVLSDENKRRMFDMGQDPYAPGGGGAGGFGGAGGFAFDDIMNAFFGGGQPGGRGPRERVRRGRSIKIRVELDLVETAFGVSKEITFPTAILCETCQGEGTAAGSHRTTCEMCHGQGEVSQVTRSFLGQVMTSRPCPQCSGQGSVITNPCGDCAGEGRVREKVTRTVKIPAGVDDGTRIQLAGEGEVGPNGGPRGDIILEIIQRPHPTFERRGDDLHCTVTVPMTAAALGASFAFDTLDGTENIDLRPGTNSGHVITLPNKGVSHLDGGGRGDLRIRVDVETPSRLDEEQEALLRKFAELRGEDQTPGRFSPGHGGFFSKIRDAFGAK
>NC_014210.1|WP_013151755.1|865972_866710_+|16S-rRNA-(uracil(1498)-N(3))-methyltransferase
MTPPVFLVEAADLAADRVTVDGAEGRHAAVVRRIREGETVDLSDGRGLRARCTVTAVGGDHIVCAVVERREEPAPRPRLTVVQALPKGDRGELAVEMMTEAGADAVVPWAAERCVTRWKGDRAAKALAKWRATAREAAKQARRARLPEVADLADRTAVVELLAGADLGVVLHEDGASRLSQLEPPVGQDADVVVVVGPEGGFSDAELEAFDAAGAVRALLGPSVLRTSTAGVAALSVLQARTGRW
>NC_014210.1|WP_013151756.1|866848_867610_-|hypothetical-protein
MTSPTNPTNDPFEEQLRHLLKAEADTVTTSPEALNLIRERTERSRGSAWFGMPWLRPAVAVAGAALIAGSVVISSPQVRDHVLEIVPAGADREGAPAEEEGEGGGVIAPDPSTGSVDGTTQQEEEPPRDPASSPTPEDDEEEPAPSEEGVTAATTCPTPEEPASPAPSSSEGEKGEKAASEEECEPSDEPSSGTGDGSTGEEGGGDGGGTGGEEPSGGDGTGGEGGGTGGDGTGTGGTGTTGGDNGAKTAPSS
>NC_014210.1|WP_013151757.1|867606_868137_-|SigE-family-RNA-polymerase-sigma-factor
MVAGATTAPLSVEWDADHAVTELYREHYRPLVRLAALLVRDHATAEEVVQDSFVAMHGAWRRLRDPNKALSYLRQAVVNKARSVLRHRAVVEKHAPKALPDAPSAEHGALSLLEREAVIRALRKLPTRQREAIVLRYYGDLSEAQIADAMGISRGAVKSHTSRGISALRSVLEQTT
>NC_014210.1|WP_013151758.1|868462_868813_+|histidine-triad-nucleotide-binding-protein
MAQDDCLFCKIVKGEVPAEIVRESERAVAFRDINPQAPTHVLVIPREHHPNAAEAAAADTGLLDEIVRVAHEVAVDEGVADQGYRLVFNTGSGAGQTVFHLHGHLLGGRGLNWPPG
>NC_014210.1|WP_013151759.1|869095_870205_+|PhoH-family-protein
MSETTHTHPPRDTQVKVVVPDEHTMVSLLGSRDELLRALERAFDSDIHVRGNEFTISGSPEETAVVVRLVEELIELAKSGTHVTPDTIERMVHMLRSPGAERPADVLTTNILSNRGKTIRPKTLNQKRYVDTIDQRTVVFGIGPAGTGKTYLAMAKAVKALQDKEVNRIILTRPAVEAGERLGFLPGTLYDKIDPYLRPLYDALHDMLDPDSIPKLMAAGTIEVAPLAYMRGRTLNDSFIILDEAQNTSPEQMKMFLTRLGFGSKIVVTGDVTQVDLPGGQTSGLRTIESILSDIDDIAFCRLSSEDVVRHKLVGKIVDAYGRYDAAQGDARDGRGSAGGGRSRRGSARRVAPDTPAEPGSAGDGEQAD
>NC_014210.1|WP_013151760.1|870399_870888_+|rRNA-maturation-RNase-YbeY
MSIDVANESGVTTVDEERLSRLARHVLDAMRVHPLAELSVVLVDEEPMADLHVRWMDEPGPTDVLSFPMDELRPGGPGRTSEPGVLGDVIICPQVAERQAEKAGHGTEAEIDLLCTHGILHLLGYDHAEPEEHKEMFGLQGEILAAWREREAAGAEGDESAR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_014210_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_014210_4

991666-991867

Orphan

Consensus_repeat	Method
CGGGGCCGCCGCCGTAGGGCGGCTGGCCGCC	CRISPRCasFinder

2 spacers

The CRISPR arrays of NC_014210_4

>merge|NC_014210|4|991666-991867|CRISPRCasFinder
CGGGGCCGCCGCCGTAGGGCGGCTGGCCGCCCGCGTACATCTGCTGGTCCTGGGGGCCGGGGAAACCCGCGGGGCCGCCGCCGTAGGGCGGTTGGCCGCCGGTGCCGGGGTCGCCGTAGGGACCGCCGTGGGGCGGCTGTCCTCCGGTGTTGGGGTCACCGTAGGGGGCGCCGTGGTGCGGGCCGTAGGGCGGCTGGCCCCC

>NC_014210|4|4|991666-991867|CRISPRCasFinder
CGGGGCCGCCGCCGTAGGGCGGCTGGCCGCC	CGCGTACATCTGCTGGTCCTGGGGGCCGGGGAAACCCG
CGGGGCCGCCGCCGTAGGGCGGTTGGCCGCC	GGTGCCGGGGTCGCCGTAGGGACCGCCGTGGGGCGGCTGTCCTCCGGTGTTGGGGTCACCGTAGGGGGCGC
CGTGGTGCGGGCCGTAGGGCGGCTGGCCCCC

Protein	Signature genes	Signature genes Name	Protein_function
NC_014210.1\|WP_013151864.1\|1002648_1006008_+\|HAMP-domain-containing-protein	unknown	unknown	gnl\|CDD\|377989
NC_014210.1\|WP_013151845.1\|975233_976448_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|379312
NC_014210.1\|WP_126625046.1\|1000878_1002123_-\|peptidase-M15	unknown	unknown	gnl\|CDD\|350615
NC_014210.1\|WP_013151847.1\|977927_979178_-\|UDP-glucuronosyltransferase	unknown	unknown	gnl\|CDD\|224732
NC_014210.1\|WP_013151860.1\|998602_999637_+\|LacI-family-DNA-binding-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224525
NC_014210.1\|WP_013151859.1\|996956_998357_+\|beta-glucosidase	unknown	unknown	gnl\|CDD\|274539
NC_014210.1\|WP_041552329.1\|986048_987638_-\|polysaccharide-deacetylase-family-protein	unknown	unknown	gnl\|CDD\|200578
NC_014210.1\|WP_041552331.1\|994087_995044_+\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|236863
NC_014210.1\|WP_013151850.1\|982876_984046_+\|quinone-dependent-dihydroorotate-dehydrogenase	unknown	unknown	gnl\|CDD\|235388
NC_014210.1\|WP_013151861.1\|999779_999998_+\|hypothetical-protein	unknown	unknown	unknown
NC_014210.1\|WP_041552322.1\|981953_982880_+\|PAC2-family-protein	unknown	unknown	gnl\|CDD\|378251
NC_014210.1\|WP_013151862.1\|1000041_1000707_+\|hypothetical-protein	unknown	unknown	unknown
NC_014210.1\|WP_013151855.1\|992382_993432_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226400
NC_014210.1\|WP_013151853.1\|988244_990545_+\|5-methyltetrahydropteroyltriglutamate---homocysteine-S-methyltransferase	unknown	unknown	gnl\|CDD\|235367
NC_014210.1\|WP_013151858.1\|995853_996714_+\|metal-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270315
NC_014210.1\|WP_013151857.1\|995040_995781_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224922
NC_014210.1\|WP_041552325.1\|984217_985777_-\|polysaccharide-deacetylase-family-protein	unknown	unknown	gnl\|CDD\|213022
NC_014210.1\|WP_117199296.1\|976444_977815_-\|aminotransferase-class-I/II-fold-pyridoxal-phosphate-dependent-enzyme	unknown	unknown	gnl\|CDD\|99747
NC_014210.1\|WP_013151848.1\|979868_981620_+\|ATPase	unknown	unknown	gnl\|CDD\|370720
NC_014210.1\|WP_013151844.1\|974547_975237_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213222

Protein	Function_ID	Function_description	E-value
NC_014210.1\|WP_013151845.1\|975233_976448_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	6.1876e-10
NC_014210.1\|WP_126625046.1\|1000878_1002123_-\|peptidase-M15	gnl\|CDD\|350615	cd14814, Peptidase_M15, Metalloproteases including zinc D-Ala-D-Ala carboxypeptidase, L-Ala-D-Glu peptidase, L,D-carboxypeptidase, bacteriophage endolysins, and related proteins. This family summarizes zinc-binding metallopeptidases which are mostly carboxypeptidases and dipeptidases, and includes zinc-dependent D-Ala-D-Ala carboxypeptidases, VanX, L-Ala-D-Glu peptidase, L,D-carboxypeptidase and bacteriophage endolysins, amongst other family members. These peptidases belong to MEROPS family M15 which are involved in bacterial cell wall biosynthesis and metabolism.	4.52299e-29
NC_014210.1\|WP_013151847.1\|977927_979178_-\|UDP-glucuronosyltransferase	gnl\|CDD\|224732	COG1819, COG1819, Glycosyl transferases, related to UDP-glucuronosyltransferase [Carbohydrate transport and metabolism / Signal transduction mechanisms].	8.35512e-28
NC_014210.1\|WP_013151860.1\|998602_999637_+\|LacI-family-DNA-binding-transcriptional-regulator	gnl\|CDD\|224525	COG1609, PurR, Transcriptional regulators [Transcription].	1.2487e-115
NC_014210.1\|WP_013151859.1\|996956_998357_+\|beta-glucosidase	gnl\|CDD\|274539	TIGR03356, BGL, beta-galactosidase.	0
NC_014210.1\|WP_041552329.1\|986048_987638_-\|polysaccharide-deacetylase-family-protein	gnl\|CDD\|200578	cd10954, CE4_CtAXE_like, Catalytic NodB homology domain of Clostridium thermocellum acetylxylan esterase and its bacterial homologs. This family is represented by Clostridium thermocellum acetylxylan esterase (CtAXE, EC 3.1.1.72), a member of the carbohydrate esterase 4 (CE4) superfamily. CtAXE deacetylates O-acetylated xylan, a key component of plant cell walls. It shows no detectable activity on generic esterase substrates including para-nitrophenyl acetate. It is specific for sugar-based substrates and will precipitate acetylxylan, as a consequence of deacetylation. CtAXE is a monomeric protein containing a catalytic NodB homology domain with the same overall topology and a deformed (beta/alpha)8 barrel fold as other CE4 esterases. However, due to differences in the topography of the substrate-binding groove, the chemistry of the active center, and metal ion coordination, CtAXE has different metal ion preference and lacks activity on N-acetyl substrates. It is significantly activated by Co2+. Moreover, CtAXE displays distinctly different ligand coordination to the metal ion, utilizing an aspartate, a histidine, and four water molecules, as opposed to the conserved His-His-Asp zinc-binding triad of other CE4 esterases.	7.69466e-72
NC_014210.1\|WP_041552331.1\|994087_995044_+\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|236863	PRK11153, metN, DL-methionine transporter ATP-binding subunit; Provisional.	1.20666e-157
NC_014210.1\|WP_013151850.1\|982876_984046_+\|quinone-dependent-dihydroorotate-dehydrogenase	gnl\|CDD\|235388	PRK05286, PRK05286, quinone-dependent dihydroorotate dehydrogenase.	0
NC_014210.1\|WP_013151864.1\|1002648_1006008_+\|HAMP-domain-containing-protein	gnl\|CDD\|377989	pfam08376, NIT, Nitrate and nitrite sensing. The nitrate- and nitrite sensing domain (NIT) is found in receptor components of signal transducing pathways in bacteria which control gene expression, cellular motility and enzyme activity in response to nitrate and nitrite concentrations. The NIT domain is predicted to be all alpha-helical in structure.	5.96137e-31
NC_014210.1\|WP_041552322.1\|981953_982880_+\|PAC2-family-protein	gnl\|CDD\|378251	pfam09754, PAC2, PAC2 family. This PAC2 (Proteasome assembly chaperone) family of proteins is found in bacteria, archaea and eukaryotes. Proteins in this family are typically between 247 and 307 amino acids in length. These proteins function as a chaperone for the 26S proteasome. The 26S proteasome mediates ubiquitin-dependent proteolysis in eukaryotic cells. A number of studies including very recent ones have revealed that assembly of its 20S catalytic core particle is an ordered process that involves several conserved proteasome assembly chaperones (PACs). Two heterodimeric chaperones, PAC1-PAC2 and PAC3-PAC4, promote the assembly of rings composed of seven alpha subunits.	4.49616e-41
NC_014210.1\|WP_013151855.1\|992382_993432_-\|hypothetical-protein	gnl\|CDD\|226400	COG3883, COG3883, Uncharacterized protein conserved in bacteria [Function unknown].	0.000151942
NC_014210.1\|WP_013151853.1\|988244_990545_+\|5-methyltetrahydropteroyltriglutamate---homocysteine-S-methyltransferase	gnl\|CDD\|235367	PRK05222, PRK05222, 5-methyltetrahydropteroyltriglutamate--homocysteine S-methyltransferase; Provisional.	0
NC_014210.1\|WP_013151858.1\|995853_996714_+\|metal-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270315	cd13597, PBP2_lipoprotein_Tp32, The substrate-binding domain of the 32-kilodalton lipoprotein (Tp32) from Treponema pallidum binds L-methionine; the type 2 periplasmic-binding protein fold. This group includes the lipoprotein Tp32, a periplasmic component of a methionine uptake transporter system, and its closely related homologs. The Tp32 has both structural and sequential homology to the MetQ family of substrate-binding protein, and thus it belongs to the type 2 periplasmic binding fold protein superfamily (PBP2). The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. The majority of PBP2 proteins function in the uptake of small soluble substrates in eubacteria and archaea.	4.77259e-95
NC_014210.1\|WP_013151857.1\|995040_995781_+\|ABC-transporter-permease	gnl\|CDD\|224922	COG2011, AbcD, ABC-type metal ion transport system, permease component [Inorganic ion transport and metabolism].	5.9306e-101
NC_014210.1\|WP_041552325.1\|984217_985777_-\|polysaccharide-deacetylase-family-protein	gnl\|CDD\|213022	cd10917, CE4_NodB_like_6s_7s, Catalytic NodB homology domain of rhizobial NodB-like proteins. This family belongs to the large and functionally diverse carbohydrate esterase 4 (CE4) superfamily, whose members show strong sequence similarity with some variability due to their distinct carbohydrate substrates. It includes many rhizobial NodB chitooligosaccharide N-deacetylase (EC 3.5.1.-)-like proteins, mainly from bacteria and eukaryotes, such as chitin deacetylases (EC 3.5.1.41), bacterial peptidoglycan N-acetylglucosamine deacetylases (EC 3.5.1.-), and acetylxylan esterases (EC 3.1.1.72), which catalyze the N- or O-deacetylation of substrates such as acetylated chitin, peptidoglycan, and acetylated xylan. All members of this family contain a catalytic NodB homology domain with the same overall topology and a deformed (beta/alpha)8 barrel fold with 6- or 7 strands. Their catalytic activity is dependent on the presence of a divalent cation, preferably cobalt or zinc, and they employ a conserved His-His-Asp zinc-binding triad closely associated with the conserved catalytic base (aspartic acid) and acid (histidine) to carry out acid/base catalysis. Several family members show diversity both in metal ion specificities and in the residues that coordinate the metal.	1.01039e-62
NC_014210.1\|WP_117199296.1\|976444_977815_-\|aminotransferase-class-I/II-fold-pyridoxal-phosphate-dependent-enzyme	gnl\|CDD\|99747	cd06454, KBL_like, KBL_like; this family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The major groups in this CD corresponds to serine palmitoyltransferase (SPT), 5-aminolevulinate synthase (ALAS), 8-amino-7-oxononanoate synthase (AONS), and 2-amino-3-ketobutyrate CoA ligase (KBL). SPT is responsible for the condensation of L-serine with palmitoyl-CoA to produce 3-ketodihydrospingosine, the reaction of the first step in sphingolipid biosynthesis. ALAS is involved in heme biosynthesis; it catalyzes the synthesis of 5-aminolevulinic acid from glycine and succinyl-coenzyme A. AONS catalyses the decarboxylative condensation of l-alanine and pimeloyl-CoA in the first committed step of biotin biosynthesis. KBL catalyzes the second reaction step of the metabolic degradation pathway for threonine converting 2-amino-3-ketobutyrate, to glycine and acetyl-CoA. The members of this CD are widely found in all three forms of life.	1.01472e-137
NC_014210.1\|WP_013151848.1\|979868_981620_+\|ATPase	gnl\|CDD\|370720	pfam09818, ABC_ATPase, Predicted ATPase of the ABC class. Members of this family include various bacterial predicted ABC class ATPases.	0
NC_014210.1\|WP_013151844.1\|974547_975237_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|213222	cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein. This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of lipoproteins from the cytoplasmic membrane (LolCDE). They are clustered together phylogenetically. MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all. An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport. The LolCDE complex catalyzes the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane.	5.60798e-76

>NC_014210.1|WP_013151853.1|988244_990545_+|5-methyltetrahydropteroyltriglutamate---homocysteine-S-methyltransferase
MTTTPAPSAAPGGPRPSVRSTVHGYPRIGPARELKRACESHWRGRTTARELDEVAAGLRLGVYAQLREAGVDDIPSNTFSYYDHVLDTAVLFDLVPSRFAPPAAAADREEELRRYFALARGEQGAPPLEMTKWFDTNYHYLVPELSPGSRPRLVGDKPVAEFREAAEAGFHTRPVLVGPLTFLLLAKPADGAPEGWEPVQLLDQLLEAYAQLLGDLRAAGATEVQLDEPILATDEGRAAVGHLERAYQYLGAVTDRPSLLVSTYFGSIGSAALRVLKDSAVEAVGLDLVTDDEGVDDLVRVSGLGATRLVAGVVEGRNVWRTDIPAAVAALGTLLALTDELTVSTSCSLLHVPLDLDAEPSLAPELRGALAFAKQKAEETALLGRVLSEGAESEHTGRGGVRPPAFTDARVRARLDALGPDAYERPRERGRPTDTPLTTTTIGSFPQTAELRRARAAHRRGELAEDAYKAVLREEIDRVVALQEEIGLDVLVHGEPERNDMVQYFAEQLEGYATTENGWVQSYGSRCVRPPILFGDVSRPQPMTVEWTTYAQSRTDKPVKGMLTGPVTMLAWSFVRTDQPLGETARQVALSLRDEVADLERAGIRHIQVDEAALRELLPLRSEHRARYLDWAVGSFRLATSGVSPSTTIHTHMCYSEFGLIVGGIEALDADVTSVEAARSRMELVRDLGERGYGRGIGPGVYDIHSPRVPSVEEIEGALRLAVAHIDARNLWVNPDCGLKTRGYAEAEQALRNMVEAARRVRADLA
>NC_014210.1|WP_041552329.1|986048_987638_-|polysaccharide-deacetylase-family-protein
MAPDHPLITVVVALAVLAGMVLLATRSSGEPEPGPRTHGAPVSESEPSPPASGEPDGLTEVDAAAVAGLEEAELPYDGEISVAVTYPVIPNAEPLADFLERELTDEVHAFEAANPGAVSFEAGWNLTAARDGLLGVRVTRVETDSEGSREGYTTYWYDTETAAHHPSAALVGGQEQLEELNGLVRGAVGSGEGGEGPADPGVVHPISSLYDSVGFNPDGDLVVEFDAGQVAPAEEGRTRAVVAAGEAEGLLSELGLRVRDAATVGVEDFSIAAPPQADKDGQEEGAVPGQVPAVDPEVDCSDPETKCVALTYDDGPGGRTPELLDALAEYDARATFFVTGNPVMEHPHTVRRAYAEGHEIANHTLNHPDLAGLGAGGVRADLDVVQALVYRETGYTMNLMRPPYGSTDEGVASVTADMGLAQILWSVDTLDWKDRKASVIHDRVLEGASDGAIILMHDIHGTTVDASRTAIRELDEQGYTMVTVSQLLGTTTPGQSYMDGVPDAPEEDADPSEEAGEPAEGAEEASEEA
>NC_014210.1|WP_041552325.1|984217_985777_-|polysaccharide-deacetylase-family-protein
MSSTRVHPNEAAPCPGAGGNRPWERRARWPGAALVALVLPLAACGTEGIASGGGEDPELITVVAAEPGDGVTEWRGDASDFEDHPYKPEGLTIDVAYPVFSGADAFAEELAARVDQEVRDYRGASRDPVSLGVDWEVVAAGDGVLGVRLVRTEEDFHGLRRGYGTYWYDASTGHTAYSTELLADDAALRELNGIVRASFADEEAVDARGLQPVMRTYDSMGFNGDGDLVVEFDDGHLSPIVEGHPPSSEPGRMVAVVPAEEAAPLLSGLGERAREAAMAEEPVLAVEAPDAEPPADPPVPGAVSAGDPDLDCAGAKCIALTFDDGPVATTPRLLDLLAEEEVAATFFLNGNPALTRPSVIRRAYAEGHEIGSHNHLHERMPDAFEGEELVHQVAAVSAMVRRQTGHTVELFRPPFGDSSPEVLGEIGRQGMAEILWSQDSKDWTGMSRDEVVESVVDGARPGGVVLLHDTLEPTLAAVPEIIERLRADGYEFATVSQVYDGPEAGKSYPPEGLSAPAGS
>NC_014210.1|WP_013151850.1|982876_984046_+|quinone-dependent-dihydroorotate-dehydrogenase
MTVFYQMLFRSVLRHMDAEKVHRLSFAALRGVTSLPAVASAMKGVLGPREPELTVHALGQEFPGPLGLAAGFDKNAESPSGLAALGFGFVEVGTVTAQPQPGNPRPRLSRLVADRAIVNRMGFNNEGSALVAERLHHRRGGRRPVLGVNIGKTKVTPEEEAPADYALSARRLARYADYLVVNVSSPNTPGLRNLQGVERLRPLLAAVREAMAEAGRPDLPLLVKIAPDLADEDVDAVADLALAEGLDGIIATNTTISREGLTTPAAQVEAAGAGGLSGAPLKRRSLEVLRRLRARVGDRVTLIAVGGIETPLDAWFRIRAGASLVQGYTGLIYGGPLWPRRINRGLARLVRASGHRSINEVVGADVPSPAAPAADTGQGADPAAATAKG
>NC_014210.1|WP_041552322.1|981953_982880_+|PAC2-family-protein
MRDSADLYELHPGFEDVAGLAMLVCLDGFVDAGHAGRQLITSLFERFTAEEVATFDADRLVDYRSRRPTMTFVENTWTAYDAPKIALYRLHDDEGAPFLVLHGPEPDREWEAFAAAVGRLVDHFSVTLSVSVHGIPMAVPHTRPVTVTPHSTRPELVEGHTPWIGRVEVPGSATSLLEYRLGERGHDFVGYAVHVPSYLAQAQYPRAAIAAAEYVAGATGLALATTEMEEVAAATDVDIAEQVMASEEIQRVVANLERQYDDIMSSRTDPEERPTLPLADDDAQLPTADELGAELERFLAEREGEGNG
>NC_014210.1|WP_013151848.1|979868_981620_+|ATPase
MTGRYGGGQGRRYGGRGGRGGGRGPEPEPIRGVRDEARLSEELLRMDGASYGRYKSLRGDWDFGDFTLTVQRVQADPFAPPSRVRVLIPDAGVPKSAWGDPVRRRATADYLGRRARRLLRGSLLRIDTGGQEVIERSSCQLTDGGIDLRIGIDLPGHGRRIDGRTAERELCRTLPRLVDDLDWEEVDAEEAAAFADTVADTVALRSQLEERGLVAFVADGAVLPRRSGVSDEPMTGGAVPFASPEGLRVSVDLPHRGTVSGMGVPEGITLIVGGGFHGKSTLLHALERGVYDHVPGDGRELVVTRGDAVKIRAEEGRRVERVDVSPFVRNLPTGADTSDFRTENASGSTSQAANICEAVEAGARTLLVDEDSTATNLMIRDERMQALVHGDREPLVPFIDLVRPLRREHGVSTVLVMGGSGDYFDVADHVVMLDAYHPHDVTERARELARERVDADFALPRPRVVDPASVDDGTSRGRGRIKRRDMDVLVFGDHDVDVRAVEQFVDPGQITGAGLALRELVAGRHLDGGRTLAEALDSLEEALDRRGVTLLGSDFGGDYALPRRFEVAAVLNRLRSLLVADLH
>NC_014210.1|WP_013151847.1|977927_979178_-|UDP-glucuronosyltransferase
MRVILFAPETFNLAETTRSIEVAKHLRETYECVFSGYSERYSGLIEEAGFTFHRLAPALTDEDADQLIRVDQGKAVRHPFTAAMLRTRVASELALIGTLRPAAVVIGTTLSQFVSARAAGVPLVYVKPFAYSWPHILQTRSLPLAEGDGPLPRAVNTGAAALLREAARVTTYKPAAFRAVAREHGVRLPGRTIQALDADLNLITSLSCYLRPYRMPANYRLVGPVFARIDREIPPDVVRVAEASARAKRPVVYFAMGSSGNREVVLRVLTELSRMPVTVIAPVASYLEESDLPQVADNIHVRDLLPAHLLGDLIDASVIHGGEGTVQTAVTTGKPFVGIGLQMEQRWNVADCVRFGNAVAVSPKDVSGASFRNAVEKVLTDPRTRSRARTLRELLSGVDGAASAAEHIHEHVSQKP
>NC_014210.1|WP_117199296.1|976444_977815_-|aminotransferase-class-I/II-fold-pyridoxal-phosphate-dependent-enzyme
MIDDLGFDSIMIMDLVSSLAKNYPQIRSIDPWEDFQDDITYADLELRLHALVEDTPADAPAAPEGIARMEKIVQFGDFLRGQEDLPYFAAYRGIAANTISVGARTFVNYSSYNYLGTNGHPRIRKAVDDAVAEHGTSVSASRLIGGEIGLHGELERTIADFIGVDDALVQVGGHSTNVNILGNLFGEDDLILHDSLAHNSLIQGALLSDAKRKPFKHNDMENLEQELARLRPRFRNVVIVVEGVYSMDGDLCPLPELLRIKEHHDAFLMIDEAHSIGTVGRAGRGVASHFGVDPRRVDIHMGTLSKAFNSCGGYIAGSRGFVEYLRYNLPGFVFSVGMTPANTAAALESIRLCQENPHWIDELHGISQRFLDTLRDMGLDTGKSGGTPVVPLITGDSALALRFSEQLHVSGINVAPILHPAVREDEARLRFFLSRLHTEEDLEVTFKALNELEATR
>NC_014210.1|WP_013151845.1|975233_976448_-|class-I-SAM-dependent-methyltransferase
MRHSEIALRRHDLALRSRQTPVVRAALAAANGLGLRGGPLLQLLLLSKLQGFLRHIVLTLMDREFPDGDLSARPDTDPRILDDFLRLALELGVAARVDGAVVPEPAYTTGFPGFGGDSATRPRAEAEKDYVFVRGLIRKAEADGETGPLHRPDVRYLIVLSRYILELEGMGFDAQVAPSFSEKFYSDLGALAYELYTKRSFERLCRRLSPASVLDIGCGDGLHMSSVLSTLPTARMVGLEPQVKVADATRERLSGHPNTRVESVRFTDHDTTDRFDMVLSSFMIFYMPEEERVPFFRRVREVLSPTGTYVIGQYFPDFEDVQEVLVRSTSPVPGIQLYLSGVGNSLVKAEALLNRVLSDFRSVAYWSTLQDQLSEAGLAVEEIVPADSMYYSYFLLVRRAEGAS
>NC_014210.1|WP_013151844.1|974547_975237_-|ABC-transporter-ATP-binding-protein
MIAAENLVKSFPVGGEHGTTVLKGVSLKIEEATLCTILGPSGSGKSTLLNCLSGLEGIDSGTVTVADRDVHSLSRREVDRFRRDEIAFVFQEYNLVGDLTLHENIVLDRPLIPKVDELIDGWNLRGVVDSFPGECSGGQRQKCAILRALNKECAILFCDEPTGALDTVSTREVFSVLQDLTLRFGVTIVMITHNELVTGISHQVVRLHDGRVVSDDRGLAPVDASSVAW
>NC_014210.1|WP_013151855.1|992382_993432_-|hypothetical-protein
MQPDDLSRVDEFADFWAPDPPELSWPDRARALAGFLAAAARPDRARVAALAVAVLGSFLFAPQGTAVAAPVPAEPEDMGALQDRAEALSEEFNGELRDMEGVIQEAERAEERAQSTREDVEEAREQVRALAVATYTSSGIDLSMSLFVEADPDEVIDRAVVINYLSTSNQDKIDQLSEALERDETAQQNAEEQLAAAEEDLDELEGRREEVQEMIADHPVQPMGGQYNITPRTEQMRELIIEKFGEGTDVGGVGCYREVGGWVVGEHPKGRACDFMVDPNGNTPSQEQIDRGYAIAEWAQENADRLGIMYIIYRQQIWDIRRGDEGWRDMADRGSITENHFDHVHISMF
>NC_014210.1|WP_041552331.1|994087_995044_+|ATP-binding-cassette-domain-containing-protein
MGLHKAYRLKKHRVTALDGVDLHVEPGEIFGVVGQSGAGKSTLLRSVNLLERPDAGTVRVDGEELTALRGARLRVARRRIGMVHQHFALLSSRTVAGNVAFPMEVSGVDRARRRRRVGELLELVGLGDKARAYPSQLSGGQKQRVGIARALASDPKVLLSDEATSALDPATTDAILALLRRLRDELGLTILLITHEMDVIKRICDSAAIMDSGAFLESGRVLDLIGTPGSLLARSLFPLPAHGGPDTVYVTYPRSFDEPLMSELTRRFDVDVNILGGGVEEVAGQSVGRLSVDLRGDRRDQALAYLSEHGLLVEEARK
>NC_014210.1|WP_013151857.1|995040_995781_+|ABC-transporter-permease
MSTNPADVLHLAAATGAAGPWDAVVAFVQAWPAMWPDLWLGTLDTVYMVWWATVVSVLFGLPLGVLLVATDRGGLIPAPAVRAVLSAVVNIGRSLPFIVLMVAVLSLTRLLVGTTLGPTAAIVPLSIGAIPFFARLVETSLREVDRGVVEAAHAMGTRRVTIVGKVMLPEAMPGLIAGLVMTVVTLISYSAMAGAIGGGGLGDLAIREGYQRFNDHYLWATVILLIVIVQIAQSLGDLLVRRLARR
>NC_014210.1|WP_013151858.1|995853_996714_+|metal-ABC-transporter-substrate-binding-protein
MTEDARRRAVRGAAAATAAALLAACGSPSERAREETGGEDVTVLRIGATPMPHAEILEFVDENLAADAGLALDVSVYTDYNQPNAALAEGELHANYYQTRPFLEEYLQGNPDADLSYVTDVHLEAFGVYSQELTDLADLPEGAQIGVPNDTSNMGRALDLLDTEGVITLADTGEEAPSVDDIEDNPLDVTVTPVEAAQLPRSLQDLDAAVVNGNYALEADLVSTANVLAWEETEDNPYANGLVVATHDIGDEEIARLDELLHSDEVRAFMEERWEGVVVPVGGEGD
>NC_014210.1|WP_013151859.1|996956_998357_+|beta-glucosidase
MNNRNDFPEGFLWGAATASFQIEGATTADGRGRSIWDTFAETPGKVLGGDTGDPADDHYNRYADDVALMTQLNLGAYRFSVAWPRIIPEGTGAVNQAGIDFYDRLVDTLLAAGIQPWATLYHWDLPQPLEDAGGWPHRDTAYRFRDYAQVVAEALGDRVSNWMTINEPWCSAFLGYENGHHAPGHKDPAAALAAAHHLLLGHGLAAEAIRSTGHPARVGLAHNQAVIRPHGPSAADARAARRADGVRNRIFTDPLLKGRYPADVREDLAGVSDFSFIQDGDLEITSAPLDFLGVNYYSPEFVAASAKGLDPALVSGEGGAWLGAEPEEVHVSQGLPVTHMGWEIDPTGLYDVLSRLAGESGGIDLYVTENGCAFEDTVTEAGEVNDTDRIDYYEGHLRAAKEAVLAGVPLRGYFAWSLLDNFEWAWGYSRRFGIVHVDYETQRRIIKDSGHWYAELAKTGQFPERQ
>NC_014210.1|WP_013151860.1|998602_999637_+|LacI-family-DNA-binding-transcriptional-regulator
MAKTGAGRKRPTLEMVAQRAGVGRGTVSRVINGSAQVSPRTREAVHAAIAELGYSPNQAARTLVTRRTDTIALVVSEPRDRLFSDPFFADIIRGVSSVLHERDLQLMLTTARTEAEHKRVGDYLSGFHVDGALLISLHSDNPLSARLDEAGVPVVHGGRPHSPEQPAPYCVDIDNIGGARMAIRHLLERGCRRVAAITGPLDMNAGVERLRGYREVMAAAGLEVDDRLVVQGDFSVEGGAEAMERLLGTGLEPDAVFAASDMMALGGLRVLRARGLRVPEDVALVGYDDTVMAQHSDPPLTTIHQPTVQMGQEMARLLVDVAIPRTTEAETVMLGTHLVVRESG
>NC_014210.1|WP_013151861.1|999779_999998_+|hypothetical-protein
MEREPTHSRCAISSCGWCERDGVECRFCSGTGWWRPERPHRDGSGVIVWLRVDEPCRGCAGTGKEHSPTAVL
>NC_014210.1|WP_013151862.1|1000041_1000707_+|hypothetical-protein
MRWVTYLSPSGGSERVGALDDGDVLGSPDPVRLADLLEAGGDALAGAHERAVAAPIEIIVEPEARMCAPLVPAEPVPVRAGDDVWRIPPELVRGSDDAVPPRASSARVGVAAVAGGGASVSAYTPACLWLDGEGQPVQLTLGPVLTTADEVPGEPLNVSASVEEGELGRGLADPAHEWLVSGPGRVRALLPVATPPLETDDELFVDADVLGTFEVRVGSQV
>NC_014210.1|WP_126625046.1|1000878_1002123_-|peptidase-M15
MGPAHGKTRGPSVRAFSVSTALPAGLAVLLCLSTAAPGAASDGDASGSALGSVRVELAALRAGMETLRQEASEKIEHYEAERERLTELTERSREAQERAGEADERGETARLAAARQAATAYKGGELGMVNAWAGPEGPTGMLERGAYLTLLGSHREADVGRAEAARVATDTLAGIAETARTEQAEAVEDARSAREDAVEAVADQEAALEELLEEQTRLEARLAEVRDAEAAERRREEALRDARAANSSGGSAESAVTAVSAEEQEGGEEAPSAEGADRGCTGGVATAHANGRIPESVLCPLPQPGERLRADAAEAFIELDGDYREAFGRPMCVADSYRPYHEQVRLFQEMVPGMAARPGTSQHGLGLAVDLCGGVNRLGTAEHQWMLAHAPEHGWHNPPWARGGFEPWHWEFTP
>NC_014210.1|WP_013151864.1|1002648_1006008_+|HAMP-domain-containing-protein
MSTRATKNGAGAQSEAAQAEHADATPKRRADWWRPRNWRVRSRLVALIVIPTAVALALGGLRVYEAAVSTVTHAHIQDRAEVGVLIVELANQLGHERSASAVYISDNADPARRSDELRQRMEEERDASRDLQQTLTARLDDMGEVDTETASSRLSSMRSQLSTLDALRTEVDETRITVLPVVTKYRTITRSLAEFNQTMADGTGDTDLRESVRTLTALSTARDQLSYETALMGHSLARNTMTGGIAEAIDSARARYESEISNFVQAASEEQRQIFDDNFTGLEVSQVSTMRMRVMYRADRGDDLTGVTANDGPEDYREIADVALGRLQTVEEGIAEGIAADANTLRDEAMGRALIDLFVVAGVLLAVFVLTSLVVRSLVRPLRALEDGARRVAERDLPDAINRMQEAGTVPENVKVTPIEVDTHDEIGEVARAFDDVHRVALTLASDEAALRSNVNAMFVNLSRRSQTLVERQLRLIDGLEQSEQDADRLSDLFQLDHLATRMRRNNENLLVLSGQDNTRKWAQPVPLVDVLRGAVSEVEQYERVNVRAPSHISVLGRPVNDVIHLVAELVENATSFSPHDTEVLVSAKTLDNGGVQVDVTDSGIGMAPEDMAAINARLAAPPVIDVAVSRRMGLFVVSRLAHRHGVRLRLEEAHGGGTTAHVIFPPDLLITPVEGQHALGGADSRPELTSGAPNTYADAEAAFASTPAPVEPNDPWQTQESGSVPGDLGGLPRRQTTGSHTEEHPPSGQDLWGNTGTGSVWDTTRGAGTTGSPSGGANGRPVVDPYDASEDDEPQRPQPETGGRNFFDPSPRGDSFGGGSVGRSTDTGSFSRPSDTGSFRRPTGDTGEFRRPDTGAFRSTANESYDAFGGAGAQSGGHTGAPADNGASAGNGAFSGNGSGHAFGGRDMGAHERPAARERDDNTETFPAIPSSQDGGNWRSGGIDSREGYGSTAYLSRRYGGAQGPNNTVVPPTPSGEESDSLPIFDAIESNWFKRRTGGPTVDTTETGPIQQVPAAQEQRSPASTDQAPRSTQEWTSEADRGWKAARTAAEPKADGLTPSGLPKRVPKANLVPGTAPKPENFKQMPTRSADRVRNRFSGFQKGVREGRDRLGEGSTEG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_014210_5

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_014210_5

1110362-1110444

Orphan

Consensus_repeat	Method
CGGAGACGGCTGTCCTCCCGGTG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_014210_5

>merge|NC_014210|5|1110362-1110444|CRISPRCasFinder
CGGAGACGGCTGTCCTCCCGGTGGTCTCCGGGGAGCCGGAGGACGGACACGCTCCCGGCTCGGAGACGGCCGTCCTCCCGGTG

>NC_014210|5|5|1110362-1110444|CRISPRCasFinder
CGGAGACGGCTGTCCTCCCGGTG	GTCTCCGGGGAGCCGGAGGACGGACACGCTCCCGGCT
CGGAGACGGCCGTCCTCCCGGTG

Protein	Signature genes	Signature genes Name	Protein_function
NC_014210.1\|WP_013151962.1\|1116463_1117078_+\|signal-peptidase-II	unknown	unknown	gnl\|CDD\|237810
NC_014210.1\|WP_013151954.1\|1106934_1107453_+\|cell-division-protein-SepF	unknown	unknown	gnl\|CDD\|224712
NC_014210.1\|WP_013151960.1\|1115249_1115777_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NC_014210.1\|WP_013151963.1\|1117074_1118001_+\|RluA-family-pseudouridine-synthase	unknown	unknown	gnl\|CDD\|223638
NC_014210.1\|WP_013151955.1\|1107492_1107780_+\|YggT-family-protein	unknown	unknown	gnl\|CDD\|376765
NC_014210.1\|WP_013151949.1\|1100518_1101979_+\|UDP-N-acetylmuramate--L-alanine-ligase	unknown	unknown	gnl\|CDD\|234757
NC_014210.1\|WP_013151951.1\|1103260_1104757_+\|cell-division-protein-FtsZ	unknown	unknown	gnl\|CDD\|236468
NC_014210.1\|WP_013151964.1\|1118230_1119211_-\|DMT-family-transporter	unknown	unknown	gnl\|CDD\|223769
NC_014210.1\|WP_013151956.1\|1107914_1108790_+\|DivIVA-domain-containing-protein	unknown	unknown	gnl\|CDD\|377456
NC_014210.1\|WP_013151958.1\|1111214_1114415_-\|isoleucine--tRNA-ligase	unknown	unknown	gnl\|CDD\|235681
NC_014210.1\|WP_041552353.1\|1102035_1102764_+\|FtsQ-type-POTRA-domain-containing-protein	unknown	unknown	gnl\|CDD\|135428
NC_014210.1\|WP_013151948.1\|1099361_1100522_+\|undecaprenyldiphospho-muramoylpentapeptide-beta-N-acetylglucosaminyltransferase	unknown	unknown	gnl\|CDD\|234825
NC_014210.1\|WP_013151967.1\|1122829_1123147_-\|branched-chain-amino-acid-transport	unknown	unknown	gnl\|CDD\|377512
NC_014210.1\|WP_013151965.1\|1119284_1120190_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176115
NC_014210.1\|WP_013151952.1\|1105008_1105728_+\|peptidoglycan-editing-factor-PgeF	unknown	unknown	gnl\|CDD\|376831
NC_014210.1\|WP_013151959.1\|1114768_1115029_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379328
NC_014210.1\|WP_013151947.1\|1097934_1099365_+\|putative-lipid-II-flippase-FtsW	unknown	unknown	gnl\|CDD\|274232
NC_014210.1\|WP_013151953.1\|1106078_1106807_+\|YggS-family-pyridoxal-phosphate-dependent-enzyme	unknown	unknown	gnl\|CDD\|223402
NC_014210.1\|WP_013151961.1\|1116023_1116434_+\|conjugal-transfer-protein-TraR	unknown	unknown	gnl\|CDD\|274340
NC_014210.1\|WP_013151966.1\|1120549_1122232_-\|thiamine-pyrophosphate-binding-protein	unknown	unknown	gnl\|CDD\|181285

Protein	Function_ID	Function_description	E-value
NC_014210.1\|WP_013151962.1\|1116463_1117078_+\|signal-peptidase-II	gnl\|CDD\|237810	PRK14764, PRK14764, lipoprotein signal peptidase; Provisional.	4.91418e-65
NC_014210.1\|WP_013151954.1\|1106934_1107453_+\|cell-division-protein-SepF	gnl\|CDD\|224712	COG1799, COG1799, Uncharacterized protein conserved in bacteria [Function unknown].	1.25347e-30
NC_014210.1\|WP_013151960.1\|1115249_1115777_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	1.34382e-05
NC_014210.1\|WP_013151963.1\|1117074_1118001_+\|RluA-family-pseudouridine-synthase	gnl\|CDD\|223638	COG0564, RluA, Pseudouridylate synthases, 23S RNA-specific [Translation, ribosomal structure and biogenesis].	1.30621e-99
NC_014210.1\|WP_013151955.1\|1107492_1107780_+\|YggT-family-protein	gnl\|CDD\|376765	pfam02325, YGGT, YGGT family. This family consists of a repeat found in conserved hypothetical integral membrane proteins. The function of this region and the proteins which possess it is unknown.	7.21968e-05
NC_014210.1\|WP_013151949.1\|1100518_1101979_+\|UDP-N-acetylmuramate--L-alanine-ligase	gnl\|CDD\|234757	PRK00421, murC, UDP-N-acetylmuramate--L-alanine ligase; Provisional.	0
NC_014210.1\|WP_013151951.1\|1103260_1104757_+\|cell-division-protein-FtsZ	gnl\|CDD\|236468	PRK09330, PRK09330, cell division protein FtsZ; Validated.	0
NC_014210.1\|WP_013151964.1\|1118230_1119211_-\|DMT-family-transporter	gnl\|CDD\|223769	COG0697, RhaT, Permeases of the drug/metabolite transporter (DMT) superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / General function prediction only].	2.76447e-20
NC_014210.1\|WP_013151956.1\|1107914_1108790_+\|DivIVA-domain-containing-protein	gnl\|CDD\|377456	pfam05103, DivIVA, DivIVA protein. The Bacillus subtilis divIVA1 mutation causes misplacement of the septum during cell division, resulting in the formation of small, circular, anucleate mini-cells. Inactivation of divIVA produces a mini-cell phenotype, whereas overproduction of DivIVA results in a filamentation phenotype. These proteins appear to contain coiled-coils.	6.35545e-15
NC_014210.1\|WP_013151958.1\|1111214_1114415_-\|isoleucine--tRNA-ligase	gnl\|CDD\|235681	PRK06039, ileS, isoleucyl-tRNA synthetase; Reviewed.	0
NC_014210.1\|WP_041552353.1\|1102035_1102764_+\|FtsQ-type-POTRA-domain-containing-protein	gnl\|CDD\|135428	PRK05529, PRK05529, cell division protein FtsQ; Provisional.	1.61286e-31
NC_014210.1\|WP_013151948.1\|1099361_1100522_+\|undecaprenyldiphospho-muramoylpentapeptide-beta-N-acetylglucosaminyltransferase	gnl\|CDD\|234825	PRK00726, murG, undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional.	2.4653e-136
NC_014210.1\|WP_013151967.1\|1122829_1123147_-\|branched-chain-amino-acid-transport	gnl\|CDD\|377512	pfam05437, AzlD, Branched-chain amino acid transport protein (AzlD). This family consists of a number of bacterial and archaeal branched-chain amino acid transport proteins. AzlD is known to be involved in conferring resistance to 4-azaleucine although its exact role is uncertain.	5.02616e-07
NC_014210.1\|WP_013151965.1\|1119284_1120190_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176115	cd08423, PBP2_LTTR_like_6, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold. LysR-transcriptional regulators comprise the largest family of prokaryotic transcription factor. Homologs of some of LTTRs with similar domain organizations are also found in the archaea and eukaryotic organisms. The LTTRs are composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal substrate-binding domain, which is structurally homologous to the type 2 periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcriptional repressor undergoes a conformational change upon substrate binding which in turn changes the DNA binding affinity of the repressor. The genes controlled by the LTTRs have diverse functional roles including amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to a name a few. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	3.88633e-55
NC_014210.1\|WP_013151952.1\|1105008_1105728_+\|peptidoglycan-editing-factor-PgeF	gnl\|CDD\|376831	pfam02578, Cu-oxidase_4, Multi-copper polyphenol oxidoreductase laccase. Laccases are multi-copper oxidoreductases able to oxidize a wide variety of phenolic and non-phenolic compounds and are widely distributed among both prokaryotes and eukaryotes. There are two main active catalytic sites with conserved histidines that are capable of binding four copper atoms.	4.07306e-77
NC_014210.1\|WP_013151959.1\|1114768_1115029_+\|hypothetical-protein	gnl\|CDD\|379328	pfam13676, TIR_2, TIR domain. This is a family of bacterial Toll-like receptors.	0.0073018
NC_014210.1\|WP_013151947.1\|1097934_1099365_+\|putative-lipid-II-flippase-FtsW	gnl\|CDD\|274232	TIGR02614, Putative_lipid_II_flippase_FtsW, cell division protein FtsW. This family consists of FtsW, an integral membrane protein with ten transmembrane segments. In general, it is one of two paralogs involved in peptidoglycan biosynthesis, the other being RodA, and is essential for cell division. All members of the seed alignment for this model are encoded in operons for the biosynthesis of UDP-N-acetylmuramoyl-pentapeptide, a precursor of murein (peptidoglycan). The FtsW designation is not used in endospore-forming bacterial (e.g. Bacillus subtilis), where the member of this family is designated SpoVE and three or more RodA/FtsW/SpoVE family paralogs are present. SpoVE acts in spore cortex formation and is dispensible for growth. Biological rolls for FtsW in cell division include recruitment of penicillin-binding protein 3 to the division site. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan, Cellular processes, Cell division].	2.15735e-127
NC_014210.1\|WP_013151953.1\|1106078_1106807_+\|YggS-family-pyridoxal-phosphate-dependent-enzyme	gnl\|CDD\|223402	COG0325, COG0325, Predicted enzyme with a TIM-barrel fold [General function prediction only].	3.07161e-84
NC_014210.1\|WP_013151961.1\|1116023_1116434_+\|conjugal-transfer-protein-TraR	gnl\|CDD\|274340	TIGR02890, conserved_hypothetical_protein, regulatory protein, yteA family. Members of this predicted regulatory protein are found only in endospore-forming members of the Firmicutes group of bacteria, and in nearly every such species; Clostridium perfringens seems to be an exception. The member from Bacillus subtilis, the model system for the study of the sporulation program, has been designated both yteA and yzwB. Some (but not all) members of this family show a strong sequence match to Pfam family pfam01258 the C4-type zinc finger protein, DksA/TraR family, but only one of the four key Cys residues is conserved. All members of this protein family share an additional C-terminal domain. Smaller proteins from the proteobacteria with just the N-terminal domain, including DksA and DksA2 are RNA polymerase-binding regulatory proteins even if the Zn-binding site is not conserved. [Unknown function, General].	9.55919e-20
NC_014210.1\|WP_013151966.1\|1120549_1122232_-\|thiamine-pyrophosphate-binding-protein	gnl\|CDD\|181285	PRK08199, PRK08199, thiamine pyrophosphate protein; Validated.	0

>NC_014210.1|WP_013151956.1|1107914_1108790_+|DivIVA-domain-containing-protein
MPLTPADVRNKQFSTTRLRPGYDEEEVDAFLDEVESELDRLIQENEELRGKLAECLRGKVPNAGMQDFQQQDQAPEPQHEQMRPEPVQPPQAVEPQPPVQQQMQMAGPGMGMGGEENMDTAARVLALAQQTADQAISDARREADETLGRARHESEDILGKARRQADQIIGEARARSENLDRDAQERHRQVMGSLVQQREELEHKVNVLKDFEREYRSRLKDYFERQLRELKSEEEKAQELNNPNTTGGFQTMAPQTGATPSLQHGPTGNPFGQPEPAQHGGFHPGEPHERR
>NC_014210.1|WP_013151955.1|1107492_1107780_+|YggT-family-protein
MSTVLSVLIIILQLFVFVLLARVILEMVQSFSRSWRPTGFVLVIAEIVYTITDPPLRFLRRFIKPVRLGSIALDLSVLVLFFGVYILIALLGSFA
>NC_014210.1|WP_013151954.1|1106934_1107453_+|cell-division-protein-SepF
MAGAMRKMAVYLGLVEDDRYDHRYADEYDEFDDFDEGVEEQRERDADAPPGEEARGDVMDTGGYLGSGRGGTTATASTADLARITTLHPRTYNEARTIGEHFREGTPVIMNLTEMVDSDAKRLVDFAAGLIFGLHGSIERVTNKVFLLSPANVEVTAEDKARIAERGFFNQS
>NC_014210.1|WP_013151953.1|1106078_1106807_+|YggS-family-pyridoxal-phosphate-dependent-enzyme
MTHADPARVEQVRANLAAARARIEAACAKAGRSPDEVSLVAVTKTHPASDVRILASLGVTDVGENRDQEAAPKAAETADLGLTWHFVGQLQTNKARSVASYADVVHSVDRARLARALGERAAAAGRSLTCLVQINLDEDSRAGVIGPRGGVDPGDALELAARIEEHEALVLGGVMAVAPREGDPSAAFARLQEVAARIRDRYPRATVVSAGMSGDLEAAVERGATHLRLGTALLGNRGPIVG
>NC_014210.1|WP_013151952.1|1105008_1105728_+|peptidoglycan-editing-factor-PgeF
MSNVIDLGHGVRAAVTERHGGVSAPPYDSLNMGLSSGDEREAVLANRKIAARDLGFDVDRVVWMHQVHSADVLVATGPGGAGTCDGVVTTRSDLVLASMAADCLPVLAADAEAGVLGAAHSGRLGTANGVAANLVAAMADQGARADRITVFLGPAICGGCYEVPPHVRDETARGVPEAACTTSRGTAGVDMRAAVTAQLRRAGVTDIRADGRCTLESPELFSHRGQAPTGRFAAFLWRA
>NC_014210.1|WP_013151951.1|1103260_1104757_+|cell-division-protein-FtsZ
MAAPQNYLAVIKVVGIGGGGVNAVNRMIEEGLKGVEFIAINTDAQALLMSDADVKLDVGRELTRGLGAGANPDVGRKAAEDHREEIEEVLKGADMVFVTAGEGGGTGTGGAPVVANIARSLGALTIGVVTRPFGFEGKRRATQAESGIAMLREEVDTLIVIPNDRLLSISDRQVSVLDAFKAADQVLLSGVQGITDLITTPGLINLDFADVKSVMSGAGSALMGIGSARGDDRAVAAAEMAISSPLLEASIDGAHGVLLSIQGGSDLGLFEINEAAQLVANSAAPEANIIFGAVIDDALGDEVRVTVIAAGFDEPEGVIPVVRERQPVDPPEAAAPKAGITSGREERTAPAAPASADASGASAANMPWITPSRPAEPAPEPQWTPPATQAPPVQQPVEAEPAHQEQYTQAAPAEPGPAQQTPPHGTSAFQAEAEPAEPVRAEEPAPAEEEPAEREGGHAGHIHAVSDATAERRGDVPTPRRRVIFDDPDDLDVPEFLK
>NC_014210.1|WP_041552353.1|1102035_1102764_+|FtsQ-type-POTRA-domain-containing-protein
MVAEQEEAAGHAVPRKRSDPWKFAFVALLVVALVCVVAWLLLGSRLLVVRDVAVTGLDRTPSEEVVAALGVPTGTPLIRVDLDRSEERAEALPLVESATVTRGWPATLEVEVVERRPLLAVQAGEDYRLIDADGVRIEDAPSLPDAYPLVRVTGEVEGNEAVAAAADIVGRAPDSLLSRIRLIDATDPEAIVIELAEEARVEWGSPEETARKSDVLRVLIGEHPPQEERVYDVSAPDLAVVR
>NC_014210.1|WP_013151949.1|1100518_1101979_+|UDP-N-acetylmuramate--L-alanine-ligase
MSLVRPTEPVPVDKLGRTHFIGLGGAGMSGIARVLLQSGVEVSGSDARDSDTLRELEQMGADVHVGHAADNLGTAETLVVSSAIREDNPELVEARRRGLRVLPRAAALGALLLGREGVAVSGTHGKTTTTSMVAVVLQHVGADPGYVIGGKLVTTGLGADAGIGEVIAVEADESDGSFLMLSPKIAVVTNVEADHLDNYSGIEEIHANFASFVDRVERTLVVGVDDPGARRVAELARERGKRVLTYGEAEDADYRVTRVRARGFTTEFTIRTANGEPVDGQLAVPGRHNVLNAAAAVAVADELGHDLEVAVEGIADFAGAARRFEPKGEAGGVAVYDSYAHHPTEIEADLRATRAALESLAEEAREDGREHAGGRVVALFQPHLYSRTRIFAEEFAAALGLADEVVVTEVYAAREDPEPGVTAELITSRVAHDRVWYVPGRDDAVLRVAELAGPGDIVLTMGAGDVTELGPRIVEALAQRADGLGG
>NC_014210.1|WP_013151948.1|1099361_1100522_+|undecaprenyldiphospho-muramoylpentapeptide-beta-N-acetylglucosaminyltransferase
MRVALAGGGTAGHIEPALSLADALRRMDPSTEILCLGTERGLETRLVPMRGYELGIIPAVPLPRRLTPQLLSVPGKLAGALSAAGEHLDRLQADIIVGFGGYVATPGYLAARRRRIPIVVHEANPLPGLANRLGARLTPHVFTGHPHTQIRNGRFVGIPLREQITSLDRLAMGDKARTYFGLRHDLPTLLIFGGSQGAQRINETAYAARDAFRDSGVQVLHVVGPKNADEPQDLTQMGIPYVAVPYVDRMDMAYAAADVAMCRSGAMTCAELTAVGLPGAFVPLAIGNGEQALNAEPIVQAGGGMMVNNADVSVEWITQQLIPLLTDTDRVVAMSEAAARMGRRDADMELAREVTAIARGDKPTPDMPVSEDDGDEAFYDDGKDTR
>NC_014210.1|WP_013151947.1|1097934_1099365_+|putative-lipid-II-flippase-FtsW
MAATTAVPGATRSKARAAVGGRERALWREWVRLLDRPLTSYYLILGTSVLLIALGLMMVLSSTMVNSIDETGSAFSMFQQQLVSAALGLPLMFLASHLPQRIFRLVGYPAMIVSAALLLLTVFQGVEVNGATRWLDLGGLIIQPSEPAKLAFALWGANILARKEELRELTEWRHLLIPLLPGCGLLVLLVLMGSNLSTGLVFLVTFLGLLWVVGAPGRLFGAMFGLVLGLAAIAIAIEPYRMARVTSFLDPEADPLGSGMQSLHSLYALGTGGVFGVGIGESREKWGFLPFAESDFVFAIIGEEFGLIGTLLMLALFGMLGYAGMRVAFRVKEPFPRLASFAIVTWIMGQAMINIGAVIGLLPVTGVPLPLVSYGGSSLVTTMAALGVLLALAKTEPEARKVLEARGPSRVQRALSWLGLDNIAASVNNLGGAAASGRPTTARGPRTAGARGGRTTAKHRSGPVPAGDRPRRNRRR
>NC_014210.1|WP_013151958.1|1111214_1114415_-|isoleucine--tRNA-ligase
MANDPRPESRALPQLPAQIDLPAMEREILGRWSKENVFQRSLDQTRGGPNWVFYEGPPTANGQPGVHHVEARAFKDVFPRFRTMRGYHVDRKAGWDCHGLPVEVAVEKELGLSGKKDIESFGIAEFNDRCRESVLRNVDAFTSMTERMGYWVNMDDAYRTMDPQYVESVWWALKQIWDKGLLVRDYRISPYCPRCGTTLSDHELAQGYETVTDPSVYVRFPVTSGPLAAAEHPTSLLVWTTTPWTLVSNTAVAVHPDVEYVVATDGQERLVVARPLFEKVLGEGWELTGESFEGDEMERWTYERPFDLVPFDEPAHYVVLADYVTVEDGTGLVHQSPAFGADDMVVCRAYGLPVVNPVRPDGTFEADLPLVGGVFFKEADKTLVRDLRDRGLLFRHVSYEHSYPHCWRCHTALLYYAVPSWYIRTTAVKDELIAQNQATHWVPENVKEGRFGEWLRGNVDWALSRNRYWGTPLPIWEFPDGRQICVGSLEELGRLSGRDLSSLDPHRPYVDDIVIPDPDADPSLPEEERVARRVPEVIDAWFDSGSMPFAQWGAPHQNEETFRENFPAQYISEAIDQTRGWFYSLLAVSTLVFGRNSFENVVVLGHILAEDGRKMSKHLGNVMEPIAVMDRHGADALRWFMLASGSPWTARRVGHAALEEIVRKVLLTYHSTVSFFTLYANAGEGWDHSLLDSAPAPQDRPLLDRWLLSELNEVVRDVTEAMDTFDTTAAGRRLTAFVDDVSNWYVRRSRRRFWGGAATPEGAAAFATLFEALETVTLLMAPIVPFLTDHVWSALRRPGAPDSVHLASWPEVREDLIDPELSRNMALTRRLVELGRSARVDSAVRTRQPLARALVGAPGFADLPEQLRGQIADELNVASLDSLSSVGGDLVDFTVKPNFRALGKRFAKRTPLVAKAVQAADPAELVRQVRATGWARVHVEDEPVEVSADELLVTEQPREGWAVASESGETVALDLELTPELRRAGLAREMVRMLQEARKRSGLEVSDRIEVWWTVTDEATELALAEHGQAIAAEVLADSFVAGEPGRELHTASSEEFGVTFGFRKA
>NC_014210.1|WP_013151959.1|1114768_1115029_+|hypothetical-protein
MAEDVRGAVLVTMADREDAEELADQLLEQGYEPCLVHRDMLAGEDDAEDVDWVIEVHTGPHGGPAVFDEPHLAALAEDYGGFAFAE
>NC_014210.1|WP_013151960.1|1115249_1115777_+|GNAT-family-N-acetyltransferase
MLIRTAVPEDGPAVADVEVRSWRAAYPGIVPQDYLDAMDAAERGARWSDWIAGAARPGAELLLAEDGAGVVAFACFAPVEEGGEGAGGTAGPCELEAFFSVPETWGSGVNRRLIADVHRAVAGAGYGEAVLWVLRDNPRARRFYAAHGWEADGAVTEEGPLNGAVLPRLRYRRGF
>NC_014210.1|WP_013151961.1|1116023_1116434_+|conjugal-transfer-protein-TraR
MKATDAARLPVLPGEDPWTAGELAEVRGRLEEEAAAAKRELGQVEAEFTELLEDPVEGAGDDSADAGARAFQREQDLALAYNTRDLLAEGERAIERMDAGTYGVCGSCGQAIGKARLQAFPRATLCVTCKQREERR
>NC_014210.1|WP_013151962.1|1116463_1117078_+|signal-peptidase-II
MTTTDKTGARPRRYLLLLLVALAAIGVDFLTKEWVLATFAEGEYLDVIGDFVQFTLVFNTGAAFSMGTDFTWVFTCIASIVVLVIGYMGLRVRSVWWGVTLGLMMGGAAGNLVDRFFRDPAPFHGAVVDFISVGTFPVFNIADSCVVVGACLVVALTFKGLNLDGTFIEDDRDTKKASAEGGENAGGAGGTGAAGDDRTGGRDQ
>NC_014210.1|WP_013151963.1|1117074_1118001_+|RluA-family-pseudouridine-synthase
MSDVRSLPVPDGLEGDRLDSAIARMFGLSRTRAAEIIGDGGVLVDGSEAAKSDRVSAGAWLEVTLPPPPTAPVPRPEAVPGMRIVHEDTDIIVVDKPVGVVAHPTVGWTGPSVLEGLLASGVQVATSGAAERQGIVHRLDANTTGLMVVAKSETAYSVLKRAFKERTVDKHYHTLVQGHPDPLRGTVDAPIDRHPAGDGRWAVVAGGRPSVTHYDTQEAFRAASLLEIKLETGRTHQIRVHMSALRHPCVGDMLYGADPTLAERLGVRRQWLHAVRLGFDHPTEHRPVEFSSPYPDDLAAAVETLRED
>NC_014210.1|WP_013151964.1|1118230_1119211_-|DMT-family-transporter
MSAASAVSPVSAPPGSPRRALSDWRAKFVLLSLIWGMSFLFIKIGAEVLSPVQLSLGRMATGALPLLAVLLLRGGRLPRSPRLWGHMFVAALLLNTVPFTLFGYAAQLIPSALMGIVNASTPLFGVVFSMLLLSDERPDRDRVLGLGIGFLGVLTVFGVWRSLDEVTVSDGDAVLGMLFVVGATVCYGIGTPYLRRFVAGSSHGALELSTLQLLLGSVPLVVLVPLFTEMPTGVTWQVVAAVSTLGVFGTGVAYILQYAVVREAGATVATTVTYVAPVVAIAAGVVLLDETLSWNQPLGAVVIILGAALCQGVIRTRYVVPSARRR
>NC_014210.1|WP_013151965.1|1119284_1120190_+|LysR-family-transcriptional-regulator
MLSVDRLRVLHTIAAHGSLSAAAEALHVTNSAVSQQLTKLEREVGQPLVERNGRGVRLTDAAELLVEHTARILSMVQRAEADLEAHRDDVTGHLRLSATPTAVRGLLPHALSSLREAHPGLRVELHEEEPHESVPAMARGDADLAMVVDWIGAPLNLPSGMSRAPLMEDVGDIALPADHPLAHREILAPEEILDLPWISWSRGSICDDWLHGLIRAHGGEPNVIHNVEEHQTKLALIAAGIGAAVMPRLGCGPLPEGVRVVPVQPALVRQVYVFWRTDASRRPGIRATVRALREAAAAYAA
>NC_014210.1|WP_013151966.1|1120549_1122232_-|thiamine-pyrophosphate-binding-protein
MATGAAERPSPPTDTAAHAVVGVLAAAGIRRCYTVPGESFLELADAIDQHPRMQLVSTRHENGAGFMAEAEAKLTGVPAVAAATRGPGASNLAVGVHTAMQDSTPMIVFLGQAETEHLGREAFQEVDLTAFYTPITKWSTTVHRADRLAEVTAKAVRVATTGRPGPVAIAVPGDLFGQRVGPQDPPGPPVVPRPVLGTEARDRLATWLARAVRPVIVAGGGARAAREDLIRVAERFNTGVYAAWRRQDVFPNDHPLYLGHLGLGCSPPVLNALAEADAVLVVGCRMSETTTQGYRLPERGGRVRVAQIDIDPGQLGAGTDLWFGAVADAGEALRELAGAPVQAPYRDWSSARRVWVDTATVPPEAAGHTGSRLHPWAVVAGMRAALPEDALITNDAGNFASFLHRGWWFRHPRTQLAPTSGAMGYAVPAAVAAKIAAPDRTVVAVAGDGGALMTGQELETAVRMDAPVTVVVFQNGLYGTIAMHQARELGRIAGTRISGPLDLAGYARSLGARGATAHTREELEKALAEAVGADLPTLVDVRTDPEVISPGATLSGLLNG
>NC_014210.1|WP_013151967.1|1122829_1123147_-|branched-chain-amino-acid-transport
MTLWTVLVATAAGCYLLKYAGLAAPRRLLDNPWLRRFATAVPLALLAALIAVEALRGEGQALAWDTARMGGLGAAVLALVLRAPFLVVIVAAAATTAGLRALGVG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_014210_6

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_014210_6

1573011-1573099

TypeI-E

Consensus_repeat	Method
GCACCAGCCGCACCTGCGACACCCGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_014210_6

>merge|NC_014210|6|1573011-1573099|CRISPRCasFinder
ACACCCGACCCGCCCGCGGCACCAGCCGCACCTGCGACACCCGCCACGCCCGCTGTGCCCACGGCACCAGCCGCACCAGCCGCACCTGC

>NC_014210|6|6|1573011-1573099|CRISPRCasFinder
ACACCCGACCCGCCCGCGGCACCAGC	CGCACCTGCGACACCCGCCACGCCCGCTGTGCCCACG
GCACCAGCCGCACCAGCCGCACCTGC

Protein	Signature genes	Signature genes Name	Protein_function
NC_014210.1\|WP_013152320.1\|1579590_1580484_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223669
NC_014210.1\|WP_013152310.1\|1567632_1569102_+\|DEAD/DEAH-box-helicase	unknown	unknown	gnl\|CDD\|223587
NC_014210.1\|WP_013152315.1\|1574287_1575433_-\|protein-L-isoaspartate-O-methyltransferase	unknown	unknown	gnl\|CDD\|275041
NC_014210.1\|WP_049800289.1\|1577885_1578518_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|366102
NC_014210.1\|WP_013152311.1\|1569427_1570186_+\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133378
NC_014210.1\|WP_013152302.1\|1560184_1561027_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|283837
NC_014210.1\|WP_013152316.1\|1575888_1577382_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	unknown
NC_014210.1\|WP_013152319.1\|1578516_1579419_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|225176
NC_014210.1\|WP_013152317.1\|1577378_1577861_+\|hypothetical-protein	unknown	unknown	unknown
NC_014210.1\|WP_013152308.1\|1565929_1566922_+\|sigma-70-family-RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|236196
NC_014210.1\|WP_013152312.1\|1570294_1572190_-\|S9-family-peptidase	unknown	unknown	gnl\|CDD\|224423
NC_014210.1\|WP_049800290.1\|1581029_1581686_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|379522
NC_014210.1\|WP_013152309.1\|1567180_1567384_+\|cold-shock-protein	unknown	unknown	gnl\|CDD\|224197
NC_014210.1\|WP_013152321.1\|1580518_1580884_-\|glyoxalase	unknown	unknown	gnl\|CDD\|319924
NC_014210.1\|WP_013152303.1\|1561299_1562256_+\|daunorubicin-resistance-protein-DrrA-family-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|130256
NC_014210.1\|WP_013152306.1\|1565145_1565535_+\|glyoxalase	unknown	unknown	gnl\|CDD\|319898
NC_014210.1\|WP_013152314.1\|1573600_1574119_-\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|379279
NC_014210.1\|WP_013152323.1\|1582243_1584016_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224055
NC_014210.1\|WP_013152307.1\|1565544_1565928_+\|glyoxalase	unknown	unknown	gnl\|CDD\|319911
NC_014210.1\|WP_026338765.1\|1562303_1563155_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|366444

Protein	Function_ID	Function_description	E-value
NC_014210.1\|WP_013152320.1\|1579590_1580484_-\|alpha/beta-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	1.42801e-15
NC_014210.1\|WP_013152310.1\|1567632_1569102_+\|DEAD/DEAH-box-helicase	gnl\|CDD\|223587	COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis].	1.07896e-121
NC_014210.1\|WP_013152315.1\|1574287_1575433_-\|protein-L-isoaspartate-O-methyltransferase	gnl\|CDD\|275041	TIGR04188, conserved_hypothetical_protein, methyltransferase, ATP-grasp peptide maturase system. Members of this protein family are predicted SAM-dependent methyltransferases that regularly occur in the context of a putative peptide modification ATP-grasp enzyme (TIGR04187, related to enzymes of microviridin maturation) and a putative ribosomal peptide modification target (TIGR04186).	2.15773e-91
NC_014210.1\|WP_049800289.1\|1577885_1578518_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|366102	pfam00440, TetR_N, Bacterial regulatory proteins, tetR family.	7.23039e-12
NC_014210.1\|WP_013152311.1\|1569427_1570186_+\|MerR-family-transcriptional-regulator	gnl\|CDD\|133378	cd00592, HTH_MerR-like, Helix-Turn-Helix DNA binding domain of MerR-like transcription regulators. Helix-turn-helix (HTH) MerR-like transcription regulator, N-terminal domain. The MerR family transcription regulators have been shown to mediate responses to stress including exposure to heavy metals, drugs, or oxygen radicals in eubacterial and some archaeal species. They regulate transcription of multidrug/metal ion transporter genes and oxidative stress regulons by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.	6.56319e-18
NC_014210.1\|WP_013152302.1\|1560184_1561027_+\|hypothetical-protein	gnl\|CDD\|283837	pfam06259, Abhydrolase_8, Alpha/beta hydrolase. Members of this family are predicted to have an alpha/beta hydrolase fold. They contain a predicted Ser-His-Asp catalytic triad, in which the serine is likely to act as a nucleophile.	1.68974e-26
NC_014210.1\|WP_049800290.1\|1581029_1581686_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|379522	pfam14246, TetR_C_7, AefR-like transcriptional repressor, C-terminal region. This family comprises the C-terminal domain of transcriptional regulators of the TetR family. It includes the AefR transcriptional regulator from P. syringae. It is found in association with pfam00440.	3.46023e-30
NC_014210.1\|WP_013152319.1\|1578516_1579419_+\|alpha/beta-hydrolase	gnl\|CDD\|225176	COG2267, PldB, Lysophospholipase [Lipid metabolism].	5.95048e-31
NC_014210.1\|WP_013152308.1\|1565929_1566922_+\|sigma-70-family-RNA-polymerase-sigma-factor	gnl\|CDD\|236196	PRK08241, PRK08241, RNA polymerase subunit sigma-70.	7.57374e-163
NC_014210.1\|WP_013152312.1\|1570294_1572190_-\|S9-family-peptidase	gnl\|CDD\|224423	COG1506, DAP2, Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism].	5.43819e-80
NC_014210.1\|WP_013152323.1\|1582243_1584016_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	1.40908e-73
NC_014210.1\|WP_013152309.1\|1567180_1567384_+\|cold-shock-protein	gnl\|CDD\|224197	COG1278, CspC, Cold shock proteins [Transcription].	7.05118e-35
NC_014210.1\|WP_013152321.1\|1580518_1580884_-\|glyoxalase	gnl\|CDD\|319924	cd07263, VOC_like, uncharacterized subfamily of vicinal oxygen chelate (VOC) family. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	1.03031e-17
NC_014210.1\|WP_013152303.1\|1561299_1562256_+\|daunorubicin-resistance-protein-DrrA-family-ABC-transporter-ATP-binding-protein	gnl\|CDD\|130256	TIGR01188, drrA, daunorubicin resistance ABC transporter ATP-binding subunit. This model describes daunorubicin resistance ABC transporter, ATP binding subunit in bacteria and archaea. This model is restricted in its scope to preferentially recognize the ATP binding subunit associated with effux of the drug, daunorubicin. This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily. The characteristic feature of these transporter is the obligatory coupling of ATP hydrolysis to substrate translocation. The minimal configuration of bacterial ABC transport system: an ATPase or ATP binding subunit; An integral membrane protein; a hydrophilic polypetpide, which likely functions as substrate binding protein. In eukaryotes proteins of similar function include p-gyco proteins, multidrug resistance protein etc. [Transport and binding proteins, Other].	2.32455e-111
NC_014210.1\|WP_013152306.1\|1565145_1565535_+\|glyoxalase	gnl\|CDD\|319898	cd06587, VOC, vicinal oxygen chelate (VOC) family. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC is found in a variety of structurally related metalloproteins, including the type I extradiol dioxygenases, glyoxalase I and a group of antibiotic resistance proteins. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). Type I extradiol dioxygenases catalyze the incorporation of both atoms of molecular oxygen into aromatic substrates, which results in the cleavage of aromatic rings. They are key enzymes in the degradation of aromatic compounds. Type I extradiol dioxygenases include class I and class II enzymes. Class I and II enzymes show sequence similarity; the two-domain class II enzymes evolved from a class I enzyme through gene duplication. Glyoxylase I catalyzes the glutathione-dependent inactivation of toxic methylglyoxal, requiring zinc or nickel ions for activity. The antibiotic resistance proteins in this family use a variety of mechanisms to block the function of antibiotics. Bleomycin resistance protein (BLMA) sequesters bleomycin's activity by directly binding to it. Whereas, three types of fosfomycin resistance proteins employ different mechanisms to render fosfomycin inactive by modifying the fosfomycin molecule. Although the proteins in this superfamily are functionally distinct, their structures are similar. The difference among the three dimensional structures of the three types of proteins in this superfamily is interesting from an evolutionary perspective. Both glyoxalase I and BLMA show domain swapping between subunits. However, there is no domain swapping for type 1 extradiol dioxygenases.	6.11025e-05
NC_014210.1\|WP_013152314.1\|1573600_1574119_-\|ATP-binding-protein	gnl\|CDD\|379279	pfam13581, HATPase_c_2, Histidine kinase-like ATPase domain.	1.16222e-07
NC_014210.1\|WP_013152307.1\|1565544_1565928_+\|glyoxalase	gnl\|CDD\|319911	cd07247, SgaA_N_like, N-terminal domain of Streptomyces griseus SgaA and similar domains. SgaA suppresses the growth disturbances caused by high osmolarity and a high concentration of A-factor, a microbial hormone, during the early growth phase in Streptomyces griseus. A-factor (2-isocapryloyl-3R-hydroxymethyl-gamma-butyrolactone) controls morphological differentiation and secondary metabolism in Streptomyces griseus. It is a chemical signaling molecule that at a very low concentration acts as a switch for yellow pigment production, aerial mycelium formation, streptomycin production, and streptomycin resistance. The structure and amino acid sequence of SgaA are closely related to a group of antibiotics resistance proteins, including bleomycin resistance protein, mitomycin resistance protein, and fosfomycin resistance proteins. SgaA might also function as a streptomycin resistance protein.	1.51806e-10
NC_014210.1\|WP_026338765.1\|1562303_1563155_+\|ABC-transporter-permease	gnl\|CDD\|366444	pfam01061, ABC2_membrane, ABC-2 type transporter.	2.23165e-13

>NC_014210.1|WP_013152312.1|1570294_1572190_-|S9-family-peptidase
MALPDLIPVEDFFSPPERAGATISPDGTRIAYLAPWRDRLNVWVQGLDPSGDLDGEPRCVTADQARSVQSYQWTDDPRWLLYLQDSGGDENWHLFRVDLDAAEPTAVDLTPFPGARVVSFEPSRGRPGKLAVSLNARDAAAFDLHELDVATGELTVLAESPGAAKVWAQGREGELIATALNADNDFEISRHDSETDTTSTVLVYEGADYPLGVFPAQVTPDGTGMWIGSSRGTDRTRLVRVDLSTGEETEVDSHATFDIDTRAQVFPTFPSPLIRDRRGELLGVRYLGERQVVHALDPDFAEVLANLEKLSEGDLAAVSCDDSGQRWVVGFTHDRAPGATWFYDHSTGESRLLFRPHPHLDPDAMAPMRPVTITARDGLELPSYLTLPVGVEPRNLPMVLLVHGGPWARDAWGFDPTVQLLANRGYAVLQVNFRGSTGFGKAHMKAAIGEFAGKMHDDLIDAVDWAVERGYADPDRVAIFGGSYGGYAALVGVTFTPDRFAAAVDYVGISDLANFMRNQPVFVRPALANNWYRYVGDPDIPEQEADMLARSPISRVDRITAPLFVAQGANDARVVKAESDNIVAALRERGVDVEYLLKEDEGHGFVNPENQLDLHRAAERFLARHLDERRD
>NC_014210.1|WP_013152311.1|1569427_1570186_+|MerR-family-transcriptional-regulator
MAWSTRQLAELAGTTLRTVRHYHDVGLLAEPERGANGYKRYKVEHLVRVMRVKRLSDLGFSLVQIAQMGEADAYPEQELRALDGELAQAIERLEGMRAELALALRAPGPTELPPDVAQAAAETAMTEADRSLTAVITRLFTPQTQRAFAELVRAHGSCPADEEFNDLPADADERTRRELTERLSRTSRALLSDRPELRITQAPTAIDRHKAAQAFATALNELYNPAQLDVLNRLSRAAVADLETDQQADQRP
>NC_014210.1|WP_013152310.1|1567632_1569102_+|DEAD/DEAH-box-helicase
MNQPRTNTRRGRPSGGYGRQRPHQSGGRPQRGGFGGRSAGRSSGEFALPVSTTPALDPVHAFEDLEMPAQLKSTLARQGLTTPSAIQAATLPNSLAGRDVLGRSQTGSGKTLAFGLALLARLEGRVAEPRRPLAVVLAPTRELAQQVNDSLAPYARSLRVRTTTVVGGMPISRQSRALRQGVELVVATPGRLRDLMERDDCVLDQVDVTVLDEADQMTDMGFMPQVTAILTEVPTGGQRMLFSATLDRNVDTLVRRFLNDPVVHSVDPSEGAVSTMEHHVLHVSHADKQDAATRIAARDGQVILFLDTKHAVDRMAKHLLNSGVRAAPLHGGRSQPQRTRTLKQFKEGTVTALVATNVAARGIHVDGLDLVVNIDPPTDHKDYLHRGGRTARAGQTGSVVTLVLPSERRDMDRLMRLARIDAHVAQVSASDPELARVTGAREPSGVPVSLPSGPREEPRRQGGRGSASRGGSASRGGSASRRRGPRRPA
>NC_014210.1|WP_013152309.1|1567180_1567384_+|cold-shock-protein
MATGKVKWFNGEKGFGFIEQDGGGPDVFAHYSAIQANGYRELAEGQNVEFDVTQGAKGLQADNITLI
>NC_014210.1|WP_013152308.1|1565929_1566922_+|sigma-70-family-RNA-polymerase-sigma-factor
MTVVVEHASDQDFMSAADPYRRELFAHCYRMLGSVHDAEDLVQETYLRAWKAYDRFEGRSSLRTWLHRIATTACLTALDRRRRRPLPTGLGGPAAEPEGELADRPELPWLEPVPDALVGADDPGTVVAARESVRLALVAALQHLRPRQRAVLILRDVLRYSAAEVADTLGVSVPAVNSLLQRARAQLARVTPAEEEVAEPRPEQREVLDRYVDAFESYDISAITEVFTADAVFEMPPFATWVRGAGHIGRLIAAHCPASGPGDMALVPTGANGQPAFALYMRGGDGVHRAFGIQVLELAPGGDAVAHAVMFFDTSLFRHFGLPAVLSPRR
>NC_014210.1|WP_013152307.1|1565544_1565928_+|glyoxalase
MFDTTRAFGSFAVRDPDRAREFYGTTLGLTVGPVEGMEEHGLLSIDLGEGRAVLVYPKPDHEPAGFTVLNLPVDDIDAVVDELARRGVGTLRYEGFDQDGKGISRGVPTVAWFADPFGNVCSVIQEA
>NC_014210.1|WP_013152306.1|1565145_1565535_+|glyoxalase
MERPNLDGMLLATTDPDRLHDWYADVLSPQDDIDMDGYRVLRLGTFHLLIDRRDDVAPRAGDPTRMILNVDVDDARAVAARVDARGTGWLAPLEDRDGSLFGTAVDPDGNHVQIIQLSDEHRAAMARES
>NC_014210.1|WP_026338765.1|1562303_1563155_+|ABC-transporter-permease
MASVTEVERPVPEEPGPLARTRWAVADTWVVARRYLLHLVYKPDELVGTLMVPVLAVLLFGFVFGEAMGAVMDAPGEEYREFLMPGLFALTMAFGIGNTTIAVVTDAGRGVVDRFRTLPMAPASLLAGRSLADVLSAVVDLAVLAGMGLLVGWRWHEGPLSALAALGLLLLLRLAFTWIGIYLGLVVRSPEAAMKFFSLVFPLAMVADTFVPTDTMPDWLVPVAEWNPLSATVIAARDLFGNPVAANDSWIAQNALLMAVVWPLVLMMVFVPLALRRFRRLSR
>NC_014210.1|WP_013152303.1|1561299_1562256_+|daunorubicin-resistance-protein-DrrA-family-ABC-transporter-ATP-binding-protein
MILARDVRKSYPGARGRAALDGFDLEVPPGAVHALLGPNGAGKTTAVRVMATLLRFDSGQVRVAGFDVARQSARVRSRIGFAGQYAALDEVLDGRRNLEMFARLHHLRARAARARAAELLERFGLTDAARRPVREYSGGMRRRLDLAASLIPDPAVLFLDEPTTGLDPRSRAEVWRAVRDLAEGGTTVLLTTQYLEEADRLADRISVVDAGRIIAEGTPEELKSRVGGGRVEAVVADADALSPVGEVLGRVAGALPEVDADALRVSVPFDGRGAGLAKVVRALDEAGLDVEDIALRRPTLDDVFLGLTGRQGTRGEGS
>NC_014210.1|WP_013152302.1|1560184_1561027_+|hypothetical-protein
MIAAGPRHASPSTPLRYEEREWHGLRLLAHDETGDGRIVEALGDVAAADHIVVLVPGNDNYLGNYFDANRPTRPRVNGGTVLRTMQALAPGERSAVVVWVGYDTPRGFAEAAFRGPAERGAEDLARLTSFLPRTARITLVGHSYGTVVCGLALRHGRVDDCVALGSPGMGGNSVADLGFTGNLWAALGPADWIRFFPRGRWRDLGHGPSPLRPGFGATAFATGPIPGHCSYYTEGSESVRNIARIGLGRHAEVTRPDVPAQRTRPGPRPAPGAPVTEAAS
>NC_014210.1|WP_013152314.1|1573600_1574119_-|ATP-binding-protein
MTVLPRPRRPIDLDRRWKRRSYPASLAAIRRARADLRADLSRISGADEELVAAVVLCASEMLANTMDRAQPCGSGAEVVRTLVLRHDPGGRRVLRLSVADRWVPGALACVPDPAKTGQDWRELALGQGLLLIGHFSARWGTRRVGAPGEGRGRVIWAEFDLAPRWSPRRVAA
>NC_014210.1|WP_013152315.1|1574287_1575433_-|protein-L-isoaspartate-O-methyltransferase
MIPPHERMVERLVEEGALAAEWRGAFAAVPRHLFLPDEIADPDTGVPVDRYRGELRWLEAAYADVPVVTQVDDGARYGPGEPTSSSPAPSSVAETVQRLRLAPGMRVLEVGTGSGYTAALLARFLGDDAVTSVEIDFELAEQARVRLMSAGLTPLVVSGDGMRGWAGRAPYDRVVSAVTVQRVPYAWVAQCQPGGRVLTPWGTAFHHGVTADLVVGPHGTAHGRFTGHTDRMWARADRTPRHLLETYVRPDDDEHTTTCSRLHPGEVVGDSDGAFAVGLQMPDVHRIVRLGGGPEDPRFTVYLLDSSTWSWASWHIDPGHRDRGYEVRQHGPRRLFNELEAAHLLWVEAGRPAHTRFGLTVSAEHQLVWLDDEATIFAATR
>NC_014210.1|WP_013152316.1|1575888_1577382_+|helix-turn-helix-domain-containing-protein
MTKSQVGPRLSPSRAFWARADVLRSLAEHDAGALFGLVRQHTGASQQTIGSAVDMAQPHVSAIMAGRRLVTALSTWQRIADGLAMPSEARRTLGLADSGDEYSKGVSWTESSLQEGDLWSASRTAQDIVDITLKDLMKRRDAFAVGGALLMGAALTETLEHWLLPGPAAPGLVRGTIGEAELGRIEAATVALRHWNDRWRLGVRRKAVVGQLSEVSELVETPQPASVQNRLFAVMAELSKTVASMSFDAGDHPTAQRYYTLSLRALHQAGPEHRPYGVGVLADMARQMLDLHRPEDALDISRLALDSADSTGAPALVRAMLRTREGWSYARMGRSEAYRRTVIQAEDLLEGANGEEVPDWVGGFDHAELAGVVGARYRDLAVLQEDPGARRRHAESSAAYITKALQLRAPSGKRGRAFDLIGLGRTYLLLDEPAEAARVVRQAAALEPSLGSGRVRRRLRDWYTESATHHRDPHVAAVRDELSHTLLHHQRNVKGMT
>NC_014210.1|WP_013152317.1|1577378_1577861_+|hypothetical-protein
MTRIGITGHSNLSGDSVTLVRKALVAALDPHADDRLVGVSCLARGADQLFAEAVLDVGGRLEVVLPSADYREAKVKPANLDRFDDLLVRSSLVRYMPHRRAGRAAYEDANEAVLDWVELMFAVWDGQPADGRGGTADAVEAARVRGVPVEVIWPEGVRRD
>NC_014210.1|WP_049800289.1|1577885_1578518_-|TetR/AcrR-family-transcriptional-regulator
MARSSAPRTAATTRVGGSPDTPRRRPRQQRSRETVEVILEAAAQVFEREGLEATTNRVAERAGYSIGTLYQYFPNKRALLHSLAERHVEETRRTLEELAEVLRRDEPSWEDTVRRLAAAVADAHGDRPRLHSLMHAHAPRVPAGVTAVEALRSYLAAELVWHLRRCGRGGTDPERTAALLVHTADAQMHGVLMGEEDAAAELVRSLLALS
>NC_014210.1|WP_013152319.1|1578516_1579419_+|alpha/beta-hydrolase
MDNPYTAWMPVGLRPDPPPRCESTWRRFPDADVHVERVGEPDAARRAVLLHGAGGHAGLLRPYAAALAHRGFHVVVPDLPGYGRTRVRRRGAVRYADWVRVAVGISSAERQAHQGPLTLVGASMGGLLAYDAATRTGAADAVVATCLLDPRDPRARRRISRYAWLGDAAPPLLRVAAGPLAATRVPVRWLANMWAISNQPELTEAVVGDPLGGGNSVPLGFLRSFLESAPAVEPERAADTTVVLAHPAEDRWTPVEVSLPFFERLAGPKRLVMLDGAGHLPVEEPGVGQLLDAVVEASSG
>NC_014210.1|WP_013152320.1|1579590_1580484_-|alpha/beta-hydrolase
MSHHSHHSPGAHTLKVPGARIHYEVRGSGPVLLMIPGGPQDAGVYTALAEHLSDRYTTVAYDPRGNSRSTLDGEPEDQRVEVHSDDAARLIAEMGAGPAYVFGNSAGAQIGLDMAVRHPGSVRALLAHEPPCLMLLDDPSEVLARDQDVYDTYQREGVEAAIGKFMAMNGLGEEAGGTQEEGGREPEGAATEGPMHEDPETFERVSGNFAYFLAHGLMPLSLYQPDVEALREGRVPVTVGLGDASAGQPIHDIGLALVRRLGTEPVAFPGDHVGFGTHPRAFAEALHGALDGAPKQR
>NC_014210.1|WP_013152321.1|1580518_1580884_-|glyoxalase
MYVKFAELPVFDQERAKAFYTDRLGCTVVTDAPMSDDGWRWIELGFPGSRTHLHFQRRADEDPSAEPVMVLVTEDVEGTVEALRAEGVEIVTEPQEAMWQPGVTAAEFRDSEGNRMVLSDS
>NC_014210.1|WP_049800290.1|1581029_1581686_+|TetR/AcrR-family-transcriptional-regulator
MLNSVNPPAEEGLSRSARKRRAILGAAEEVFLRGGYLGTNMDEIAALSEVSKQTVYKHFGSKEGLFVEIVTSMTSGAGDVVRDETPEPDRVEDVEAYLRDYARRQLTVVLTPRLMRLRRMVIGEVARFPELARVLYECGPQRAIAGLAESFARLGERGLLAVGDPLRAASHFNWLVMSEPVNRAMLLGDEAIPAEAELCQHAEEGVRVFLAAYGVDGR
>NC_014210.1|WP_013152323.1|1582243_1584016_-|ABC-transporter-ATP-binding-protein
MISALRFVLTTGYRTDRFRSLIVVAVALLEQATGIGLAVAIGLFSEVASGGSASGLVVLALCVAVFVMLTQGTFIAGYFTRLRLQEEIQNEVERRFIDVVGTTPTLEVHERSSRSDRAAVVRGARGEIGPGFDRLMWLAGAALALITSAALMASVVPVLALLPLFAVPAVLATRAADRKRGRAVERATPRTRLAGHLFTLATTAAPGRETRLFGLAGELRRRHREEWDAGGRDITRTDRLARVPVALAWLLFVLAYATAVALMVRAGLSGDAPLGLIVAAVAVSSQITGQVQSLLNLSFWSLESLRATRAFLDVVEEGTAERAALMPTTPVAVPARLESGIRVEGLGFRYWNRDQPALSGIDLELPAGTVVALVGENGAGKSTLVKMLSGLYQPGEGRVLVDGTDLARFAPEEWRARITAAFQDPVRIEMSLRDAVGLGRIEHRDDPERVIEALRTVGGDGLLASLPGGLDTRLGRGSWDGEGLSGGQWQTVANARAAMRRAPLLRIMDEPTASLDARAEERLFQQYADLGRQEGGVTVLVTHRFTTARAADLIVVLDGGRVVETGTHDTLSRAGGLYAELFRLQARYFV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_014210_7

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_014210_7

1581787-1582179

TypeI-E

I-E

Consensus_repeat	Method
GTGCTCCCCGCGCACGCGGGGATGG	PILER-CR
GTGCTCCCCGCGCACGCGGGGATGGTCCC	CRISPRCasFinder
GTGCTCCCCGCGCACGCGGGGATGGTCCC	CRT

6 spacers

cas8e,cas7,cas5,cas6e,cas1,cas2

The CRISPR arrays of NC_014210_7

>merge|NC_014210|7|1581787-1582179|PILER-CR,CRISPRCasFinder,CRT
GTGCTCCCCGCGCACGCGGGGATGGTCCCTCCGCGAACGAGATGCTCATGGGCGGCGGGATGTGCTCCCCGCGCACGCGGGGATGGTCCCCTCCAAGCTCTGACCCAGCTCACGCCTGAAGTGCTCCCCGCGCACGCGGGGATGGTCCCGACGACGGGGTCGCTGCTGCTGGCCAGGGTGGGTGCTCCCCGCGCACGCGGGGATGGTCCGATCCTCCTGCCGCCGCCCTGGGACGCGATGAGGTGCTCCCCGCGCACGCGGGGATGGTCCCTCTTCTCGGGTCATTGCACTTTCTCCTGTTCTGTGCTCCCCGCGCACGCGGGGATGGTCCCAGGACGGAGCGCGGGTGCGCCTGGTGTGCGGGGTGCTCCCCGCGCACGCGGGGATGGCCCC

>NC_014210|7|1|1581787-1582175|PILER-CR
GTGCTCCCCGCGCACGCGGGGATGG	TCCCTCCGCGAACGAGATGCTCATGGGCGGCGGGAT
GTGCTCCCCGCGCACGCGGGGATGG	TCCCCTCCAAGCTCTGACCCAGCTCACGCCTGAA
GTGCTCCCCGCGCACGCGGGGATGG	TCCCGACGACGGGGTCGCTGCTGCTGGCCAGGGTGG
GTGCTCCCCGCGCACGCGGGGATGG	TCCGATCCTCCTGCCGCCGCCCTGGGACGCGATGAG
GTGCTCCCCGCGCACGCGGGGATGG	TCCCTCTTCTCGGGTCATTGCACTTTCTCCTGTTCT
GTGCTCCCCGCGCACGCGGGGATGG	TCCCAGGACGGAGCGCGGGTGCGCCTGGTGTGCGGG
GTGCTCCCCGCGCACGCGGGGATGG

>NC_014210|7|7|1581787-1582179|CRISPRCasFinder
GTGCTCCCCGCGCACGCGGGGATGGTCCC	TCCGCGAACGAGATGCTCATGGGCGGCGGGAT
GTGCTCCCCGCGCACGCGGGGATGGTCCC	CTCCAAGCTCTGACCCAGCTCACGCCTGAA
GTGCTCCCCGCGCACGCGGGGATGGTCCC	GACGACGGGGTCGCTGCTGCTGGCCAGGGTGG
GTGCTCCCCGCGCACGCGGGGATGGTCCG	ATCCTCCTGCCGCCGCCCTGGGACGCGATGAG
GTGCTCCCCGCGCACGCGGGGATGGTCCC	TCTTCTCGGGTCATTGCACTTTCTCCTGTTCT
GTGCTCCCCGCGCACGCGGGGATGGTCCC	AGGACGGAGCGCGGGTGCGCCTGGTGTGCGGG
GTGCTCCCCGCGCACGCGGGGATGGCCCC

>NC_014210|7|1|1581787-1582179|CRT
GTGCTCCCCGCGCACGCGGGGATGGTCCC	TCCGCGAACGAGATGCTCATGGGCGGCGGGAT
GTGCTCCCCGCGCACGCGGGGATGGTCCC	CTCCAAGCTCTGACCCAGCTCACGCCTGAA
GTGCTCCCCGCGCACGCGGGGATGGTCCC	GACGACGGGGTCGCTGCTGCTGGCCAGGGTGG
GTGCTCCCCGCGCACGCGGGGATGGTCCG	ATCCTCCTGCCGCCGCCCTGGGACGCGATGAG
GTGCTCCCCGCGCACGCGGGGATGGTCCC	TCTTCTCGGGTCATTGCACTTTCTCCTGTTCT
GTGCTCCCCGCGCACGCGGGGATGGTCCC	AGGACGGAGCGCGGGTGCGCCTGGTGTGCGGG
GTGCTCCCCGCGCACGCGGGGATGGCCCC

Protein	Signature genes	Signature genes Name	Protein_function
NC_014210.1\|WP_013152320.1\|1579590_1580484_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223669
NC_014210.1\|WP_049800289.1\|1577885_1578518_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|366102
NC_014210.1\|WP_013152328.1\|1590959_1592147_+\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	cas7	pfam09344_cas7_CAS-I-E	gnl\|CDD\|378153
NC_014210.1\|WP_013152316.1\|1575888_1577382_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	unknown
NC_014210.1\|WP_086000764.1\|1584012_1585803_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224055
NC_014210.1\|WP_013152323.1\|1582243_1584016_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224055
NC_014210.1\|WP_013152314.1\|1573600_1574119_-\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|379279
NC_014210.1\|WP_041553074.1\|1588503_1590147_+\|type-I-E-CRISPR-associated-protein-Cse1/CasA	cas8e	cd09729_cas8e_CAS-I-E	gnl\|CDD\|378189
NC_014210.1\|WP_013152313.1\|1572481_1573294_-\|SUMF1/EgtB/PvdO-family-nonheme-iron-enzyme	unknown	unknown	gnl\|CDD\|335469
NC_014210.1\|WP_013152329.1\|1592143_1592872_+\|type-I-E-CRISPR-associated-protein-Cas5/CasD	cas5	cd09756_cas5_CAS-I-E	gnl\|CDD\|187886
NC_014210.1\|WP_013152319.1\|1578516_1579419_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|225176
NC_014210.1\|WP_013152317.1\|1577378_1577861_+\|hypothetical-protein	unknown	unknown	unknown
NC_014210.1\|WP_049800290.1\|1581029_1581686_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|379522
NC_014210.1\|WP_013152331.1\|1593594_1594578_+\|type-I-E-CRISPR-associated-endonuclease-Cas1	cas1	cd09719_cas1_CAS-I-E	gnl\|CDD\|274693
NC_014210.1\|WP_041552460.1\|1586551_1587160_+\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|379312
NC_014210.1\|WP_126625053.1\|1586243_1586438_+\|hypothetical-protein	unknown	unknown	unknown
NC_014210.1\|WP_013152332.1\|1594574_1594925_+\|type-I-E-CRISPR-associated-endoribonuclease-Cas2	cas2	pfam09707_cas2_CAS-I-E	gnl\|CDD\|378244
NC_014210.1\|WP_013152315.1\|1574287_1575433_-\|protein-L-isoaspartate-O-methyltransferase	unknown	unknown	gnl\|CDD\|275041
NC_014210.1\|WP_013152330.1\|1592871_1593591_+\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	cas6e	pfam08798_cas6e_CAS-I-E:CAS-IV	gnl\|CDD\|378050
NC_014210.1\|WP_013152321.1\|1580518_1580884_-\|glyoxalase	unknown	unknown	gnl\|CDD\|319924

Protein	Function_ID	Function_description	E-value
NC_014210.1\|WP_013152320.1\|1579590_1580484_-\|alpha/beta-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	1.42801e-15
NC_014210.1\|WP_049800289.1\|1577885_1578518_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|366102	pfam00440, TetR_N, Bacterial regulatory proteins, tetR family.	7.23039e-12
NC_014210.1\|WP_013152328.1\|1590959_1592147_+\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	gnl\|CDD\|378153	pfam09344, Cas_CT1975, CT1975-like protein. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family is represented by CT1975 of Chlorobium tepidum.	5.35801e-161
NC_014210.1\|WP_049800290.1\|1581029_1581686_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|379522	pfam14246, TetR_C_7, AefR-like transcriptional repressor, C-terminal region. This family comprises the C-terminal domain of transcriptional regulators of the TetR family. It includes the AefR transcriptional regulator from P. syringae. It is found in association with pfam00440.	3.46023e-30
NC_014210.1\|WP_086000764.1\|1584012_1585803_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	1.7775e-77
NC_014210.1\|WP_013152323.1\|1582243_1584016_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	1.40908e-73
NC_014210.1\|WP_013152314.1\|1573600_1574119_-\|ATP-binding-protein	gnl\|CDD\|379279	pfam13581, HATPase_c_2, Histidine kinase-like ATPase domain.	1.16222e-07
NC_014210.1\|WP_041553074.1\|1588503_1590147_+\|type-I-E-CRISPR-associated-protein-Cse1/CasA	gnl\|CDD\|378189	pfam09481, CRISPR_Cse1, CRISPR-associated protein Cse1 (CRISPR_cse1). Clusters of short DNA repeats with non-homologous spacers, which are found at regular intervals in the genomes of phylogenetically distinct prokaryotic species, comprise a family with recognisable features. This family is known as CRISPR (short for Clustered, Regularly Interspaced Short Palindromic Repeats). A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This entry, represented by CT1972 from Chlorobaculum tepidum, is found in the CRISPR/Cas subtype Ecoli regions of many bacteria (most of which are mesophiles), and not in Archaea. It is designated Cse1.	2.5974e-138
NC_014210.1\|WP_013152313.1\|1572481_1573294_-\|SUMF1/EgtB/PvdO-family-nonheme-iron-enzyme	gnl\|CDD\|335469	pfam03781, FGE-sulfatase, Sulfatase-modifying factor enzyme 1. This domain is found in eukaryotic proteins required for post-translational sulfatase modification (SUMF1). These proteins are associated with the rare disorder multiple sulfatase deficiency (MSD). The protein product of the SUMF1 gene is FGE, formylglycine (FGly),-generating enzyme, which is a sulfatase. Sulfatases are enzymes essential for degradation and remodelling of sulfate esters, and formylglycine (FGly), the key catalytic in the active site, is unique to sulfatases. FGE is localized to the endoplasmic reticulum (ER) and interacts with and modifies the unfolded form of newly synthesized sulfatases. FGE is a single-domain monomer with a surprising paucity of secondary structure that adopts a unique fold which is stabilized by two Ca2+ ions. The effect of all mutations found in MSD patients is explained by the FGE structure, providing a molecular basis for MSD. A redox-active disulfide bond is present in the active site of FGE. An oxidized cysteine residue, possibly cysteine sulfenic acid, has been detected that may allow formulation of a structure-based mechanism for FGly formation from cysteine residues in all sulfatases. In Mycobacteria and Treponema denticola this enzyme functions as an iron(II)-dependent oxidoreductase.	7.8421e-28
NC_014210.1\|WP_013152329.1\|1592143_1592872_+\|type-I-E-CRISPR-associated-protein-Cas5/CasD	gnl\|CDD\|187886	cd09756, Cas5_I-E, CRISPR/Cas system-associated RAMP superfamily protein Cas5. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas5 is a RAMP superfamily protein; Subunit of the Cascade complex.	1.75642e-43
NC_014210.1\|WP_013152319.1\|1578516_1579419_+\|alpha/beta-hydrolase	gnl\|CDD\|225176	COG2267, PldB, Lysophospholipase [Lipid metabolism].	5.95048e-31
NC_014210.1\|WP_013152331.1\|1593594_1594578_+\|type-I-E-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|274693	TIGR03638, cas1_ECOLI, CRISPR-associated endonuclease Cas1, subtype I-E/ECOLI. The CRISPR-associated protein Cas1 is virtually universal to CRISPR systems. CRISPR, an acronym for Clustered Regularly Interspaced Short Palindromic Repeats, is prokaryotic immunity system for foreign DNA, mostly from phage. CRISPR systems belong to different subtypes, distinguished by both nature of the repeats, the makeup of the cohort of associated Cas proteins, and by molecular phylogeny within the more universal Cas proteins such as this one. This model is of type EXCEPTION and provides more specific information than the EQUIVALOG model TIGR00287. It describes the Cas1 protein particular to the ECOLI subtype of CRISPR/Cas system.	6.12838e-114
NC_014210.1\|WP_041552460.1\|1586551_1587160_+\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	4.80606e-17
NC_014210.1\|WP_013152332.1\|1594574_1594925_+\|type-I-E-CRISPR-associated-endoribonuclease-Cas2	gnl\|CDD\|378244	pfam09707, Cas_Cas2CT1978, CRISPR-associated protein (Cas_Cas2CT1978). This entry represents a minor branch of the Cas2 family of CRISPR-associated protein which are found in IPR003799. Cas proteins are found adjacent to a characteristic short, palindromic repeat cluster termed CRISPR, a probable mobile DNA element.	4.87705e-44
NC_014210.1\|WP_013152315.1\|1574287_1575433_-\|protein-L-isoaspartate-O-methyltransferase	gnl\|CDD\|275041	TIGR04188, conserved_hypothetical_protein, methyltransferase, ATP-grasp peptide maturase system. Members of this protein family are predicted SAM-dependent methyltransferases that regularly occur in the context of a putative peptide modification ATP-grasp enzyme (TIGR04187, related to enzymes of microviridin maturation) and a putative ribosomal peptide modification target (TIGR04186).	2.15773e-91
NC_014210.1\|WP_013152330.1\|1592871_1593591_+\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	gnl\|CDD\|378050	pfam08798, CRISPR_assoc, CRISPR associated protein. This domain forms an anti-parallel beta strand structure with flanking alpha helical regions.	4.44127e-77
NC_014210.1\|WP_013152321.1\|1580518_1580884_-\|glyoxalase	gnl\|CDD\|319924	cd07263, VOC_like, uncharacterized subfamily of vicinal oxygen chelate (VOC) family. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	1.03031e-17

>NC_014210.1|WP_049800290.1|1581029_1581686_+|TetR/AcrR-family-transcriptional-regulator
MLNSVNPPAEEGLSRSARKRRAILGAAEEVFLRGGYLGTNMDEIAALSEVSKQTVYKHFGSKEGLFVEIVTSMTSGAGDVVRDETPEPDRVEDVEAYLRDYARRQLTVVLTPRLMRLRRMVIGEVARFPELARVLYECGPQRAIAGLAESFARLGERGLLAVGDPLRAASHFNWLVMSEPVNRAMLLGDEAIPAEAELCQHAEEGVRVFLAAYGVDGR
>NC_014210.1|WP_013152321.1|1580518_1580884_-|glyoxalase
MYVKFAELPVFDQERAKAFYTDRLGCTVVTDAPMSDDGWRWIELGFPGSRTHLHFQRRADEDPSAEPVMVLVTEDVEGTVEALRAEGVEIVTEPQEAMWQPGVTAAEFRDSEGNRMVLSDS
>NC_014210.1|WP_013152320.1|1579590_1580484_-|alpha/beta-hydrolase
MSHHSHHSPGAHTLKVPGARIHYEVRGSGPVLLMIPGGPQDAGVYTALAEHLSDRYTTVAYDPRGNSRSTLDGEPEDQRVEVHSDDAARLIAEMGAGPAYVFGNSAGAQIGLDMAVRHPGSVRALLAHEPPCLMLLDDPSEVLARDQDVYDTYQREGVEAAIGKFMAMNGLGEEAGGTQEEGGREPEGAATEGPMHEDPETFERVSGNFAYFLAHGLMPLSLYQPDVEALREGRVPVTVGLGDASAGQPIHDIGLALVRRLGTEPVAFPGDHVGFGTHPRAFAEALHGALDGAPKQR
>NC_014210.1|WP_013152319.1|1578516_1579419_+|alpha/beta-hydrolase
MDNPYTAWMPVGLRPDPPPRCESTWRRFPDADVHVERVGEPDAARRAVLLHGAGGHAGLLRPYAAALAHRGFHVVVPDLPGYGRTRVRRRGAVRYADWVRVAVGISSAERQAHQGPLTLVGASMGGLLAYDAATRTGAADAVVATCLLDPRDPRARRRISRYAWLGDAAPPLLRVAAGPLAATRVPVRWLANMWAISNQPELTEAVVGDPLGGGNSVPLGFLRSFLESAPAVEPERAADTTVVLAHPAEDRWTPVEVSLPFFERLAGPKRLVMLDGAGHLPVEEPGVGQLLDAVVEASSG
>NC_014210.1|WP_049800289.1|1577885_1578518_-|TetR/AcrR-family-transcriptional-regulator
MARSSAPRTAATTRVGGSPDTPRRRPRQQRSRETVEVILEAAAQVFEREGLEATTNRVAERAGYSIGTLYQYFPNKRALLHSLAERHVEETRRTLEELAEVLRRDEPSWEDTVRRLAAAVADAHGDRPRLHSLMHAHAPRVPAGVTAVEALRSYLAAELVWHLRRCGRGGTDPERTAALLVHTADAQMHGVLMGEEDAAAELVRSLLALS
>NC_014210.1|WP_013152317.1|1577378_1577861_+|hypothetical-protein
MTRIGITGHSNLSGDSVTLVRKALVAALDPHADDRLVGVSCLARGADQLFAEAVLDVGGRLEVVLPSADYREAKVKPANLDRFDDLLVRSSLVRYMPHRRAGRAAYEDANEAVLDWVELMFAVWDGQPADGRGGTADAVEAARVRGVPVEVIWPEGVRRD
>NC_014210.1|WP_013152316.1|1575888_1577382_+|helix-turn-helix-domain-containing-protein
MTKSQVGPRLSPSRAFWARADVLRSLAEHDAGALFGLVRQHTGASQQTIGSAVDMAQPHVSAIMAGRRLVTALSTWQRIADGLAMPSEARRTLGLADSGDEYSKGVSWTESSLQEGDLWSASRTAQDIVDITLKDLMKRRDAFAVGGALLMGAALTETLEHWLLPGPAAPGLVRGTIGEAELGRIEAATVALRHWNDRWRLGVRRKAVVGQLSEVSELVETPQPASVQNRLFAVMAELSKTVASMSFDAGDHPTAQRYYTLSLRALHQAGPEHRPYGVGVLADMARQMLDLHRPEDALDISRLALDSADSTGAPALVRAMLRTREGWSYARMGRSEAYRRTVIQAEDLLEGANGEEVPDWVGGFDHAELAGVVGARYRDLAVLQEDPGARRRHAESSAAYITKALQLRAPSGKRGRAFDLIGLGRTYLLLDEPAEAARVVRQAAALEPSLGSGRVRRRLRDWYTESATHHRDPHVAAVRDELSHTLLHHQRNVKGMT
>NC_014210.1|WP_013152315.1|1574287_1575433_-|protein-L-isoaspartate-O-methyltransferase
MIPPHERMVERLVEEGALAAEWRGAFAAVPRHLFLPDEIADPDTGVPVDRYRGELRWLEAAYADVPVVTQVDDGARYGPGEPTSSSPAPSSVAETVQRLRLAPGMRVLEVGTGSGYTAALLARFLGDDAVTSVEIDFELAEQARVRLMSAGLTPLVVSGDGMRGWAGRAPYDRVVSAVTVQRVPYAWVAQCQPGGRVLTPWGTAFHHGVTADLVVGPHGTAHGRFTGHTDRMWARADRTPRHLLETYVRPDDDEHTTTCSRLHPGEVVGDSDGAFAVGLQMPDVHRIVRLGGGPEDPRFTVYLLDSSTWSWASWHIDPGHRDRGYEVRQHGPRRLFNELEAAHLLWVEAGRPAHTRFGLTVSAEHQLVWLDDEATIFAATR
>NC_014210.1|WP_013152314.1|1573600_1574119_-|ATP-binding-protein
MTVLPRPRRPIDLDRRWKRRSYPASLAAIRRARADLRADLSRISGADEELVAAVVLCASEMLANTMDRAQPCGSGAEVVRTLVLRHDPGGRRVLRLSVADRWVPGALACVPDPAKTGQDWRELALGQGLLLIGHFSARWGTRRVGAPGEGRGRVIWAEFDLAPRWSPRRVAA
>NC_014210.1|WP_013152313.1|1572481_1573294_-|SUMF1/EgtB/PvdO-family-nonheme-iron-enzyme
MIEIPAGEIALRDEGTRTDWRVGVGAFRLAPCPVTRDLYAAVVGGVLGSAGVGGTREVDGASAGVAGAAGAAGAVGTAGVAGVAGAAGAAGGSGVAHEADTEDAAGPRTPVTEVSWLDAVRFCNLLSRTEGLQPCYSGGDDPDALDVACDWDAGGYRLPSEAEWEYACRAGSSGVRYGELDDIGWHRANSGDGARDVATRAPNAWGLYDTIGNVWEWCWDVYDPAVYGPYRVFRGGGWNDHPRGCRASCRRKSHPTLRVDDLGFRLARSL
>NC_014210.1|WP_013152323.1|1582243_1584016_-|ABC-transporter-ATP-binding-protein
MISALRFVLTTGYRTDRFRSLIVVAVALLEQATGIGLAVAIGLFSEVASGGSASGLVVLALCVAVFVMLTQGTFIAGYFTRLRLQEEIQNEVERRFIDVVGTTPTLEVHERSSRSDRAAVVRGARGEIGPGFDRLMWLAGAALALITSAALMASVVPVLALLPLFAVPAVLATRAADRKRGRAVERATPRTRLAGHLFTLATTAAPGRETRLFGLAGELRRRHREEWDAGGRDITRTDRLARVPVALAWLLFVLAYATAVALMVRAGLSGDAPLGLIVAAVAVSSQITGQVQSLLNLSFWSLESLRATRAFLDVVEEGTAERAALMPTTPVAVPARLESGIRVEGLGFRYWNRDQPALSGIDLELPAGTVVALVGENGAGKSTLVKMLSGLYQPGEGRVLVDGTDLARFAPEEWRARITAAFQDPVRIEMSLRDAVGLGRIEHRDDPERVIEALRTVGGDGLLASLPGGLDTRLGRGSWDGEGLSGGQWQTVANARAAMRRAPLLRIMDEPTASLDARAEERLFQQYADLGRQEGGVTVLVTHRFTTARAADLIVVLDGGRVVETGTHDTLSRAGGLYAELFRLQARYFV
>NC_014210.1|WP_086000764.1|1584012_1585803_-|ABC-transporter-ATP-binding-protein
MLPSLVRYSFSVAPGTATLTTALAVLAGAAPVGITIGIGGLVDGLTSAIGQGLDTPAARECYRWVALIVVLFLLTHIAESARTALGRALGRRVTGRLRERVMAAASEPTTIGHLEDPAYLDRIGRARGEGTIDMPPGAAVFGLSAKASLWVTGVGSAVLLTQVTWGLGLIVFAVFVVLHSRLVRNYRIAVIETANQTEKLRRTSYLRDVPTTPGAAREVRLFGLTAFFRDAYHSEWRVNMAEVWRRRREHRVFVVVIVVVTGLTVASVLYYLAYRAATGGTTVGDLALGGLALLALLQVLRTDEDDLRTSFGSKAAAEALAFPVVAPPGGPDTARWAEPVATVSCEGLRFRYGGAAGDVLHGIDLDIPAGQSLAVVGLNGAGKTTLARLLAGLDAPSGGRLRVGGTTVEDANRRSWQRQVVAVFQDFGRYELTVRDNIAFGSLAHADDEEGLREVARQAGLLEFVEGLPHGWDTVMSSGYTGGVDASGGEWQRIAIARALFGLRHGARLLIMDEPAASLDARAEARLYDTFHELTAGATTVAISHRFATVRKAERVVVLDQGRIVEDGRHEDLISAGGRYAELFHLQAKRFEEASS
>NC_014210.1|WP_126625053.1|1586243_1586438_+|hypothetical-protein
MRVHHRGTHPCDVVITGDGPAELGAGLTLCRAPVHPCTRAPVHPEPEAQAAEHVLGEHRHGSTP
>NC_014210.1|WP_041552460.1|1586551_1587160_+|class-I-SAM-dependent-methyltransferase
MFEPEGWDERYAGQERFWTGNPNPQLVAAATGLTPGTALDVGCGEGGDVVWLARQGWTVTGADFSANGLARAARRAEQAGVADRVEWWRVDARTIAADGRSYDLVTSHYLHAPDGGMVDVTRLLAHAVAPGGHLLVVGHTPSEEFAHMTEKQRRAMFLAEELLPGLPDDFEALVVEQRPRKLTREGTAVDAHDSTLFARRRR
>NC_014210.1|WP_041553074.1|1588503_1590147_+|type-I-E-CRISPR-associated-protein-Cse1/CasA
MTSRPWVPVQRLDGTEAELSLTGVFEQAARIRRLVGDVPTQDFALLRLLLAILHDAIDGPEDIEDWADLWDEGRGELPADRVRDYLGEHRDRLDLLHPTAPFLQVADLRTAKGEYSSLDPIVADVPNNARFFTMRAHGAESLGFAEAARWLLHAHAYDTSGIKSGVVGDPRVKGGKVYPQGVGWSGNLGGIHMEGDDLRATLLLNLLPRDTDNLRSRPDDRPAWRRAPATAEALGGAEAQTRPHGLRDLYTWQSRRVRLHHDGESVHGVLLAYGDPLTPRNKHDREPMTAWRRSPAQEKKLGEEQVYLPRDHDPARSAWRGLAALVTGRVRGAEQRREAAKIVRPRVLDWIARLTVEEYLDKGFLLRARLVGAVYGTQQSVIDEIVDDTVAMPVVLLHDQDRALGQTAVDAVNDAEEAVMVLGDLATALAEAAGAETEAPRAAARDRGFAELDEPFRKWLRDLRPSEDPLYPDEQRRVWQLRAHRIVSQLGAELMDTAGEAAWTGRVVATKNGSVWLTASRADLRFRSALRRALPLTNTDHSTEEEQ
>NC_014210.1|WP_013152328.1|1590959_1592147_+|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC
MSRTILDVHVLQTVPPSNLNRDDTGAPKTAVYGGVRRSRVSSQAWKRATRLAFDALLDPRELGTRTKRVAELVASRIRDLDTSIEEAEALTLAAETVQVATGSRIEVPKRKADAAKKNGTKEPAPESAYLMFLSARQRDGLAALAVEGREDIKAFLKEKENKARAKAVADTRHSVDIALFGRMVADGADVNVDAAAQVAHALSVHAVENESDYYTAVDDRNPEEETGAGMIGTVEFNSATLYRYAAVDVDLLRRNLGEGLREDEPVTEPLRRAVEAFVRGFVESMPTGKVNTFGNHTLPDAVVVKLRGARPISFVGAFEEPVEAGAGHVAQASARLAEYVPQVERAFGAADDVDTWVVRVGERTAKLSGLGEEVTLPELVERVGAAVAQRQAPRA
>NC_014210.1|WP_013152329.1|1592143_1592872_+|type-I-E-CRISPR-associated-protein-Cas5/CasD
MSAVSVLPLVLAGPLQAWGSASRFARRGTENAPTKSGVLGLLAAALGRDRTADLSDLAALRFGVRVDQPGIRVRDYQTAKHLDTDTSMPVSERFYLSDAVFVAAVEGPEGLVAELYRAVRDPVYLPYLGRRSCPPSRPVDLGEPVAGTVEEVLGDQPWQAAPWYWRRTGRRQDAQIPLTTLVDAAPGDGRADSLRDLPLSFDPAHRRYALRAVRSGSVDAPNPFARRRPVPDHDPMAALGGS
>NC_014210.1|WP_013152330.1|1592871_1593591_+|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE
MYLTRFRFNTHRPGARKLLSSPQALHAAVMGSYADLLPSDTGGPRVLWRVDRNARAEVFLYVVGPNRPDLTHVVEQAGWPTDPANTWQTHEYSGFLKRLEAGQTWAFRLTANPVHSIRRKDGEPTKLTAHVTPRHQAGWLLQRQERCGFEIVRKDAEQQLLPGQDEHELVVHDRDARGFDKADPRPDRRGKRMKVPVVTATFDGRLTVTDPDALRRTLCAGLGRAKAYGCGLMTLAPVG
>NC_014210.1|WP_013152331.1|1593594_1594578_+|type-I-E-CRISPR-associated-endonuclease-Cas1
MGTVGRRRTSGPRELTRVGERLSFLYLERCVVHRDSNAITAEDGDGTRYLPSATIGTLLLGPGTNVTHSAMSLLGECGATVVWVGEHGVRYYAAGRALTRSSRLVEAQATAWANRRSRLDVARAMYRMRFPDLDVEALSRQALLGKEGDRVKACYREQAARTGVTWRGRRYVPGDHDVSDPPNKAITAAAQCFYGVAHAVTAALGCSPGLGFVHSGHERGFVMDVADLYKVEIGIPVAFDAAAQGDEDVDGVTRRLLRDRINEEGLLERCVRDIKALLLGEGSVGAQGEAEDAGESANDDVADTVGLVGDRGELLESGYSYADEVVW
>NC_014210.1|WP_013152332.1|1594574_1594925_+|type-I-E-CRISPR-associated-endoribonuclease-Cas2
MTVVVLTNCPAGLRGFLTRWLMEISAGVFIGNPSRRIREALWAEVKEYAGNGRALLAYSDDSEQGFTFQTFERHWEPVDHEGLTLMHRPKKVQEENRRPPKSGWSKASKRRRFGGR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_014210_8

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_014210_8

1587461-1588160

TypeI-E

I-E

Consensus_repeat	Method
GTGCTCCCCGCGCACGCGGGGATGGTCC	PILER-CR
GTGCTCCCCGCGCACGCGGGGATGGTCCC	CRISPRCasFinder
GTGCTCCCCGCGCACGCGGGGATGGTCCC	CRT

11 spacers

cas8e,cas7,cas5,cas6e,cas1,cas2

The CRISPR arrays of NC_014210_8

>merge|NC_014210|8|1587461-1588160|PILER-CR,CRISPRCasFinder,CRT
GTGCTCCCCGCGCACGCGGGGATGGTCCCAAGGCCACCCACTGCTGGCAGGACCCGCGCACGTGCTCCCCGCGCACGCGGGGATGGTCCCCAGTCCAACAACGTCACGGACGCCCCGTACTTGTGCTCCCCGCGCACGCGGGGATGGTCCCGCCATCAACGCCGCCGCCCGCTCCGGTGGTATGTGCTCCCCGCGCACGCGGGGATGGTCCCAAGAAGTTGCGCGGGCGCTGGTCCGGACTGGTGTGCTCCCCGCGCACGCGGGGATGGTCCCCGGTGCGTGACCGGTGCGCCCAGATGGTCGACGTGCTCCCCGCGCACGCGGGGATGGTCCCGGTCACCCTCGGCCCGGCATTACGGGCCATCCGTGCTCCCCGCGCACGCGGGGATGGTCCCCCAGGCCGCCGACCCTCGCGCGGCCCGCCACGGTGCTCCCCGCGCACGCGGGGATGGTCCTCACCACCCGAGACCGCTTGGCCATCGGGACCGGTGCTCCCCGCGCACGCGGGGATGGTCCGCGGGTCCGAGGTCGGCGGGCGGGCGGTCCTCGGTGCTCCCCGCGCACGCGAGGATGGTCCCGGCACGGCACCCTGGACCGCCGCTGCGTCATCGTGCTCCCCGCGCACGCGGGGATGGTCCCGGGAAGCCCACCGGCACCGTCCGCAAGGTCGCGTGCTCCCCGCGCACGCGGGGATGGTCCC

>NC_014210|8|2|1587461-1588159|PILER-CR
GTGCTCCCCGCGCACGCGGGGATGGTCC	CAAGGCCACCCACTGCTGGCAGGACCCGCGCAC
GTGCTCCCCGCGCACGCGGGGATGGTCC	CCAGTCCAACAACGTCACGGACGCCCCGTACTT
GTGCTCCCCGCGCACGCGGGGATGGTCC	CGCCATCAACGCCGCCGCCCGCTCCGGTGGTAT
GTGCTCCCCGCGCACGCGGGGATGGTCC	CAAGAAGTTGCGCGGGCGCTGGTCCGGACTGGT
GTGCTCCCCGCGCACGCGGGGATGGTCC	CCGGTGCGTGACCGGTGCGCCCAGATGGTCGAC
GTGCTCCCCGCGCACGCGGGGATGGTCC	CGGTCACCCTCGGCCCGGCATTACGGGCCATCC
GTGCTCCCCGCGCACGCGGGGATGGTCC	CCCAGGCCGCCGACCCTCGCGCGGCCCGCCACG
GTGCTCCCCGCGCACGCGGGGATGGTCC	TCACCACCCGAGACCGCTTGGCCATCGGGACCG
GTGCTCCCCGCGCACGCGGGGATGGTCC	GCGGGTCCGAGGTCGGCGGGCGGGCGGTCCTCG
GTGCTCCCCGCGCACGCGAGGATGGTCC	CGGCACGGCACCCTGGACCGCCGCTGCGTCATC
GTGCTCCCCGCGCACGCGGGGATGGTCC	CGGGAAGCCCACCGGCACCGTCCGCAAGGTCGC
GTGCTCCCCGCGCACGCGGGGATGGTCC

>NC_014210|8|8|1587461-1588160|CRISPRCasFinder
GTGCTCCCCGCGCACGCGGGGATGGTCCC	AAGGCCACCCACTGCTGGCAGGACCCGCGCAC
GTGCTCCCCGCGCACGCGGGGATGGTCCC	CAGTCCAACAACGTCACGGACGCCCCGTACTT
GTGCTCCCCGCGCACGCGGGGATGGTCCC	GCCATCAACGCCGCCGCCCGCTCCGGTGGTAT
GTGCTCCCCGCGCACGCGGGGATGGTCCC	AAGAAGTTGCGCGGGCGCTGGTCCGGACTGGT
GTGCTCCCCGCGCACGCGGGGATGGTCCC	CGGTGCGTGACCGGTGCGCCCAGATGGTCGAC
GTGCTCCCCGCGCACGCGGGGATGGTCCC	GGTCACCCTCGGCCCGGCATTACGGGCCATCC
GTGCTCCCCGCGCACGCGGGGATGGTCCC	CCAGGCCGCCGACCCTCGCGCGGCCCGCCACG
GTGCTCCCCGCGCACGCGGGGATGGTCCT	CACCACCCGAGACCGCTTGGCCATCGGGACCG
GTGCTCCCCGCGCACGCGGGGATGGTCCG	CGGGTCCGAGGTCGGCGGGCGGGCGGTCCTCG
GTGCTCCCCGCGCACGCGAGGATGGTCCC	GGCACGGCACCCTGGACCGCCGCTGCGTCATC
GTGCTCCCCGCGCACGCGGGGATGGTCCC	GGGAAGCCCACCGGCACCGTCCGCAAGGTCGC
GTGCTCCCCGCGCACGCGGGGATGGTCCC

>NC_014210|8|2|1587461-1588160|CRT
GTGCTCCCCGCGCACGCGGGGATGGTCCC	AAGGCCACCCACTGCTGGCAGGACCCGCGCAC
GTGCTCCCCGCGCACGCGGGGATGGTCCC	CAGTCCAACAACGTCACGGACGCCCCGTACTT
GTGCTCCCCGCGCACGCGGGGATGGTCCC	GCCATCAACGCCGCCGCCCGCTCCGGTGGTAT
GTGCTCCCCGCGCACGCGGGGATGGTCCC	AAGAAGTTGCGCGGGCGCTGGTCCGGACTGGT
GTGCTCCCCGCGCACGCGGGGATGGTCCC	CGGTGCGTGACCGGTGCGCCCAGATGGTCGAC
GTGCTCCCCGCGCACGCGGGGATGGTCCC	GGTCACCCTCGGCCCGGCATTACGGGCCATCC
GTGCTCCCCGCGCACGCGGGGATGGTCCC	CCAGGCCGCCGACCCTCGCGCGGCCCGCCACG
GTGCTCCCCGCGCACGCGGGGATGGTCCT	CACCACCCGAGACCGCTTGGCCATCGGGACCG
GTGCTCCCCGCGCACGCGGGGATGGTCCG	CGGGTCCGAGGTCGGCGGGCGGGCGGTCCTCG
GTGCTCCCCGCGCACGCGAGGATGGTCCC	GGCACGGCACCCTGGACCGCCGCTGCGTCATC
GTGCTCCCCGCGCACGCGGGGATGGTCCC	GGGAAGCCCACCGGCACCGTCCGCAAGGTCGC
GTGCTCCCCGCGCACGCGGGGATGGTCCC

Protein	Signature genes	Signature genes Name	Protein_function
NC_014210.1\|WP_013152323.1\|1582243_1584016_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224055
NC_014210.1\|WP_126625053.1\|1586243_1586438_+\|hypothetical-protein	unknown	unknown	unknown
NC_014210.1\|WP_013152328.1\|1590959_1592147_+\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	cas7	pfam09344_cas7_CAS-I-E	gnl\|CDD\|378153
NC_014210.1\|WP_013152332.1\|1594574_1594925_+\|type-I-E-CRISPR-associated-endoribonuclease-Cas2	cas2	pfam09707_cas2_CAS-I-E	gnl\|CDD\|378244
NC_014210.1\|WP_086000764.1\|1584012_1585803_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224055
NC_014210.1\|WP_049800289.1\|1577885_1578518_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|366102
NC_014210.1\|WP_041553074.1\|1588503_1590147_+\|type-I-E-CRISPR-associated-protein-Cse1/CasA	cas8e	cd09729_cas8e_CAS-I-E	gnl\|CDD\|378189
NC_014210.1\|WP_049800290.1\|1581029_1581686_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|379522
NC_014210.1\|WP_013152319.1\|1578516_1579419_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|225176
NC_014210.1\|WP_013152317.1\|1577378_1577861_+\|hypothetical-protein	unknown	unknown	unknown
NC_014210.1\|WP_126625054.1\|1596686_1596920_-\|hypothetical-protein	unknown	unknown	unknown
NC_014210.1\|WP_013152320.1\|1579590_1580484_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223669
NC_014210.1\|WP_013152333.1\|1596037_1596442_-\|hypothetical-protein	unknown	unknown	unknown
NC_014210.1\|WP_013152331.1\|1593594_1594578_+\|type-I-E-CRISPR-associated-endonuclease-Cas1	cas1	cd09719_cas1_CAS-I-E	gnl\|CDD\|274693
NC_014210.1\|WP_041552460.1\|1586551_1587160_+\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|379312
NC_014210.1\|WP_013152336.1\|1598288_1598426_-\|hypothetical-protein	unknown	unknown	unknown
NC_014210.1\|WP_013152329.1\|1592143_1592872_+\|type-I-E-CRISPR-associated-protein-Cas5/CasD	cas5	cd09756_cas5_CAS-I-E	gnl\|CDD\|187886
NC_014210.1\|WP_013152330.1\|1592871_1593591_+\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	cas6e	pfam08798_cas6e_CAS-I-E:CAS-IV	gnl\|CDD\|378050
NC_014210.1\|WP_013152335.1\|1597140_1598289_-\|methyltransferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|275041
NC_014210.1\|WP_013152321.1\|1580518_1580884_-\|glyoxalase	unknown	unknown	gnl\|CDD\|319924

Protein	Function_ID	Function_description	E-value
NC_014210.1\|WP_013152323.1\|1582243_1584016_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	1.40908e-73
NC_014210.1\|WP_013152320.1\|1579590_1580484_-\|alpha/beta-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	1.42801e-15
NC_014210.1\|WP_013152328.1\|1590959_1592147_+\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	gnl\|CDD\|378153	pfam09344, Cas_CT1975, CT1975-like protein. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family is represented by CT1975 of Chlorobium tepidum.	5.35801e-161
NC_014210.1\|WP_013152332.1\|1594574_1594925_+\|type-I-E-CRISPR-associated-endoribonuclease-Cas2	gnl\|CDD\|378244	pfam09707, Cas_Cas2CT1978, CRISPR-associated protein (Cas_Cas2CT1978). This entry represents a minor branch of the Cas2 family of CRISPR-associated protein which are found in IPR003799. Cas proteins are found adjacent to a characteristic short, palindromic repeat cluster termed CRISPR, a probable mobile DNA element.	4.87705e-44
NC_014210.1\|WP_086000764.1\|1584012_1585803_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	1.7775e-77
NC_014210.1\|WP_049800289.1\|1577885_1578518_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|366102	pfam00440, TetR_N, Bacterial regulatory proteins, tetR family.	7.23039e-12
NC_014210.1\|WP_041553074.1\|1588503_1590147_+\|type-I-E-CRISPR-associated-protein-Cse1/CasA	gnl\|CDD\|378189	pfam09481, CRISPR_Cse1, CRISPR-associated protein Cse1 (CRISPR_cse1). Clusters of short DNA repeats with non-homologous spacers, which are found at regular intervals in the genomes of phylogenetically distinct prokaryotic species, comprise a family with recognisable features. This family is known as CRISPR (short for Clustered, Regularly Interspaced Short Palindromic Repeats). A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This entry, represented by CT1972 from Chlorobaculum tepidum, is found in the CRISPR/Cas subtype Ecoli regions of many bacteria (most of which are mesophiles), and not in Archaea. It is designated Cse1.	2.5974e-138
NC_014210.1\|WP_049800290.1\|1581029_1581686_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|379522	pfam14246, TetR_C_7, AefR-like transcriptional repressor, C-terminal region. This family comprises the C-terminal domain of transcriptional regulators of the TetR family. It includes the AefR transcriptional regulator from P. syringae. It is found in association with pfam00440.	3.46023e-30
NC_014210.1\|WP_013152319.1\|1578516_1579419_+\|alpha/beta-hydrolase	gnl\|CDD\|225176	COG2267, PldB, Lysophospholipase [Lipid metabolism].	5.95048e-31
NC_014210.1\|WP_013152331.1\|1593594_1594578_+\|type-I-E-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|274693	TIGR03638, cas1_ECOLI, CRISPR-associated endonuclease Cas1, subtype I-E/ECOLI. The CRISPR-associated protein Cas1 is virtually universal to CRISPR systems. CRISPR, an acronym for Clustered Regularly Interspaced Short Palindromic Repeats, is prokaryotic immunity system for foreign DNA, mostly from phage. CRISPR systems belong to different subtypes, distinguished by both nature of the repeats, the makeup of the cohort of associated Cas proteins, and by molecular phylogeny within the more universal Cas proteins such as this one. This model is of type EXCEPTION and provides more specific information than the EQUIVALOG model TIGR00287. It describes the Cas1 protein particular to the ECOLI subtype of CRISPR/Cas system.	6.12838e-114
NC_014210.1\|WP_041552460.1\|1586551_1587160_+\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	4.80606e-17
NC_014210.1\|WP_013152329.1\|1592143_1592872_+\|type-I-E-CRISPR-associated-protein-Cas5/CasD	gnl\|CDD\|187886	cd09756, Cas5_I-E, CRISPR/Cas system-associated RAMP superfamily protein Cas5. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas5 is a RAMP superfamily protein; Subunit of the Cascade complex.	1.75642e-43
NC_014210.1\|WP_013152330.1\|1592871_1593591_+\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	gnl\|CDD\|378050	pfam08798, CRISPR_assoc, CRISPR associated protein. This domain forms an anti-parallel beta strand structure with flanking alpha helical regions.	4.44127e-77
NC_014210.1\|WP_013152335.1\|1597140_1598289_-\|methyltransferase-domain-containing-protein	gnl\|CDD\|275041	TIGR04188, conserved_hypothetical_protein, methyltransferase, ATP-grasp peptide maturase system. Members of this protein family are predicted SAM-dependent methyltransferases that regularly occur in the context of a putative peptide modification ATP-grasp enzyme (TIGR04187, related to enzymes of microviridin maturation) and a putative ribosomal peptide modification target (TIGR04186).	1.45919e-97
NC_014210.1\|WP_013152321.1\|1580518_1580884_-\|glyoxalase	gnl\|CDD\|319924	cd07263, VOC_like, uncharacterized subfamily of vicinal oxygen chelate (VOC) family. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	1.03031e-17

>NC_014210.1|WP_041552460.1|1586551_1587160_+|class-I-SAM-dependent-methyltransferase
MFEPEGWDERYAGQERFWTGNPNPQLVAAATGLTPGTALDVGCGEGGDVVWLARQGWTVTGADFSANGLARAARRAEQAGVADRVEWWRVDARTIAADGRSYDLVTSHYLHAPDGGMVDVTRLLAHAVAPGGHLLVVGHTPSEEFAHMTEKQRRAMFLAEELLPGLPDDFEALVVEQRPRKLTREGTAVDAHDSTLFARRRR
>NC_014210.1|WP_126625053.1|1586243_1586438_+|hypothetical-protein
MRVHHRGTHPCDVVITGDGPAELGAGLTLCRAPVHPCTRAPVHPEPEAQAAEHVLGEHRHGSTP
>NC_014210.1|WP_086000764.1|1584012_1585803_-|ABC-transporter-ATP-binding-protein
MLPSLVRYSFSVAPGTATLTTALAVLAGAAPVGITIGIGGLVDGLTSAIGQGLDTPAARECYRWVALIVVLFLLTHIAESARTALGRALGRRVTGRLRERVMAAASEPTTIGHLEDPAYLDRIGRARGEGTIDMPPGAAVFGLSAKASLWVTGVGSAVLLTQVTWGLGLIVFAVFVVLHSRLVRNYRIAVIETANQTEKLRRTSYLRDVPTTPGAAREVRLFGLTAFFRDAYHSEWRVNMAEVWRRRREHRVFVVVIVVVTGLTVASVLYYLAYRAATGGTTVGDLALGGLALLALLQVLRTDEDDLRTSFGSKAAAEALAFPVVAPPGGPDTARWAEPVATVSCEGLRFRYGGAAGDVLHGIDLDIPAGQSLAVVGLNGAGKTTLARLLAGLDAPSGGRLRVGGTTVEDANRRSWQRQVVAVFQDFGRYELTVRDNIAFGSLAHADDEEGLREVARQAGLLEFVEGLPHGWDTVMSSGYTGGVDASGGEWQRIAIARALFGLRHGARLLIMDEPAASLDARAEARLYDTFHELTAGATTVAISHRFATVRKAERVVVLDQGRIVEDGRHEDLISAGGRYAELFHLQAKRFEEASS
>NC_014210.1|WP_013152323.1|1582243_1584016_-|ABC-transporter-ATP-binding-protein
MISALRFVLTTGYRTDRFRSLIVVAVALLEQATGIGLAVAIGLFSEVASGGSASGLVVLALCVAVFVMLTQGTFIAGYFTRLRLQEEIQNEVERRFIDVVGTTPTLEVHERSSRSDRAAVVRGARGEIGPGFDRLMWLAGAALALITSAALMASVVPVLALLPLFAVPAVLATRAADRKRGRAVERATPRTRLAGHLFTLATTAAPGRETRLFGLAGELRRRHREEWDAGGRDITRTDRLARVPVALAWLLFVLAYATAVALMVRAGLSGDAPLGLIVAAVAVSSQITGQVQSLLNLSFWSLESLRATRAFLDVVEEGTAERAALMPTTPVAVPARLESGIRVEGLGFRYWNRDQPALSGIDLELPAGTVVALVGENGAGKSTLVKMLSGLYQPGEGRVLVDGTDLARFAPEEWRARITAAFQDPVRIEMSLRDAVGLGRIEHRDDPERVIEALRTVGGDGLLASLPGGLDTRLGRGSWDGEGLSGGQWQTVANARAAMRRAPLLRIMDEPTASLDARAEERLFQQYADLGRQEGGVTVLVTHRFTTARAADLIVVLDGGRVVETGTHDTLSRAGGLYAELFRLQARYFV
>NC_014210.1|WP_049800290.1|1581029_1581686_+|TetR/AcrR-family-transcriptional-regulator
MLNSVNPPAEEGLSRSARKRRAILGAAEEVFLRGGYLGTNMDEIAALSEVSKQTVYKHFGSKEGLFVEIVTSMTSGAGDVVRDETPEPDRVEDVEAYLRDYARRQLTVVLTPRLMRLRRMVIGEVARFPELARVLYECGPQRAIAGLAESFARLGERGLLAVGDPLRAASHFNWLVMSEPVNRAMLLGDEAIPAEAELCQHAEEGVRVFLAAYGVDGR
>NC_014210.1|WP_013152321.1|1580518_1580884_-|glyoxalase
MYVKFAELPVFDQERAKAFYTDRLGCTVVTDAPMSDDGWRWIELGFPGSRTHLHFQRRADEDPSAEPVMVLVTEDVEGTVEALRAEGVEIVTEPQEAMWQPGVTAAEFRDSEGNRMVLSDS
>NC_014210.1|WP_013152320.1|1579590_1580484_-|alpha/beta-hydrolase
MSHHSHHSPGAHTLKVPGARIHYEVRGSGPVLLMIPGGPQDAGVYTALAEHLSDRYTTVAYDPRGNSRSTLDGEPEDQRVEVHSDDAARLIAEMGAGPAYVFGNSAGAQIGLDMAVRHPGSVRALLAHEPPCLMLLDDPSEVLARDQDVYDTYQREGVEAAIGKFMAMNGLGEEAGGTQEEGGREPEGAATEGPMHEDPETFERVSGNFAYFLAHGLMPLSLYQPDVEALREGRVPVTVGLGDASAGQPIHDIGLALVRRLGTEPVAFPGDHVGFGTHPRAFAEALHGALDGAPKQR
>NC_014210.1|WP_013152319.1|1578516_1579419_+|alpha/beta-hydrolase
MDNPYTAWMPVGLRPDPPPRCESTWRRFPDADVHVERVGEPDAARRAVLLHGAGGHAGLLRPYAAALAHRGFHVVVPDLPGYGRTRVRRRGAVRYADWVRVAVGISSAERQAHQGPLTLVGASMGGLLAYDAATRTGAADAVVATCLLDPRDPRARRRISRYAWLGDAAPPLLRVAAGPLAATRVPVRWLANMWAISNQPELTEAVVGDPLGGGNSVPLGFLRSFLESAPAVEPERAADTTVVLAHPAEDRWTPVEVSLPFFERLAGPKRLVMLDGAGHLPVEEPGVGQLLDAVVEASSG
>NC_014210.1|WP_049800289.1|1577885_1578518_-|TetR/AcrR-family-transcriptional-regulator
MARSSAPRTAATTRVGGSPDTPRRRPRQQRSRETVEVILEAAAQVFEREGLEATTNRVAERAGYSIGTLYQYFPNKRALLHSLAERHVEETRRTLEELAEVLRRDEPSWEDTVRRLAAAVADAHGDRPRLHSLMHAHAPRVPAGVTAVEALRSYLAAELVWHLRRCGRGGTDPERTAALLVHTADAQMHGVLMGEEDAAAELVRSLLALS
>NC_014210.1|WP_013152317.1|1577378_1577861_+|hypothetical-protein
MTRIGITGHSNLSGDSVTLVRKALVAALDPHADDRLVGVSCLARGADQLFAEAVLDVGGRLEVVLPSADYREAKVKPANLDRFDDLLVRSSLVRYMPHRRAGRAAYEDANEAVLDWVELMFAVWDGQPADGRGGTADAVEAARVRGVPVEVIWPEGVRRD
>NC_014210.1|WP_041553074.1|1588503_1590147_+|type-I-E-CRISPR-associated-protein-Cse1/CasA
MTSRPWVPVQRLDGTEAELSLTGVFEQAARIRRLVGDVPTQDFALLRLLLAILHDAIDGPEDIEDWADLWDEGRGELPADRVRDYLGEHRDRLDLLHPTAPFLQVADLRTAKGEYSSLDPIVADVPNNARFFTMRAHGAESLGFAEAARWLLHAHAYDTSGIKSGVVGDPRVKGGKVYPQGVGWSGNLGGIHMEGDDLRATLLLNLLPRDTDNLRSRPDDRPAWRRAPATAEALGGAEAQTRPHGLRDLYTWQSRRVRLHHDGESVHGVLLAYGDPLTPRNKHDREPMTAWRRSPAQEKKLGEEQVYLPRDHDPARSAWRGLAALVTGRVRGAEQRREAAKIVRPRVLDWIARLTVEEYLDKGFLLRARLVGAVYGTQQSVIDEIVDDTVAMPVVLLHDQDRALGQTAVDAVNDAEEAVMVLGDLATALAEAAGAETEAPRAAARDRGFAELDEPFRKWLRDLRPSEDPLYPDEQRRVWQLRAHRIVSQLGAELMDTAGEAAWTGRVVATKNGSVWLTASRADLRFRSALRRALPLTNTDHSTEEEQ
>NC_014210.1|WP_013152328.1|1590959_1592147_+|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC
MSRTILDVHVLQTVPPSNLNRDDTGAPKTAVYGGVRRSRVSSQAWKRATRLAFDALLDPRELGTRTKRVAELVASRIRDLDTSIEEAEALTLAAETVQVATGSRIEVPKRKADAAKKNGTKEPAPESAYLMFLSARQRDGLAALAVEGREDIKAFLKEKENKARAKAVADTRHSVDIALFGRMVADGADVNVDAAAQVAHALSVHAVENESDYYTAVDDRNPEEETGAGMIGTVEFNSATLYRYAAVDVDLLRRNLGEGLREDEPVTEPLRRAVEAFVRGFVESMPTGKVNTFGNHTLPDAVVVKLRGARPISFVGAFEEPVEAGAGHVAQASARLAEYVPQVERAFGAADDVDTWVVRVGERTAKLSGLGEEVTLPELVERVGAAVAQRQAPRA
>NC_014210.1|WP_013152329.1|1592143_1592872_+|type-I-E-CRISPR-associated-protein-Cas5/CasD
MSAVSVLPLVLAGPLQAWGSASRFARRGTENAPTKSGVLGLLAAALGRDRTADLSDLAALRFGVRVDQPGIRVRDYQTAKHLDTDTSMPVSERFYLSDAVFVAAVEGPEGLVAELYRAVRDPVYLPYLGRRSCPPSRPVDLGEPVAGTVEEVLGDQPWQAAPWYWRRTGRRQDAQIPLTTLVDAAPGDGRADSLRDLPLSFDPAHRRYALRAVRSGSVDAPNPFARRRPVPDHDPMAALGGS
>NC_014210.1|WP_013152330.1|1592871_1593591_+|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE
MYLTRFRFNTHRPGARKLLSSPQALHAAVMGSYADLLPSDTGGPRVLWRVDRNARAEVFLYVVGPNRPDLTHVVEQAGWPTDPANTWQTHEYSGFLKRLEAGQTWAFRLTANPVHSIRRKDGEPTKLTAHVTPRHQAGWLLQRQERCGFEIVRKDAEQQLLPGQDEHELVVHDRDARGFDKADPRPDRRGKRMKVPVVTATFDGRLTVTDPDALRRTLCAGLGRAKAYGCGLMTLAPVG
>NC_014210.1|WP_013152331.1|1593594_1594578_+|type-I-E-CRISPR-associated-endonuclease-Cas1
MGTVGRRRTSGPRELTRVGERLSFLYLERCVVHRDSNAITAEDGDGTRYLPSATIGTLLLGPGTNVTHSAMSLLGECGATVVWVGEHGVRYYAAGRALTRSSRLVEAQATAWANRRSRLDVARAMYRMRFPDLDVEALSRQALLGKEGDRVKACYREQAARTGVTWRGRRYVPGDHDVSDPPNKAITAAAQCFYGVAHAVTAALGCSPGLGFVHSGHERGFVMDVADLYKVEIGIPVAFDAAAQGDEDVDGVTRRLLRDRINEEGLLERCVRDIKALLLGEGSVGAQGEAEDAGESANDDVADTVGLVGDRGELLESGYSYADEVVW
>NC_014210.1|WP_013152332.1|1594574_1594925_+|type-I-E-CRISPR-associated-endoribonuclease-Cas2
MTVVVLTNCPAGLRGFLTRWLMEISAGVFIGNPSRRIREALWAEVKEYAGNGRALLAYSDDSEQGFTFQTFERHWEPVDHEGLTLMHRPKKVQEENRRPPKSGWSKASKRRRFGGR
>NC_014210.1|WP_013152333.1|1596037_1596442_-|hypothetical-protein
MPTTTPSTRPRPVAGTVALWALQVLLAVVFAVIAFPKAMGDPISVAPFELIGLGIPGMVVVGWLELAGAIALLVPRLCGLALLCQIPLMIGATALSAIVTPDLVAIPAVTLVLVCVAAWFRRHDTAALVRMVRR
>NC_014210.1|WP_126625054.1|1596686_1596920_-|hypothetical-protein
MMRKHGVSPTVTKALASARPEPGKKLPPRPSRLDACKPLIDAMPRAVLDALREQRHTCTRVFGPAPAPPDWNRRNGT
>NC_014210.1|WP_013152335.1|1597140_1598289_-|methyltransferase-domain-containing-protein
MLPQHEKLVSRLTQAGNLDQHWHGAFAAVERHRFLPGRITAPDGTTVDRDGDHDGDRERWLELAYDDIPVITQVDDGTGEGSGYPASSASQPSIVADMLHRLDVFPGMRVLEVGTGTGYNAGLLSHRLGGENVTTVEIDADLAEQARVRLLDAGFAAHVVTGDGTRGWPKRAPYDRVLSTAAVQRVPYAWVAQSRPGGRILTPWGTAFHNGALAELRVGPDGSARGHFAGDVAFMWVRDQRIPRRVVETHVRPEEQEFTRSRTGLHPYEPISDFSASFAIGLHMPTVLNRVEYTDEEQRFTVHLVDPGTGSWASWHVDPDRGETGYEVHQHGPRRLFSELEAAYTWWQEEGPPEHTRFGLTVSAERQNAWLDHEGRPVLTAP
>NC_014210.1|WP_013152336.1|1598288_1598426_-|hypothetical-protein
MRSTDLHAKHEDNSTHDGHKPDRPVPPPTPNDGGSGGGKHERDGK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_014210_9

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_014210_9

1595026-1595670

TypeI-E

I-E

Consensus_repeat	Method
GTGCTCCCCGCGCACGCGGGGATGGTCCC	PILER-CR
GTGCTCCCCGCGCACGCGGGGATGGTCCC	CRISPRCasFinder
GTGCTCCCCGCGCACGCGGGGATGGTCCC	CRT

10 spacers

cas2,cas1,cas6e,cas5,cas7,cas8e

The CRISPR arrays of NC_014210_9

>merge|NC_014210|9|1595026-1595670|PILER-CR,CRISPRCasFinder,CRT
GTGCTCCCCGCGCACGCGGGGATGGTCCCCCCTCGGGGGCGCTCTCCAGCTTCGCCACGCGCGCGGTGCTCCCCGCGCACGCGGGGATGGTCCCAAAACCCTTACTCAGCAGGGGTTTAGGCGTACAGTGCTCCCCGCGCACGCGGGGATGGTCCCCAGCGTCGTCGACCCCAGGCTGACGGAGGTCTGTGCTCCCCGCGCACGCGGGGATGGTCCCCCTGCGGTTGCGGGGTTGTCCGCGAGCGGGAGGTGCTCCCCGCGCACGCGGGGATGGTCCCCCGGACCGCCACGTTATCCCGTGGGCCGAGCTGTGCTCCCCGCGCACGCGGGGATGGTCCCTGGCCGTTCGAGGGTGAGCGCGTTTACCTCGGGTGCTCCCCGCGCATGCGGGGATGGTCCCGCGGACCGGCCCACCCGGCTGGCGACCGTCGCGTGCTCCCCGCGCACGCGGGGATGGTCCCGCCGTCGCCGCCTACGCGACCGCCCTCGGGCTGTGCTCCCCGCGCACGCGGGGATGGTCCCCATGCGGCAATCCACCCCACAGAGAAGCCCGTGGTGCTCCCCGCGCACGCGGGGATGGTCCCTCGATGACCGAGGTCGACGGCACCGGGTCGGAGTGCTCCCCGCGCACGCGGGGATGGTCTC

>NC_014210|9|3|1595026-1595670|PILER-CR
GTGCTCCCCGCGCACGCGGGGATGGTCCC	CCCTCGGGGGCGCTCTCCAGCTTCGCCACGCGCGCG
GTGCTCCCCGCGCACGCGGGGATGGTCCC	AAAACCCTTACTCAGCAGGGGTTTAGGCGTACA
GTGCTCCCCGCGCACGCGGGGATGGTCCC	CAGCGTCGTCGACCCCAGGCTGACGGAGGTCT
GTGCTCCCCGCGCACGCGGGGATGGTCCC	CCTGCGGTTGCGGGGTTGTCCGCGAGCGGGAG
GTGCTCCCCGCGCACGCGGGGATGGTCCC	CCGGACCGCCACGTTATCCCGTGGGCCGAGCT
GTGCTCCCCGCGCACGCGGGGATGGTCCC	TGGCCGTTCGAGGGTGAGCGCGTTTACCTCGG
GTGCTCCCCGCGCATGCGGGGATGGTCCC	GCGGACCGGCCCACCCGGCTGGCGACCGTCGC
GTGCTCCCCGCGCACGCGGGGATGGTCCC	GCCGTCGCCGCCTACGCGACCGCCCTCGGGCT
GTGCTCCCCGCGCACGCGGGGATGGTCCC	CATGCGGCAATCCACCCCACAGAGAAGCCCGTG
GTGCTCCCCGCGCACGCGGGGATGGTCCC	TCGATGACCGAGGTCGACGGCACCGGGTCGGA
GTGCTCCCCGCGCACGCGGGGATGGTCTC

>NC_014210|9|9|1595026-1595670|CRISPRCasFinder
GTGCTCCCCGCGCACGCGGGGATGGTCCC	CCCTCGGGGGCGCTCTCCAGCTTCGCCACGCGCGCG
GTGCTCCCCGCGCACGCGGGGATGGTCCC	AAAACCCTTACTCAGCAGGGGTTTAGGCGTACA
GTGCTCCCCGCGCACGCGGGGATGGTCCC	CAGCGTCGTCGACCCCAGGCTGACGGAGGTCT
GTGCTCCCCGCGCACGCGGGGATGGTCCC	CCTGCGGTTGCGGGGTTGTCCGCGAGCGGGAG
GTGCTCCCCGCGCACGCGGGGATGGTCCC	CCGGACCGCCACGTTATCCCGTGGGCCGAGCT
GTGCTCCCCGCGCACGCGGGGATGGTCCC	TGGCCGTTCGAGGGTGAGCGCGTTTACCTCGG
GTGCTCCCCGCGCATGCGGGGATGGTCCC	GCGGACCGGCCCACCCGGCTGGCGACCGTCGC
GTGCTCCCCGCGCACGCGGGGATGGTCCC	GCCGTCGCCGCCTACGCGACCGCCCTCGGGCT
GTGCTCCCCGCGCACGCGGGGATGGTCCC	CATGCGGCAATCCACCCCACAGAGAAGCCCGTG
GTGCTCCCCGCGCACGCGGGGATGGTCCC	TCGATGACCGAGGTCGACGGCACCGGGTCGGA
GTGCTCCCCGCGCACGCGGGGATGGTCTC

>NC_014210|9|3|1595026-1595670|CRT
GTGCTCCCCGCGCACGCGGGGATGGTCCC	CCCTCGGGGGCGCTCTCCAGCTTCGCCACGCGCGCG
GTGCTCCCCGCGCACGCGGGGATGGTCCC	AAAACCCTTACTCAGCAGGGGTTTAGGCGTACA
GTGCTCCCCGCGCACGCGGGGATGGTCCC	CAGCGTCGTCGACCCCAGGCTGACGGAGGTCT
GTGCTCCCCGCGCACGCGGGGATGGTCCC	CCTGCGGTTGCGGGGTTGTCCGCGAGCGGGAG
GTGCTCCCCGCGCACGCGGGGATGGTCCC	CCGGACCGCCACGTTATCCCGTGGGCCGAGCT
GTGCTCCCCGCGCACGCGGGGATGGTCCC	TGGCCGTTCGAGGGTGAGCGCGTTTACCTCGG
GTGCTCCCCGCGCATGCGGGGATGGTCCC	GCGGACCGGCCCACCCGGCTGGCGACCGTCGC
GTGCTCCCCGCGCACGCGGGGATGGTCCC	GCCGTCGCCGCCTACGCGACCGCCCTCGGGCT
GTGCTCCCCGCGCACGCGGGGATGGTCCC	CATGCGGCAATCCACCCCACAGAGAAGCCCGTG
GTGCTCCCCGCGCACGCGGGGATGGTCCC	TCGATGACCGAGGTCGACGGCACCGGGTCGGA
GTGCTCCCCGCGCACGCGGGGATGGTCTC

Protein	Signature genes	Signature genes Name	Protein_function
NC_014210.1\|WP_013152329.1\|1592143_1592872_+\|type-I-E-CRISPR-associated-protein-Cas5/CasD	cas5	cd09756_cas5_CAS-I-E	gnl\|CDD\|187886
NC_014210.1\|WP_041553074.1\|1588503_1590147_+\|type-I-E-CRISPR-associated-protein-Cse1/CasA	cas8e	cd09729_cas8e_CAS-I-E	gnl\|CDD\|378189
NC_014210.1\|WP_013152330.1\|1592871_1593591_+\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	cas6e	pfam08798_cas6e_CAS-I-E:CAS-IV	gnl\|CDD\|378050
NC_014210.1\|WP_013152340.1\|1600244_1600493_-\|DUF397-domain-containing-protein	unknown	unknown	gnl\|CDD\|377231
NC_014210.1\|WP_013152338.1\|1598763_1599312_+\|hypothetical-protein	unknown	unknown	unknown
NC_014210.1\|WP_086000764.1\|1584012_1585803_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224055
NC_014210.1\|WP_013152323.1\|1582243_1584016_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224055
NC_014210.1\|WP_013152337.1\|1598576_1598780_+\|hypothetical-protein	unknown	unknown	unknown
NC_014210.1\|WP_013152336.1\|1598288_1598426_-\|hypothetical-protein	unknown	unknown	unknown
NC_014210.1\|WP_013152328.1\|1590959_1592147_+\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	cas7	pfam09344_cas7_CAS-I-E	gnl\|CDD\|378153
NC_014210.1\|WP_013152342.1\|1601583_1602147_+\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|340413
NC_014210.1\|WP_013152341.1\|1600496_1601357_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|379262
NC_014210.1\|WP_126625054.1\|1596686_1596920_-\|hypothetical-protein	unknown	unknown	unknown
NC_014210.1\|WP_013152333.1\|1596037_1596442_-\|hypothetical-protein	unknown	unknown	unknown
NC_014210.1\|WP_013152331.1\|1593594_1594578_+\|type-I-E-CRISPR-associated-endonuclease-Cas1	cas1	cd09719_cas1_CAS-I-E	gnl\|CDD\|274693
NC_014210.1\|WP_013152339.1\|1599308_1600181_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|379262
NC_014210.1\|WP_041552460.1\|1586551_1587160_+\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|379312
NC_014210.1\|WP_126625053.1\|1586243_1586438_+\|hypothetical-protein	unknown	unknown	unknown
NC_014210.1\|WP_013152332.1\|1594574_1594925_+\|type-I-E-CRISPR-associated-endoribonuclease-Cas2	cas2	pfam09707_cas2_CAS-I-E	gnl\|CDD\|378244
NC_014210.1\|WP_013152335.1\|1597140_1598289_-\|methyltransferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|275041

Protein	Function_ID	Function_description	E-value
NC_014210.1\|WP_013152329.1\|1592143_1592872_+\|type-I-E-CRISPR-associated-protein-Cas5/CasD	gnl\|CDD\|187886	cd09756, Cas5_I-E, CRISPR/Cas system-associated RAMP superfamily protein Cas5. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas5 is a RAMP superfamily protein; Subunit of the Cascade complex.	1.75642e-43
NC_014210.1\|WP_041553074.1\|1588503_1590147_+\|type-I-E-CRISPR-associated-protein-Cse1/CasA	gnl\|CDD\|378189	pfam09481, CRISPR_Cse1, CRISPR-associated protein Cse1 (CRISPR_cse1). Clusters of short DNA repeats with non-homologous spacers, which are found at regular intervals in the genomes of phylogenetically distinct prokaryotic species, comprise a family with recognisable features. This family is known as CRISPR (short for Clustered, Regularly Interspaced Short Palindromic Repeats). A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This entry, represented by CT1972 from Chlorobaculum tepidum, is found in the CRISPR/Cas subtype Ecoli regions of many bacteria (most of which are mesophiles), and not in Archaea. It is designated Cse1.	2.5974e-138
NC_014210.1\|WP_013152330.1\|1592871_1593591_+\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	gnl\|CDD\|378050	pfam08798, CRISPR_assoc, CRISPR associated protein. This domain forms an anti-parallel beta strand structure with flanking alpha helical regions.	4.44127e-77
NC_014210.1\|WP_013152340.1\|1600244_1600493_-\|DUF397-domain-containing-protein	gnl\|CDD\|377231	pfam04149, DUF397, Domain of unknown function (DUF397). The function of this family is unknown.	5.06004e-20
NC_014210.1\|WP_086000764.1\|1584012_1585803_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	1.7775e-77
NC_014210.1\|WP_013152323.1\|1582243_1584016_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	1.40908e-73
NC_014210.1\|WP_013152328.1\|1590959_1592147_+\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	gnl\|CDD\|378153	pfam09344, Cas_CT1975, CT1975-like protein. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family is represented by CT1975 of Chlorobium tepidum.	5.35801e-161
NC_014210.1\|WP_013152342.1\|1601583_1602147_+\|ATP-binding-protein	gnl\|CDD\|340413	cd16936, HATPase_RsbW-like, Histidine kinase-like ATPase domain of RsbW, an anti sigma-B factor and serine-protein kinase involved in regulating sigma-B during stress in Bacilli, and related domains. This family includes histidine kinase-like ATPase (HATPase) domain of RsbW, an anti sigma-B factor as well as a serine-protein kinase involved in regulating sigma-B during stress in Bacilli. The alternative sigma factor sigma-B is an important regulator of the general stress response of Bacillus cereus and B. subtilis. RsbW is an anti-sigma factor while RsbV is an anti-sigma factor antagonist (anti-anti-sigma factor). RsbW can also act as a kinase on RsbV. In a partner-switching mechanism, RsbW, RsbV, and sigma-B participate as follows: in non-stressed cells, sigma-B is present in an inactive form complexed with RsbW; in this form, sigma-B is unable to bind to RNA polymerase. Under stress, RsbV binds to RsbW, forming an RsbV-RsbW complex, and sigma-B is released to bind to RNA polymerase. RsbW may then act as a kinase on RsbV, phosphorylating a serine residue; RsbW is then released to bind to sigma-B, hence blocking its ability to bind RNA polymerase. A phosphatase then dephosphorylates RsbV so that it can again form a complex with RsbW, leading to the release of sigma-B.	2.65188e-09
NC_014210.1\|WP_013152341.1\|1600496_1601357_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|379262	pfam13560, HTH_31, Helix-turn-helix domain. This domain is a helix-turn-helix domain that probably binds to DNA.	7.40935e-09
NC_014210.1\|WP_013152331.1\|1593594_1594578_+\|type-I-E-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|274693	TIGR03638, cas1_ECOLI, CRISPR-associated endonuclease Cas1, subtype I-E/ECOLI. The CRISPR-associated protein Cas1 is virtually universal to CRISPR systems. CRISPR, an acronym for Clustered Regularly Interspaced Short Palindromic Repeats, is prokaryotic immunity system for foreign DNA, mostly from phage. CRISPR systems belong to different subtypes, distinguished by both nature of the repeats, the makeup of the cohort of associated Cas proteins, and by molecular phylogeny within the more universal Cas proteins such as this one. This model is of type EXCEPTION and provides more specific information than the EQUIVALOG model TIGR00287. It describes the Cas1 protein particular to the ECOLI subtype of CRISPR/Cas system.	6.12838e-114
NC_014210.1\|WP_041552460.1\|1586551_1587160_+\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	4.80606e-17
NC_014210.1\|WP_013152339.1\|1599308_1600181_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|379262	pfam13560, HTH_31, Helix-turn-helix domain. This domain is a helix-turn-helix domain that probably binds to DNA.	2.4137e-08
NC_014210.1\|WP_013152332.1\|1594574_1594925_+\|type-I-E-CRISPR-associated-endoribonuclease-Cas2	gnl\|CDD\|378244	pfam09707, Cas_Cas2CT1978, CRISPR-associated protein (Cas_Cas2CT1978). This entry represents a minor branch of the Cas2 family of CRISPR-associated protein which are found in IPR003799. Cas proteins are found adjacent to a characteristic short, palindromic repeat cluster termed CRISPR, a probable mobile DNA element.	4.87705e-44
NC_014210.1\|WP_013152335.1\|1597140_1598289_-\|methyltransferase-domain-containing-protein	gnl\|CDD\|275041	TIGR04188, conserved_hypothetical_protein, methyltransferase, ATP-grasp peptide maturase system. Members of this protein family are predicted SAM-dependent methyltransferases that regularly occur in the context of a putative peptide modification ATP-grasp enzyme (TIGR04187, related to enzymes of microviridin maturation) and a putative ribosomal peptide modification target (TIGR04186).	1.45919e-97

>NC_014210.1|WP_013152332.1|1594574_1594925_+|type-I-E-CRISPR-associated-endoribonuclease-Cas2
MTVVVLTNCPAGLRGFLTRWLMEISAGVFIGNPSRRIREALWAEVKEYAGNGRALLAYSDDSEQGFTFQTFERHWEPVDHEGLTLMHRPKKVQEENRRPPKSGWSKASKRRRFGGR
>NC_014210.1|WP_013152331.1|1593594_1594578_+|type-I-E-CRISPR-associated-endonuclease-Cas1
MGTVGRRRTSGPRELTRVGERLSFLYLERCVVHRDSNAITAEDGDGTRYLPSATIGTLLLGPGTNVTHSAMSLLGECGATVVWVGEHGVRYYAAGRALTRSSRLVEAQATAWANRRSRLDVARAMYRMRFPDLDVEALSRQALLGKEGDRVKACYREQAARTGVTWRGRRYVPGDHDVSDPPNKAITAAAQCFYGVAHAVTAALGCSPGLGFVHSGHERGFVMDVADLYKVEIGIPVAFDAAAQGDEDVDGVTRRLLRDRINEEGLLERCVRDIKALLLGEGSVGAQGEAEDAGESANDDVADTVGLVGDRGELLESGYSYADEVVW
>NC_014210.1|WP_013152330.1|1592871_1593591_+|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE
MYLTRFRFNTHRPGARKLLSSPQALHAAVMGSYADLLPSDTGGPRVLWRVDRNARAEVFLYVVGPNRPDLTHVVEQAGWPTDPANTWQTHEYSGFLKRLEAGQTWAFRLTANPVHSIRRKDGEPTKLTAHVTPRHQAGWLLQRQERCGFEIVRKDAEQQLLPGQDEHELVVHDRDARGFDKADPRPDRRGKRMKVPVVTATFDGRLTVTDPDALRRTLCAGLGRAKAYGCGLMTLAPVG
>NC_014210.1|WP_013152329.1|1592143_1592872_+|type-I-E-CRISPR-associated-protein-Cas5/CasD
MSAVSVLPLVLAGPLQAWGSASRFARRGTENAPTKSGVLGLLAAALGRDRTADLSDLAALRFGVRVDQPGIRVRDYQTAKHLDTDTSMPVSERFYLSDAVFVAAVEGPEGLVAELYRAVRDPVYLPYLGRRSCPPSRPVDLGEPVAGTVEEVLGDQPWQAAPWYWRRTGRRQDAQIPLTTLVDAAPGDGRADSLRDLPLSFDPAHRRYALRAVRSGSVDAPNPFARRRPVPDHDPMAALGGS
>NC_014210.1|WP_013152328.1|1590959_1592147_+|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC
MSRTILDVHVLQTVPPSNLNRDDTGAPKTAVYGGVRRSRVSSQAWKRATRLAFDALLDPRELGTRTKRVAELVASRIRDLDTSIEEAEALTLAAETVQVATGSRIEVPKRKADAAKKNGTKEPAPESAYLMFLSARQRDGLAALAVEGREDIKAFLKEKENKARAKAVADTRHSVDIALFGRMVADGADVNVDAAAQVAHALSVHAVENESDYYTAVDDRNPEEETGAGMIGTVEFNSATLYRYAAVDVDLLRRNLGEGLREDEPVTEPLRRAVEAFVRGFVESMPTGKVNTFGNHTLPDAVVVKLRGARPISFVGAFEEPVEAGAGHVAQASARLAEYVPQVERAFGAADDVDTWVVRVGERTAKLSGLGEEVTLPELVERVGAAVAQRQAPRA
>NC_014210.1|WP_041553074.1|1588503_1590147_+|type-I-E-CRISPR-associated-protein-Cse1/CasA
MTSRPWVPVQRLDGTEAELSLTGVFEQAARIRRLVGDVPTQDFALLRLLLAILHDAIDGPEDIEDWADLWDEGRGELPADRVRDYLGEHRDRLDLLHPTAPFLQVADLRTAKGEYSSLDPIVADVPNNARFFTMRAHGAESLGFAEAARWLLHAHAYDTSGIKSGVVGDPRVKGGKVYPQGVGWSGNLGGIHMEGDDLRATLLLNLLPRDTDNLRSRPDDRPAWRRAPATAEALGGAEAQTRPHGLRDLYTWQSRRVRLHHDGESVHGVLLAYGDPLTPRNKHDREPMTAWRRSPAQEKKLGEEQVYLPRDHDPARSAWRGLAALVTGRVRGAEQRREAAKIVRPRVLDWIARLTVEEYLDKGFLLRARLVGAVYGTQQSVIDEIVDDTVAMPVVLLHDQDRALGQTAVDAVNDAEEAVMVLGDLATALAEAAGAETEAPRAAARDRGFAELDEPFRKWLRDLRPSEDPLYPDEQRRVWQLRAHRIVSQLGAELMDTAGEAAWTGRVVATKNGSVWLTASRADLRFRSALRRALPLTNTDHSTEEEQ
>NC_014210.1|WP_041552460.1|1586551_1587160_+|class-I-SAM-dependent-methyltransferase
MFEPEGWDERYAGQERFWTGNPNPQLVAAATGLTPGTALDVGCGEGGDVVWLARQGWTVTGADFSANGLARAARRAEQAGVADRVEWWRVDARTIAADGRSYDLVTSHYLHAPDGGMVDVTRLLAHAVAPGGHLLVVGHTPSEEFAHMTEKQRRAMFLAEELLPGLPDDFEALVVEQRPRKLTREGTAVDAHDSTLFARRRR
>NC_014210.1|WP_126625053.1|1586243_1586438_+|hypothetical-protein
MRVHHRGTHPCDVVITGDGPAELGAGLTLCRAPVHPCTRAPVHPEPEAQAAEHVLGEHRHGSTP
>NC_014210.1|WP_086000764.1|1584012_1585803_-|ABC-transporter-ATP-binding-protein
MLPSLVRYSFSVAPGTATLTTALAVLAGAAPVGITIGIGGLVDGLTSAIGQGLDTPAARECYRWVALIVVLFLLTHIAESARTALGRALGRRVTGRLRERVMAAASEPTTIGHLEDPAYLDRIGRARGEGTIDMPPGAAVFGLSAKASLWVTGVGSAVLLTQVTWGLGLIVFAVFVVLHSRLVRNYRIAVIETANQTEKLRRTSYLRDVPTTPGAAREVRLFGLTAFFRDAYHSEWRVNMAEVWRRRREHRVFVVVIVVVTGLTVASVLYYLAYRAATGGTTVGDLALGGLALLALLQVLRTDEDDLRTSFGSKAAAEALAFPVVAPPGGPDTARWAEPVATVSCEGLRFRYGGAAGDVLHGIDLDIPAGQSLAVVGLNGAGKTTLARLLAGLDAPSGGRLRVGGTTVEDANRRSWQRQVVAVFQDFGRYELTVRDNIAFGSLAHADDEEGLREVARQAGLLEFVEGLPHGWDTVMSSGYTGGVDASGGEWQRIAIARALFGLRHGARLLIMDEPAASLDARAEARLYDTFHELTAGATTVAISHRFATVRKAERVVVLDQGRIVEDGRHEDLISAGGRYAELFHLQAKRFEEASS
>NC_014210.1|WP_013152323.1|1582243_1584016_-|ABC-transporter-ATP-binding-protein
MISALRFVLTTGYRTDRFRSLIVVAVALLEQATGIGLAVAIGLFSEVASGGSASGLVVLALCVAVFVMLTQGTFIAGYFTRLRLQEEIQNEVERRFIDVVGTTPTLEVHERSSRSDRAAVVRGARGEIGPGFDRLMWLAGAALALITSAALMASVVPVLALLPLFAVPAVLATRAADRKRGRAVERATPRTRLAGHLFTLATTAAPGRETRLFGLAGELRRRHREEWDAGGRDITRTDRLARVPVALAWLLFVLAYATAVALMVRAGLSGDAPLGLIVAAVAVSSQITGQVQSLLNLSFWSLESLRATRAFLDVVEEGTAERAALMPTTPVAVPARLESGIRVEGLGFRYWNRDQPALSGIDLELPAGTVVALVGENGAGKSTLVKMLSGLYQPGEGRVLVDGTDLARFAPEEWRARITAAFQDPVRIEMSLRDAVGLGRIEHRDDPERVIEALRTVGGDGLLASLPGGLDTRLGRGSWDGEGLSGGQWQTVANARAAMRRAPLLRIMDEPTASLDARAEERLFQQYADLGRQEGGVTVLVTHRFTTARAADLIVVLDGGRVVETGTHDTLSRAGGLYAELFRLQARYFV
>NC_014210.1|WP_013152333.1|1596037_1596442_-|hypothetical-protein
MPTTTPSTRPRPVAGTVALWALQVLLAVVFAVIAFPKAMGDPISVAPFELIGLGIPGMVVVGWLELAGAIALLVPRLCGLALLCQIPLMIGATALSAIVTPDLVAIPAVTLVLVCVAAWFRRHDTAALVRMVRR
>NC_014210.1|WP_126625054.1|1596686_1596920_-|hypothetical-protein
MMRKHGVSPTVTKALASARPEPGKKLPPRPSRLDACKPLIDAMPRAVLDALREQRHTCTRVFGPAPAPPDWNRRNGT
>NC_014210.1|WP_013152335.1|1597140_1598289_-|methyltransferase-domain-containing-protein
MLPQHEKLVSRLTQAGNLDQHWHGAFAAVERHRFLPGRITAPDGTTVDRDGDHDGDRERWLELAYDDIPVITQVDDGTGEGSGYPASSASQPSIVADMLHRLDVFPGMRVLEVGTGTGYNAGLLSHRLGGENVTTVEIDADLAEQARVRLLDAGFAAHVVTGDGTRGWPKRAPYDRVLSTAAVQRVPYAWVAQSRPGGRILTPWGTAFHNGALAELRVGPDGSARGHFAGDVAFMWVRDQRIPRRVVETHVRPEEQEFTRSRTGLHPYEPISDFSASFAIGLHMPTVLNRVEYTDEEQRFTVHLVDPGTGSWASWHVDPDRGETGYEVHQHGPRRLFSELEAAYTWWQEEGPPEHTRFGLTVSAERQNAWLDHEGRPVLTAP
>NC_014210.1|WP_013152336.1|1598288_1598426_-|hypothetical-protein
MRSTDLHAKHEDNSTHDGHKPDRPVPPPTPNDGGSGGGKHERDGK
>NC_014210.1|WP_013152337.1|1598576_1598780_+|hypothetical-protein
MKLTRIAGECNNRRTCPTVYASDRGTVVVQGYTLAAGDLTQITLPEGESAVEIPLSLLKEAARVHGD
>NC_014210.1|WP_013152338.1|1598763_1599312_+|hypothetical-protein
MFTETELEAFFDEHLTTSAFRLEALDHYEVDSDGDDFARFKAGEAEPDWERKNAWLEVLRAEREAGIREYRVRVLRTPLNDYLRYECEWGYVLNAEAGEEIHVLDLAECELPAEVVDHDFWLIDDKYPLRMHYGEAGEFIGAELVGSLDRYQKARDAALAAAEPFGRWWARHPEEWRANRPV
>NC_014210.1|WP_013152339.1|1599308_1600181_+|helix-turn-helix-domain-containing-protein
MTVPQNSPVGRGAEGRDRLARALREGRARAAISGVRAGRAAGMSQSKISKIERGLLLPSVDDVAALCRVYELPADKRAELLAQAEALREEASSRVIMARGVSQFQRRATRMEAAASLVRSFEPALVLGALQTREYARCVFDDPRDKVSEEEAAASVEARQERHRALTEGTTRYELIMPEGALRWQVGSASIMVDQVEEIAAIAARGGNAVVGLVPWTTPVHVFPGHAFDIYDEDAVVVATETATATLTGAADIATYVELFGELEKLACFGEEAGGHLERIAGEYRSLARR
>NC_014210.1|WP_013152340.1|1600244_1600493_-|DUF397-domain-containing-protein
MTYLKFRKSSYSGHDQNCVEVAHIPTGFRKSSYSGQEPNCVEVADLPCGTAVRDSKHPTHGHLPFPATEWDAFLTIARTGHP
>NC_014210.1|WP_013152341.1|1600496_1601357_-|helix-turn-helix-domain-containing-protein
MPTPYSPSIRRRRLSSELRRLRTEAGFTLAEAAKQAGLGRSNLGKMEQAESRTVPTAALDKLLDLYNVHETQTREAMHALAQDAKQRGWWSKYKGLFDDDRALPDFEAEASTIRTFEALCIPGLLQTPEYAHALFEGGRYTSLPAIERRVAFRMARREILTRVRPAHFRAVLDEAALRRVIGGPDVMHAQLMHLLHMAEMPHVDVQVIPFQDGSHAGLTAPFAILDFPDPRDSSIVYVGTIAGSVFFEQEDEVERYNVTYGDLQGSALSTKQSAALIKTAADSLRE
>NC_014210.1|WP_013152342.1|1601583_1602147_+|ATP-binding-protein
MPVTAPMPALPEVTVPLAELVPPRCRHYFTGRSDRAHYKMRRYDFGGSTQFMPLVRAFLDTCAAERDRDYRYLFTLLGSELANNALRHSRSGQPFGVYTLTCQRTRAGLRLTCRDQGSRDGRKAVLGQCCHLVPNPKGLDLAAESGRGLAMIDAFASSWGDNGICDYRQVWFFLAYDLTGSLWNTQQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_014210_10

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_014210_10

1602745-1603444

TypeI-E

I-E

Consensus_repeat	Method
GTGCTCCCCGCGCACGCGGGGATGGTCCC	PILER-CR
GTGCTCCCCGCGCACGCGGGGATGGTCCC	CRISPRCasFinder
GTGCTCCCCGCGCACGCGGGGATGGTCCC	CRT

11 spacers

The CRISPR arrays of NC_014210_10

>merge|NC_014210|10|1602745-1603444|PILER-CR,CRISPRCasFinder,CRT
GTGCTCCCCGCGCACGCGGGGATGGTCCCTGAGAAACCGCTCATGAACTGGAGAAACACATGTGCTCCCCGCGCACGCGGGGATGGTCCCCGGGGCCGTGGTGTTGGACGCCGCGGATGTGGGTGCTCCCCGCGCACGCGGGGATGGTCCCTCGGACGCGGGCGATGACTTCTTCTGCGTCTTGTGCTCCCCGCGCACGCGGGGATGGTCCCTCGTCGGCCTTGACCATCATCTGCACCCCGCGGTGCTCCCCGCGCACGCGGGGATGGTCCCCGGCCGCCGGGCCGCCGCGGTGGCCAGCTCCTGTGCTCCCCGCGCACGCGGGGATGGTCCCGAGGCGGCGCGCGCGGACCCGTCGTCGCTGTCGTGCTCCCCGCGCACGCGGGGATGGTCCCATCCCGCGTGGCGCTGCCCTCTACCTGCGCGGGTGCTCCCCGCGCACGCGGGGATAGTCCCTACTGGCGAACCTGCTGGAGGACCTGTCCGACGTGCTCCCCGCGCACGCGGGGATGGTCCCTGCGCGGCCGCCGCCTTGTTTGCCCACGTCCCGTGCTCCCCGCGCACGCGGGGATGGTCCCGGCAGTGGTGAGGGGCTCGCCCTTCAGGCCAAGTGCTCCCCGCGCACGCGGGGATGGTCCCCCTCCGTCCGTAGGTGGCCAACCACAGGAGCAGTGCTCCCCGCGCACACGGGGATAGGCCC

>NC_014210|10|4|1602745-1603383|PILER-CR
GTGCTCCCCGCGCACGCGGGGATGGTCCC	TGAGAAACCGCTCATGAACTGGAGAAACACAT
GTGCTCCCCGCGCACGCGGGGATGGTCCC	CGGGGCCGTGGTGTTGGACGCCGCGGATGTGG
GTGCTCCCCGCGCACGCGGGGATGGTCCC	TCGGACGCGGGCGATGACTTCTTCTGCGTCTT
GTGCTCCCCGCGCACGCGGGGATGGTCCC	TCGTCGGCCTTGACCATCATCTGCACCCCGCG
GTGCTCCCCGCGCACGCGGGGATGGTCCC	CGGCCGCCGGGCCGCCGCGGTGGCCAGCTCCT
GTGCTCCCCGCGCACGCGGGGATGGTCCC	GAGGCGGCGCGCGCGGACCCGTCGTCGCTGTC
GTGCTCCCCGCGCACGCGGGGATGGTCCC	ATCCCGCGTGGCGCTGCCCTCTACCTGCGCGG
GTGCTCCCCGCGCACGCGGGGATAGTCCC	TACTGGCGAACCTGCTGGAGGACCTGTCCGAC
GTGCTCCCCGCGCACGCGGGGATGGTCCC	TGCGCGGCCGCCGCCTTGTTTGCCCACGTCCC
GTGCTCCCCGCGCACGCGGGGATGGTCCC	GGCAGTGGTGAGGGGCTCGCCCTTCAGGCCAA
GTGCTCCCCGCGCACGCGGGGATGGTCCC

>NC_014210|10|10|1602745-1603444|CRISPRCasFinder
GTGCTCCCCGCGCACGCGGGGATGGTCCC	TGAGAAACCGCTCATGAACTGGAGAAACACAT
GTGCTCCCCGCGCACGCGGGGATGGTCCC	CGGGGCCGTGGTGTTGGACGCCGCGGATGTGG
GTGCTCCCCGCGCACGCGGGGATGGTCCC	TCGGACGCGGGCGATGACTTCTTCTGCGTCTT
GTGCTCCCCGCGCACGCGGGGATGGTCCC	TCGTCGGCCTTGACCATCATCTGCACCCCGCG
GTGCTCCCCGCGCACGCGGGGATGGTCCC	CGGCCGCCGGGCCGCCGCGGTGGCCAGCTCCT
GTGCTCCCCGCGCACGCGGGGATGGTCCC	GAGGCGGCGCGCGCGGACCCGTCGTCGCTGTC
GTGCTCCCCGCGCACGCGGGGATGGTCCC	ATCCCGCGTGGCGCTGCCCTCTACCTGCGCGG
GTGCTCCCCGCGCACGCGGGGATAGTCCC	TACTGGCGAACCTGCTGGAGGACCTGTCCGAC
GTGCTCCCCGCGCACGCGGGGATGGTCCC	TGCGCGGCCGCCGCCTTGTTTGCCCACGTCCC
GTGCTCCCCGCGCACGCGGGGATGGTCCC	GGCAGTGGTGAGGGGCTCGCCCTTCAGGCCAA
GTGCTCCCCGCGCACGCGGGGATGGTCCC	CCTCCGTCCGTAGGTGGCCAACCACAGGAGCA
GTGCTCCCCGCGCACACGGGGATAGGCCC

>NC_014210|10|4|1602745-1603444|CRT
GTGCTCCCCGCGCACGCGGGGATGGTCCC	TGAGAAACCGCTCATGAACTGGAGAAACACAT
GTGCTCCCCGCGCACGCGGGGATGGTCCC	CGGGGCCGTGGTGTTGGACGCCGCGGATGTGG
GTGCTCCCCGCGCACGCGGGGATGGTCCC	TCGGACGCGGGCGATGACTTCTTCTGCGTCTT
GTGCTCCCCGCGCACGCGGGGATGGTCCC	TCGTCGGCCTTGACCATCATCTGCACCCCGCG
GTGCTCCCCGCGCACGCGGGGATGGTCCC	CGGCCGCCGGGCCGCCGCGGTGGCCAGCTCCT
GTGCTCCCCGCGCACGCGGGGATGGTCCC	GAGGCGGCGCGCGCGGACCCGTCGTCGCTGTC
GTGCTCCCCGCGCACGCGGGGATGGTCCC	ATCCCGCGTGGCGCTGCCCTCTACCTGCGCGG
GTGCTCCCCGCGCACGCGGGGATAGTCCC	TACTGGCGAACCTGCTGGAGGACCTGTCCGAC
GTGCTCCCCGCGCACGCGGGGATGGTCCC	TGCGCGGCCGCCGCCTTGTTTGCCCACGTCCC
GTGCTCCCCGCGCACGCGGGGATGGTCCC	GGCAGTGGTGAGGGGCTCGCCCTTCAGGCCAA
GTGCTCCCCGCGCACGCGGGGATGGTCCC	CCTCCGTCCGTAGGTGGCCAACCACAGGAGCA
GTGCTCCCCGCGCACACGGGGATAGGCCC

Protein	Signature genes	Signature genes Name	Protein_function
NC_014210.1\|WP_013152342.1\|1601583_1602147_+\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|340413
NC_014210.1\|WP_013152340.1\|1600244_1600493_-\|DUF397-domain-containing-protein	unknown	unknown	gnl\|CDD\|377231
NC_014210.1\|WP_013152351.1\|1612608_1614453_+\|PQQ-binding-like-beta-propeller-repeat-protein	unknown	unknown	gnl\|CDD\|376764
NC_014210.1\|WP_013152346.1\|1608685_1609114_-\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197670
NC_014210.1\|WP_013152349.1\|1610695_1611559_-\|hypothetical-protein	unknown	unknown	unknown
NC_014210.1\|WP_013152337.1\|1598576_1598780_+\|hypothetical-protein	unknown	unknown	unknown
NC_014210.1\|WP_041553076.1\|1607522_1608155_-\|hypothetical-protein	unknown	unknown	unknown
NC_014210.1\|WP_013152341.1\|1600496_1601357_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|379262
NC_014210.1\|WP_126625134.1\|1615967_1617161_+\|methyltransferase,-FxLD-system	unknown	unknown	gnl\|CDD\|275158
NC_014210.1\|WP_013152352.1\|1614718_1615636_+\|PQQ-binding-like-beta-propeller-repeat-protein	unknown	unknown	gnl\|CDD\|379140
NC_014210.1\|WP_126625054.1\|1596686_1596920_-\|hypothetical-protein	unknown	unknown	unknown
NC_014210.1\|WP_013152333.1\|1596037_1596442_-\|hypothetical-protein	unknown	unknown	unknown
NC_014210.1\|WP_013152344.1\|1605351_1607178_-\|serine/threonine-protein-kinase	unknown	unknown	gnl\|CDD\|270916
NC_014210.1\|WP_013152338.1\|1598763_1599312_+\|hypothetical-protein	unknown	unknown	unknown
NC_014210.1\|WP_013152350.1\|1611633_1612035_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377188
NC_014210.1\|WP_081461704.1\|1603475_1605359_-\|serine/threonine-protein-kinase	unknown	unknown	gnl\|CDD\|270916
NC_014210.1\|WP_013152336.1\|1598288_1598426_-\|hypothetical-protein	unknown	unknown	unknown
NC_014210.1\|WP_013152347.1\|1609206_1609938_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187620
NC_014210.1\|WP_013152339.1\|1599308_1600181_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|379262
NC_014210.1\|WP_013152335.1\|1597140_1598289_-\|methyltransferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|275041

Protein	Function_ID	Function_description	E-value
NC_014210.1\|WP_013152342.1\|1601583_1602147_+\|ATP-binding-protein	gnl\|CDD\|340413	cd16936, HATPase_RsbW-like, Histidine kinase-like ATPase domain of RsbW, an anti sigma-B factor and serine-protein kinase involved in regulating sigma-B during stress in Bacilli, and related domains. This family includes histidine kinase-like ATPase (HATPase) domain of RsbW, an anti sigma-B factor as well as a serine-protein kinase involved in regulating sigma-B during stress in Bacilli. The alternative sigma factor sigma-B is an important regulator of the general stress response of Bacillus cereus and B. subtilis. RsbW is an anti-sigma factor while RsbV is an anti-sigma factor antagonist (anti-anti-sigma factor). RsbW can also act as a kinase on RsbV. In a partner-switching mechanism, RsbW, RsbV, and sigma-B participate as follows: in non-stressed cells, sigma-B is present in an inactive form complexed with RsbW; in this form, sigma-B is unable to bind to RNA polymerase. Under stress, RsbV binds to RsbW, forming an RsbV-RsbW complex, and sigma-B is released to bind to RNA polymerase. RsbW may then act as a kinase on RsbV, phosphorylating a serine residue; RsbW is then released to bind to sigma-B, hence blocking its ability to bind RNA polymerase. A phosphatase then dephosphorylates RsbV so that it can again form a complex with RsbW, leading to the release of sigma-B.	2.65188e-09
NC_014210.1\|WP_013152351.1\|1612608_1614453_+\|PQQ-binding-like-beta-propeller-repeat-protein	gnl\|CDD\|376764	pfam02322, Cyt_bd_oxida_II, Cytochrome bd terminal oxidase subunit II. This family consists of cytochrome bd type terminal oxidases that catalyze quinol-dependent, Na+-independent oxygen uptake. Members of this family are integral membrane proteins and contain a protohaem IX centre B558. One member of the family, Klebsiella pneumoniae CydB, is implicated in having an important role in micro-aerobic nitrogen fixation in the enteric bacterium Klebsiella pneumoniae. The family forms an integral functional unit with subunit I, family Bac_Ubq_Cox, pfam01654.	1.54971e-06
NC_014210.1\|WP_013152346.1\|1608685_1609114_-\|MarR-family-transcriptional-regulator	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	8.92733e-22
NC_014210.1\|WP_013152341.1\|1600496_1601357_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|379262	pfam13560, HTH_31, Helix-turn-helix domain. This domain is a helix-turn-helix domain that probably binds to DNA.	7.40935e-09
NC_014210.1\|WP_126625134.1\|1615967_1617161_+\|methyltransferase,-FxLD-system	gnl\|CDD\|275158	TIGR04364, methyltran_FxLD, methyltransferase, FxLD system. Members of this family resemble occur regularly in the vicinity of lantibiotic biosynthesis enzymes and their probable target, the FxLD family of putative ribosomal natural product precursor (TIGR04363). Members resemble protein-L-isoaspartate O-methyltransferase (TIGR00080) and a predicted methyltranserase, TIGR04188, of another putative peptide modification system.	1.08547e-121
NC_014210.1\|WP_013152352.1\|1614718_1615636_+\|PQQ-binding-like-beta-propeller-repeat-protein	gnl\|CDD\|379140	pfam13360, PQQ_2, PQQ-like domain. This domain contains several repeats of the PQQ repeat.	7.18878e-06
NC_014210.1\|WP_013152344.1\|1605351_1607178_-\|serine/threonine-protein-kinase	gnl\|CDD\|270916	cd14014, STKc_PknB_like, Catalytic domain of bacterial Serine/Threonine kinases, PknB and similar proteins. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This subfamily includes many bacterial eukaryotic-type STKs including Staphylococcus aureus PknB (also called PrkC or Stk1), Bacillus subtilis PrkC, and Mycobacterium tuberculosis Pkn proteins (PknB, PknD, PknE, PknF, PknL, and PknH), among others. S. aureus PknB is the only eukaryotic-type STK present in this species, although many microorganisms encode for several such proteins. It is important for the survival and pathogenesis of S. aureus as it is involved in the regulation of purine and pyrimidine biosynthesis, cell wall metabolism, autolysis, virulence, and antibiotic resistance. M. tuberculosis PknB is essential for growth and it acts on diverse substrates including proteins involved in peptidoglycan synthesis, cell division, transcription, stress responses, and metabolic regulation. B. subtilis PrkC is located at the inner membrane of endospores and functions to trigger spore germination. Bacterial STKs in this subfamily show varied domain architectures. The well-characterized members such as S. aureus and M. tuberculosis PknB, and B. subtilis PrkC, contain an N-terminal cytosolic kinase domain, a transmembrane (TM) segment, and mutliple C-terminal extracellular PASTA domains. The PknB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.	1.75313e-86
NC_014210.1\|WP_013152350.1\|1611633_1612035_-\|hypothetical-protein	gnl\|CDD\|377188	pfam03995, Inhibitor_I36, Peptidase inhibitor family I36. This domain is currently only found in a small set of S. coelicolor secreted proteins. There are four conserved cysteines that probably form two disulphide bonds. Proteins 2SCK31.15C and SCO3675 also have probable beta-propellers at their C-termini. This family includes Streptomyces nigrescens SmpI, a known peptidase inhibitor of known structure. This protein has a crystallin like fold pfam00030 and is distantly related by sequence. It is not known whether other members of this family are peptidase inhibitors.	0.00159456
NC_014210.1\|WP_081461704.1\|1603475_1605359_-\|serine/threonine-protein-kinase	gnl\|CDD\|270916	cd14014, STKc_PknB_like, Catalytic domain of bacterial Serine/Threonine kinases, PknB and similar proteins. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This subfamily includes many bacterial eukaryotic-type STKs including Staphylococcus aureus PknB (also called PrkC or Stk1), Bacillus subtilis PrkC, and Mycobacterium tuberculosis Pkn proteins (PknB, PknD, PknE, PknF, PknL, and PknH), among others. S. aureus PknB is the only eukaryotic-type STK present in this species, although many microorganisms encode for several such proteins. It is important for the survival and pathogenesis of S. aureus as it is involved in the regulation of purine and pyrimidine biosynthesis, cell wall metabolism, autolysis, virulence, and antibiotic resistance. M. tuberculosis PknB is essential for growth and it acts on diverse substrates including proteins involved in peptidoglycan synthesis, cell division, transcription, stress responses, and metabolic regulation. B. subtilis PrkC is located at the inner membrane of endospores and functions to trigger spore germination. Bacterial STKs in this subfamily show varied domain architectures. The well-characterized members such as S. aureus and M. tuberculosis PknB, and B. subtilis PrkC, contain an N-terminal cytosolic kinase domain, a transmembrane (TM) segment, and mutliple C-terminal extracellular PASTA domains. The PknB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.	4.47554e-85
NC_014210.1\|WP_013152339.1\|1599308_1600181_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|379262	pfam13560, HTH_31, Helix-turn-helix domain. This domain is a helix-turn-helix domain that probably binds to DNA.	2.4137e-08
NC_014210.1\|WP_013152347.1\|1609206_1609938_+\|SDR-family-oxidoreductase	gnl\|CDD\|187620	cd05362, THN_reductase-like_SDR_c, tetrahydroxynaphthalene/trihydroxynaphthalene reductase-like, classical (c) SDRs. 1,3,6,8-tetrahydroxynaphthalene reductase (4HNR) of Magnaporthe grisea and the related 1,3,8-trihydroxynaphthalene reductase (3HNR) are typical members of the SDR family containing the canonical glycine rich NAD(P)-binding site and active site tetrad, and function in fungal melanin biosynthesis. This subgroup also includes an SDR from Norway spruce that may function to protect against both biotic and abitoic stress. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	3.00737e-84
NC_014210.1\|WP_013152340.1\|1600244_1600493_-\|DUF397-domain-containing-protein	gnl\|CDD\|377231	pfam04149, DUF397, Domain of unknown function (DUF397). The function of this family is unknown.	5.06004e-20
NC_014210.1\|WP_013152335.1\|1597140_1598289_-\|methyltransferase-domain-containing-protein	gnl\|CDD\|275041	TIGR04188, conserved_hypothetical_protein, methyltransferase, ATP-grasp peptide maturase system. Members of this protein family are predicted SAM-dependent methyltransferases that regularly occur in the context of a putative peptide modification ATP-grasp enzyme (TIGR04187, related to enzymes of microviridin maturation) and a putative ribosomal peptide modification target (TIGR04186).	1.45919e-97

>NC_014210.1|WP_013152342.1|1601583_1602147_+|ATP-binding-protein
MPVTAPMPALPEVTVPLAELVPPRCRHYFTGRSDRAHYKMRRYDFGGSTQFMPLVRAFLDTCAAERDRDYRYLFTLLGSELANNALRHSRSGQPFGVYTLTCQRTRAGLRLTCRDQGSRDGRKAVLGQCCHLVPNPKGLDLAAESGRGLAMIDAFASSWGDNGICDYRQVWFFLAYDLTGSLWNTQQ
>NC_014210.1|WP_013152341.1|1600496_1601357_-|helix-turn-helix-domain-containing-protein
MPTPYSPSIRRRRLSSELRRLRTEAGFTLAEAAKQAGLGRSNLGKMEQAESRTVPTAALDKLLDLYNVHETQTREAMHALAQDAKQRGWWSKYKGLFDDDRALPDFEAEASTIRTFEALCIPGLLQTPEYAHALFEGGRYTSLPAIERRVAFRMARREILTRVRPAHFRAVLDEAALRRVIGGPDVMHAQLMHLLHMAEMPHVDVQVIPFQDGSHAGLTAPFAILDFPDPRDSSIVYVGTIAGSVFFEQEDEVERYNVTYGDLQGSALSTKQSAALIKTAADSLRE
>NC_014210.1|WP_013152340.1|1600244_1600493_-|DUF397-domain-containing-protein
MTYLKFRKSSYSGHDQNCVEVAHIPTGFRKSSYSGQEPNCVEVADLPCGTAVRDSKHPTHGHLPFPATEWDAFLTIARTGHP
>NC_014210.1|WP_013152339.1|1599308_1600181_+|helix-turn-helix-domain-containing-protein
MTVPQNSPVGRGAEGRDRLARALREGRARAAISGVRAGRAAGMSQSKISKIERGLLLPSVDDVAALCRVYELPADKRAELLAQAEALREEASSRVIMARGVSQFQRRATRMEAAASLVRSFEPALVLGALQTREYARCVFDDPRDKVSEEEAAASVEARQERHRALTEGTTRYELIMPEGALRWQVGSASIMVDQVEEIAAIAARGGNAVVGLVPWTTPVHVFPGHAFDIYDEDAVVVATETATATLTGAADIATYVELFGELEKLACFGEEAGGHLERIAGEYRSLARR
>NC_014210.1|WP_013152338.1|1598763_1599312_+|hypothetical-protein
MFTETELEAFFDEHLTTSAFRLEALDHYEVDSDGDDFARFKAGEAEPDWERKNAWLEVLRAEREAGIREYRVRVLRTPLNDYLRYECEWGYVLNAEAGEEIHVLDLAECELPAEVVDHDFWLIDDKYPLRMHYGEAGEFIGAELVGSLDRYQKARDAALAAAEPFGRWWARHPEEWRANRPV
>NC_014210.1|WP_013152337.1|1598576_1598780_+|hypothetical-protein
MKLTRIAGECNNRRTCPTVYASDRGTVVVQGYTLAAGDLTQITLPEGESAVEIPLSLLKEAARVHGD
>NC_014210.1|WP_013152336.1|1598288_1598426_-|hypothetical-protein
MRSTDLHAKHEDNSTHDGHKPDRPVPPPTPNDGGSGGGKHERDGK
>NC_014210.1|WP_013152335.1|1597140_1598289_-|methyltransferase-domain-containing-protein
MLPQHEKLVSRLTQAGNLDQHWHGAFAAVERHRFLPGRITAPDGTTVDRDGDHDGDRERWLELAYDDIPVITQVDDGTGEGSGYPASSASQPSIVADMLHRLDVFPGMRVLEVGTGTGYNAGLLSHRLGGENVTTVEIDADLAEQARVRLLDAGFAAHVVTGDGTRGWPKRAPYDRVLSTAAVQRVPYAWVAQSRPGGRILTPWGTAFHNGALAELRVGPDGSARGHFAGDVAFMWVRDQRIPRRVVETHVRPEEQEFTRSRTGLHPYEPISDFSASFAIGLHMPTVLNRVEYTDEEQRFTVHLVDPGTGSWASWHVDPDRGETGYEVHQHGPRRLFSELEAAYTWWQEEGPPEHTRFGLTVSAERQNAWLDHEGRPVLTAP
>NC_014210.1|WP_126625054.1|1596686_1596920_-|hypothetical-protein
MMRKHGVSPTVTKALASARPEPGKKLPPRPSRLDACKPLIDAMPRAVLDALREQRHTCTRVFGPAPAPPDWNRRNGT
>NC_014210.1|WP_013152333.1|1596037_1596442_-|hypothetical-protein
MPTTTPSTRPRPVAGTVALWALQVLLAVVFAVIAFPKAMGDPISVAPFELIGLGIPGMVVVGWLELAGAIALLVPRLCGLALLCQIPLMIGATALSAIVTPDLVAIPAVTLVLVCVAAWFRRHDTAALVRMVRR
>NC_014210.1|WP_081461704.1|1603475_1605359_-|serine/threonine-protein-kinase
MSEHRGHGPGPGSGSGDGPHPRDGRPTGSGPAPGSGPRPETGRAPGTGPETAPGSTPSSGPGSGPGSGPGSRSGPGPGTRPGFAPLRPDDPETLGGFRIVGRVGTGGMGTVYAGLRLRPGGRARSGYAAVKVIREELTEDPDFRARFTREIRLLSRVRSRSVPEFLGSGQDAHGPWLVTEFVPGLSLSAHVRQHGPLPPNLLLGLAAGVAEALNAVHTAGIVHRDLKPGNVMLAPEGPKVLDFGIARAVDETALTRTGSLVGTPGWIAPEVLRGAPAAPPADLFAWGALMAYAATGRAPFGSGSTDSLPSQMLDQPPDLAGVPGPLLPLVTAALNPDPRQRPTAAQAARALVALGQGQGREQGQGAGRQKQGVPLDGSGLSNAVGALLDREWRGVRAVRPPAPPRRVPKALVVASAAVLLLGTVGGGFLAAQVLSPDGGESEGTGEGTAAEGTEEGSGAGGPQEVRGSGEEGTEGPDTEWVMPEPTPFGTNAEWLAEVITSPNGMPTFQATPDSYETLFHLSVSSVEEVPEGVRFTVLVGNLVEGHSASVPELFTVPTPEGPIEPEEAPGPVSVGDRLVLTFPGAPERGPLTFGDPDFVPGVSGIPPVSQCYDAAAGSASVDYDSCP
>NC_014210.1|WP_013152344.1|1605351_1607178_-|serine/threonine-protein-kinase
MTSPEPPSRPSRSSQTFQPLRPRDPGSVGRYRTVGRLGAGGMGTVYAGRDPSGGLVAIKLVHGDLSADPDFRARFRREADLVRRVSSPCVPRFLDSDTDAAQPWLATEYVAGPTLRQHVREHGPLTGTNLRAFATGVSEALRAIHTAGIVHRDLKPGNVVLAADGPKVLDFGIARALAETAITRTGGLFGTPGWVAPELLRGGQPSPAADVFAWGALVAFAATGRNPFGTGSAETVAVRVLDGRPDLAGVPDDLLPLVTAATGSDPARRPTVEQALSELLGARLTGTGGTSPAEEATALVTRVLRDGWEAPPPPTTTTPPRSLDPSPGTGQPLDRSAAREPGKRRWTLVAAAAAAVLLVAGGGWFVGVRFGPGGTGPGADRTDAAGGTEGSGSGSGENGDGPGEGSGGVSNAGAGGEIAVEISGNGLFTVHADGSGGLGITPGFDGASPALPEDVERAEYAVATVRVETVYSDTAAQTGIMVFGEVEYVADTGEFTLRSGDITLLEVGEGLDPLPRDPTADGRPAHVAVPDEVLATVSRETPGAEFEVRFPEAPESGLLAYLPAPTALGGNADTARGAYACYMNWHPYPPVDMTDEEFVPCPEERPNE
>NC_014210.1|WP_041553076.1|1607522_1608155_-|hypothetical-protein
MDGKELRPRARWYWIGGLTIPIGALASFLVFLSLLLSATAEPEFIAEFEGGSSATFQVEEGQEGHWGLYVEGDANRFACELDTPAGPGSGNDNLDTAPHSYSGTAYDSWRLTAELSTPEPGEYVLRCDDIHSGTYGIGTLEQTASSEAKLVTGTLVLVVLGPLSFIAGVVVLIVTGVRRASHRTRLVRERMQTFGAPQPAGPGPQPGPIS
>NC_014210.1|WP_013152346.1|1608685_1609114_-|MarR-family-transcriptional-regulator
MTSHALAAAVTTLHREAAALYALLGREFGLTAQQAQLLCVLTSDRPSFSELATTLGCDRTNVTGMIDRLEKRGLLARERDSEDRRVNRVTATQEGEQLIVRLRERFAESVADRFSRLTPEEHDRLAALATALTPATAPNSKH
>NC_014210.1|WP_013152347.1|1609206_1609938_+|SDR-family-oxidoreductase
MNSKVAVVTGASRGIGRAVAERLGADGARVIVNYHSDAVAAKDAVAAVERAGGRATAVRADVRDATQLSSLVEAAVAEYGGLDVLVSNTGMARPTSLADATDEDLELHLAINTRPVFRALKETALHMRHGGRVVVISSGSTVVAHPGAGLYAASKAAAEQLARTAAHELGPRGITVNSVLPGATRTEALQAQMPADVAASIRSQTPLGRLGEPADIASVVAFLVSDEGAWINGQTIHASGGLF
>NC_014210.1|WP_013152349.1|1610695_1611559_-|hypothetical-protein
MNRRRLPGAAAALGLVLGLAACGARGDDGNGFLAEEEQARALSLPFDEHTLSPFEMRTLRYAEDLLVRECMRENGMDWRVVPAPEEEGIDSAHRRRYGVIETGVAELYGYQAPPASEHEERVERVREERQSLPVTEYRAAHGDESGTGCLRQAQQEMSAEVPATDDSLLNSYISTGFDTSLRDPAVVDAFAAWSACMADRGFAYSTPTEASQDPRWQDNVASAEETAVASADVACKETASVVRVWHGAEAAAQNDLIEEHAGDFALFAQAKKVRMDRARALVERLAP
>NC_014210.1|WP_013152350.1|1611633_1612035_-|hypothetical-protein
MSSKRRMFAIVGALGSITLAGVLGTASTASAASIPAVEAQATYIYLYEHDDYAGGSFRTSGHVYNLQGRCWSGSGCRDVNDNASSMKNRKPNDASFYAHANGEGPSYYAQANSVDSDLTNNGFDNRISSIRIW
>NC_014210.1|WP_013152351.1|1612608_1614453_+|PQQ-binding-like-beta-propeller-repeat-protein
MRRRVGDVLGWSGVTVLVGALILTTPHVSNFSERAAPGSQGPALLVGLTLLLAAAVLGWVSLTATRDPDRLAARPTLGSALGRGAVVLVVLAVVWAAFPTRHLAAIVDNDGYRMFSDHVLALWVGVCLVALGTALALGAATALPWHRWKRVLTGAAAGTLVVALVWTLVPAALTRAFMVEHTVAAADGGQAAPVPATISRVGWTWEPEHPVLDPVLGVERGPRGPLVLYDDGFVALDGATGEELWTYRLPFSRQAQAGVFAGQDRYAYLSHVTEATPESEPQTHAMVVLDAATGEVVRETPMPALTWQGQEKSPPLRYLTPDVRVFRVHEDGRSLVVAYATDSTERLWEVELREGAGERWCQWADDGGIRGHGDRVLVARLCLDQEHLPEEDVESTLYRMDVPEDAVESVTALDVSTGERVWRQEWTPDNLSYTQVPIIGAVREGRGGEAVARTPGGAFAVDDGASAQVFPPAPDPMYEYAVGVDTRGAVVLRDRGGDEPGLLLVTDASGEVVQRSEVEVDADLWAPVNQARVLESVLVVPHLAWDDADRRVLTVSVLPWEGEAAQQGWTQILLEDGEGPVEAPDLLGVGDYGVLPVPGAVVSHVEDRLYGLVP
>NC_014210.1|WP_013152352.1|1614718_1615636_+|PQQ-binding-like-beta-propeller-repeat-protein
MRIPLRSAAAAAVVVAASACTVAPGPGEPAPDNAVVRLQEAGYVPVTSGISPREHLLCTPDGERAPACTEQGQVRWSLPLEGEYRLTGSLTLHHLDTGARPRDSSNPFKAVDAGENGVLYAENALLRMVDADTGELLWTTDLRERSDIDFLHSGLWSLHADDDRIVLRFGGGFVQVDAADGSVSSVAPRAECAGDLVAINGNEAVLEHCGGQEGFYLALDLSTGEVLWEFRRADPEEMAGDLLRTGTSWVWVSDVDDGPATAVETSGGSLGPAGLGTIGLNQIGDIAVACLVPGSLEARNQRFGI
>NC_014210.1|WP_126625134.1|1615967_1617161_+|methyltransferase,-FxLD-system
MIIRLRAVNALHSEPVTRAVRTVPRHAFAPEFPLEEVYDPETVLRTRFADDGTATSSVSATWVQTLMLERARLRPGMRVLEVGSGGYNAALAAEVVGPAGSVTSLDIDPAVIDRARTHLTQAGYADRVELVVGDAEHGHPSSAPYDRIIVTAAATDLPPTWTHQLVDGGRLVLPLGVRGFQRVYAFTRHGALLLGETGNHAGFVPMQGLGASASTTVPVTDTVELTTDADPTPAPEALSAVFALPAQEQFTGVRIAGMEPFSALQMWMATGLPHFATLTGTADDFRYRPMTHALIPAMWDGTSLAYLLLPAVPDASATYEFVACGHGPDAADVVATMADHVRRWDRDHRGGPGPRFLAHPDFPPGDGIIRTRHTRLLALWDQAEEDHGLDWPADPGR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_014210_11

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_014210_11

1638344-1638676

Orphan

I-E

Consensus_repeat	Method
GTGCTCCCCGCGCACGCGGGGATGGTCCC	PILER-CR
GTGCTCCCCGCGCACGCGGGGATGGTCCC	CRISPRCasFinder
GTGCTCCCCGCGCACGCGGGGATGGTCCC	CRT

5 spacers

The CRISPR arrays of NC_014210_11

>merge|NC_014210|11|1638344-1638676|PILER-CR,CRISPRCasFinder,CRT
GTGCTCCCCGCGCACGCGGGGATGGTCCCTACGCATCCACGGCAAGCCGCCGCTGCGCGAAGTGCTCCCCGCGCACGCGGGGATGGTCCCCGCCGTCGGTCTTCTCAGTCAGGTCCGCGTAGGTGCTCCCCGCGCACGCGGGGATGGTCCCAGCTGTCCGTGGCCAGTGTCGGTTCCGGGCGGTGCTCCCCGCGCACGCGGGGATGGTCCCTTCTTGGCGTTCATCGCTTCAGCTCCGGCAGGGTGCTCCCCGCGCACGCGGGGATGGTCCCAGGGTGAGCGGGTCCACGGCGCCGGTGACGATGTGCTCCCCGCGCACGCGGGGATGGCCCC

>NC_014210|11|5|1638344-1638676|PILER-CR
GTGCTCCCCGCGCACGCGGGGATGGTCCC	TACGCATCCACGGCAAGCCGCCGCTGCGCGAA
GTGCTCCCCGCGCACGCGGGGATGGTCCC	CGCCGTCGGTCTTCTCAGTCAGGTCCGCGTAG
GTGCTCCCCGCGCACGCGGGGATGGTCCC	AGCTGTCCGTGGCCAGTGTCGGTTCCGGGCG
GTGCTCCCCGCGCACGCGGGGATGGTCCC	TTCTTGGCGTTCATCGCTTCAGCTCCGGCAGG
GTGCTCCCCGCGCACGCGGGGATGGTCCC	AGGGTGAGCGGGTCCACGGCGCCGGTGACGAT
GTGCTCCCCGCGCACGCGGGGATGGCCCC

>NC_014210|11|11|1638344-1638676|CRISPRCasFinder
GTGCTCCCCGCGCACGCGGGGATGGTCCC	TACGCATCCACGGCAAGCCGCCGCTGCGCGAA
GTGCTCCCCGCGCACGCGGGGATGGTCCC	CGCCGTCGGTCTTCTCAGTCAGGTCCGCGTAG
GTGCTCCCCGCGCACGCGGGGATGGTCCC	AGCTGTCCGTGGCCAGTGTCGGTTCCGGGCG
GTGCTCCCCGCGCACGCGGGGATGGTCCC	TTCTTGGCGTTCATCGCTTCAGCTCCGGCAGG
GTGCTCCCCGCGCACGCGGGGATGGTCCC	AGGGTGAGCGGGTCCACGGCGCCGGTGACGAT
GTGCTCCCCGCGCACGCGGGGATGGCCCC

>NC_014210|11|5|1638344-1638676|CRT
GTGCTCCCCGCGCACGCGGGGATGGTCCC	TACGCATCCACGGCAAGCCGCCGCTGCGCGAA
GTGCTCCCCGCGCACGCGGGGATGGTCCC	CGCCGTCGGTCTTCTCAGTCAGGTCCGCGTAG
GTGCTCCCCGCGCACGCGGGGATGGTCCC	AGCTGTCCGTGGCCAGTGTCGGTTCCGGGCG
GTGCTCCCCGCGCACGCGGGGATGGTCCC	TTCTTGGCGTTCATCGCTTCAGCTCCGGCAGG
GTGCTCCCCGCGCACGCGGGGATGGTCCC	AGGGTGAGCGGGTCCACGGCGCCGGTGACGAT
GTGCTCCCCGCGCACGCGGGGATGGCCCC

Protein	Signature genes	Signature genes Name	Protein_function
NC_014210.1\|WP_013152372.1\|1638698_1639538_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|375319
NC_014210.1\|WP_013152366.1\|1633118_1633715_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|366102
NC_014210.1\|WP_013152382.1\|1651177_1651795_-\|hypothetical-protein	unknown	unknown	unknown
NC_014210.1\|WP_013152363.1\|1628914_1630294_-\|UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D--alanine-ligase	unknown	unknown	gnl\|CDD\|223841
NC_014210.1\|WP_013152380.1\|1649521_1650511_+\|L-carnitine-dehydrogenase	unknown	unknown	gnl\|CDD\|168796
NC_014210.1\|WP_013152369.1\|1636277_1637036_+\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|369777
NC_014210.1\|WP_013152365.1\|1632206_1632992_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|180604
NC_014210.1\|WP_013152375.1\|1642448_1643630_+\|DUF2236-domain-containing-protein	unknown	unknown	gnl\|CDD\|378343
NC_014210.1\|WP_013152362.1\|1628262_1628913_+\|peptidase	unknown	unknown	gnl\|CDD\|379241
NC_014210.1\|WP_013152370.1\|1637410_1637737_+\|hypothetical-protein	unknown	unknown	unknown
NC_014210.1\|WP_013152379.1\|1648581_1649481_+\|3-keto-5-aminohexanoate-cleavage-protein	unknown	unknown	gnl\|CDD\|377562
NC_014210.1\|WP_013152368.1\|1635175_1636063_+\|chitinase	unknown	unknown	gnl\|CDD\|381595
NC_014210.1\|WP_041553081.1\|1634118_1634559_+\|hypothetical-protein	unknown	unknown	unknown
NC_014210.1\|WP_041552485.1\|1647489_1648428_+\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|379409
NC_014210.1\|WP_013152376.1\|1643731_1645192_+\|aldehyde-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|143456
NC_014210.1\|WP_013152364.1\|1630491_1631409_-\|phosphotransferase	unknown	unknown	gnl\|CDD\|270704
NC_014210.1\|WP_013152381.1\|1650507_1650960_+\|4-hydroxybenzoyl-CoA-thioesterase	unknown	unknown	gnl\|CDD\|236044
NC_014210.1\|WP_013152373.1\|1639918_1640866_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|235627
NC_014210.1\|WP_126625057.1\|1628032_1628266_+\|pyridoxal-phosphate-dependent-enzyme	unknown	unknown	gnl\|CDD\|107205
NC_014210.1\|WP_013152374.1\|1640999_1642313_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340913

Protein	Function_ID	Function_description	E-value
NC_014210.1\|WP_013152372.1\|1638698_1639538_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|375319	pfam17765, MLTR_LBD, MmyB-like transcription regulator ligand binding domain. This domain is found in a family of actinobacterial transcription factors. The structure shows it has a PAS domain like fold and it is bound to Myristic acid.	1.85214e-37
NC_014210.1\|WP_013152366.1\|1633118_1633715_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|366102	pfam00440, TetR_N, Bacterial regulatory proteins, tetR family.	1.72829e-09
NC_014210.1\|WP_013152363.1\|1628914_1630294_-\|UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D--alanine-ligase	gnl\|CDD\|223841	COG0770, MurF, UDP-N-acetylmuramyl pentapeptide synthase [Cell envelope biogenesis, outer membrane].	6.98463e-137
NC_014210.1\|WP_013152380.1\|1649521_1650511_+\|L-carnitine-dehydrogenase	gnl\|CDD\|168796	PRK07066, PRK07066, L-carnitine dehydrogenase.	2.22356e-111
NC_014210.1\|WP_013152369.1\|1636277_1637036_+\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|369777	pfam08241, Methyltransf_11, Methyltransferase domain. Members of this family are SAM dependent methyltransferases.	7.10981e-30
NC_014210.1\|WP_013152365.1\|1632206_1632992_-\|SDR-family-oxidoreductase	gnl\|CDD\|180604	PRK06523, PRK06523, short chain dehydrogenase; Provisional.	5.1771e-73
NC_014210.1\|WP_013152375.1\|1642448_1643630_+\|DUF2236-domain-containing-protein	gnl\|CDD\|378343	pfam09995, DUF2236, Uncharacterized protein conserved in bacteria (DUF2236). This domain, found in various hypothetical bacterial proteins, has no known function. This family contains a highly conserved arginine and histidine that may be active site residues for an as yet unknown catalytic activity.	1.6011e-10
NC_014210.1\|WP_013152362.1\|1628262_1628913_+\|peptidase	gnl\|CDD\|379241	pfam13529, Peptidase_C39_2, Peptidase_C39 like family.	0.000515176
NC_014210.1\|WP_013152379.1\|1648581_1649481_+\|3-keto-5-aminohexanoate-cleavage-protein	gnl\|CDD\|377562	pfam05853, BKACE, beta-keto acid cleavage enzyme. BKACE, beta-keto acid cleavage enzyme plays, a role in lysine degradation. In certain instances it catalyzes the conversion of 3-keto-5-aminohexanoate and acetyl-CoA into acetoacetate and 3-aminobutyryl-CoA. The family is found to have at least 14 slightly different potential new enzymatic activities, all of which can therefore be designated as beta-keto acid cleavage enzymes.	9.56533e-128
NC_014210.1\|WP_013152368.1\|1635175_1636063_+\|chitinase	gnl\|CDD\|381595	cd00325, chitinase_GH19, Glycoside hydrolase family 19, chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Glycoside hydrolase family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases, but they are smaller in size due to certain deletions. Despite lacking any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the prokaryotic/eukaryotic divergence.	3.47312e-82
NC_014210.1\|WP_041552485.1\|1647489_1648428_+\|TetR-family-transcriptional-regulator	gnl\|CDD\|379409	pfam13977, TetR_C_6, BetI-type transcriptional repressor, C-terminal. This family comprises the C-terminal portion of proteins that belong to the TetR family of transcriptional regulators. The C-terminus represents the regulatory region, and does not include the DNA binding helix-turn-helix domain. The target proteins that are repressed are involved in the transcriptional control of multi-drug efflux pumps, pathways for the biosynthesis of antibiotics, response to osmotic stress and toxic chemicals, control of catabolic pathways, differentiation processes, and pathogenicity. One of the target proteins is BetI, an osmoprotectant which controls the choline-glycine betaine pathway in E.coli.	5.3138e-23
NC_014210.1\|WP_013152376.1\|1643731_1645192_+\|aldehyde-dehydrogenase-family-protein	gnl\|CDD\|143456	cd07138, ALDH_CddD_SSP0762, Rhodococcus ruber 6-oxolauric acid dehydrogenase-like. The 6-oxolauric acid dehydrogenase (CddD) from Rhodococcus ruber SC1 which converts 6-oxolauric acid to dodecanedioic acid, and the aldehyde dehydrogenase (locus SSP0762) from Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 and other similar sequences, are included in this CD.	0
NC_014210.1\|WP_013152364.1\|1630491_1631409_-\|phosphotransferase	gnl\|CDD\|270704	cd05155, APH_ChoK_like_1, Uncharacterized bacterial proteins with similarity to Aminoglycoside 3'-phosphotransferase and Choline kinase. This subfamily is composed of uncharacterized bacterial proteins with similarity to APH and ChoK. Other APH/ChoK-like proteins include ethanolamine kinase (ETNK), macrolide 2'-phosphotransferase (MPH2'), an unusual homoserine kinase, and uncharacterized proteins with similarity to the N-terminal domain of acyl-CoA dehydrogenase 10 (ACAD10). These proteins catalyze the transfer of the gamma-phosphoryl group from ATP (or CTP) to small molecule substrates, such as aminoglycosides, macrolides, choline, ethanolamine, and homoserine. Phosphorylation of the antibiotics, aminoglycosides, and macrolides leads to their inactivation and to bacterial antibiotic resistance. Phosphorylation of choline, ethanolamine, and homoserine serves as precursors to the synthesis of important biological compounds, such as the major phospholipids, phosphatidylcholine and phosphatidylethanolamine and the amino acids, threonine, methionine, and isoleucine. The APH/ChoK-like subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K).	1.15326e-78
NC_014210.1\|WP_013152381.1\|1650507_1650960_+\|4-hydroxybenzoyl-CoA-thioesterase	gnl\|CDD\|236044	PRK07531, PRK07531, carnitine 3-dehydrogenase.	1.01713e-37
NC_014210.1\|WP_013152373.1\|1639918_1640866_+\|SDR-family-oxidoreductase	gnl\|CDD\|235627	PRK05854, PRK05854, SDR family oxidoreductase.	0
NC_014210.1\|WP_126625057.1\|1628032_1628266_+\|pyridoxal-phosphate-dependent-enzyme	gnl\|CDD\|107205	cd01562, Thr-dehyd, Threonine dehydratase: The first step in amino acid degradation is the removal of nitrogen. Although the nitrogen atoms of most amino acids are transferred to alpha-ketoglutarate before removal, the alpha-amino group of threonine can be directly converted into NH4+. The direct deamination is catalyzed by threonine dehydratase, in which pyridoxal phosphate (PLP) is the prosthetic group. Threonine dehydratase is widely distributed in all three major phylogenetic divisions.	3.44686e-14
NC_014210.1\|WP_013152374.1\|1640999_1642313_+\|MFS-transporter	gnl\|CDD\|340913	cd17355, MFS_YcxA_like, MFS-type transporter YcxA and similar proteins of the Major Facilitator Superfamily of transporters. This group is composed of uncharacterized bacterial MFS-type transporters including Bacillus subtilis YcxA and YbfB. YcxA has been shown to facilitate the export of surfactin in B. subtilis. The YcxA-like group belongs to the Monocarboxylate transporter -like (MCT-like) family of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	4.3945e-49

>NC_014210.1|WP_013152370.1|1637410_1637737_+|hypothetical-protein
MHPIRLTSAFLLVALAATGCGSSEPTDESETQAAGAMCEDHVERQLEVSATTESVTFVRATADDDGEWWTYEAVGSYDTEDGSHTDYTCTVVNDSGDWVVVDLRSAEQ
>NC_014210.1|WP_013152369.1|1636277_1637036_+|class-I-SAM-dependent-methyltransferase
MDRVTDVPQTPAQPTDPARANDYDGFAEAYAADNENNIQNAYYERPAMVALAGDVTGRRILDAGCGAGPLSAALRDRGADVTGIDASAGMLALARRRLGDDADLRVVDLSDPLPFDDGAFDDVVASLVLHYLEDWGPTLAEMRRVLRPGGRLIASVQHPFVDYAIQDPRPDYFATTSYSDEFTFGGQPVQLRFWRRPLHAMTDAFSAAGFRLRTISEPQPDPAARELFPDEFHALSTRIGFLFFVLEAPLRP
>NC_014210.1|WP_013152368.1|1635175_1636063_+|chitinase
MIRRLLSQLAALGALAAVLIVLPATVAQAATCAAAWSASAVYTGGGQVSYDGRNYTAKWWTQNERPGTSDVWTDQGACGNDGGGEEPNPTGFVVTEAQFNQMFPNRNPFYTYSGLTAALSSYPAFTNTGSTEVRRREAAAFLANVSHETGGLVHIRETNEANYPHYCDGNQPFGCPAGQAAYYGRGPIQLSWNYNYKAAGDALGIDLLNNPYLVEQNASVAWRTGLWYWNTQTGPGTITSHNAIVNGHGFGETIRSINGAHECDGGNPAQVQSRINKFTQFAQILGTTTGSNLSC
>NC_014210.1|WP_041553081.1|1634118_1634559_+|hypothetical-protein
MWAWDEDNGWCRGGERWCSAKAGQGRGRCRRVREPVVPVAGQRERQTLLADLRALVAYLEAHPQLPVGEMTRVEITYFPEGCDGHQQDQVVRLAEALGTRPRREGEHFSCGRWFGQAGYRVVSIPERARKGGLAEAVPLGGSRRRA
>NC_014210.1|WP_013152366.1|1633118_1633715_+|TetR/AcrR-family-transcriptional-regulator
MEQERRVRPMRADAERTAKAILEAAERVLSANPAATMEQIAEAAGVARTTVHRRFTSREALVDAMTAWATQQFHDAVTSARPETAPPLVALYQVTANVLRVKIGWGFAMNAIKPEDSEAARVHADVLDQCDRLFRRLQHTGAIRPDTDLTWARRTYYALIHEAAQTQPTDAREVDELATLVVDTLLTGVGQQSLKPNV
>NC_014210.1|WP_013152365.1|1632206_1632992_-|SDR-family-oxidoreductase
MDLQMDGKVAVVTGASRGIGLATVSALIGEGMRVLAAARTITPELQATGALSVSVDLSTPDGPAQLIERAEAELGRLDVLVNNVGGGDGGGQTGGFLAFTDQQWSSAFDLNFLAAVRTTRAALPHLLESRGAIVNISSNGARTPHAGPITYTTAKAALTAFGKAVAEEFGPQGVRINTVSPGPVRTHMWESSDGYGAELAESLGLSREQLMNNLPAAMGMVTGRLVKPAEVADLVAYLASPLAGSTTGADHIIDGGAIKSV
>NC_014210.1|WP_013152364.1|1630491_1631409_-|phosphotransferase
MTEIEITAGLIRALLRDQHPDLAELPLREVEGGWGNQMWRLGDELAVRIQRMDTDPVPQLKERRWLPLLAPHLPLPVPVPVRDGAPSERFPKMWTVMTWVPGLPLDRGAITRGEHAAHTLAAFLRALHVPAPADAPVDTGRGAHPKDCADGFDQFFDSLDADAIGADAADVRAVWDDAVAAPAWEGPPVWVHGDLHPANVVVADGTLAGVVDFGDLFVGDPASDLAAAWVLLPMGAAARFFAAYAEADEATVRRARGLAALKSLFLMLMGQNGDRGLPGGKPAWGPAGRAALDRVLSEPLPRVHA
>NC_014210.1|WP_013152363.1|1628914_1630294_-|UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D--alanine-ligase
MQPLSLAQIAAAAGGQVSDADPQTQVTGVAFDSRKVSPGDLFVALRGEEGRDGHDFAPSAVRAGAVAVLAARPLDVPAIMVDDPLTALGGWARAHVEALSELDVVALTGSSGKTSTKDLIAQVLQRAGATVFTQGSFNNEIGLPITALEATADTRHLVVEMGARGQGHIAYLTQITPPRIGAVLNVGTAHAGEFGGPEMTAKAKGELVEALPSEAEGGVAVLNADDARVAAMSARTKARVVTFGVERSADVYATDVTLDGQGRASFTLHTPTGDAPVRLQVVGEHQVPNALAAAAVAEAAGMDAAQIGKALTAAESLSEGRMRVTERPDGVTVVNDAYNANADSTAAALRALAHLGRERAGRTIALLGEMRELGASSAEEHRRIGALAAVLGIDVLVAVGEGDARVLATEYGPDGRVEATKAAAGEWLSRYNFRAGDVVLVKGSNALGLGELADALAAR
>NC_014210.1|WP_013152362.1|1628262_1628913_+|peptidase
MSRCGACANTSTLHEPVEAITQYASPELISAIAYEGHDPGADPAWAVSGAASREEYSTWCRHACGTACLRMVLTHRDGHAPPLLELLHGVRKAGGYVEQPDGSVKGLIYAPFVEYVRDTHRLDARVRTGMDTTALLQELGQGRMVLASVHKEIRRPDRPAPGRGGHLVLVIGHHDGTVHFRNPSGHRPDTVSATLPAERFGEFFAGRGVVVDPARR
>NC_014210.1|WP_126625057.1|1628032_1628266_+|pyridoxal-phosphate-dependent-enzyme
MNRQLLAGMVTVSEADTATAMRWCSEHLRPVVEPSGGIALAALSARRGGIGEGPAGAVLSGGNVSRDTFTHLLGEDP
>NC_014210.1|WP_013152372.1|1638698_1639538_-|helix-turn-helix-domain-containing-protein
MIDRIGLAEFLRNRRQALQPEDVGLPRGQRRRTNGLRREEVASLCHMSADYYSRLERERGPQPSHRMLASIAQGLHLSLDERDHLFRLAGHNPPPRGTSNEHVSPGLLRVLDRLDDTPAEIVTELGETLRQSPMGVALTGDATRYTGPARSAGYRWFTDPESRRIYAPEEHPFLTRMYAAGLRELVTLRGPESPAAQLAELLLARSEEFRRVWSDHEIGIRPHEVKHFVHPEVGALELTCQRLVDPGQAHSLMVYTAVPGTESYEKLQVLSVIGTQTLS
>NC_014210.1|WP_013152373.1|1639918_1640866_+|SDR-family-oxidoreductase
MPRRPIDITVPDLTGKRAVVTGASDGMGLAMARRLAAAGAEVIMPVRNPRKGEDAIARIRQTVPRANVSLRGLDLSSLASVAALGDTLREEGLPIHILINNAGVMRPPNQQTTTDGHELQFGTNHLGHFALVGHILPLLRAGRARVTSQISVSARRGSINWEDLNWERSYNEMRAYSQSKIAFGLFGLELDRRSTAHGWGITSNLSHPGVAPTSLLAARPEIGRSEDTPYIRRIRALSARGILLGTLETSKLPALMAATDPAAKRGALYSPSGFGRLGGPPSEQRLYPPLRSAQEAARVWQVSEELTRVSFPAAV
>NC_014210.1|WP_013152374.1|1640999_1642313_+|MFS-transporter
MLVGSGTANAVGPQMYLATIGLFVLPIVEDTGFSRTTVTGAFSVAAVGMAIGLVIVAQLVDRFAARYILVPGFVLFAASMALIGLVPPVEWVYLVPCFFVGFFGAGTAVPATRAVVSWFDNNRALAVGVVTGIIGLGTALAPILAGALIEGVGWRGAYGLMALISVLVSVTMVTLFVRARAERHVRGRLVQETRVEGREVSLELPGLTVGEAVRTRQFWAIALGLGLVGVVVYGLQVHLVPMMTDRGLSADQAATLLVVFGLASLVGRVAGGLILDRVHACVIGPIVMIAPIAGMFFLEPPFGGAVVAVAFIGVAFGIEGDLLALLITRYLGTRYFGRILGLVQAAFLLGSALGPLLLGLGYDLLGSYDPVMPVLMGVLVVGAVLIATLGRYVYPAVNGFDRLAARDELAAAEVLSDIAGTGDAHGSPDRPRAEAHG
>NC_014210.1|WP_013152375.1|1642448_1643630_+|DUF2236-domain-containing-protein
MTEQSPWPTQRAGRSTVLAQFGHTRADLMQWALTTGDVLADAVVAEMHQIGMRQARPVVNKGIREGLASLTDPPPALEALLRQTESPPDYVDDSLLDQGPMPFYTSPPPVHIIALNAGSLIRVYESPSISKVLTTTGRLVESAQRRIQETGAWLTRTMLPGSLRVGQPGYVATLEVRMLHAHMRRLALDRGYDSSADGCPINQVDLGRTWMDFTLTAYTAEGLLGFGLSSREQAGLYRYWWYVAHLLGIDARLVEGITGNEAAARLDAVFQTVTGPATEESAVLADATLASATSALHTMLKVPGELARPALNAIARRIHGDGVCQDLRIPPAPIADAWLGPVLSGLALARERRRRDPRRWQAAIDQNLAAARDLVARPGQPTAYQRGATGAED
>NC_014210.1|WP_013152376.1|1643731_1645192_+|aldehyde-dehydrogenase-family-protein
MQTNDYTNMFYVNGRWIRSHGTRQVVVTNPATEESLGRVTLGDVTDVEAVVDAARRAAPGWAGTPVSERAALLRAVAAELALRQEEIARLETAEVGSPITLSRRAHAQSPIHLFASAADLVERSEPDETIPGATVLREPYGVVGAITPWNYPLHQSAAKIAPALAAGNTVVHKPSETTPLGAYALAEAIESAGLPPGVFNMVMGDGATVGARVAGHPDVDLVSFTGSTRAGVRVAAEAAATVKKVSLELGGKSPAVILPGAPLRPAVRRALRSGFLNSGQTCMALTRILVDRARLAEAEEIVRDAVADYVVGDPTDPDTEYGPLVSKAQRDRVRDYVRRGQREGLRLITGGPDRPAALSRGYYLPLTVFSDVPPTSALVTDEIFGPVLVIQVYDSVGEAVDLANRTPYGLCAGVWGADRAEAVEVAGRLQVGQVFVNGAGFNPDVPFGGFKRSGIGREYGRYGLEEFQQTKGLVFGADAVGCGGYR
>NC_014210.1|WP_041552485.1|1647489_1648428_+|TetR-family-transcriptional-regulator
MSDNVADDVRGRAREAIRRSGLSQRQFATRLGIDPSKLSKSLTGTRRFTALELAGIADETGVTVNWLLNGKDDAETVSAVPRDSSAVRPTSASLAGHPAAAREHSRRLQIIEAAWTLIAERGLHSVRVAQIAQACGTSSATVHYYFPTLNDLLVEALRHSVKQAFDRQVAGLHTIEDPYERLLRLIELQLPDSERLRLEWSIWLQVWTAAALDPRMRGLHTDSYLRWHETIARTLREGRESGVFADFDVEEMTRRLTALIDGMGIQVMTGMPGRSVAHMRDTLRSVIDSDVLGRRGAPGDGDIPGGSGAPGD
>NC_014210.1|WP_013152379.1|1648581_1649481_+|3-keto-5-aminohexanoate-cleavage-protein
MSDTMNPKPILTCALTGAGDTVGRSEHVPVTPEQIAAAAVEAAEAGASVVHIHVRDPETGAPSRDSALYREVVDRIRQTGVDIVINLTAGMGGDLVIGQEDPLEFEEGTDLVNGLDRLPHVEELLPDICTLDCGSLNFGDGSQVYISTPDMLRAGARRIQELGVRPELEIFDTGQLWFAKTMHAEGLIDDPSLFQLCTGIPYGAPSDPGVLQSMVNLLPEGAQWASFSIGRKQMPWVAQSVLLGGHARVGLEDNLYLSRGVKATNGQLTEKAVNIIEQLGARVATPDETRAMLGLRRAA
>NC_014210.1|WP_013152380.1|1649521_1650511_+|L-carnitine-dehydrogenase
MTENARTTPEAVRTVACVGAGVIGGGWVAHFLGRGYRVVAWDPAPDAESRLRGLVSSAWPALEELGPAEGASMANLRVVDTLAEAVADADFVQESAPERLDLKIDLLAEIDAATPEGVVIASSTSGYSMSEMQVGARTPGRLVVGHPFNPPYLVPLVEVVGGERSERWAVDWASDFYRAAGKSVITMERELPGFIGNRIQEAAWREALHMVAEGEATVEQIDLAMTSGPGLRWAFFGPCLTFHLAGGEGGMAHMLDHFGPSLKSPWTRLEAPELTAGLRDRMVAGTDEVVAGRSTAELIAQRDRRLIAVARALEEVERAEAAERAGADA
>NC_014210.1|WP_013152381.1|1650507_1650960_+|4-hydroxybenzoyl-CoA-thioesterase
MSATLTQRLRPEWIDYNGHLSEAYYVLVFGFATDALMDRVGLDAAYRERSGRSLYTVEAHVRYLREVAADDEVEVRTRVVGPGPDRPGARKVRICHEMRVGDALVATEELMALHVDQALGRAVPFPEEAAARLAALAEPAPDYAGRAVGG
>NC_014210.1|WP_013152382.1|1651177_1651795_-|hypothetical-protein
MRSLREPFRIIRANLGAYLVMNAIAYGVFLVGVGAALAFPELNAAQVGSQQEDGTADLVGELFANPWLFGLTIFGVNVLTVALLRIMLPSMIVPFAGIPLFAYKAYETGVILAPLDATTATLMIPHSLTLVIEFQAYALLMLGAYLLGRAWLRPAAVGAPDRRRGYLHGLRQAGWLGLPALALFVVGAAYEAFELVYIVPRMLTG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_014210_12

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_014210_12

1645359-1645632

Orphan

I-E

Consensus_repeat	Method
GTGCTCCCCGCGCACGCGGGGATGGCCCCG	PILER-CR
GTGCTCCCCGCGCACGCGGGGATGGCCCCG	CRT

4 spacers

The CRISPR arrays of NC_014210_12

>merge|NC_014210|12|1645359-1645632|PILER-CR,CRT
GTGCTCCCCGCGCACGCGGGGATGGCCCCGGGACGGAACGGGACCGCGACGGTCACCCTGGGTGCTCCCCGCGCACGCGGGGATGGCCCCGGGACGGAACGGGACCGCGACGGTCACCCTGGGTGCTCCCCGCGCACGCGGGGATGGCCCCTGGCCCTTGAACTTGACGGTGGTCACGGTGACGTGCTCCCCGCGCACGCGGGGATGGCCCCGACGGCGTCACCGTGCTCCTGGTCGATGCCGCGTGCTCCCCGCGCGCGCAGGGGTCACCTCG

>NC_014210|12|6|1645359-1645571|PILER-CR
GTGCTCCCCGCGCACGCGGGGATGGCCCCG	GGACGGAACGGGACCGCGACGGTCACCCTGG
GTGCTCCCCGCGCACGCGGGGATGGCCCCG	GGACGGAACGGGACCGCGACGGTCACCCTGG
GTGCTCCCCGCGCACGCGGGGATGGCCCCT	GGCCCTTGAACTTGACGGTGGTCACGGTGAC
GTGCTCCCCGCGCACGCGGGGATGGCCCCG

>NC_014210|12|6|1645359-1645632|CRT
GTGCTCCCCGCGCACGCGGGGATGGCCCCG	GGACGGAACGGGACCGCGACGGTCACCCTGG
GTGCTCCCCGCGCACGCGGGGATGGCCCCG	GGACGGAACGGGACCGCGACGGTCACCCTGG
GTGCTCCCCGCGCACGCGGGGATGGCCCCT	GGCCCTTGAACTTGACGGTGGTCACGGTGAC
GTGCTCCCCGCGCACGCGGGGATGGCCCCG	ACGGCGTCACCGTGCTCCTGGTCGATGCCGC
GTGCTCCCCGCGCGCGCAGGGGTCACCTCG

Protein	Signature genes	Signature genes Name	Protein_function
NC_014210.1\|WP_013152372.1\|1638698_1639538_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|375319
NC_014210.1\|WP_013152366.1\|1633118_1633715_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|366102
NC_014210.1\|WP_013152382.1\|1651177_1651795_-\|hypothetical-protein	unknown	unknown	unknown
NC_014210.1\|WP_013152374.1\|1640999_1642313_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340913
NC_014210.1\|WP_013152380.1\|1649521_1650511_+\|L-carnitine-dehydrogenase	unknown	unknown	gnl\|CDD\|168796
NC_014210.1\|WP_013152369.1\|1636277_1637036_+\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|369777
NC_014210.1\|WP_041552485.1\|1647489_1648428_+\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|379409
NC_014210.1\|WP_013152375.1\|1642448_1643630_+\|DUF2236-domain-containing-protein	unknown	unknown	gnl\|CDD\|378343
NC_014210.1\|WP_013152385.1\|1653645_1654650_-\|arsenic-resistance-protein	unknown	unknown	gnl\|CDD\|223869
NC_014210.1\|WP_013152370.1\|1637410_1637737_+\|hypothetical-protein	unknown	unknown	unknown
NC_014210.1\|WP_013152379.1\|1648581_1649481_+\|3-keto-5-aminohexanoate-cleavage-protein	unknown	unknown	gnl\|CDD\|377562
NC_014210.1\|WP_013152368.1\|1635175_1636063_+\|chitinase	unknown	unknown	gnl\|CDD\|381595
NC_014210.1\|WP_041553081.1\|1634118_1634559_+\|hypothetical-protein	unknown	unknown	unknown
NC_014210.1\|WP_013152383.1\|1651905_1652562_-\|hypothetical-protein	unknown	unknown	unknown
NC_014210.1\|WP_013152386.1\|1654896_1655802_-\|cytochrome-c-biogenesis-protein-CcdA	unknown	unknown	gnl\|CDD\|223856
NC_014210.1\|WP_013152381.1\|1650507_1650960_+\|4-hydroxybenzoyl-CoA-thioesterase	unknown	unknown	gnl\|CDD\|236044
NC_014210.1\|WP_013152384.1\|1652874_1653615_+\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133378
NC_014210.1\|WP_013152387.1\|1655794_1656640_-\|thioredoxin-domain-containing-protein	unknown	unknown	gnl\|CDD\|372611
NC_014210.1\|WP_013152373.1\|1639918_1640866_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|235627
NC_014210.1\|WP_013152376.1\|1643731_1645192_+\|aldehyde-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|143456

Protein	Function_ID	Function_description	E-value
NC_014210.1\|WP_013152372.1\|1638698_1639538_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|375319	pfam17765, MLTR_LBD, MmyB-like transcription regulator ligand binding domain. This domain is found in a family of actinobacterial transcription factors. The structure shows it has a PAS domain like fold and it is bound to Myristic acid.	1.85214e-37
NC_014210.1\|WP_013152366.1\|1633118_1633715_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|366102	pfam00440, TetR_N, Bacterial regulatory proteins, tetR family.	1.72829e-09
NC_014210.1\|WP_013152374.1\|1640999_1642313_+\|MFS-transporter	gnl\|CDD\|340913	cd17355, MFS_YcxA_like, MFS-type transporter YcxA and similar proteins of the Major Facilitator Superfamily of transporters. This group is composed of uncharacterized bacterial MFS-type transporters including Bacillus subtilis YcxA and YbfB. YcxA has been shown to facilitate the export of surfactin in B. subtilis. The YcxA-like group belongs to the Monocarboxylate transporter -like (MCT-like) family of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	4.3945e-49
NC_014210.1\|WP_013152380.1\|1649521_1650511_+\|L-carnitine-dehydrogenase	gnl\|CDD\|168796	PRK07066, PRK07066, L-carnitine dehydrogenase.	2.22356e-111
NC_014210.1\|WP_013152369.1\|1636277_1637036_+\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|369777	pfam08241, Methyltransf_11, Methyltransferase domain. Members of this family are SAM dependent methyltransferases.	7.10981e-30
NC_014210.1\|WP_041552485.1\|1647489_1648428_+\|TetR-family-transcriptional-regulator	gnl\|CDD\|379409	pfam13977, TetR_C_6, BetI-type transcriptional repressor, C-terminal. This family comprises the C-terminal portion of proteins that belong to the TetR family of transcriptional regulators. The C-terminus represents the regulatory region, and does not include the DNA binding helix-turn-helix domain. The target proteins that are repressed are involved in the transcriptional control of multi-drug efflux pumps, pathways for the biosynthesis of antibiotics, response to osmotic stress and toxic chemicals, control of catabolic pathways, differentiation processes, and pathogenicity. One of the target proteins is BetI, an osmoprotectant which controls the choline-glycine betaine pathway in E.coli.	5.3138e-23
NC_014210.1\|WP_013152375.1\|1642448_1643630_+\|DUF2236-domain-containing-protein	gnl\|CDD\|378343	pfam09995, DUF2236, Uncharacterized protein conserved in bacteria (DUF2236). This domain, found in various hypothetical bacterial proteins, has no known function. This family contains a highly conserved arginine and histidine that may be active site residues for an as yet unknown catalytic activity.	1.6011e-10
NC_014210.1\|WP_013152385.1\|1653645_1654650_-\|arsenic-resistance-protein	gnl\|CDD\|223869	COG0798, ACR3, Arsenite efflux pump ACR3 and related permeases [Inorganic ion transport and metabolism].	6.14364e-52
NC_014210.1\|WP_013152379.1\|1648581_1649481_+\|3-keto-5-aminohexanoate-cleavage-protein	gnl\|CDD\|377562	pfam05853, BKACE, beta-keto acid cleavage enzyme. BKACE, beta-keto acid cleavage enzyme plays, a role in lysine degradation. In certain instances it catalyzes the conversion of 3-keto-5-aminohexanoate and acetyl-CoA into acetoacetate and 3-aminobutyryl-CoA. The family is found to have at least 14 slightly different potential new enzymatic activities, all of which can therefore be designated as beta-keto acid cleavage enzymes.	9.56533e-128
NC_014210.1\|WP_013152368.1\|1635175_1636063_+\|chitinase	gnl\|CDD\|381595	cd00325, chitinase_GH19, Glycoside hydrolase family 19, chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Glycoside hydrolase family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases, but they are smaller in size due to certain deletions. Despite lacking any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the prokaryotic/eukaryotic divergence.	3.47312e-82
NC_014210.1\|WP_013152386.1\|1654896_1655802_-\|cytochrome-c-biogenesis-protein-CcdA	gnl\|CDD\|223856	COG0785, CcdA, Cytochrome c biogenesis protein [Posttranslational modification, protein turnover, chaperones].	3.20854e-22
NC_014210.1\|WP_013152381.1\|1650507_1650960_+\|4-hydroxybenzoyl-CoA-thioesterase	gnl\|CDD\|236044	PRK07531, PRK07531, carnitine 3-dehydrogenase.	1.01713e-37
NC_014210.1\|WP_013152384.1\|1652874_1653615_+\|MerR-family-transcriptional-regulator	gnl\|CDD\|133378	cd00592, HTH_MerR-like, Helix-Turn-Helix DNA binding domain of MerR-like transcription regulators. Helix-turn-helix (HTH) MerR-like transcription regulator, N-terminal domain. The MerR family transcription regulators have been shown to mediate responses to stress including exposure to heavy metals, drugs, or oxygen radicals in eubacterial and some archaeal species. They regulate transcription of multidrug/metal ion transporter genes and oxidative stress regulons by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.	1.27646e-18
NC_014210.1\|WP_013152387.1\|1655794_1656640_-\|thioredoxin-domain-containing-protein	gnl\|CDD\|372611	pfam13462, Thioredoxin_4, Thioredoxin.	8.86943e-28
NC_014210.1\|WP_013152373.1\|1639918_1640866_+\|SDR-family-oxidoreductase	gnl\|CDD\|235627	PRK05854, PRK05854, SDR family oxidoreductase.	0
NC_014210.1\|WP_013152376.1\|1643731_1645192_+\|aldehyde-dehydrogenase-family-protein	gnl\|CDD\|143456	cd07138, ALDH_CddD_SSP0762, Rhodococcus ruber 6-oxolauric acid dehydrogenase-like. The 6-oxolauric acid dehydrogenase (CddD) from Rhodococcus ruber SC1 which converts 6-oxolauric acid to dodecanedioic acid, and the aldehyde dehydrogenase (locus SSP0762) from Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 and other similar sequences, are included in this CD.	0

>NC_014210.1|WP_013152376.1|1643731_1645192_+|aldehyde-dehydrogenase-family-protein
MQTNDYTNMFYVNGRWIRSHGTRQVVVTNPATEESLGRVTLGDVTDVEAVVDAARRAAPGWAGTPVSERAALLRAVAAELALRQEEIARLETAEVGSPITLSRRAHAQSPIHLFASAADLVERSEPDETIPGATVLREPYGVVGAITPWNYPLHQSAAKIAPALAAGNTVVHKPSETTPLGAYALAEAIESAGLPPGVFNMVMGDGATVGARVAGHPDVDLVSFTGSTRAGVRVAAEAAATVKKVSLELGGKSPAVILPGAPLRPAVRRALRSGFLNSGQTCMALTRILVDRARLAEAEEIVRDAVADYVVGDPTDPDTEYGPLVSKAQRDRVRDYVRRGQREGLRLITGGPDRPAALSRGYYLPLTVFSDVPPTSALVTDEIFGPVLVIQVYDSVGEAVDLANRTPYGLCAGVWGADRAEAVEVAGRLQVGQVFVNGAGFNPDVPFGGFKRSGIGREYGRYGLEEFQQTKGLVFGADAVGCGGYR
>NC_014210.1|WP_013152375.1|1642448_1643630_+|DUF2236-domain-containing-protein
MTEQSPWPTQRAGRSTVLAQFGHTRADLMQWALTTGDVLADAVVAEMHQIGMRQARPVVNKGIREGLASLTDPPPALEALLRQTESPPDYVDDSLLDQGPMPFYTSPPPVHIIALNAGSLIRVYESPSISKVLTTTGRLVESAQRRIQETGAWLTRTMLPGSLRVGQPGYVATLEVRMLHAHMRRLALDRGYDSSADGCPINQVDLGRTWMDFTLTAYTAEGLLGFGLSSREQAGLYRYWWYVAHLLGIDARLVEGITGNEAAARLDAVFQTVTGPATEESAVLADATLASATSALHTMLKVPGELARPALNAIARRIHGDGVCQDLRIPPAPIADAWLGPVLSGLALARERRRRDPRRWQAAIDQNLAAARDLVARPGQPTAYQRGATGAED
>NC_014210.1|WP_013152374.1|1640999_1642313_+|MFS-transporter
MLVGSGTANAVGPQMYLATIGLFVLPIVEDTGFSRTTVTGAFSVAAVGMAIGLVIVAQLVDRFAARYILVPGFVLFAASMALIGLVPPVEWVYLVPCFFVGFFGAGTAVPATRAVVSWFDNNRALAVGVVTGIIGLGTALAPILAGALIEGVGWRGAYGLMALISVLVSVTMVTLFVRARAERHVRGRLVQETRVEGREVSLELPGLTVGEAVRTRQFWAIALGLGLVGVVVYGLQVHLVPMMTDRGLSADQAATLLVVFGLASLVGRVAGGLILDRVHACVIGPIVMIAPIAGMFFLEPPFGGAVVAVAFIGVAFGIEGDLLALLITRYLGTRYFGRILGLVQAAFLLGSALGPLLLGLGYDLLGSYDPVMPVLMGVLVVGAVLIATLGRYVYPAVNGFDRLAARDELAAAEVLSDIAGTGDAHGSPDRPRAEAHG
>NC_014210.1|WP_013152373.1|1639918_1640866_+|SDR-family-oxidoreductase
MPRRPIDITVPDLTGKRAVVTGASDGMGLAMARRLAAAGAEVIMPVRNPRKGEDAIARIRQTVPRANVSLRGLDLSSLASVAALGDTLREEGLPIHILINNAGVMRPPNQQTTTDGHELQFGTNHLGHFALVGHILPLLRAGRARVTSQISVSARRGSINWEDLNWERSYNEMRAYSQSKIAFGLFGLELDRRSTAHGWGITSNLSHPGVAPTSLLAARPEIGRSEDTPYIRRIRALSARGILLGTLETSKLPALMAATDPAAKRGALYSPSGFGRLGGPPSEQRLYPPLRSAQEAARVWQVSEELTRVSFPAAV
>NC_014210.1|WP_013152372.1|1638698_1639538_-|helix-turn-helix-domain-containing-protein
MIDRIGLAEFLRNRRQALQPEDVGLPRGQRRRTNGLRREEVASLCHMSADYYSRLERERGPQPSHRMLASIAQGLHLSLDERDHLFRLAGHNPPPRGTSNEHVSPGLLRVLDRLDDTPAEIVTELGETLRQSPMGVALTGDATRYTGPARSAGYRWFTDPESRRIYAPEEHPFLTRMYAAGLRELVTLRGPESPAAQLAELLLARSEEFRRVWSDHEIGIRPHEVKHFVHPEVGALELTCQRLVDPGQAHSLMVYTAVPGTESYEKLQVLSVIGTQTLS
>NC_014210.1|WP_013152370.1|1637410_1637737_+|hypothetical-protein
MHPIRLTSAFLLVALAATGCGSSEPTDESETQAAGAMCEDHVERQLEVSATTESVTFVRATADDDGEWWTYEAVGSYDTEDGSHTDYTCTVVNDSGDWVVVDLRSAEQ
>NC_014210.1|WP_013152369.1|1636277_1637036_+|class-I-SAM-dependent-methyltransferase
MDRVTDVPQTPAQPTDPARANDYDGFAEAYAADNENNIQNAYYERPAMVALAGDVTGRRILDAGCGAGPLSAALRDRGADVTGIDASAGMLALARRRLGDDADLRVVDLSDPLPFDDGAFDDVVASLVLHYLEDWGPTLAEMRRVLRPGGRLIASVQHPFVDYAIQDPRPDYFATTSYSDEFTFGGQPVQLRFWRRPLHAMTDAFSAAGFRLRTISEPQPDPAARELFPDEFHALSTRIGFLFFVLEAPLRP
>NC_014210.1|WP_013152368.1|1635175_1636063_+|chitinase
MIRRLLSQLAALGALAAVLIVLPATVAQAATCAAAWSASAVYTGGGQVSYDGRNYTAKWWTQNERPGTSDVWTDQGACGNDGGGEEPNPTGFVVTEAQFNQMFPNRNPFYTYSGLTAALSSYPAFTNTGSTEVRRREAAAFLANVSHETGGLVHIRETNEANYPHYCDGNQPFGCPAGQAAYYGRGPIQLSWNYNYKAAGDALGIDLLNNPYLVEQNASVAWRTGLWYWNTQTGPGTITSHNAIVNGHGFGETIRSINGAHECDGGNPAQVQSRINKFTQFAQILGTTTGSNLSC
>NC_014210.1|WP_041553081.1|1634118_1634559_+|hypothetical-protein
MWAWDEDNGWCRGGERWCSAKAGQGRGRCRRVREPVVPVAGQRERQTLLADLRALVAYLEAHPQLPVGEMTRVEITYFPEGCDGHQQDQVVRLAEALGTRPRREGEHFSCGRWFGQAGYRVVSIPERARKGGLAEAVPLGGSRRRA
>NC_014210.1|WP_013152366.1|1633118_1633715_+|TetR/AcrR-family-transcriptional-regulator
MEQERRVRPMRADAERTAKAILEAAERVLSANPAATMEQIAEAAGVARTTVHRRFTSREALVDAMTAWATQQFHDAVTSARPETAPPLVALYQVTANVLRVKIGWGFAMNAIKPEDSEAARVHADVLDQCDRLFRRLQHTGAIRPDTDLTWARRTYYALIHEAAQTQPTDAREVDELATLVVDTLLTGVGQQSLKPNV
>NC_014210.1|WP_041552485.1|1647489_1648428_+|TetR-family-transcriptional-regulator
MSDNVADDVRGRAREAIRRSGLSQRQFATRLGIDPSKLSKSLTGTRRFTALELAGIADETGVTVNWLLNGKDDAETVSAVPRDSSAVRPTSASLAGHPAAAREHSRRLQIIEAAWTLIAERGLHSVRVAQIAQACGTSSATVHYYFPTLNDLLVEALRHSVKQAFDRQVAGLHTIEDPYERLLRLIELQLPDSERLRLEWSIWLQVWTAAALDPRMRGLHTDSYLRWHETIARTLREGRESGVFADFDVEEMTRRLTALIDGMGIQVMTGMPGRSVAHMRDTLRSVIDSDVLGRRGAPGDGDIPGGSGAPGD
>NC_014210.1|WP_013152379.1|1648581_1649481_+|3-keto-5-aminohexanoate-cleavage-protein
MSDTMNPKPILTCALTGAGDTVGRSEHVPVTPEQIAAAAVEAAEAGASVVHIHVRDPETGAPSRDSALYREVVDRIRQTGVDIVINLTAGMGGDLVIGQEDPLEFEEGTDLVNGLDRLPHVEELLPDICTLDCGSLNFGDGSQVYISTPDMLRAGARRIQELGVRPELEIFDTGQLWFAKTMHAEGLIDDPSLFQLCTGIPYGAPSDPGVLQSMVNLLPEGAQWASFSIGRKQMPWVAQSVLLGGHARVGLEDNLYLSRGVKATNGQLTEKAVNIIEQLGARVATPDETRAMLGLRRAA
>NC_014210.1|WP_013152380.1|1649521_1650511_+|L-carnitine-dehydrogenase
MTENARTTPEAVRTVACVGAGVIGGGWVAHFLGRGYRVVAWDPAPDAESRLRGLVSSAWPALEELGPAEGASMANLRVVDTLAEAVADADFVQESAPERLDLKIDLLAEIDAATPEGVVIASSTSGYSMSEMQVGARTPGRLVVGHPFNPPYLVPLVEVVGGERSERWAVDWASDFYRAAGKSVITMERELPGFIGNRIQEAAWREALHMVAEGEATVEQIDLAMTSGPGLRWAFFGPCLTFHLAGGEGGMAHMLDHFGPSLKSPWTRLEAPELTAGLRDRMVAGTDEVVAGRSTAELIAQRDRRLIAVARALEEVERAEAAERAGADA
>NC_014210.1|WP_013152381.1|1650507_1650960_+|4-hydroxybenzoyl-CoA-thioesterase
MSATLTQRLRPEWIDYNGHLSEAYYVLVFGFATDALMDRVGLDAAYRERSGRSLYTVEAHVRYLREVAADDEVEVRTRVVGPGPDRPGARKVRICHEMRVGDALVATEELMALHVDQALGRAVPFPEEAAARLAALAEPAPDYAGRAVGG
>NC_014210.1|WP_013152382.1|1651177_1651795_-|hypothetical-protein
MRSLREPFRIIRANLGAYLVMNAIAYGVFLVGVGAALAFPELNAAQVGSQQEDGTADLVGELFANPWLFGLTIFGVNVLTVALLRIMLPSMIVPFAGIPLFAYKAYETGVILAPLDATTATLMIPHSLTLVIEFQAYALLMLGAYLLGRAWLRPAAVGAPDRRRGYLHGLRQAGWLGLPALALFVVGAAYEAFELVYIVPRMLTG
>NC_014210.1|WP_013152383.1|1651905_1652562_-|hypothetical-protein
MIKERRRREAAKRIRDGDGRPLKRFRWWQPLSRALFHLPLTDGGGQRAVYSVDVPYWQRVMTEDGKGRAHLYLDGRHHLESTLPAVFPVPGGVVEVESTAFGLKRCHHVTAGGDERQLVPDERSAEGRRARLDRERPALGRLVRAVSLVLLVVPILLVVPQVVEAVSRVPPVAERFGAFTSPVDLPLWLNVALGLCASASSVERATRLRWNALLDGSG
>NC_014210.1|WP_013152384.1|1652874_1653615_+|MerR-family-transcriptional-regulator
MAWSTQQLAELANTTVKAVRYYHEVGLLDVPERTANGYKQYQVSHLVRLLQIKRLSDLGVPLSEVASMGRADEDPDEAIRVLDKELEATVDRLNRVRAELAVILRHRAPAYVPPAFAPVSHELSDRQRSLLMVYSTVLSERSVEKFRELISDPDETDEEFEALPEDADDAAIDRLAARMLPVVRRRSEENPWSADPAADAPGGAERAERTMAEAMAQLYNPAQLRVLKRLSALLREGVPDGGGDAP
>NC_014210.1|WP_013152385.1|1653645_1654650_-|arsenic-resistance-protein
MSLAERLQSLFVALAAVAGLAAGLLLPVGPAAEHVVLPALLAMLTAVFAQMDAAHVGEVGRARTLVAVSLALNFVFTPALAWALGAGLLGGEPDLRIGLLLLLVTPCTDWYLVFTAVARGHTGIAAALLPVNLVLQLALLPVYVLLLGGRAAMVDAATLAESVLLVLVVPLALASVLRWASYRFKGAAWRERYVTGPASRLVLPLLYAAVLAMFAWQARTVLEHGADLLALLPPLAVFFVALPLIATGLSRMLRLPADQGVTLVMTTTARNSPIALAVAVAAFPDRPLIAVALVVGPLVELPVLALLAQLVRVRPPAASGSAPARTRQGHGRER
>NC_014210.1|WP_013152386.1|1654896_1655802_-|cytochrome-c-biogenesis-protein-CcdA
MADVGLVAALAGGVLALFSPCSALLLPSFFGYAFRDPRRLLGRTGVFYLGLCTTLVPLGAGSAAVSRLFYGERELLITVAGSLVIAFGVAQIVGFGFSSRLARRLQGRFSGRTNTVSVFGLGAVYGFAGFCSGPILGAVLTVAATGGPLRGALLLAVYALGMAGPLFVLALLWDRYDLGEKRWLRGRTVSLGPVRVHTTSTLSGLLFVAIGVVFLRYDGTASLFGGVGAFDDQSYRVQEWLFAVGGAGIDVFVLAAAGIALLAAGVWQWSRARGPKGSEGRDPAQEGSARGTRSETTGGGA
>NC_014210.1|WP_013152387.1|1655794_1656640_-|thioredoxin-domain-containing-protein
MSSSSGSGPGRGKKQVNARPSPGAERGRGRTPDGGGGSWRGLLFAGLALLVVAGLLVANRAVDDRAQEPAAREPAADSAPHSAGADDQTPDQREFGALLARRDPEDPAAMGEVDAPVVMVAYSDYNCPYCGRWARETQPELMHYVERGDLRIEWRDFPIITGSSETVSHAARAAGMQGGFWEFHEAYFTHGEKFEGEALEEVLDGIVAELGMDPERFEEDRHGDEVASMVSRDFAEAQGIGVTSTPAFLVNGQPLMGAQPLSVFVSAIEDALADAGRDGDG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_014210_13

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_014210_13

1662442-1662836

Orphan

I-E

Consensus_repeat	Method
GTGCTCCCCGCGCACGCGGGGATGGTCCC	PILER-CR
GTGCTCCCCGCGCACGCGGGGATGGTCCC	CRISPRCasFinder
GTGCTCCCCGCGCACGCGGGGATGGTCCC	CRT

6 spacers

The CRISPR arrays of NC_014210_13

>merge|NC_014210|13|1662442-1662836|PILER-CR,CRISPRCasFinder,CRT
GTGCTCCCCGCGCACGCGGGGATGGTCCCTCCACGTCCTGCCCCGGCAGCAAGAACTACTCGTGCTCCCCGCGCACGCGGGGATGGTCCCACCAGAACGTGATCCGCGGCGGCGGCATCGTCGTGCTCCCCGCGCACGCGGGGATGGTCCCCGCTCCAGCCCGAAACCCTGGCTCGCGCCGACGTGCTCCCCGCGCACGCGGGGATGGTCCCTCACCGGTGGCCGACCCTTCCTGCACGCCATCGTGCTCCCCGCGCACGCGGGGATGGTCCCGGCGCCGACGGCGACGACTGGTCGCTCTCCAAGTGCTCCCCGCGCACGCGGGGATGGTCCCGTGGGTGGGGCCGGGCGGGGGAAGTGGAAGCGGTGCTCCCCGCGCACGCGGGGATGGGGCC

>NC_014210|13|7|1662442-1662775|PILER-CR
GTGCTCCCCGCGCACGCGGGGATGGTCCC	TCCACGTCCTGCCCCGGCAGCAAGAACTACTC
GTGCTCCCCGCGCACGCGGGGATGGTCCC	ACCAGAACGTGATCCGCGGCGGCGGCATCGTC
GTGCTCCCCGCGCACGCGGGGATGGTCCC	CGCTCCAGCCCGAAACCCTGGCTCGCGCCGAC
GTGCTCCCCGCGCACGCGGGGATGGTCCC	TCACCGGTGGCCGACCCTTCCTGCACGCCATC
GTGCTCCCCGCGCACGCGGGGATGGTCCC	GGCGCCGACGGCGACGACTGGTCGCTCTCCAA
GTGCTCCCCGCGCACGCGGGGATGGTCCC

>NC_014210|13|12|1662442-1662836|CRISPRCasFinder
GTGCTCCCCGCGCACGCGGGGATGGTCCC	TCCACGTCCTGCCCCGGCAGCAAGAACTACTC
GTGCTCCCCGCGCACGCGGGGATGGTCCC	ACCAGAACGTGATCCGCGGCGGCGGCATCGTC
GTGCTCCCCGCGCACGCGGGGATGGTCCC	CGCTCCAGCCCGAAACCCTGGCTCGCGCCGAC
GTGCTCCCCGCGCACGCGGGGATGGTCCC	TCACCGGTGGCCGACCCTTCCTGCACGCCATC
GTGCTCCCCGCGCACGCGGGGATGGTCCC	GGCGCCGACGGCGACGACTGGTCGCTCTCCAA
GTGCTCCCCGCGCACGCGGGGATGGTCCC	GTGGGTGGGGCCGGGCGGGGGAAGTGGAAGCG
GTGCTCCCCGCGCACGCGGGGATGGGGCC

>NC_014210|13|7|1662442-1662836|CRT
GTGCTCCCCGCGCACGCGGGGATGGTCCC	TCCACGTCCTGCCCCGGCAGCAAGAACTACTC
GTGCTCCCCGCGCACGCGGGGATGGTCCC	ACCAGAACGTGATCCGCGGCGGCGGCATCGTC
GTGCTCCCCGCGCACGCGGGGATGGTCCC	CGCTCCAGCCCGAAACCCTGGCTCGCGCCGAC
GTGCTCCCCGCGCACGCGGGGATGGTCCC	TCACCGGTGGCCGACCCTTCCTGCACGCCATC
GTGCTCCCCGCGCACGCGGGGATGGTCCC	GGCGCCGACGGCGACGACTGGTCGCTCTCCAA
GTGCTCCCCGCGCACGCGGGGATGGTCCC	GTGGGTGGGGCCGGGCGGGGGAAGTGGAAGCG
GTGCTCCCCGCGCACGCGGGGATGGGGCC

Protein	Signature genes	Signature genes Name	Protein_function
NC_014210.1\|WP_013152392.1\|1660562_1662077_-\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|223737
NC_014210.1\|WP_013152400.1\|1668426_1670451_-\|CocE/NonD-family-hydrolase	unknown	unknown	gnl\|CDD\|225487
NC_014210.1\|WP_013152394.1\|1663965_1664136_+\|hypothetical-protein	unknown	unknown	unknown
NC_014210.1\|WP_013152383.1\|1651905_1652562_-\|hypothetical-protein	unknown	unknown	unknown
NC_014210.1\|WP_013152397.1\|1665529_1665874_-\|hypothetical-protein	unknown	unknown	unknown
NC_014210.1\|WP_013152385.1\|1653645_1654650_-\|arsenic-resistance-protein	unknown	unknown	gnl\|CDD\|223869
NC_014210.1\|WP_013152396.1\|1664985_1665447_+\|PPOX-class-F420-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|274679
NC_014210.1\|WP_013152398.1\|1665905_1666310_-\|four-helix-bundle-copper-binding-protein	unknown	unknown	gnl\|CDD\|153434
NC_014210.1\|WP_013152387.1\|1655794_1656640_-\|thioredoxin-domain-containing-protein	unknown	unknown	gnl\|CDD\|372611
NC_014210.1\|WP_013152386.1\|1654896_1655802_-\|cytochrome-c-biogenesis-protein-CcdA	unknown	unknown	gnl\|CDD\|223856
NC_014210.1\|WP_041552491.1\|1670466_1671771_-\|ATP-grasp-domain-containing-protein	unknown	unknown	gnl\|CDD\|274264
NC_014210.1\|WP_013152390.1\|1658254_1659562_-\|PQQ-binding-like-beta-propeller-repeat-protein	unknown	unknown	gnl\|CDD\|379140
NC_014210.1\|WP_013152389.1\|1657828_1658197_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|367747
NC_014210.1\|WP_013152393.1\|1662916_1663870_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|173926
NC_014210.1\|WP_013152395.1\|1664219_1664870_+\|hypothetical-protein	unknown	unknown	unknown
NC_014210.1\|WP_013152391.1\|1659564_1660290_-\|thioredoxin-domain-containing-protein	unknown	unknown	gnl\|CDD\|372611
NC_014210.1\|WP_013152384.1\|1652874_1653615_+\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133378
NC_014210.1\|WP_013152388.1\|1656872_1657832_-\|M56-family-metallopeptidase	unknown	unknown	gnl\|CDD\|320685
NC_014210.1\|WP_126624970.1\|1666365_1667676_-\|cytochrome-P450	unknown	unknown	gnl\|CDD\|365848
NC_014210.1\|WP_013152402.1\|1672193_1673192_-\|L-glyceraldehyde-3-phosphate-reductase	unknown	unknown	gnl\|CDD\|381377

Protein	Function_ID	Function_description	E-value
NC_014210.1\|WP_013152392.1\|1660562_1662077_-\|FAD-dependent-oxidoreductase	gnl\|CDD\|223737	COG0665, DadA, Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism].	1.87939e-44
NC_014210.1\|WP_013152400.1\|1668426_1670451_-\|CocE/NonD-family-hydrolase	gnl\|CDD\|225487	COG2936, COG2936, Predicted acyl esterases [General function prediction only].	6.08556e-114
NC_014210.1\|WP_013152402.1\|1672193_1673192_-\|L-glyceraldehyde-3-phosphate-reductase	gnl\|CDD\|381377	cd19151, AKR_AKR14A2, Salmonella enterica aldo-keto reductase (AKR) and similar protein. Salmonella enterica AKR is a founding member of aldo-keto reductase family 14 member A2 (AKR14A2).	0
NC_014210.1\|WP_013152385.1\|1653645_1654650_-\|arsenic-resistance-protein	gnl\|CDD\|223869	COG0798, ACR3, Arsenite efflux pump ACR3 and related permeases [Inorganic ion transport and metabolism].	6.14364e-52
NC_014210.1\|WP_013152396.1\|1664985_1665447_+\|PPOX-class-F420-dependent-oxidoreductase	gnl\|CDD\|274679	TIGR03618, Rv1155_F420, PPOX class probable F420-dependent enzyme. A Genome Properties metabolic reconstruction for F420 biosynthesis shows that slightly over 10 percent of all prokaryotes with fully sequenced genomes, including about two thirds of the Actinomyces, make F420. The Partial Phylogenetic Profiling algorithm identifies this members of this protein family as high-scoring proteins to the F420 biosynthesis profile. A member of this family, Rv1155, was crytallized after expression in Escherichia coli, which does not synthesize F420; the crystal structure shown to resemble FMN-binding proteins, but with a recognizable empty cleft corresponding to, yet differing profounding from, the FMN site of pyridoxine 5'-phosphate oxidase. We propose that this protein family consists of F420-binding enzymes. [Unknown function, Enzymes of unknown specificity].	1.3289e-35
NC_014210.1\|WP_013152398.1\|1665905_1666310_-\|four-helix-bundle-copper-binding-protein	gnl\|CDD\|153434	cd08026, DUF326, Cysteine-rich 4 helical bundle widely conserved in bacteria. This functionally uncharacterized protein forms a 4-helical bundle with a bromodomain-like topology. It is present in major bacterial lineages and contains highly conserved cysteines in a repeated pattern, whose sidechains appear buried. Some family members have been (mis)annotated as putative ferredoxins.	7.02349e-20
NC_014210.1\|WP_013152387.1\|1655794_1656640_-\|thioredoxin-domain-containing-protein	gnl\|CDD\|372611	pfam13462, Thioredoxin_4, Thioredoxin.	8.86943e-28
NC_014210.1\|WP_013152386.1\|1654896_1655802_-\|cytochrome-c-biogenesis-protein-CcdA	gnl\|CDD\|223856	COG0785, CcdA, Cytochrome c biogenesis protein [Posttranslational modification, protein turnover, chaperones].	3.20854e-22
NC_014210.1\|WP_041552491.1\|1670466_1671771_-\|ATP-grasp-domain-containing-protein	gnl\|CDD\|274264	TIGR02712, Includes:_Allophanate_hydrolase, urea carboxylase. Members of this family are ATP-dependent urea carboxylase, including characterized members from Oleomonas sagaranensis (alpha class Proteobacterium) and yeasts such as Saccharomyces cerevisiae. The allophanate hydrolase domain of the yeast enzyme is not included in this model and is represented by an adjacent gene in Oleomonas sagaranensis. The fusion of urea carboxylase and allophanate hydrolase is designated urea amidolyase. The enzyme from Oleomonas sagaranensis was shown to be highly active on acetamide and formamide as well as urea. [Central intermediary metabolism, Nitrogen metabolism].	7.99757e-07
NC_014210.1\|WP_013152390.1\|1658254_1659562_-\|PQQ-binding-like-beta-propeller-repeat-protein	gnl\|CDD\|379140	pfam13360, PQQ_2, PQQ-like domain. This domain contains several repeats of the PQQ repeat.	3.33119e-05
NC_014210.1\|WP_013152389.1\|1657828_1658197_-\|hypothetical-protein	gnl\|CDD\|367747	pfam03965, Penicillinase_R, Penicillinase repressor. The penicillinase repressor negatively regulates expression of the penicillinase gene. The N-terminal region of this protein is involved in operator recognition, while the C-terminal is responsible for dimerization of the protein.	5.93346e-23
NC_014210.1\|WP_013152393.1\|1662916_1663870_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|173926	cd04301, NAT_SF, N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate. NAT (N-Acyltransferase) is a large superfamily of enzymes that mostly catalyze the transfer of an acyl group to a substrate and are implicated in a variety of functions, ranging from bacterial antibiotic resistance to circadian rhythms in mammals. Members include GCN5-related N-Acetyltransferases (GNAT) such as Aminoglycoside N-acetyltransferases, Histone N-acetyltransferase (HAT) enzymes, and Serotonin N-acetyltransferase, which catalyze the transfer of an acetyl group to a substrate. The kinetic mechanism of most GNATs involves the ordered formation of a ternary complex: the reaction begins with Acetyl Coenzyme A (AcCoA) binding, followed by binding of substrate, then direct transfer of the acetyl group from AcCoA to the substrate, followed by product and subsequent CoA release. Other family members include Arginine/ornithine N-succinyltransferase, Myristoyl-CoA: protein N-myristoyltransferase, and Acyl-homoserinelactone synthase which have a similar catalytic mechanism but differ in types of acyl groups transferred. Leucyl/phenylalanyl-tRNA-protein transferase and FemXAB nonribosomal peptidyltransferases which catalyze similar peptidyltransferase reactions are also included.	1.39235e-06
NC_014210.1\|WP_013152391.1\|1659564_1660290_-\|thioredoxin-domain-containing-protein	gnl\|CDD\|372611	pfam13462, Thioredoxin_4, Thioredoxin.	4.26092e-28
NC_014210.1\|WP_013152384.1\|1652874_1653615_+\|MerR-family-transcriptional-regulator	gnl\|CDD\|133378	cd00592, HTH_MerR-like, Helix-Turn-Helix DNA binding domain of MerR-like transcription regulators. Helix-turn-helix (HTH) MerR-like transcription regulator, N-terminal domain. The MerR family transcription regulators have been shown to mediate responses to stress including exposure to heavy metals, drugs, or oxygen radicals in eubacterial and some archaeal species. They regulate transcription of multidrug/metal ion transporter genes and oxidative stress regulons by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.	1.27646e-18
NC_014210.1\|WP_013152388.1\|1656872_1657832_-\|M56-family-metallopeptidase	gnl\|CDD\|320685	cd07326, M56_BlaR1_MecR1_like, Peptidase M56-like including those in BlaR1 and MecR1, integral membrane metallopeptidase. This family contains peptidase M56, which includes zinc metalloprotease domain in MecR1 as well as BlaR1. MecR1 is a transmembrane beta-lactam sensor/signal transducer protein that regulates the expression of an altered penicillin-binding protein PBP2a, which resists inactivation by beta-lactam antibiotics, in methicillin-resistant Staphylococcus aureus (MRSA). BlaR1 regulates the inducible expression of a class A beta-lactamase that hydrolytically destroys certain ?-lactam antibiotics in MRSA. Both, MecR1 and BlaR1, are transmembrane proteins that consist of four transmembrane helices, a cytoplasmic zinc protease domain, and the soluble C-terminal extracellular sensor domain, and are highly similar in sequence and function. The signal for protein expression is transmitted by site-specific proteolytic cleavage of both the transducer, which auto-activates, and the repressor, which is inactivated, unblocking gene transcription. All members contain the zinc metalloprotease motif (HEXXH). Homologs of this peptidase domain are also found in a number of other bacterial genome sequences, most of which are as yet uncharacterized.	5.01443e-30
NC_014210.1\|WP_126624970.1\|1666365_1667676_-\|cytochrome-P450	gnl\|CDD\|365848	pfam00067, p450, Cytochrome P450. Cytochrome P450s are haem-thiolate proteins involved in the oxidative degradation of various compounds. They are particularly well known for their role in the degradation of environmental toxins and mutagens. They can be divided into 4 classes, according to the method by which electrons from NAD(P)H are delivered to the catalytic site. Sequence conservation is relatively low within the family - there are only 3 absolutely conserved residues - but their general topography and structural fold are highly conserved. The conserved core is composed of a coil termed the 'meander', a four-helix bundle, helices J and K, and two sets of beta-sheets. These constitute the haem-binding loop (with an absolutely conserved cysteine that serves as the 5th ligand for the haem iron), the proton-transfer groove and the absolutely conserved EXXR motif in helix K. While prokaryotic P450s are soluble proteins, most eukaryotic P450s are associated with microsomal membranes. their general enzymatic function is to catalyze regiospecific and stereospecific oxidation of non-activated hydrocarbons at physiological temperatures.	1.63342e-09

>NC_014210.1|WP_013152392.1|1660562_1662077_-|FAD-dependent-oxidoreductase
MQHRSVWTVVENRPEFPRLSQDVEVDVAVVGGGIVGLTTALLARRAGAGSVAVLEAGRLGQGTTGHTTGKVTSQHGLVYAGLIDRYGQDLARVYADANQAGVELVAELAGEYGIDCDLTRAPAVAYTRDPAQRRTLEEEAAAAQRLRLPASLVETTDLPFGIEAAVRFDQQLHFHSGRYVAGLAEALSAAGGQVFEHTRVLEVEEERDGTVRVRTDDATVRASSVVVATLLPINMIGGYFARTRPFRSFGLAARLHGPAPQEMAISIDSPSRSTRPWPDRGPNGLIVVGGGHETGTGQDTQALWDDLEQWTRSTFDVDAVEYRWSGQDYTTADQVPYIGRSSMNDRILVATGFNKWGLSNGTAAAVILSDLLQGRDNPWLAMFDATRVGDAKAVGRLIKDNLKVGADMVGGHLGRLYPHHARHLDRGQGGVVEVDGDSVGAYRDERGGLHAVSLNCTHLGCRLAWNAAETSWDCPCHGSRYDTDGSVLNGPAVKPLPTVDLDDA
>NC_014210.1|WP_013152391.1|1659564_1660290_-|thioredoxin-domain-containing-protein
MSEPSRRNRAPALLLAGSACALLLLTALFVNAEDSGAAGSPGGTAADTVSEETRAAGEELARRDPADPHAMGTADAPVVLIVYSDYLCPFCADWVHRTQPELVEAYVAPGLVRIEWREFPYLGEGSRLLARGAVAAGNQDRFWEYHARVYAAPEDFTGDADEVRASMRDAAEEIGLDTDAFARDLDAAEAGAAVERDFTEGQDMGMSGAPAFLVNGDPVLGAQPLEAFTDSIDAALRAAGR
>NC_014210.1|WP_013152390.1|1658254_1659562_-|PQQ-binding-like-beta-propeller-repeat-protein
MTPLQSPGRPLPRRNAPGPGRTRRARNPVRTAAAACLLLVLTACGRPGLAAPRDARPLDEPPVPPVAVDAARVPGVLGDRGLWTSPYSSEPKATDDGFVGLVADDGGGDLRFLGVDARGRTRWSTPRNPSCTGFTTTRGGRGGELVVLLDSDAAPERGLLAATVTAAAYDPSTGRRVWGPTEVPGTWVGPGLVFARVSHTVMSEETGPRVALAADTGAVAADEEDGDAVLHEYQGTLLVHRDGGLRAIDTSSGEQLWRGSELPVPDSLARGTGETTLTYGHRPASDSAGLVTLRWERGGAAVYTVHDVRDGRPLAELSSRAEPVTVADGSGRAAVAGVSAATGAPVLLGRGGPSRDGLWSVEARPGERPVRVVGGLLYTAADDGNRVLSTADGRTLEEGTWEIPVAGPERGPVLVEAGDGDGSYVAVARSGPERD
>NC_014210.1|WP_013152389.1|1657828_1658197_-|hypothetical-protein
MIPGLGPLEAAVMEVLWEASEPLAVRQVRERLTDHATAYTTISTVLENLRRKGWVDREQLGRVWFYRPVRDRSAHAADVMHEALTGSRDSEATLLRFVDGMSPQDVRALRTLLDGLPPEEEA
>NC_014210.1|WP_013152388.1|1656872_1657832_-|M56-family-metallopeptidase
MIWPLAAVCAVVALGVRGPDLLRRASRSCGPGPRTMLALWTLATAVWSASCAALAAVFAAELLGPSVKAVLAACLSVLQALERDNAGWGVGVSAALVLAAALRLLWTGVRRGRAGSSWRRSHHRDLLSRARRRLLHGQRVWLVDSAESGAYCVPGAQGGVVITRGALEVLSGPQVRAVLAHEKAHLSQRHHLVVGWVRLLDSAFPRVPLFRAAASEVPVLVEWAADDRAVREVGVRPLVHALGALAEAGRSRSPQVLSIDGARPVDRVRRQVAPLAGCRRWRTRTRTALVAALVSAPLLITVASALAGVLLPYCDCAAY
>NC_014210.1|WP_013152387.1|1655794_1656640_-|thioredoxin-domain-containing-protein
MSSSSGSGPGRGKKQVNARPSPGAERGRGRTPDGGGGSWRGLLFAGLALLVVAGLLVANRAVDDRAQEPAAREPAADSAPHSAGADDQTPDQREFGALLARRDPEDPAAMGEVDAPVVMVAYSDYNCPYCGRWARETQPELMHYVERGDLRIEWRDFPIITGSSETVSHAARAAGMQGGFWEFHEAYFTHGEKFEGEALEEVLDGIVAELGMDPERFEEDRHGDEVASMVSRDFAEAQGIGVTSTPAFLVNGQPLMGAQPLSVFVSAIEDALADAGRDGDG
>NC_014210.1|WP_013152386.1|1654896_1655802_-|cytochrome-c-biogenesis-protein-CcdA
MADVGLVAALAGGVLALFSPCSALLLPSFFGYAFRDPRRLLGRTGVFYLGLCTTLVPLGAGSAAVSRLFYGERELLITVAGSLVIAFGVAQIVGFGFSSRLARRLQGRFSGRTNTVSVFGLGAVYGFAGFCSGPILGAVLTVAATGGPLRGALLLAVYALGMAGPLFVLALLWDRYDLGEKRWLRGRTVSLGPVRVHTTSTLSGLLFVAIGVVFLRYDGTASLFGGVGAFDDQSYRVQEWLFAVGGAGIDVFVLAAAGIALLAAGVWQWSRARGPKGSEGRDPAQEGSARGTRSETTGGGA
>NC_014210.1|WP_013152385.1|1653645_1654650_-|arsenic-resistance-protein
MSLAERLQSLFVALAAVAGLAAGLLLPVGPAAEHVVLPALLAMLTAVFAQMDAAHVGEVGRARTLVAVSLALNFVFTPALAWALGAGLLGGEPDLRIGLLLLLVTPCTDWYLVFTAVARGHTGIAAALLPVNLVLQLALLPVYVLLLGGRAAMVDAATLAESVLLVLVVPLALASVLRWASYRFKGAAWRERYVTGPASRLVLPLLYAAVLAMFAWQARTVLEHGADLLALLPPLAVFFVALPLIATGLSRMLRLPADQGVTLVMTTTARNSPIALAVAVAAFPDRPLIAVALVVGPLVELPVLALLAQLVRVRPPAASGSAPARTRQGHGRER
>NC_014210.1|WP_013152384.1|1652874_1653615_+|MerR-family-transcriptional-regulator
MAWSTQQLAELANTTVKAVRYYHEVGLLDVPERTANGYKQYQVSHLVRLLQIKRLSDLGVPLSEVASMGRADEDPDEAIRVLDKELEATVDRLNRVRAELAVILRHRAPAYVPPAFAPVSHELSDRQRSLLMVYSTVLSERSVEKFRELISDPDETDEEFEALPEDADDAAIDRLAARMLPVVRRRSEENPWSADPAADAPGGAERAERTMAEAMAQLYNPAQLRVLKRLSALLREGVPDGGGDAP
>NC_014210.1|WP_013152383.1|1651905_1652562_-|hypothetical-protein
MIKERRRREAAKRIRDGDGRPLKRFRWWQPLSRALFHLPLTDGGGQRAVYSVDVPYWQRVMTEDGKGRAHLYLDGRHHLESTLPAVFPVPGGVVEVESTAFGLKRCHHVTAGGDERQLVPDERSAEGRRARLDRERPALGRLVRAVSLVLLVVPILLVVPQVVEAVSRVPPVAERFGAFTSPVDLPLWLNVALGLCASASSVERATRLRWNALLDGSG
>NC_014210.1|WP_013152393.1|1662916_1663870_+|GNAT-family-N-acetyltransferase
MTGSELVTAADVRLMQGLAQRVTAIRPDLVNSDASFGELAWNWGRGHASDGATWPRRLWFSGGELVAWGWLRLPRRVRLSDGSVRDVTGAYLMHQVHPDHAGLVDEVIAWYDATAAGLERTVLPSAADGFALERWAAHGYGTDPESLGDDGTWTQLNERDLTDVEQPVLPTGFRFRTADEAGPEAAVRAHLGAWAPSAYTAEAYRGVRRTAGYRGDLHVLVEAPDGTMASSTIMWLDEANGTVEFEPVGTHPDYRRRGLGRAMLLHGMRLARAAGATHATVACLGAPGHPEARGLYYGVGFRMLVRDAPLVKPATAE
>NC_014210.1|WP_013152394.1|1663965_1664136_+|hypothetical-protein
MSVPEESRPKTTDTDQVVDADHSDDAREPDTRGELEAELQDRMEEQDLSREDFGTE
>NC_014210.1|WP_013152395.1|1664219_1664870_+|hypothetical-protein
MSDPSAHAAPGPRDPLTRLRLRANRSERSRKVFYGLHQGLSLGCVMGFAQFLLLGSDPWTSLLYGIVAGVVFSSFMALFVTPPRPRVSQDPAVQAAVSPETLRAATDRLILGRPGADPETNRVAALQAEQVLDAPSVRIPVAVAALVAAACALGALALPSDEALDFPRALLGTVTLACVLTPCLMLPVWLLRRRRSRELLALHTPSDRDRSDSGRD
>NC_014210.1|WP_013152396.1|1664985_1665447_+|PPOX-class-F420-dependent-oxidoreductase
MSPSIATNTRVDLDGLLEFVRPRHHALLITRRADGGPQASPVTCGVDTQGRIVVSTYPERAKTRNARRDPRVSVVVLSDDFDGAWVQVDGEAEVIDGEDAVEPLVEYFRVISGEHPDWDEYREAMRRQGKSLVRVTPKRWGPVATGGFPADRV
>NC_014210.1|WP_013152397.1|1665529_1665874_-|hypothetical-protein
MEWATPGALFGILMALVIPIGVIFLVLWIIRRDTIRKQEAVRSPDYWKERPEGRRYPTGWDRDSMPGLGTARPGEGTAGTSSGEDWKPPPEGGDPPDRGAAPPDDDWRPPPAGR
>NC_014210.1|WP_013152398.1|1665905_1666310_-|four-helix-bundle-copper-binding-protein
MSVVEQMLDTRSDRRGDGIEERVRACIEACGACAQACVLCADSCLGERAVAELVACVRLDLDCADVCESTQRVLSRRTGEDDTLVRTLVKACAEACRLCGEECDRHAARHEHCWVCAEACRRCECACRELLAAL
>NC_014210.1|WP_126624970.1|1666365_1667676_-|cytochrome-P450
MLSSVLLPNLARGVIVRRPLMTGLVAGLDADRRAVSLLRGLRERHGDDPLPLRLAGRRLALVLSPEDVGRLLRETPEPFSPGGMEKRGALSHFQPHGVLISDHDARPGRRAANVAALVPGQTIHPDGDVVAGQADDEALALRLALRSGEVLDWRRFADSFHAMARRVVFGSFAAQDRRTTELLHTLRSRANWAYAAPADHAAREEFLGRVRANIERAEPGSLAARLVAGSAAAKSAAGCPHGGDGQGADVHPEDQVAHWLFAFDAAAVAAFRSLALLTSLSPGAHAAREEADGREGLDLPLLRATVRESVRLWPTTLMVIRESTRETAWREEVFEAGTAFLVVSSYFHRDSSRLPYADAFEPEVWLDGRAEAEPGIVPFSYGPAGCAARDLVPLTVSLFLRALLRGRNLTRVDAGGPLPASGLPASLNHFALRFSL
>NC_014210.1|WP_013152400.1|1668426_1670451_-|CocE/NonD-family-hydrolase
MHVVNNLPNAVQEDEHLWIPMSDGVHLAARVWRATSSDVSPVPAVLEYLPYRRRDLTSVRDSMHHPYIAGHGYACVRVDLRGTGDSEGVLTDEYLEREQLDAEEVLAWLAEQPWCNGKTSMMGLSWGGFAALQVAARQPPSLGAIVISSFTDDRYGDDFHYMGGCLLSDNLAEAGTMFSAGTCPPDPVTVGDDWRRMWHERLEATEPWVLEWLRHQRRDDYWRHASVSEDYSKVRCPVLASSGWADGYSNAVFRLLENLEAPRRGLIGPWSHRYPHMGSPGPAIGYLQEVVRWLDRWLKDRENGVDEGPSLWAWMQDSVLPSTAYTERPGRWVREDVWPSPSVEYRGYPLARYRIGRPGEEVHSESLTVRSPLTVGQFAGKWASYNAPPDLPYDQREEDGGSLVFDSDVLSEDVEILGAAEVELDVSVTEPVAMVAARLVDVAPDGSATRVTYGLLNLTHRDGHEHPEKLEPGEIYRVKVTMNGVAQAFPVGHRIRLSLSTSYWPLAWPPPKPALLTVHPENSRLLLPVRPHSEADEPHPEPFGEPEAAPEISTTRREKPEHSWTVYRDLVDTRSALEIVKDGGILHFDDIDLDVGRRAYEYYESVAGDFTSARGESTWTMRFARDGWRTRTETHTSLECTETEFRVYATLDAFENDERVFSRQWTETLPRDHL
>NC_014210.1|WP_041552491.1|1670466_1671771_-|ATP-grasp-domain-containing-protein
MKNVFVVGLDEHNLEILRRTPTGQHCEFHQLLNLDELQVGEIDIQELLAKAERILDDFDGSVDAIVGYWDFPVTLFVPILCSRRGLPSSSLESFVKCEHKYWSRLEQQKVIDEYPAFGLVELSEENPAPPESPAYPMWLKPVKSASSELAYKVGDDEAFQQAVSLLRDGVDRIGRPFEQILEMVDLPPEISSVGGRTALAEAAMQGVQAAVEGYVYKGEVVVYGALDSVDYPGSSVFLRHQYPSGLPENVCRWMSEVATKVIERVGMDNSTFSVEFFYDPVEEKLGLLEVNTRHSQSHAELFELVDGVANHERMLRLGFGQDPALDEDARGEYRVAAEWYHRRFEDGVAARVPTPEEVSALEESLPGVTIEIVPKQGQRLSDMTAQDSYSFELAKITIGAEDETAMRAKYERCVDELVFEFEDEHGTKDKLAEH
>NC_014210.1|WP_013152402.1|1672193_1673192_-|L-glyceraldehyde-3-phosphate-reductase
MTYVAAPERYETMPYRRCGRSGLRLPALSLGLWHNFGHERGIEDQRAVLLRAFDLGVTHFDLANNYGPPPGSAEENFGRVMTRDLRRYRDEIVVSTKAGYLMWPGPYGEWGSRKYLLSSLDQSLERMGLEYVDVFYHHRPDPDTPLEESMGALDTAVRQGKALYAGVSNYSPEQTREAAAILRDLGTPMLIHQPSYSMFNRWVEDGLLDVLDEVGAGSIAYSPLAQGLLTDRYLHGVPEGSRAAGSSPFLNAEGITEEVLERVRGLDGIARRRGQSLAQMALAWVLRGGRVTSAVIGASSVEQLEDNVAAVADLEFDAGELAEIDRYAPRAR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_014210_14

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_014210_14

2013511-2015306

Orphan

I-E:NA

Consensus_repeat	Method
GTGAGCCCCGCGCACGCGGGGATGAACCG	PILER-CR
GTGAGCCCCGCGCACGCGGGGATGAACCG	CRISPRCasFinder
GTGAGCCCCGCGCACGCGGGGATG	CRT
AGTGAGCCCCGCGCACGCGGGGATGAACCG	PILER-CR
GTGAGCCCCGCGCACGCGGGGATGAACCG	PILER-CR

29 spacers

The CRISPR arrays of NC_014210_14

>merge|NC_014210|14|2013511-2015306|PILER-CR,CRISPRCasFinder,CRT,PILER-CR,PILER-CR
GTGAGCCCCGCGCACGCGGGGATGAACCGGGCAGCAGGTCCTCCAGGGAACCGCCGCCCCGGTGAGCCCCGCGCACGCGGGGATGAACCGCACTCGCCTTCACTCTGTCGAACGACCGGTCGTGAGCCCCGCGCACGCGGGGATGAACCGGTCTGATCACGTCTATGGTGGTCGGTCTTCGGTGAGCCCCGCGCACGCGGGGATGAACCGTTCACCCCCCGGCGTCCGGTGACCCGTGCTCCGTGAGCCCCGCGCACGCGGGGATGAACCGCGCACGTCGATGCTCCCCGAGACGCGGCGGGAGTGAGCCCCGCGCACGCGGGGATGAACCGCCGGGGCGGGTCACGGACGTGTACCTGCTCCAGTGAGCCCCGCGCACGCGGGGATGAACCGCCGGGGCGGGTCACGGACGTGTACCTGCTCCAGTGAGCCCCGCGCACGCGGGGATGAACCGGCCATGCTCGCGTCCGAGACCCGCAAGATCCAGTGAGCCCCGCGCACGCGGGGATGAACCGGTGACGTCGTCGGGCGTGTAGAGCTCGCGCTTGTGAGCCCCGCGCACGCGGGGATGAACCGACTTGCCCCCCGTTGGCCCTACTGCTGTCTCTGTGAGCCCCGCGCACGCGGGGATGAACCGGCGTTCATCAGCTGAGGCTCACCGGCGGCGGGGTGAGCCCCGCGCACGCGGGGATGAACCGATCCCGGCCAGCCCCCTGCTCAGGTTGCCGCTGTGAGCCCCGCGCACGCGGGGATGAACCGGGATTGACGGGGTTCGTAGCCGGTGACGATTCGTGAGCCCCGCGCACGCGGGGATGAACCGGCTCAGCCCACTGAGGGCTGAGAGGTCACCGCGTGAGCCCCGCGCACGCGGGGATGAACCGAGCATCATGCCCGTCTGTGCGGGGGAGCCCACGTGAGCCCCGCGCACGCGGGGATGAACCGCCGCAGGTCGAGAGGTACAGGTCAATCTCGGTGTGAGCCCCGCGCACGCGGGGATGAACCGGGGCGACAGACCACCCGGCTACCAACCGTGTCGTGAGCCCCGCGCACGCGGGGATGAACCGGAGGAGTTCGCCTACGCCATCGCTGGGTCGGGGTGAGCCCCGCGCACGCGGGGATGAACCGTACGGCCAGCCGGTCGGTCCCTACCGCATCGCGTGAGCCCCGCGCACGCGGGGATGGACCGTGCGCGGCCACGTACCCGGCGAGGTCGATCACGTGAGCCCCGCGCACGCGGGGATGGACCGGGATGACGCAAGCCGAGATCGTCCGGGCCACGGTGAGCCCCGCGCACGCGGGGATGGACCGCCATCGACAGGGGCACACGCCCCGCCGACCTAGTGAGCCCCGCGCACGCGGGGATGGACCGGCCATCGCGATCGCCGCTGTCCTGGGCATGCAGTGAGCCCCGCGCACGCGGGGATGGACCGGCGACCCCCGCTGACGCTCCCATCGTCGTCTCGTGAGCCCCGCGCACGCGGGGATGGACCGCCCCTCCAGCGCAAGCTGGGCGTGGACGCTGAGTGAGCCCCGCGCACGCGGGGATGGACCGATGATGGTGGTGGCGTTGGACGCCGGGGCGGGGTGAGCCCCGCGCACGCGGGGATGGACCGACATCGACCTCCTCACCGCAGAATCCCCCCACGTGAGCCCCGCGCACGCGGGGATGGACCGGCCGTCAGCGTGGAACTCAGAGGCGTATGGGAGTGAGCCCCGCGCACGCGGGGATGAACCGCGGGCCATCTGCATGGCGGCCTCTTCGGCGACGTGAGCCCTGTGTACGCGGGGATGGACCG

>NC_014210|14|8|2013511-2013720|PILER-CR
GTGAGCCCCGCGCACGCGGGGATGAACCG	GGCAGCAGGTCCTCCAGGGAACCGCCGCCCCG
GTGAGCCCCGCGCACGCGGGGATGAACCG	CACTCGCCTTCACTCTGTCGAACGACCGGTC
GTGAGCCCCGCGCACGCGGGGATGAACCG	GTCTGATCACGTCTATGGTGGTCGGTCTTCG
GTGAGCCCCGCGCACGCGGGGATGAACCGTTCACCCCCCGGCGTCCGGTGACCCGTGCTCCGTGAGCCCCGCGCACGCGGGGATGAACCGCGCACGTCGATGCTCCCCGAGACGCGGCGGGAGTGAGCCCCGCGCACGCGGGGATGAACCG	CCGGGGCGGGTCACGGACGTGTACCTGCTCC
AGTGAGCCCCGCGCACGCGGGGATGAACCG	CCGGGGCGGGTCACGGACGTGTACCTGCTCC
AGTGAGCCCCGCGCACGCGGGGATGAACCG	GCCATGCTCGCGTCCGAGACCCGCAAGATCC
AGTGAGCCCCGCGCACGCGGGGATGAACCG	GTGACGTCGTCGGGCGTGTAGAGCTCGCGCT
TGTGAGCCCCGCGCACGCGGGGATGAACCGACTTGCCCCCCGTTGGCCCTACTGCTGTCTCTGTGAGCCCCGCGCACGCGGGGATGAACCGGCGTTCATCAGCTGAGGCTCACCGGCGGCGGGGTGAGCCCCGCGCACGCGGGGATGAACCG	ATCCCGGCCAGCCCCCTGCTCAGGTTGCCGCT
GTGAGCCCCGCGCACGCGGGGATGAACCG	GGATTGACGGGGTTCGTAGCCGGTGACGATTC
GTGAGCCCCGCGCACGCGGGGATGAACCG	GCTCAGCCCACTGAGGGCTGAGAGGTCACCGC
GTGAGCCCCGCGCACGCGGGGATGAACCG	AGCATCATGCCCGTCTGTGCGGGGGAGCCCAC
GTGAGCCCCGCGCACGCGGGGATGAACCG	CCGCAGGTCGAGAGGTACAGGTCAATCTCGGT
GTGAGCCCCGCGCACGCGGGGATGAACCG	GGGCGACAGACCACCCGGCTACCAACCGTGTC
GTGAGCCCCGCGCACGCGGGGATGAACCG	GAGGAGTTCGCCTACGCCATCGCTGGGTCGGG
GTGAGCCCCGCGCACGCGGGGATGAACCG	TACGGCCAGCCGGTCGGTCCCTACCGCATCGC
GTGAGCCCCGCGCACGCGGGGATGGACCG	TGCGCGGCCACGTACCCGGCGAGGTCGATCAC
GTGAGCCCCGCGCACGCGGGGATGGACCG	GGATGACGCAAGCCGAGATCGTCCGGGCCACG
GTGAGCCCCGCGCACGCGGGGATGGACCG	CCATCGACAGGGGCACACGCCCCGCCGACCTA
GTGAGCCCCGCGCACGCGGGGATGGACCG	GCCATCGCGATCGCCGCTGTCCTGGGCATGCA
GTGAGCCCCGCGCACGCGGGGATGGACCG	GCGACCCCCGCTGACGCTCCCATCGTCGTCTC
GTGAGCCCCGCGCACGCGGGGATGGACCG	CCCCTCCAGCGCAAGCTGGGCGTGGACGCTGA
GTGAGCCCCGCGCACGCGGGGATGGACCG	ATGATGGTGGTGGCGTTGGACGCCGGGGCGGG
GTGAGCCCCGCGCACGCGGGGATGGACCG	ACATCGACCTCCTCACCGCAGAATCCCCCCAC
GTGAGCCCCGCGCACGCGGGGATGGACCG	GCCGTCAGCGTGGAACTCAGAGGCGTATGGGA


>NC_014210|14|13|2013511-2015306|CRISPRCasFinder
GTGAGCCCCGCGCACGCGGGGATGAACCG	GGCAGCAGGTCCTCCAGGGAACCGCCGCCCCG
GTGAGCCCCGCGCACGCGGGGATGAACCG	CACTCGCCTTCACTCTGTCGAACGACCGGTC
GTGAGCCCCGCGCACGCGGGGATGAACCG	GTCTGATCACGTCTATGGTGGTCGGTCTTCG
GTGAGCCCCGCGCACGCGGGGATGAACCG	TTCACCCCCCGGCGTCCGGTGACCCGTGCTCC
GTGAGCCCCGCGCACGCGGGGATGAACCG	CGCACGTCGATGCTCCCCGAGACGCGGCGGGA
GTGAGCCCCGCGCACGCGGGGATGAACCG	CCGGGGCGGGTCACGGACGTGTACCTGCTCCA
GTGAGCCCCGCGCACGCGGGGATGAACCG	CCGGGGCGGGTCACGGACGTGTACCTGCTCCA
GTGAGCCCCGCGCACGCGGGGATGAACCG	GCCATGCTCGCGTCCGAGACCCGCAAGATCCA
GTGAGCCCCGCGCACGCGGGGATGAACCG	GTGACGTCGTCGGGCGTGTAGAGCTCGCGCTT
GTGAGCCCCGCGCACGCGGGGATGAACCG	ACTTGCCCCCCGTTGGCCCTACTGCTGTCTCT
GTGAGCCCCGCGCACGCGGGGATGAACCG	GCGTTCATCAGCTGAGGCTCACCGGCGGCGGG
GTGAGCCCCGCGCACGCGGGGATGAACCG	ATCCCGGCCAGCCCCCTGCTCAGGTTGCCGCT
GTGAGCCCCGCGCACGCGGGGATGAACCG	GGATTGACGGGGTTCGTAGCCGGTGACGATTC
GTGAGCCCCGCGCACGCGGGGATGAACCG	GCTCAGCCCACTGAGGGCTGAGAGGTCACCGC
GTGAGCCCCGCGCACGCGGGGATGAACCG	AGCATCATGCCCGTCTGTGCGGGGGAGCCCAC
GTGAGCCCCGCGCACGCGGGGATGAACCG	CCGCAGGTCGAGAGGTACAGGTCAATCTCGGT
GTGAGCCCCGCGCACGCGGGGATGAACCG	GGGCGACAGACCACCCGGCTACCAACCGTGTC
GTGAGCCCCGCGCACGCGGGGATGAACCG	GAGGAGTTCGCCTACGCCATCGCTGGGTCGGG
GTGAGCCCCGCGCACGCGGGGATGAACCG	TACGGCCAGCCGGTCGGTCCCTACCGCATCGC
GTGAGCCCCGCGCACGCGGGGATGGACCG	TGCGCGGCCACGTACCCGGCGAGGTCGATCAC
GTGAGCCCCGCGCACGCGGGGATGGACCG	GGATGACGCAAGCCGAGATCGTCCGGGCCACG
GTGAGCCCCGCGCACGCGGGGATGGACCG	CCATCGACAGGGGCACACGCCCCGCCGACCTA
GTGAGCCCCGCGCACGCGGGGATGGACCG	GCCATCGCGATCGCCGCTGTCCTGGGCATGCA
GTGAGCCCCGCGCACGCGGGGATGGACCG	GCGACCCCCGCTGACGCTCCCATCGTCGTCTC
GTGAGCCCCGCGCACGCGGGGATGGACCG	CCCCTCCAGCGCAAGCTGGGCGTGGACGCTGA
GTGAGCCCCGCGCACGCGGGGATGGACCG	ATGATGGTGGTGGCGTTGGACGCCGGGGCGGG
GTGAGCCCCGCGCACGCGGGGATGGACCG	ACATCGACCTCCTCACCGCAGAATCCCCCCAC
GTGAGCCCCGCGCACGCGGGGATGGACCG	GCCGTCAGCGTGGAACTCAGAGGCGTATGGGA
GTGAGCCCCGCGCACGCGGGGATGAACCG	CGGGCCATCTGCATGGCGGCCTCTTCGGCGAC
GTGAGCCCTGTGTACGCGGGGATGGACCG

>NC_014210|14|8|2013511-2015301|CRT
GTGAGCCCCGCGCACGCGGGGATG	AACCGGGCAGCAGGTCCTCCAGGGAACCGCCGCCCCG
GTGAGCCCCGCGCACGCGGGGATG	AACCGCACTCGCCTTCACTCTGTCGAACGACCGGTC
GTGAGCCCCGCGCACGCGGGGATG	AACCGGTCTGATCACGTCTATGGTGGTCGGTCTTCG
GTGAGCCCCGCGCACGCGGGGATG	AACCGTTCACCCCCCGGCGTCCGGTGACCCGTGCTCC
GTGAGCCCCGCGCACGCGGGGATG	AACCGCGCACGTCGATGCTCCCCGAGACGCGGCGGGA
GTGAGCCCCGCGCACGCGGGGATG	AACCGCCGGGGCGGGTCACGGACGTGTACCTGCTCCA
GTGAGCCCCGCGCACGCGGGGATG	AACCGCCGGGGCGGGTCACGGACGTGTACCTGCTCCA
GTGAGCCCCGCGCACGCGGGGATG	AACCGGCCATGCTCGCGTCCGAGACCCGCAAGATCCA
GTGAGCCCCGCGCACGCGGGGATG	AACCGGTGACGTCGTCGGGCGTGTAGAGCTCGCGCTT
GTGAGCCCCGCGCACGCGGGGATG	AACCGACTTGCCCCCCGTTGGCCCTACTGCTGTCTCT
GTGAGCCCCGCGCACGCGGGGATG	AACCGGCGTTCATCAGCTGAGGCTCACCGGCGGCGGG
GTGAGCCCCGCGCACGCGGGGATG	AACCGATCCCGGCCAGCCCCCTGCTCAGGTTGCCGCT
GTGAGCCCCGCGCACGCGGGGATG	AACCGGGATTGACGGGGTTCGTAGCCGGTGACGATTC
GTGAGCCCCGCGCACGCGGGGATG	AACCGGCTCAGCCCACTGAGGGCTGAGAGGTCACCGC
GTGAGCCCCGCGCACGCGGGGATG	AACCGAGCATCATGCCCGTCTGTGCGGGGGAGCCCAC
GTGAGCCCCGCGCACGCGGGGATG	AACCGCCGCAGGTCGAGAGGTACAGGTCAATCTCGGT
GTGAGCCCCGCGCACGCGGGGATG	AACCGGGGCGACAGACCACCCGGCTACCAACCGTGTC
GTGAGCCCCGCGCACGCGGGGATG	AACCGGAGGAGTTCGCCTACGCCATCGCTGGGTCGGG
GTGAGCCCCGCGCACGCGGGGATG	AACCGTACGGCCAGCCGGTCGGTCCCTACCGCATCGC
GTGAGCCCCGCGCACGCGGGGATG	GACCGTGCGCGGCCACGTACCCGGCGAGGTCGATCAC
GTGAGCCCCGCGCACGCGGGGATG	GACCGGGATGACGCAAGCCGAGATCGTCCGGGCCACG
GTGAGCCCCGCGCACGCGGGGATG	GACCGCCATCGACAGGGGCACACGCCCCGCCGACCTA
GTGAGCCCCGCGCACGCGGGGATG	GACCGGCCATCGCGATCGCCGCTGTCCTGGGCATGCA
GTGAGCCCCGCGCACGCGGGGATG	GACCGGCGACCCCCGCTGACGCTCCCATCGTCGTCTC
GTGAGCCCCGCGCACGCGGGGATG	GACCGCCCCTCCAGCGCAAGCTGGGCGTGGACGCTGA
GTGAGCCCCGCGCACGCGGGGATG	GACCGATGATGGTGGTGGCGTTGGACGCCGGGGCGGG
GTGAGCCCCGCGCACGCGGGGATG	GACCGACATCGACCTCCTCACCGCAGAATCCCCCCAC
GTGAGCCCCGCGCACGCGGGGATG	GACCGGCCGTCAGCGTGGAACTCAGAGGCGTATGGGA
GTGAGCCCCGCGCACGCGGGGATG	AACCGCGGGCCATCTGCATGGCGGCCTCTTCGGCGAC
GTGAGCCCTGTGTACGCGGGGATG

>NC_014210|14|9|2013813-2014086|PILER-CR
	GGCAGCAGGTCCTCCAGGGAACCGCCGCCCCG
GTGAGCCCCGCGCACGCGGGGATGAACCG	CACTCGCCTTCACTCTGTCGAACGACCGGTC
GTGAGCCCCGCGCACGCGGGGATGAACCG	GTCTGATCACGTCTATGGTGGTCGGTCTTCG
GTGAGCCCCGCGCACGCGGGGATGAACCGTTCACCCCCCGGCGTCCGGTGACCCGTGCTCCGTGAGCCCCGCGCACGCGGGGATGAACCGCGCACGTCGATGCTCCCCGAGACGCGGCGGGAGTGAGCCCCGCGCACGCGGGGATGAACCG	CCGGGGCGGGTCACGGACGTGTACCTGCTCC
AGTGAGCCCCGCGCACGCGGGGATGAACCG	CCGGGGCGGGTCACGGACGTGTACCTGCTCC
AGTGAGCCCCGCGCACGCGGGGATGAACCG	GCCATGCTCGCGTCCGAGACCCGCAAGATCC
AGTGAGCCCCGCGCACGCGGGGATGAACCG	GTGACGTCGTCGGGCGTGTAGAGCTCGCGCT
TGTGAGCCCCGCGCACGCGGGGATGAACCGACTTGCCCCCCGTTGGCCCTACTGCTGTCTCTGTGAGCCCCGCGCACGCGGGGATGAACCGGCGTTCATCAGCTGAGGCTCACCGGCGGCGGGGTGAGCCCCGCGCACGCGGGGATGAACCG	ATCCCGGCCAGCCCCCTGCTCAGGTTGCCGCT
GTGAGCCCCGCGCACGCGGGGATGAACCG	GGATTGACGGGGTTCGTAGCCGGTGACGATTC
GTGAGCCCCGCGCACGCGGGGATGAACCG	GCTCAGCCCACTGAGGGCTGAGAGGTCACCGC
GTGAGCCCCGCGCACGCGGGGATGAACCG	AGCATCATGCCCGTCTGTGCGGGGGAGCCCAC
GTGAGCCCCGCGCACGCGGGGATGAACCG	CCGCAGGTCGAGAGGTACAGGTCAATCTCGGT
GTGAGCCCCGCGCACGCGGGGATGAACCG	GGGCGACAGACCACCCGGCTACCAACCGTGTC
GTGAGCCCCGCGCACGCGGGGATGAACCG	GAGGAGTTCGCCTACGCCATCGCTGGGTCGGG
GTGAGCCCCGCGCACGCGGGGATGAACCG	TACGGCCAGCCGGTCGGTCCCTACCGCATCGC
GTGAGCCCCGCGCACGCGGGGATGGACCG	TGCGCGGCCACGTACCCGGCGAGGTCGATCAC
GTGAGCCCCGCGCACGCGGGGATGGACCG	GGATGACGCAAGCCGAGATCGTCCGGGCCACG
GTGAGCCCCGCGCACGCGGGGATGGACCG	CCATCGACAGGGGCACACGCCCCGCCGACCTA
GTGAGCCCCGCGCACGCGGGGATGGACCG	GCCATCGCGATCGCCGCTGTCCTGGGCATGCA
GTGAGCCCCGCGCACGCGGGGATGGACCG	GCGACCCCCGCTGACGCTCCCATCGTCGTCTC
GTGAGCCCCGCGCACGCGGGGATGGACCG	CCCCTCCAGCGCAAGCTGGGCGTGGACGCTGA
GTGAGCCCCGCGCACGCGGGGATGGACCG	ATGATGGTGGTGGCGTTGGACGCCGGGGCGGG
GTGAGCCCCGCGCACGCGGGGATGGACCG	ACATCGACCTCCTCACCGCAGAATCCCCCCAC
GTGAGCCCCGCGCACGCGGGGATGGACCG	GCCGTCAGCGTGGAACTCAGAGGCGTATGGGA


>NC_014210|14|10|2014180-2015245|PILER-CR
	GGCAGCAGGTCCTCCAGGGAACCGCCGCCCCG
GTGAGCCCCGCGCACGCGGGGATGAACCG	CACTCGCCTTCACTCTGTCGAACGACCGGTC
GTGAGCCCCGCGCACGCGGGGATGAACCG	GTCTGATCACGTCTATGGTGGTCGGTCTTCG
GTGAGCCCCGCGCACGCGGGGATGAACCGTTCACCCCCCGGCGTCCGGTGACCCGTGCTCCGTGAGCCCCGCGCACGCGGGGATGAACCGCGCACGTCGATGCTCCCCGAGACGCGGCGGGAGTGAGCCCCGCGCACGCGGGGATGAACCG	CCGGGGCGGGTCACGGACGTGTACCTGCTCC
AGTGAGCCCCGCGCACGCGGGGATGAACCG	CCGGGGCGGGTCACGGACGTGTACCTGCTCC
AGTGAGCCCCGCGCACGCGGGGATGAACCG	GCCATGCTCGCGTCCGAGACCCGCAAGATCC
AGTGAGCCCCGCGCACGCGGGGATGAACCG	GTGACGTCGTCGGGCGTGTAGAGCTCGCGCT
TGTGAGCCCCGCGCACGCGGGGATGAACCGACTTGCCCCCCGTTGGCCCTACTGCTGTCTCTGTGAGCCCCGCGCACGCGGGGATGAACCGGCGTTCATCAGCTGAGGCTCACCGGCGGCGGGGTGAGCCCCGCGCACGCGGGGATGAACCG	ATCCCGGCCAGCCCCCTGCTCAGGTTGCCGCT
GTGAGCCCCGCGCACGCGGGGATGAACCG	GGATTGACGGGGTTCGTAGCCGGTGACGATTC
GTGAGCCCCGCGCACGCGGGGATGAACCG	GCTCAGCCCACTGAGGGCTGAGAGGTCACCGC
GTGAGCCCCGCGCACGCGGGGATGAACCG	AGCATCATGCCCGTCTGTGCGGGGGAGCCCAC
GTGAGCCCCGCGCACGCGGGGATGAACCG	CCGCAGGTCGAGAGGTACAGGTCAATCTCGGT
GTGAGCCCCGCGCACGCGGGGATGAACCG	GGGCGACAGACCACCCGGCTACCAACCGTGTC
GTGAGCCCCGCGCACGCGGGGATGAACCG	GAGGAGTTCGCCTACGCCATCGCTGGGTCGGG
GTGAGCCCCGCGCACGCGGGGATGAACCG	TACGGCCAGCCGGTCGGTCCCTACCGCATCGC
GTGAGCCCCGCGCACGCGGGGATGGACCG	TGCGCGGCCACGTACCCGGCGAGGTCGATCAC
GTGAGCCCCGCGCACGCGGGGATGGACCG	GGATGACGCAAGCCGAGATCGTCCGGGCCACG
GTGAGCCCCGCGCACGCGGGGATGGACCG	CCATCGACAGGGGCACACGCCCCGCCGACCTA
GTGAGCCCCGCGCACGCGGGGATGGACCG	GCCATCGCGATCGCCGCTGTCCTGGGCATGCA
GTGAGCCCCGCGCACGCGGGGATGGACCG	GCGACCCCCGCTGACGCTCCCATCGTCGTCTC
GTGAGCCCCGCGCACGCGGGGATGGACCG	CCCCTCCAGCGCAAGCTGGGCGTGGACGCTGA
GTGAGCCCCGCGCACGCGGGGATGGACCG	ATGATGGTGGTGGCGTTGGACGCCGGGGCGGG
GTGAGCCCCGCGCACGCGGGGATGGACCG	ACATCGACCTCCTCACCGCAGAATCCCCCCAC
GTGAGCCCCGCGCACGCGGGGATGGACCG	GCCGTCAGCGTGGAACTCAGAGGCGTATGGGA
GTGAGCCCCGCGCACGCGGGGATGAACCG

Protein	Signature genes	Signature genes Name	Protein_function
NC_014210.1\|WP_013152683.1\|2020042_2020549_-\|flavoprotein	unknown	unknown	gnl\|CDD\|376786
NC_014210.1\|WP_013152680.1\|2018127_2018253_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|133390
NC_014210.1\|WP_013152670.1\|2004880_2006320_+\|ATPase	unknown	unknown	gnl\|CDD\|273349
NC_014210.1\|WP_013152674.1\|2010315_2011242_-\|universal-stress-protein	unknown	unknown	gnl\|CDD\|366180
NC_014210.1\|WP_013152671.1\|2006621_2007818_-\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|224983
NC_014210.1\|WP_013152677.1\|2015420_2015945_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|173926
NC_014210.1\|WP_013152685.1\|2021499_2021715_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|133390
NC_014210.1\|WP_013152686.1\|2021890_2022343_-\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|379279
NC_014210.1\|WP_013152667.1\|2000465_2001269_+\|FadR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225097
NC_014210.1\|WP_013152668.1\|2001306_2003841_-\|sensor-histidine-kinase-KdpD	unknown	unknown	gnl\|CDD\|225115
NC_014210.1\|WP_013152672.1\|2007856_2009188_-\|YeeE/YedE-family-protein	unknown	unknown	gnl\|CDD\|377230
NC_014210.1\|WP_126625062.1\|2015958_2017425_-\|asparagine-synthase	unknown	unknown	gnl\|CDD\|238949
NC_014210.1\|WP_126625063.1\|2018325_2018532_-\|hypothetical-protein	unknown	unknown	unknown
NC_014210.1\|WP_013152679.1\|2017579_2017744_-\|hypothetical-protein	unknown	unknown	unknown
NC_014210.1\|WP_013152673.1\|2010022_2010307_+\|hypothetical-protein	unknown	unknown	unknown
NC_014210.1\|WP_013152675.1\|2011730_2011931_-\|hypothetical-protein	unknown	unknown	unknown
NC_014210.1\|WP_041553102.1\|2012178_2013282_+\|protein-L-isoaspartate-O-methyltransferase	unknown	unknown	gnl\|CDD\|275041
NC_014210.1\|WP_013152682.1\|2018816_2020028_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
NC_014210.1\|WP_041553104.1\|2020957_2021494_+\|CYTH-domain-containing-protein	unknown	unknown	gnl\|CDD\|224354
NC_014210.1\|WP_013152669.1\|2004119_2004884_+\|response-regulator	unknown	unknown	gnl\|CDD\|182522

Protein	Function_ID	Function_description	E-value
NC_014210.1\|WP_013152683.1\|2020042_2020549_-\|flavoprotein	gnl\|CDD\|376786	pfam02441, Flavoprotein, Flavoprotein. This family contains diverse flavoprotein enzymes. This family includes epidermin biosynthesis protein, EpiD, which has been shown to be a flavoprotein that binds FMN. This enzyme catalyzes the removal of two reducing equivalents from the cysteine residue of the C-terminal meso-lanthionine of epidermin to form a --C==C-- double bond. This family also includes the B chain of dipicolinate synthase a small polar molecule that accumulates to high concentrations in bacterial endospores, and is thought to play a role in spore heat resistance, or the maintenance of heat resistance. dipicolinate synthase catalyzes the formation of dipicolinic acid from dihydroxydipicolinic acid. This family also includes phenyl-acrylic acid decarboxylase (EC:4.1.1.-).	4.85063e-15
NC_014210.1\|WP_013152680.1\|2018127_2018253_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|133390	cd04762, HTH_MerR-trunc, Helix-Turn-Helix DNA binding domain of truncated MerR-like proteins. Proteins in this family mostly have a truncated helix-turn-helix (HTH) MerR-like domain. They lack a portion of the C-terminal region, called Wing 2 and the long dimerization helix that is typically present in MerR-like proteins. These truncated domains are found in response regulator receiver (REC) domain proteins (i.e., CheY), cytosine-C5 specific DNA methylases, IS607 transposase-like proteins, and RacA, a bacterial protein that anchors chromosomes to cell poles.	6.28548e-09
NC_014210.1\|WP_013152670.1\|2004880_2006320_+\|ATPase	gnl\|CDD\|273349	TIGR00933, Trk_system_potassium_uptake_protein_trkH., potassium uptake protein, TrkH family. The proteins of the Trk family are derived from Gram-negative and Gram-positive bacteria, yeast and wheat. The proteins of E. coli K12 TrkH and TrkG as well as several yeast proteins have been functionally characterized.The E. coli TrkH and TrkG proteins are complexed to two peripheral membrane proteins, TrkA, an NAD-binding protein, and TrkE, an ATP-binding protein. This complex forms the potassium uptake system. [Transport and binding proteins, Cations and iron carrying compounds].	5.77702e-88
NC_014210.1\|WP_013152674.1\|2010315_2011242_-\|universal-stress-protein	gnl\|CDD\|366180	pfam00582, Usp, Universal stress protein family. The universal stress protein UspA is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. UspA enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae UspA reveals an alpha/beta fold similar to that of the Methanococcus jannaschii MJ0577 protein, which binds ATP, though UspA lacks ATP-binding activity.	2.68663e-22
NC_014210.1\|WP_013152671.1\|2006621_2007818_-\|FAD-dependent-oxidoreductase	gnl\|CDD\|224983	COG2072, TrkA, Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism].	2.47835e-37
NC_014210.1\|WP_013152677.1\|2015420_2015945_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|173926	cd04301, NAT_SF, N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate. NAT (N-Acyltransferase) is a large superfamily of enzymes that mostly catalyze the transfer of an acyl group to a substrate and are implicated in a variety of functions, ranging from bacterial antibiotic resistance to circadian rhythms in mammals. Members include GCN5-related N-Acetyltransferases (GNAT) such as Aminoglycoside N-acetyltransferases, Histone N-acetyltransferase (HAT) enzymes, and Serotonin N-acetyltransferase, which catalyze the transfer of an acetyl group to a substrate. The kinetic mechanism of most GNATs involves the ordered formation of a ternary complex: the reaction begins with Acetyl Coenzyme A (AcCoA) binding, followed by binding of substrate, then direct transfer of the acetyl group from AcCoA to the substrate, followed by product and subsequent CoA release. Other family members include Arginine/ornithine N-succinyltransferase, Myristoyl-CoA: protein N-myristoyltransferase, and Acyl-homoserinelactone synthase which have a similar catalytic mechanism but differ in types of acyl groups transferred. Leucyl/phenylalanyl-tRNA-protein transferase and FemXAB nonribosomal peptidyltransferases which catalyze similar peptidyltransferase reactions are also included.	0.00440944
NC_014210.1\|WP_013152685.1\|2021499_2021715_-\|hypothetical-protein	gnl\|CDD\|133390	cd04762, HTH_MerR-trunc, Helix-Turn-Helix DNA binding domain of truncated MerR-like proteins. Proteins in this family mostly have a truncated helix-turn-helix (HTH) MerR-like domain. They lack a portion of the C-terminal region, called Wing 2 and the long dimerization helix that is typically present in MerR-like proteins. These truncated domains are found in response regulator receiver (REC) domain proteins (i.e., CheY), cytosine-C5 specific DNA methylases, IS607 transposase-like proteins, and RacA, a bacterial protein that anchors chromosomes to cell poles.	4.95346e-10
NC_014210.1\|WP_013152667.1\|2000465_2001269_+\|FadR-family-transcriptional-regulator	gnl\|CDD\|225097	COG2186, FadR, Transcriptional regulators [Transcription].	7.92132e-44
NC_014210.1\|WP_013152668.1\|2001306_2003841_-\|sensor-histidine-kinase-KdpD	gnl\|CDD\|225115	COG2205, KdpD, Osmosensitive K+ channel histidine kinase [Signal transduction mechanisms].	0
NC_014210.1\|WP_013152672.1\|2007856_2009188_-\|YeeE/YedE-family-protein	gnl\|CDD\|377230	pfam04143, Sulf_transp, Sulphur transport. This is an integral membrane protein. It is predicted to have a function in the transport of sulphur-containing molecules. It contains several conserved glycines and an invariant cysteine that is probably an important functional residue.	7.11699e-49
NC_014210.1\|WP_126625062.1\|2015958_2017425_-\|asparagine-synthase	gnl\|CDD\|238949	cd01991, Asn_Synthase_B_C, The C-terminal domain of Asparagine Synthase B. This domain is always found associated n-terminal amidotransferase domain. Family members that contain this domain catalyse the conversion of aspartate to asparagine. Asparagine synthetase B catalyzes the assembly of asparagine from aspartate, Mg(2+)ATP, and glutamine. The three-dimensional architecture of the N-terminal domain of asparagine synthetase B is similar to that observed for glutamine phosphoribosylpyrophosphate amidotransferase while the molecular motif of the C-domain is reminiscent to that observed for GMP synthetase .	1.6309e-08
NC_014210.1\|WP_013152686.1\|2021890_2022343_-\|ATP-binding-protein	gnl\|CDD\|379279	pfam13581, HATPase_c_2, Histidine kinase-like ATPase domain.	2.98221e-19
NC_014210.1\|WP_041553102.1\|2012178_2013282_+\|protein-L-isoaspartate-O-methyltransferase	gnl\|CDD\|275041	TIGR04188, conserved_hypothetical_protein, methyltransferase, ATP-grasp peptide maturase system. Members of this protein family are predicted SAM-dependent methyltransferases that regularly occur in the context of a putative peptide modification ATP-grasp enzyme (TIGR04187, related to enzymes of microviridin maturation) and a putative ribosomal peptide modification target (TIGR04186).	4.00466e-46
NC_014210.1\|WP_013152682.1\|2018816_2020028_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	4.77052e-09
NC_014210.1\|WP_041553104.1\|2020957_2021494_+\|CYTH-domain-containing-protein	gnl\|CDD\|224354	COG1437, CyaB, Adenylate cyclase, class 2 (thermophilic) [Nucleotide transport and metabolism].	6.15179e-23
NC_014210.1\|WP_013152669.1\|2004119_2004884_+\|response-regulator	gnl\|CDD\|182522	PRK10529, PRK10529, DNA-binding transcriptional activator KdpE; Provisional.	3.258e-73

>NC_014210.1|WP_041553102.1|2012178_2013282_+|protein-L-isoaspartate-O-methyltransferase
MDDLDALHTALVERLDTTATIRDAFAAHPRHLFIPDMVWPDATGLPLHRTSDPGRWTRLVYGSDAVTTQANDGGPGPRNEPSSSSSAPQVMADMIAAAGISEGMRVLEVGTGTGWNAAILAALVGEKGSVTSIEIDLGVAALARERLTGTGVTVRTAAEPPPGEVYDAVIATCAATRIPDGWFAAAEGAVLVLPWSPHPAAHSTPIVALAVREGRGSGPFVREAAFMRDRTQRPGDLPFPGLGQQPTPAADFPVGSVELIGSGMMTQLMLMMPGVRLGTGLRPFRGEPGRIVWMGVGQAWAYVWPDGTVTGGGDRALGEELGHAYRMLRGAGFPGLESFVLEAVAGQDSCRVGCAALEQHWDHSVSP
>NC_014210.1|WP_013152675.1|2011730_2011931_-|hypothetical-protein
METSTDRTRIQPSGICRRGRHRWRHDPPDGKRLLCTRCKSMSMTNYGACREDCVDCHPPADEVEGQ
>NC_014210.1|WP_013152674.1|2010315_2011242_-|universal-stress-protein
MADDPIPSPKVAVGVDGSASARGALEWAAAEAELRQLPLYVVHALSMPLVMSVYAGPTRFPPTEEMTAQGRRILEEAAEHVRSLRPDLRVETALGLEEPPLALLRRTGHGDLVVVGSRGMGPVRSVLAGAAGMRLAAKALCPVVVVPGTEGRAPRLSGPLRIAVGVDGSVDSRRALDFALHRAALQEGSSVVVVHSWEVPLPFATASLTESGWTPPDDLLERQSEELVSGVLAEVMDDATADVDISAVRTQRNPVDALVEAAAEADLVVVGSRGRGGVRGALLGSVSQGVMHSSPVPVVVVPRHAEED
>NC_014210.1|WP_013152673.1|2010022_2010307_+|hypothetical-protein
MTLTRAALTAAAALALAGLAGAPALADEATAEPTTEPSCGSPLVLLSPGAKVEGSSCSVVSTVEQELQSVGSGGLLPSMPSMAGMSGMPGTGWG
>NC_014210.1|WP_013152672.1|2007856_2009188_-|YeeE/YedE-family-protein
MTTHPSAPPGATEPAPAGTAPDAAAPVSPALSLSWRPTLSVPQPRAAEAEPVRWWPLGIALAVAVGLAAYVWNTHGALPAVLLLLGTGLGFTLFHSRFGFTSAWRQFLAVGNGTGLRAHAVLLGTTATLFALVIGTGTGLFGNDPQASAGPIGIALFLGAFLFGIGMQLGGACASGTLFAVGSGQSAIVITLVGFIAGSVIYSAAWPLVNDLPALPPFLLSDHVGWGGSWAITIAVLAAVVVGTRVVQNRRVPPPVGTPPSARGLLRVVRGSWPMIAGALVLSVLGAAVLLVSGGAWGVTSAFNLWGAKALQLLGAHPETWAFWNQPQQAAQLAGPVLQDKTSLTNIGIILGAAVAAAAAGAWKLHTGLSWKLVAAGLLGGILMGIGARLAGGCNIGAYLAGIGSGSLHGWLWAVFALAGTWAGLRARSLFGLGVPKPGDSVC
>NC_014210.1|WP_013152671.1|2006621_2007818_-|FAD-dependent-oxidoreductase
MDGAEHVHDVVVVGGGQAGLAAGYFLRRAGLDFAVLDAGEGPGGSWTEYWDSLRLFSPAEHSMLPGWWMPAEEGREYPSARHVARYLAEYERRYELPVRRPVRVEAVEREDGALRVLAREGTGRGLLSGAPRSAAERPVDGGGRPPAVPGSPGSPAQRSPLVSWRARHVISATGTWRAPHVPDVAGRGLFAGRQLHTVGYRGPEEFAGQRVVVVGGGNSAAQILAELSEVAETTWATARPPRFLPDDLDGRALFGVATRAQRAAQRGEEAPEGVGDLGDIVVVPTVREARERGALKAEPMFDRLTRTGVAWNDGTSLDCDAVLWCTGFRPVLDHLAPLGLADGRGRIALEGTRSVAEPRLFLLGYGDWTGAASATLIGAGRTAKGTVAEITAALARRE
>NC_014210.1|WP_013152670.1|2004880_2006320_+|ATPase
MRTGTGQYPPGPRAPRVPRIPARAGARADRRLRDLSGWIKPPQLTAAAFAALILVGAGLLSLPAATEAGERAPFDTALFTATSAASVTGLAVVDTASYWSGLGEAVILALIQVGGFGIMALATVLTLVVGRQLGLRMAVRTGSEAKVVTLGEVRQLVTGVLVVTVVFETALAVALALRWWLGYGLSLPEAVYTGVFHAVSAFNNAGFALYADSLMGFAEDPWITLPLALGVLAGGLGFPVWVELWRFTRRRAEHRHWTLHAKITLVVTGLLLVVGFVAFLALEWSNPATMGGLDLRGKLLTAFFQSVMPRTAGFNSLDFGQMNTQTLLVTDILMFVGGGSAGTAGGIKVTTFAVLAFVVYANVRGEPTVHVSGRRLAEGTTSQATTVALLALGLVLAGTLTLMTITPFTLDQILFETTSAFATVGLSTGITADLPLLGQAVLMFLMFVGRIGPITLASALALRRRPRLYELPEERPIVG
>NC_014210.1|WP_013152669.1|2004119_2004884_+|response-regulator
MDKDTGTGAGRAPSVLVVDDDPLIRRTLEVNLRARGYTAYLADTGEHALRLVARHHPDLLLLDLGLSGMDGLEVLRGLRGWTDVPVVVLSGRDTEPMKVQALDLGADDYVIKPFGMDELFARVRAAMRRSAVPEYEAAVDTADFTVDLAAKQVLRGGEPVRLTPRQWHIVEVLARNPDRLVTHKHLLNEVWGPAYGRETNYLRVFMTKIRQRLEPDPPRPRYFLTEPGLGYRFRPGGGVAGGGAAGPEGRENGR
>NC_014210.1|WP_013152668.1|2001306_2003841_-|sensor-histidine-kinase-KdpD
MTRGHLRVYLGAAPGVGKTYRMLDEAHRRRDRGADVVIGFVESHGRAMTEAMVDDLETIPRAVLTHRGARLEEMDLDAVLARRPQVVLVDDLAHANAPGARNARRWQDIEALLEAGITVLSTLDVQHLESLNDVVERVTGTRQSETVPDAWVRGADQIELVDMTPEALRRRLAHGNVYGPDRIDAALGHRFRADTLTALRELALLWLAGRVDDELRRHRGEHRAASAWQTRERVVVGLSGGPGGEALIRRAARIAGRGRGVELLAVHVALGDGPVGADPALLARQRVLVEDLGGTYHQVLGEDVPAALTAFAQGVDATQLVLGASGRGRLARLLRPGVGAATAALSESIDVHLVTLEEAERGSGRARSGAVSRRRRLAGYALALTALALLVFGTGVPHSEEYLSGGILLVFATVTATALVGGLWPALAAAFSGFVVLNLFFTEPYETLVVNQPGNLLTLVVFVFVAVAVSVVVDKAARRTREAARASAEAQTLATVAGSVLRGSRPLEALLERLRETFSLESVALLERRPQASSRPDHRNDPGAWEAVASVGELPHSAPGGADVDVPVDEGLTLVLHGHRPRAGERRIIEAFAAQAAVALRQERLAQEAAAAGTLAEADRMRTALLAAVSHDLRAPLASAKASVTSLRSREVRFSEEVQAELLATADESLDRLTRLVTDLLDMSRLQAGVLGVTVTGLSLRESVFAVLDDLGEQGRAVRVRVPEELPEVAADPGLLERVLANVVGNALRFSPHDRPPSVTASWTGDQVELLVADHGPGVPEHERERMFVPFQRLGDTDAATGLGLGLALARGLMEAMGGSLLPETTPGGGLTLRLVLPVAGAAG
>NC_014210.1|WP_013152667.1|2000465_2001269_+|FadR-family-transcriptional-regulator
MGSASPGTQGEGLAGRSQPRHARPNSLTSQVVAFVEELCVGPDARPGSQLPSEKELAERFGVSRVVLREALRTLEAKGLIHRRQGKPAVIASPNALPVENFVALSVLRDRRALMEFTEIRKALEVHGARLAAQRIAGPEEEQTREDIARARQAIADMRAAPLDVPNRVRTDFAFHQALISASGNRSLTQILDALERSLADSREQSHRRFLATAQDPAVSATEHEEVLEAVLSGDPARAVAAMEEHLQVTLREIETRPKAEGTREDPA
>NC_014210.1|WP_013152677.1|2015420_2015945_-|GNAT-family-N-acetyltransferase
MFTMRPATEADTSAVASVITARCDWMEERGLESWREAVADLAGQAAAGFMWVLEDEDRVVGCTTVTEHAPPKDWTPDEADEPSLYLFSTCTHPDYREHKPGTLIDLWAVDRAAREDRQWVRQGCFFPELAKYYQGQGFTLIREMDRTSGHLYLLARRAERIDLGQLGMTENPAV
>NC_014210.1|WP_126625062.1|2015958_2017425_-|asparagine-synthase
MIEHLAATDGYRTLIVVRERVADRPACDPGVRALTPAEYDQARDAVTDWPTDVVLIETEPGLPVRVTAGAARTTPLYLAVDDTTLTGSWDMADLRGHATGINPKEAARLLIYRPRYSAETLYQGVHRLTERATAHFGGSLWITYPEPALHRTPRELAPDADVLGAFIATMDTAMDRRPWAHDTTLFHLTGGFDSGTVATRAAERHPDRFPTATLLIDGPGRAQQIRRRAEMRSRVRFANPDITLDAMEHPPLAPGCRWVSGDVVNPYEDPLHHPFTLMAHAIAQTGARTVVTGLGGDEMVALTQEEEPHQGLGEMTDALVLPWVGPRARAVLEFADDGIAPPARVNSMTLLSLESAAPTLLREGLWPVHPFADPDMVGLGEQLPFAWRELKQLQRKRMAALGMSDDVVHPAERESFAEVIQHALISHAPPLFARMLADGSPLFDDGLVDPDGLRAAAERLTAEHYQEERESKLLEVLSLHLSATAFLR
>NC_014210.1|WP_013152679.1|2017579_2017744_-|hypothetical-protein
MNDFTPPPPSKSEQVSGLFLASPRAVVPTPAQSHEYKKCSGSSDAAHTYDTNRR
>NC_014210.1|WP_013152680.1|2018127_2018253_-|helix-turn-helix-domain-containing-protein
MFRVTNKTVRRWVRTGKLTSVRTLGGHRRYHEAEVRALLNQ
>NC_014210.1|WP_126625063.1|2018325_2018532_-|hypothetical-protein
MEGQELARLQAEYGGRYSIRHSRTLWIATLRVDDGTEPTLMCDTWPEMETRMRTPGSWGQVPRTRRPR
>NC_014210.1|WP_013152682.1|2018816_2020028_-|helix-turn-helix-transcriptional-regulator
MDAATRGQIIRSHRRRRGYSQTVLAGLVGRSESWLSQVERGKLPVDSHEVLSRLADVLRLPLDELTGTTEETIPVRYAPADAIERAMMRYTSLEVIVAETGGTPQAVDVERLRAEAHHTYAAYQATRYAEVGRRLPRLIRDVEAAARSRGADRPAVCSARAMVYNTAAAVLRRVGAKDLAWQAADRAMSASEWADETLLAAVGAYRLSYVFISRGNPDVAAELAMGAAHALERRMRPGTPEELSVYGGLHLAAATAAAAEYDRAAVPRFLAQAQRVADRLGQDLNLHGTAFGPTNVAIHTISTSVKTGDAKTAVAAGETLAVEHLPAGLVGRRAQVHLDVACAYAQTRQDAAAVNTLLEAERIAPELVRHDPATGRVLTELLRREHRRSTPELRPLAQRAGVS
>NC_014210.1|WP_013152683.1|2020042_2020549_-|flavoprotein
MAKTLYLVVSGAPAPEGIPDLVRRFQGDGYQVVCLSTPTGARFHDPAELEELTGEPVRVEYRMPGTGAGLPPADLVLACPLTFNSVNKFASGHADNFAVGLLCEMVGYEVPTVVVPHCKPQLASHPAFQASLRTLSSIPAVTLVYDDKAPYESRMPAWEHLHRTVRTL
>NC_014210.1|WP_041553104.1|2020957_2021494_+|CYTH-domain-containing-protein
MREIETKYRVADLEALLAALKQAGVRMSDPVYQDDQAYAPAGWRPELGQVGHTFARVRTQGSVHLLTTKTPLANAMECVEYETIVADREQMHGALLALGYEPTVRIVKHRRTGTTGPIGVCVDLVEGLGVFVELELVVDDDRDGLAAQAELDAWARGLDVALERTTDTYDTLVRTATA
>NC_014210.1|WP_013152685.1|2021499_2021715_-|hypothetical-protein
MPDYSYLLDGRPDVLTPSEVAQLFNIRPRSLHRGQWDNVLKPFRTPGGARRYPKEHIATLLNQPDESAPAP
>NC_014210.1|WP_013152686.1|2021890_2022343_-|ATP-binding-protein
MNKPIVQAPTLPRRLCGTATKSGILLGPELGHVRIARRWAAQATRSRPSLAEPVGIAVSELVTNTLRHSASGLPGGTIRVEIERTSRHLELRVTDNGPRPGEQPSFPAVPDPEPLRPSGNGLRLVEALCSYWDWKQHSCGAITVRAVFPW

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_014210_15

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_014210_15

2020724-2020871

Orphan

Consensus_repeat	Method
GGTGAGCCCCGCGCACGCGGGGATGG	CRISPRCasFinder

2 spacers

The CRISPR arrays of NC_014210_15

>merge|NC_014210|15|2020724-2020871|CRISPRCasFinder
CGTGAGCCCTGCGCACGCGGGGATGGACCGCCATGCTTGTGCAGAGCCTTGCGGTGGTCGCGGTGAGCCCCGCGCACGCGGGGATGGACCGCTGCCGGTGGCGGCGGACTGGGTGGCGGTGAGGTGAGCCCCGCGCAGGCGGGGATGG

>NC_014210|15|14|2020724-2020871|CRISPRCasFinder
CGTGAGCCCTGCGCACGCGGGGATGG	ACCGCCATGCTTGTGCAGAGCCTTGCGGTGGTCGC
GGTGAGCCCCGCGCACGCGGGGATGG	ACCGCTGCCGGTGGCGGCGGACTGGGTGGCGGTGA
GGTGAGCCCCGCGCAGGCGGGGATGG

Protein	Signature genes	Signature genes Name	Protein_function
NC_014210.1\|WP_126625062.1\|2015958_2017425_-\|asparagine-synthase	unknown	unknown	gnl\|CDD\|238949
NC_014210.1\|WP_013152680.1\|2018127_2018253_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|133390
NC_014210.1\|WP_013152679.1\|2017579_2017744_-\|hypothetical-protein	unknown	unknown	unknown
NC_014210.1\|WP_126625064.1\|2022577_2023399_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
NC_014210.1\|WP_013152674.1\|2010315_2011242_-\|universal-stress-protein	unknown	unknown	gnl\|CDD\|366180
NC_014210.1\|WP_126625063.1\|2018325_2018532_-\|hypothetical-protein	unknown	unknown	unknown
NC_014210.1\|WP_013152677.1\|2015420_2015945_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|173926
NC_014210.1\|WP_013152686.1\|2021890_2022343_-\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|379279
NC_014210.1\|WP_013152685.1\|2021499_2021715_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|133390
NC_014210.1\|WP_013152683.1\|2020042_2020549_-\|flavoprotein	unknown	unknown	gnl\|CDD\|376786
NC_014210.1\|WP_013152690.1\|2023851_2024619_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380379
NC_014210.1\|WP_013152688.1\|2023395_2023575_+\|DUF397-domain-containing-protein	unknown	unknown	gnl\|CDD\|377231
NC_014210.1\|WP_041552571.1\|2024709_2025513_+\|sulfite-exporter-TauE/SafE-family-protein	unknown	unknown	gnl\|CDD\|376667
NC_014210.1\|WP_013152693.1\|2026415_2027897_+\|hypothetical-protein	unknown	unknown	unknown
NC_014210.1\|WP_013152675.1\|2011730_2011931_-\|hypothetical-protein	unknown	unknown	unknown
NC_014210.1\|WP_013152692.1\|2025657_2026374_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|212491
NC_014210.1\|WP_041553102.1\|2012178_2013282_+\|protein-L-isoaspartate-O-methyltransferase	unknown	unknown	gnl\|CDD\|275041
NC_014210.1\|WP_013152682.1\|2018816_2020028_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
NC_014210.1\|WP_041553104.1\|2020957_2021494_+\|CYTH-domain-containing-protein	unknown	unknown	gnl\|CDD\|224354
NC_014210.1\|WP_013152689.1\|2023625_2023805_+\|DUF397-domain-containing-protein	unknown	unknown	gnl\|CDD\|377231

Protein	Function_ID	Function_description	E-value
NC_014210.1\|WP_126625062.1\|2015958_2017425_-\|asparagine-synthase	gnl\|CDD\|238949	cd01991, Asn_Synthase_B_C, The C-terminal domain of Asparagine Synthase B. This domain is always found associated n-terminal amidotransferase domain. Family members that contain this domain catalyse the conversion of aspartate to asparagine. Asparagine synthetase B catalyzes the assembly of asparagine from aspartate, Mg(2+)ATP, and glutamine. The three-dimensional architecture of the N-terminal domain of asparagine synthetase B is similar to that observed for glutamine phosphoribosylpyrophosphate amidotransferase while the molecular motif of the C-domain is reminiscent to that observed for GMP synthetase .	1.6309e-08
NC_014210.1\|WP_013152680.1\|2018127_2018253_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|133390	cd04762, HTH_MerR-trunc, Helix-Turn-Helix DNA binding domain of truncated MerR-like proteins. Proteins in this family mostly have a truncated helix-turn-helix (HTH) MerR-like domain. They lack a portion of the C-terminal region, called Wing 2 and the long dimerization helix that is typically present in MerR-like proteins. These truncated domains are found in response regulator receiver (REC) domain proteins (i.e., CheY), cytosine-C5 specific DNA methylases, IS607 transposase-like proteins, and RacA, a bacterial protein that anchors chromosomes to cell poles.	6.28548e-09
NC_014210.1\|WP_013152689.1\|2023625_2023805_+\|DUF397-domain-containing-protein	gnl\|CDD\|377231	pfam04149, DUF397, Domain of unknown function (DUF397). The function of this family is unknown.	4.07804e-16
NC_014210.1\|WP_126625064.1\|2022577_2023399_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	1.15389e-09
NC_014210.1\|WP_013152674.1\|2010315_2011242_-\|universal-stress-protein	gnl\|CDD\|366180	pfam00582, Usp, Universal stress protein family. The universal stress protein UspA is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. UspA enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae UspA reveals an alpha/beta fold similar to that of the Methanococcus jannaschii MJ0577 protein, which binds ATP, though UspA lacks ATP-binding activity.	2.68663e-22
NC_014210.1\|WP_013152677.1\|2015420_2015945_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|173926	cd04301, NAT_SF, N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate. NAT (N-Acyltransferase) is a large superfamily of enzymes that mostly catalyze the transfer of an acyl group to a substrate and are implicated in a variety of functions, ranging from bacterial antibiotic resistance to circadian rhythms in mammals. Members include GCN5-related N-Acetyltransferases (GNAT) such as Aminoglycoside N-acetyltransferases, Histone N-acetyltransferase (HAT) enzymes, and Serotonin N-acetyltransferase, which catalyze the transfer of an acetyl group to a substrate. The kinetic mechanism of most GNATs involves the ordered formation of a ternary complex: the reaction begins with Acetyl Coenzyme A (AcCoA) binding, followed by binding of substrate, then direct transfer of the acetyl group from AcCoA to the substrate, followed by product and subsequent CoA release. Other family members include Arginine/ornithine N-succinyltransferase, Myristoyl-CoA: protein N-myristoyltransferase, and Acyl-homoserinelactone synthase which have a similar catalytic mechanism but differ in types of acyl groups transferred. Leucyl/phenylalanyl-tRNA-protein transferase and FemXAB nonribosomal peptidyltransferases which catalyze similar peptidyltransferase reactions are also included.	0.00440944
NC_014210.1\|WP_013152685.1\|2021499_2021715_-\|hypothetical-protein	gnl\|CDD\|133390	cd04762, HTH_MerR-trunc, Helix-Turn-Helix DNA binding domain of truncated MerR-like proteins. Proteins in this family mostly have a truncated helix-turn-helix (HTH) MerR-like domain. They lack a portion of the C-terminal region, called Wing 2 and the long dimerization helix that is typically present in MerR-like proteins. These truncated domains are found in response regulator receiver (REC) domain proteins (i.e., CheY), cytosine-C5 specific DNA methylases, IS607 transposase-like proteins, and RacA, a bacterial protein that anchors chromosomes to cell poles.	4.95346e-10
NC_014210.1\|WP_013152683.1\|2020042_2020549_-\|flavoprotein	gnl\|CDD\|376786	pfam02441, Flavoprotein, Flavoprotein. This family contains diverse flavoprotein enzymes. This family includes epidermin biosynthesis protein, EpiD, which has been shown to be a flavoprotein that binds FMN. This enzyme catalyzes the removal of two reducing equivalents from the cysteine residue of the C-terminal meso-lanthionine of epidermin to form a --C==C-- double bond. This family also includes the B chain of dipicolinate synthase a small polar molecule that accumulates to high concentrations in bacterial endospores, and is thought to play a role in spore heat resistance, or the maintenance of heat resistance. dipicolinate synthase catalyzes the formation of dipicolinic acid from dihydroxydipicolinic acid. This family also includes phenyl-acrylic acid decarboxylase (EC:4.1.1.-).	4.85063e-15
NC_014210.1\|WP_013152690.1\|2023851_2024619_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|380379	cd06124, cupin_NimR-like_N, AraC/XylS family transcriptional regulators similar to NimR, N-terminal cupin domain. This family contains mostly bacterial proteins containing an AraC/XylS family helix-turn-helix (HTH) DNA-binding domain C-terminal to a cupin domain, and may be possible transcriptional regulators. Included in this family is Escherichia coli HTH-type transcriptional regulator NimR (also called YeaM) that negatively regulates expression of the nimT operon and its own expression. Proteins in this family belong to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold capable of homodimerization.	3.55295e-36
NC_014210.1\|WP_013152688.1\|2023395_2023575_+\|DUF397-domain-containing-protein	gnl\|CDD\|377231	pfam04149, DUF397, Domain of unknown function (DUF397). The function of this family is unknown.	1.30867e-17
NC_014210.1\|WP_013152686.1\|2021890_2022343_-\|ATP-binding-protein	gnl\|CDD\|379279	pfam13581, HATPase_c_2, Histidine kinase-like ATPase domain.	2.98221e-19
NC_014210.1\|WP_013152692.1\|2025657_2026374_+\|SDR-family-oxidoreductase	gnl\|CDD\|212491	cd05233, SDR_c, classical (c) SDRs. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human prostaglandin dehydrogenase (PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, PGDH numbering) and/or an Asn (Asn-107, PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	1.21929e-22
NC_014210.1\|WP_041553102.1\|2012178_2013282_+\|protein-L-isoaspartate-O-methyltransferase	gnl\|CDD\|275041	TIGR04188, conserved_hypothetical_protein, methyltransferase, ATP-grasp peptide maturase system. Members of this protein family are predicted SAM-dependent methyltransferases that regularly occur in the context of a putative peptide modification ATP-grasp enzyme (TIGR04187, related to enzymes of microviridin maturation) and a putative ribosomal peptide modification target (TIGR04186).	4.00466e-46
NC_014210.1\|WP_013152682.1\|2018816_2020028_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	4.77052e-09
NC_014210.1\|WP_041553104.1\|2020957_2021494_+\|CYTH-domain-containing-protein	gnl\|CDD\|224354	COG1437, CyaB, Adenylate cyclase, class 2 (thermophilic) [Nucleotide transport and metabolism].	6.15179e-23
NC_014210.1\|WP_041552571.1\|2024709_2025513_+\|sulfite-exporter-TauE/SafE-family-protein	gnl\|CDD\|376667	pfam01925, TauE, Sulfite exporter TauE/SafE. This is a family of integral membrane proteins where the alignment appears to contain two duplicated modules of three transmembrane helices. The proteins are involved in the transport of anions across the cytoplasmic membrane during taurine metabolism as an exporter of sulfoacetate. This family used to be known as DUF81.	1.62694e-18

>NC_014210.1|WP_013152683.1|2020042_2020549_-|flavoprotein
MAKTLYLVVSGAPAPEGIPDLVRRFQGDGYQVVCLSTPTGARFHDPAELEELTGEPVRVEYRMPGTGAGLPPADLVLACPLTFNSVNKFASGHADNFAVGLLCEMVGYEVPTVVVPHCKPQLASHPAFQASLRTLSSIPAVTLVYDDKAPYESRMPAWEHLHRTVRTL
>NC_014210.1|WP_013152682.1|2018816_2020028_-|helix-turn-helix-transcriptional-regulator
MDAATRGQIIRSHRRRRGYSQTVLAGLVGRSESWLSQVERGKLPVDSHEVLSRLADVLRLPLDELTGTTEETIPVRYAPADAIERAMMRYTSLEVIVAETGGTPQAVDVERLRAEAHHTYAAYQATRYAEVGRRLPRLIRDVEAAARSRGADRPAVCSARAMVYNTAAAVLRRVGAKDLAWQAADRAMSASEWADETLLAAVGAYRLSYVFISRGNPDVAAELAMGAAHALERRMRPGTPEELSVYGGLHLAAATAAAAEYDRAAVPRFLAQAQRVADRLGQDLNLHGTAFGPTNVAIHTISTSVKTGDAKTAVAAGETLAVEHLPAGLVGRRAQVHLDVACAYAQTRQDAAAVNTLLEAERIAPELVRHDPATGRVLTELLRREHRRSTPELRPLAQRAGVS
>NC_014210.1|WP_126625063.1|2018325_2018532_-|hypothetical-protein
MEGQELARLQAEYGGRYSIRHSRTLWIATLRVDDGTEPTLMCDTWPEMETRMRTPGSWGQVPRTRRPR
>NC_014210.1|WP_013152680.1|2018127_2018253_-|helix-turn-helix-domain-containing-protein
MFRVTNKTVRRWVRTGKLTSVRTLGGHRRYHEAEVRALLNQ
>NC_014210.1|WP_013152679.1|2017579_2017744_-|hypothetical-protein
MNDFTPPPPSKSEQVSGLFLASPRAVVPTPAQSHEYKKCSGSSDAAHTYDTNRR
>NC_014210.1|WP_126625062.1|2015958_2017425_-|asparagine-synthase
MIEHLAATDGYRTLIVVRERVADRPACDPGVRALTPAEYDQARDAVTDWPTDVVLIETEPGLPVRVTAGAARTTPLYLAVDDTTLTGSWDMADLRGHATGINPKEAARLLIYRPRYSAETLYQGVHRLTERATAHFGGSLWITYPEPALHRTPRELAPDADVLGAFIATMDTAMDRRPWAHDTTLFHLTGGFDSGTVATRAAERHPDRFPTATLLIDGPGRAQQIRRRAEMRSRVRFANPDITLDAMEHPPLAPGCRWVSGDVVNPYEDPLHHPFTLMAHAIAQTGARTVVTGLGGDEMVALTQEEEPHQGLGEMTDALVLPWVGPRARAVLEFADDGIAPPARVNSMTLLSLESAAPTLLREGLWPVHPFADPDMVGLGEQLPFAWRELKQLQRKRMAALGMSDDVVHPAERESFAEVIQHALISHAPPLFARMLADGSPLFDDGLVDPDGLRAAAERLTAEHYQEERESKLLEVLSLHLSATAFLR
>NC_014210.1|WP_013152677.1|2015420_2015945_-|GNAT-family-N-acetyltransferase
MFTMRPATEADTSAVASVITARCDWMEERGLESWREAVADLAGQAAAGFMWVLEDEDRVVGCTTVTEHAPPKDWTPDEADEPSLYLFSTCTHPDYREHKPGTLIDLWAVDRAAREDRQWVRQGCFFPELAKYYQGQGFTLIREMDRTSGHLYLLARRAERIDLGQLGMTENPAV
>NC_014210.1|WP_041553102.1|2012178_2013282_+|protein-L-isoaspartate-O-methyltransferase
MDDLDALHTALVERLDTTATIRDAFAAHPRHLFIPDMVWPDATGLPLHRTSDPGRWTRLVYGSDAVTTQANDGGPGPRNEPSSSSSAPQVMADMIAAAGISEGMRVLEVGTGTGWNAAILAALVGEKGSVTSIEIDLGVAALARERLTGTGVTVRTAAEPPPGEVYDAVIATCAATRIPDGWFAAAEGAVLVLPWSPHPAAHSTPIVALAVREGRGSGPFVREAAFMRDRTQRPGDLPFPGLGQQPTPAADFPVGSVELIGSGMMTQLMLMMPGVRLGTGLRPFRGEPGRIVWMGVGQAWAYVWPDGTVTGGGDRALGEELGHAYRMLRGAGFPGLESFVLEAVAGQDSCRVGCAALEQHWDHSVSP
>NC_014210.1|WP_013152675.1|2011730_2011931_-|hypothetical-protein
METSTDRTRIQPSGICRRGRHRWRHDPPDGKRLLCTRCKSMSMTNYGACREDCVDCHPPADEVEGQ
>NC_014210.1|WP_013152674.1|2010315_2011242_-|universal-stress-protein
MADDPIPSPKVAVGVDGSASARGALEWAAAEAELRQLPLYVVHALSMPLVMSVYAGPTRFPPTEEMTAQGRRILEEAAEHVRSLRPDLRVETALGLEEPPLALLRRTGHGDLVVVGSRGMGPVRSVLAGAAGMRLAAKALCPVVVVPGTEGRAPRLSGPLRIAVGVDGSVDSRRALDFALHRAALQEGSSVVVVHSWEVPLPFATASLTESGWTPPDDLLERQSEELVSGVLAEVMDDATADVDISAVRTQRNPVDALVEAAAEADLVVVGSRGRGGVRGALLGSVSQGVMHSSPVPVVVVPRHAEED
>NC_014210.1|WP_041553104.1|2020957_2021494_+|CYTH-domain-containing-protein
MREIETKYRVADLEALLAALKQAGVRMSDPVYQDDQAYAPAGWRPELGQVGHTFARVRTQGSVHLLTTKTPLANAMECVEYETIVADREQMHGALLALGYEPTVRIVKHRRTGTTGPIGVCVDLVEGLGVFVELELVVDDDRDGLAAQAELDAWARGLDVALERTTDTYDTLVRTATA
>NC_014210.1|WP_013152685.1|2021499_2021715_-|hypothetical-protein
MPDYSYLLDGRPDVLTPSEVAQLFNIRPRSLHRGQWDNVLKPFRTPGGARRYPKEHIATLLNQPDESAPAP
>NC_014210.1|WP_013152686.1|2021890_2022343_-|ATP-binding-protein
MNKPIVQAPTLPRRLCGTATKSGILLGPELGHVRIARRWAAQATRSRPSLAEPVGIAVSELVTNTLRHSASGLPGGTIRVEIERTSRHLELRVTDNGPRPGEQPSFPAVPDPEPLRPSGNGLRLVEALCSYWDWKQHSCGAITVRAVFPW
>NC_014210.1|WP_126625064.1|2022577_2023399_+|helix-turn-helix-transcriptional-regulator
MVQEEDADKAAQLRFGKLLRKLRGQAGLTQQELAALAVVSQSTVSDLERGKKGTRRDPVVRLDKALTARGMLVDAWDAVFSGVGVTAYFREVAEAEQMALKIRDYSYGLVPGLFQVEEYVRAISELSNPEATTEAIDQIVKARKYRQQILDRPHPPTITVLLDEVVLLRRFRKPEVMKQQIDHLIDQSYRPRVNLQIVPIATEGHPGLFGSFRLIDVPDSSTFAYIESQRTGVSLKQPDVVASYDRIFAELRSAALPVPSSRSRMEEIRGSIT
>NC_014210.1|WP_013152688.1|2023395_2023575_+|DUF397-domain-containing-protein
MMTEAWSKSSYSNGEGGDCVEARRDQTVVLVRDTQNRSLGHLAAPAAEWTALLGAVRGR
>NC_014210.1|WP_013152689.1|2023625_2023805_+|DUF397-domain-containing-protein
MMTEDWSKSSYSNGTGGDCVEARRDQAAVLVRDTQNRSLGHLATPTVEWTALVSAVRAQ
>NC_014210.1|WP_013152690.1|2023851_2024619_-|helix-turn-helix-transcriptional-regulator
MRNIPVAEVDSIDRPVLAIGTDYPPEHVLPAHRHRRAQFLYGATGVMRVQTADGEWTVPPHRAVLIPAGTDHRVVMTGVSTRSLYLEPSAVAWFPGRCQVVEVSPLLRELLLTAVDLEPRYSPHGRDAAVFALVLHELRRLVPLPLDLPLPGHEGLRRMCEEFLGAPDVHDPPARWAGRLHVSERTVHRLFRAETGMSFARWRQRACVLHALPLLARGEPVTRVAMELGYESPSAFSTMFLRVLGSSPRDYAAGQ
>NC_014210.1|WP_041552571.1|2024709_2025513_+|sulfite-exporter-TauE/SafE-family-protein
MLTFVLPLLALGLLTGVTTVLFGFGGGFVVVPVVYYVTRAQADPGVDPMAVAVATATAVMVVNALSATLSQRRAGRLRRDYVWPLAAYIGVGAVLGSLVATVVGGGAQRVLFIAYIAVTLLDTLLRKGFLTHDPDAEPRLLGRRTTTAGGVAIGAVTSFLGVGGSVMTVPLLRRRGLPMGEATAMANPLSLPVAVAGTAVYALFGEGGGAGPGHLGSVDLVAGALLLAGSLPAIAVTRRLVGRVPDRVHAVSYVVLLAVVLAAFLFV
>NC_014210.1|WP_013152692.1|2025657_2026374_+|SDR-family-oxidoreductase
MDLEGARVLVAGATGVLGGHISRALNREGTRVVLAGRDEEALDALSRELDGSSTAVFEAADTEGCAALVRRTAEEQGGLDGLVIAFGVVAFDTGPDSEGGIENAAVEKMFQVNTLAPMAMLRAAIDAVKPGGAVAAVTAVTAEYPTHGMAAYSASKAALSAWLTAARADYRARHVAALDVRAPHMDTGLADRPLAGTAPGNLPEPHPVDEVVDAIVRALRSDARSVAFDPRERKLTVR
>NC_014210.1|WP_013152693.1|2026415_2027897_+|hypothetical-protein
MDPRPPEPPRSDEPALAALGALVDRSVIQIAEAARDARTFDRETVRAVSDLWDNAVVPLFRAATGRTGPERERRARAALEWTALLRPTRWDWMVEQAALCGHRLDALVQPPPVYFDRPYRDYRGEVRPAYSRWTPQALAALAGDYAFGAASLRHVRIEREGARLCGFLTLEPARSYDPGDGAPGRPPTLDVHLEDLTEVDVDSDSAHGVRLDSDADGVVVGLGAGGVLRARAGSLRLDDGSWHLSGAGRRADARTPPRDDGFRPARPPQKGKVEGSAWGAATFLRWAMLMIRRVRYPGEVARVPVGAYCRALEGAGRDVLAAGALSPRRREAAFRSLTAEWLRRGGTELAADWKLLLRGVPDAGDLARGVRDELLARGETPPVSVAPEEVTDFPERAPLRMVSYTAEHTDGRVRREAGAMVHLAVPGQDGDGPWRMRVLTATDPVRLRVRTPAFDGTGRARVDRDGGGRETFTVDGDALCLDARAWVQETPPR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_014210_16

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_014210_16

2269631-2269853

Orphan

Consensus_repeat	Method
CCCGTCCGCGTGCGCGCGGCGACG	CRISPRCasFinder

3 spacers

The CRISPR arrays of NC_014210_16

>merge|NC_014210|16|2269631-2269853|CRISPRCasFinder
TCCGTCCGCGTACGCCCCGCGGCGTCGCCGACCCGCCCCTCGACCCGGTCCCCTCCGGCGCGTCCATGACGCCGACCACCCATCGCGCCCCCGTGCGCGTGGTGACGTCCGCCCGCCTTCGAGAGCGGAGACGATCGGCACCCCGTCCGCGTGCGCGCGGCGACGGCCAAGGAGCCGTTGACGCGTTGACGGCTTCCGCCTCGTCCGCGTGCGCGCGGCGACG

>NC_014210|16|15|2269631-2269853|CRISPRCasFinder
TCCGTCCGCGTACGCCCCGCGGCG	TCGCCGACCCGCCCCTCGACCCGGTCCCCTCCGGCGCGTCCATGACGCCGACCACCCAT
CGCGCCCCCGTGCGCGTGGTGACG	TCCGCCCGCCTTCGAGAGCGGAGACGATCGGCAC
CCCGTCCGCGTGCGCGCGGCGACG	GCCAAGGAGCCGTTGACGCGTTGACGGCTTCCGC
CTCGTCCGCGTGCGCGCGGCGACG

Protein	Signature genes	Signature genes Name	Protein_function
NC_014210.1\|WP_013152889.1\|2262823_2263456_-\|trimeric-intracellular-cation-channel-family-protein	unknown	unknown	gnl\|CDD\|225415
NC_014210.1\|WP_013152886.1\|2259971_2260643_-\|1-acyl-sn-glycerol-3-phosphate-acyltransferase	unknown	unknown	gnl\|CDD\|153251
NC_014210.1\|WP_041553118.1\|2258301_2259348_+\|cation-transporter	unknown	unknown	gnl\|CDD\|223604
NC_014210.1\|WP_013152894.1\|2270004_2271612_+\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|223562
NC_014210.1\|WP_013152890.1\|2263898_2265257_+\|NAD(P)/FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|224169
NC_014210.1\|WP_013152897.1\|2273641_2274109_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|236132
NC_014210.1\|WP_013152893.1\|2267937_2269206_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|234945
NC_014210.1\|WP_013152888.1\|2261816_2262869_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176115
NC_014210.1\|WP_013152902.1\|2279007_2280792_+\|pentachlorophenol-monooxygenase	unknown	unknown	gnl\|CDD\|236158
NC_014210.1\|WP_013152904.1\|2282033_2282882_+\|hypothetical-protein	unknown	unknown	unknown
NC_014210.1\|WP_013152901.1\|2277970_2278933_+\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293840
NC_014210.1\|WP_013152891.1\|2265429_2266281_-\|siderophore-interacting-protein	unknown	unknown	gnl\|CDD\|99790
NC_014210.1\|WP_013152898.1\|2274583_2275849_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|234945
NC_014210.1\|WP_013152903.1\|2280828_2282037_+\|homogentisate-1,2-dioxygenase	unknown	unknown	gnl\|CDD\|226039
NC_014210.1\|WP_013152892.1\|2266652_2267669_-\|ATPase	unknown	unknown	gnl\|CDD\|225518
NC_014210.1\|WP_013152900.1\|2277067_2277601_-\|winged-helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224759
NC_014210.1\|WP_013152885.1\|2259386_2259881_-\|metallophosphoesterase	unknown	unknown	gnl\|CDD\|223695
NC_014210.1\|WP_013152887.1\|2260791_2261715_-\|serine/threonine-dehydratase	unknown	unknown	gnl\|CDD\|181319
NC_014210.1\|WP_013152899.1\|2275919_2276978_-\|aminotransferase-class-V-fold-PLP-dependent-enzyme	unknown	unknown	gnl\|CDD\|223594
NC_014210.1\|WP_013152895.1\|2271916_2273350_-\|OmpA-family-protein	unknown	unknown	gnl\|CDD\|143586

Protein	Function_ID	Function_description	E-value
NC_014210.1\|WP_013152889.1\|2262823_2263456_-\|trimeric-intracellular-cation-channel-family-protein	gnl\|CDD\|225415	COG2860, COG2860, Predicted membrane protein [Function unknown].	2.94122e-48
NC_014210.1\|WP_013152886.1\|2259971_2260643_-\|1-acyl-sn-glycerol-3-phosphate-acyltransferase	gnl\|CDD\|153251	cd07989, LPLAT_AGPAT-like, Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: AGPAT-like. Lysophospholipid acyltransferase (LPLAT) superfamily member: acyltransferases of de novo and remodeling pathways of glycerophospholipid biosynthesis which catalyze the incorporation of an acyl group from either acylCoAs or acyl-acyl carrier proteins (acylACPs) into acceptors such as glycerol 3-phosphate, dihydroxyacetone phosphate or lyso-phosphatidic acid. Included in this subgroup are such LPLATs as 1-acyl-sn-glycerol-3-phosphate acyltransferase (AGPAT, PlsC), Tafazzin (product of Barth syndrome gene), and similar proteins.	6.85937e-55
NC_014210.1\|WP_041553118.1\|2258301_2259348_+\|cation-transporter	gnl\|CDD\|223604	COG0530, ECM27, Ca2+/Na+ antiporter [Inorganic ion transport and metabolism].	1.6148e-17
NC_014210.1\|WP_013152894.1\|2270004_2271612_+\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|223562	COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only].	8.29702e-115
NC_014210.1\|WP_013152890.1\|2263898_2265257_+\|NAD(P)/FAD-dependent-oxidoreductase	gnl\|CDD\|224169	COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion].	1.79359e-124
NC_014210.1\|WP_013152897.1\|2273641_2274109_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|236132	PRK07922, PRK07922, amino-acid N-acetyltransferase.	1.08936e-12
NC_014210.1\|WP_013152893.1\|2267937_2269206_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|234945	PRK01346, PRK01346, enhanced intracellular survival protein Eis.	2.15667e-114
NC_014210.1\|WP_013152888.1\|2261816_2262869_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176115	cd08423, PBP2_LTTR_like_6, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold. LysR-transcriptional regulators comprise the largest family of prokaryotic transcription factor. Homologs of some of LTTRs with similar domain organizations are also found in the archaea and eukaryotic organisms. The LTTRs are composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal substrate-binding domain, which is structurally homologous to the type 2 periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcriptional repressor undergoes a conformational change upon substrate binding which in turn changes the DNA binding affinity of the repressor. The genes controlled by the LTTRs have diverse functional roles including amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to a name a few. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	2.4523e-49
NC_014210.1\|WP_013152902.1\|2279007_2280792_+\|pentachlorophenol-monooxygenase	gnl\|CDD\|236158	PRK08132, PRK08132, FAD-dependent oxidoreductase; Provisional.	5.56577e-159
NC_014210.1\|WP_013152901.1\|2277970_2278933_+\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293840	cd16282, metallo-hydrolase-like_MBL-fold, uncharacterized subgroup of the MBL-fold_metallo-hydrolase superfamily; MBL-fold metallo hydrolase domain. Members of the MBL-fold metallohydrolase superfamily are mainly hydrolytic enzymes which carry out a variety of biological functions. The class B metal beta-lactamases (MBLs) for which this fold was named perform only a small fraction of the activities included in this superfamily.Activities carried out by superfamily members include class B beta-lactamases, hydroxyacylglutathione hydrolases, AHL (acyl homoserine lactone) lactonases, persulfide dioxygenases, flavodiiron proteins, cleavage and polyadenylation specificity factors such as the Int9 and Int11 subunits of Integrator, Sdsa1-like and AtsA-like arylsulfatases, 5'-exonucleases human SNM1A and yeast Pso2p, ribonuclease J and ribonuclease Z, cyclic nucleotide phosphodiesterases, insecticide hydrolases, and proteins required for natural transformation competence. Classical members of the superfamily are di-, or less commonly mono-, zinc-ion-dependent hydrolases, however the diversity of biological roles is reflected in variations in the active site metallo-chemistry.	4.50281e-59
NC_014210.1\|WP_013152891.1\|2265429_2266281_-\|siderophore-interacting-protein	gnl\|CDD\|99790	cd06193, siderophore_interacting, Siderophore interacting proteins share the domain structure of the ferredoxin reductase like family. Siderophores are produced in various bacteria (and some plants) to extract iron from hosts. Binding constants are high, so iron can be pilfered from transferrin and lactoferrin for bacterial uptake, contributing to pathogen virulence. Ferredoxin reductase (FNR), an FAD and NAD(P) binding protein, was intially identified as a chloroplast reductase activity, catalyzing the electron transfer from reduced iron-sulfur protein ferredoxin to NADP+ as the final step in the electron transport mechanism of photosystem I. FNR transfers electrons from reduced ferredoxin to FAD (forming FADH2 via a semiquinone intermediate) and then transfers a hydride ion to convert NADP+ to NADPH. FNR has since been shown to utilize a variety of electron acceptors and donors and has a variety of physiological functions including nitrogen assimilation, dinitrogen fixation, steroid hydroxylation, fatty acid metabolism, oxygenase activity, and methane assimilation in a variety of organisms. FNR has an NAD(P)-binding sub-domain of the alpha/beta class and a discrete (usually N-terminal) flavin sub-domain which vary in orientation with respect to the NAD(P) binding domain. The N-terminal moeity may contain a flavin prosthetic group (as in flavoenzymes) or use flavin as a substrate. Because flavins such as FAD can exist in oxidized, semiquinone (one-electron reduced), or fully reduced hydroquinone forms, FNR can interact with one and two electron carriers. FNR has a strong preference for NADP(H) vs NAD(H).	1.34503e-90
NC_014210.1\|WP_013152898.1\|2274583_2275849_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|234945	PRK01346, PRK01346, enhanced intracellular survival protein Eis.	2.77493e-118
NC_014210.1\|WP_013152903.1\|2280828_2282037_+\|homogentisate-1,2-dioxygenase	gnl\|CDD\|226039	COG3508, HmgA, Homogentisate 1,2-dioxygenase [Secondary metabolites biosynthesis, transport, and catabolism].	7.85027e-61
NC_014210.1\|WP_013152892.1\|2266652_2267669_-\|ATPase	gnl\|CDD\|225518	COG2971, COG2971, Predicted N-acetylglucosamine kinase [Carbohydrate transport and metabolism].	2.98595e-36
NC_014210.1\|WP_013152900.1\|2277067_2277601_-\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|224759	COG1846, MarR, Transcriptional regulators [Transcription].	1.60123e-15
NC_014210.1\|WP_013152885.1\|2259386_2259881_-\|metallophosphoesterase	gnl\|CDD\|223695	COG0622, COG0622, Predicted phosphoesterase [General function prediction only].	9.08291e-37
NC_014210.1\|WP_013152887.1\|2260791_2261715_-\|serine/threonine-dehydratase	gnl\|CDD\|181319	PRK08246, PRK08246, serine/threonine dehydratase.	3.24054e-122
NC_014210.1\|WP_013152899.1\|2275919_2276978_-\|aminotransferase-class-V-fold-PLP-dependent-enzyme	gnl\|CDD\|223594	COG0520, csdA, Selenocysteine lyase/Cysteine desulfurase [Posttranslational modification, protein turnover, chaperones].	9.48663e-47
NC_014210.1\|WP_013152895.1\|2271916_2273350_-\|OmpA-family-protein	gnl\|CDD\|143586	cd07185, OmpA_C-like, Peptidoglycan binding domains similar to the C-terminal domain of outer-membrane protein OmpA. OmpA-like domains (named after the C-terminal domain of Escherichia coli OmpA protein) have been shown to non-covalently associate with peptidoglycan, a network of glycan chains composed of disaccharides, which are crosslinked via short peptide bridges. Well-studied members of this family include the Escherichia coli outer membrane protein OmpA, the Escherichia coli lipoprotein PAL, Neisseria meningitdis RmpM, which interact with the outer membrane, as well as the Escherichia coli motor protein MotB, and the Vibrio flagellar motor proteins PomB and MotY, which interact with the inner membrane.	2.64463e-30

>NC_014210.1|WP_013152893.1|2267937_2269206_+|GNAT-family-N-acetyltransferase
MTGAPQHDPSRRDDAPAWTVREGTEKDYPEAVRVFCEALNLSAREILDNERDHPTTEHDRTLLAVDGDRVVGTALSHGFEMTMPGGPRRVAGVSGVGVWPTYRRRGVLSALMRRQLAEVRDRGENLAALWASEGGIYARFGYGLAFRETNATLQRAHARLRPDAPRDPSLTLELAETAEIRQEVERVYREALPQRAGQLARDEHWWSLILQDKEAGGPGRLRAALVRGPDGPLGYALYRVVNRWEDGLASGRVVVRELASVSTAARVALYEHLLDRDLTSEAVFEKLPGDDPLTVLLADPRRLVRRDFDALWMRLVDLPGSLSDRPYATPVDTVLEVADRYAPWNAGRWRLEADTGGARVRPTDAAPDLALDASHLGAAYLGGRTLTAFADAGLLTEHVPGAAARLDTALHAPRASFCGTDF
>NC_014210.1|WP_013152892.1|2266652_2267669_-|ATPase
MDAGGTATRALVATLSGERLGEARAGGANPNSHGADRAAERLAEAVAGALDAAGPRARGAVAFGVVGLAGVSALRDDAVRARLERALAGAGLAPENTAFTGDDEVAFASGTPGPDGTVLIAGTGAIATRVEERRRTRSADGMGWLIGDEGSGFWIGHQAARETARQLSRGGELSPLARAVAKQVIPGQRPSEGGNHLPEEHARNFARVLTTAAPVTLAALAPLVSEAHTQGDPAAEVIVEAAAGHLAHSVHQVRSPGERLPVVLAGGVLSRSEPVRSALTRKLALSASGAKVATAGCTAGAAAWLAALRAGVPEDDRRLHAAFTVVGRAPGKDRPDAA
>NC_014210.1|WP_013152891.1|2265429_2266281_-|siderophore-interacting-protein
MAQRQGRARTVHTGRVEAVEQITPHMVRVVLGGEGLDAFSTDGHTDSYVKLLFPPPAPGDPEPFDLERVRAERPREEWPVTRTYTVRDWDAEARRLTLDFVHHGGTGLAGVWAAGARPGDRLRLMGPGGAYSPDPGADWHLLAGDESALPAIATAVEALAPDATAHVFVEVGGPEDELKLEGGPGVHVHWLHRGDEAVGSVLVPAVRALDFPEGRVHAFVHGEAAFVRDLRRLLRVEHGLPKEQLSVSGYWRLGRDEDGWQSSKAEWNRGVEAEEEAALAGRA
>NC_014210.1|WP_013152890.1|2263898_2265257_+|NAD(P)/FAD-dependent-oxidoreductase
MQHMDAIVIGMGPGGETVASRLLAAGKRVAVVERELIGGECGYWACIPTKVLLRPPEVRQEADGAAGVSRPDLRWPELRDYRDQMIRHLDDSAQVQGYRDQGALVLRGEGRVIGRDPWRVAVGDTELTADHVVVATGSEAVRPPIEGLDDLDPSVVWTNREATTLTDVPGRAVVVGGSAVGVELGQFLARMGSQVTLVQRGPRLVNREEPRLCELISDQFDRDGVTVHLNTQVSAVARDGDGIRATLDNGEHVEADVIVLATGRRPRGGGLGLEEVGVELDRASLRVDERCRAAPGLWGVGDATGRALFTHVAKYQGRVVADNILGKDRAADYTGVPRVIFSYPEIAGVGLTEAQAREQGIDTATAEADLPQTLARPWTYDTDPRGTLGLVADRRRGVLVGAWAFSPMASEWIHTAALAIRTGLPVAALLDSIPQFPTYNEAYLIALENLEM
>NC_014210.1|WP_013152889.1|2262823_2263456_-|trimeric-intracellular-cation-channel-family-protein
MSTQTLILALDLVGILAFAVDGALTGIRTARLDIVGVLALGVVTALGGGVIRDLLLGVTPATFQDWRYICTALLGATAAFFLSRQLTHLNRPILVFDAAGLSLFAVIGATKALELGFGPLQATLLGVVTGVGGGTIRDVLLNRVPTVLSANSRLYAVPALLGAGLVAVAYWAGLTWGWIAVVGAVLCFAVRLLALLYRWNAPSPPGSPPL
>NC_014210.1|WP_013152888.1|2261816_2262869_+|LysR-family-transcriptional-regulator
MLDANRVRVLVEIAHAGSIAAAAERLSFTPPALSQQLTKLEREVGCTLVERGRTGATLTEAGRVLLEHGERVLGELRDAEAAVRAVAGESPERLSLGAFASAGKVLLPATLAAFGRQHPQVRLSLSDIEPPGGYGLVASGDLDLLLTHRYPGVPLPRSGGLHRERVLVDPLLVVVPEGHALADRDVALADLAGEEWICGAPGIYNRISLDTAAAAAGVSLNVAYETRDYEVALALVEAGVGVALVPLSILRSDRRGGWVSRPLRGTRLAREIYAVHRRRPPEPVPAMVELLRGVASRALGGAGDAAGARGGGEAAGTGTGGSRPGGGTGDEGTGGSHSGGEPGGLGAFQR
>NC_014210.1|WP_013152887.1|2260791_2261715_-|serine/threonine-dehydratase
MSTTTAHAAPTATDVRAAAERIAPYARRTPVMHAEVDGRPLTLKLEHLQRTGAFKLRGALNALLGGEAADRVITASGGNHGLGVATAARLLGVRATVYVPESIPEAKAAPLAATGAEVVRVGEHYAVAAEAARARAEAEGVRYLHAFDDALVVAGQGTIGLEIAADAPECDTIVVAVGGGGLVAGVRLGAEGREVVGAEPEGCASMHAAMAAGHPVQTPVDSVASSALGAATLGRVPFEVLSAHPVTRALVSDAEILRAQDRLWEEFRIATEPAAAVPFAAWLAGRVPGERPCLVVCGANAEWRRAD
>NC_014210.1|WP_013152886.1|2259971_2260643_-|1-acyl-sn-glycerol-3-phosphate-acyltransferase
MFYGALRQTVSVLARTLCRPTVEGRENVPADGAVLLASNHLSFIDSVIIPLSVTQRRVRFLAKSDYFEGTGIKGRVTKTVFSSLGAMPVQRRDARGAMLSLEMMLERLNEGEACVIYPEGTRSRDGRLYRGRTGVALLAMESKAPVVPVAVAGTQDVQPVGASMPRPRPYSIRFGEPLDFSTGYDHLAPGKARREITDRIMDSIHALSGQERAKGYNSLGADE
>NC_014210.1|WP_013152885.1|2259386_2259881_-|metallophosphoesterase
MRVLIVSDTHIPRRARDLPEQVWREVDRADAVIHAGDWCDLASLERLDARAELLVGVHGNNDGADLRERLPEVARATLGGVRFAVVHETGDARGREKRCQERFPDCDVLVFGHSHIPWDTTAPSGLRLLNPGSPTDRRRQPHHTYMTLVAEDGRLDGVRLHRVG
>NC_014210.1|WP_041553118.1|2258301_2259348_+|cation-transporter
MLEALSPPWPLGWSVAIFVLVAAVTVVASVRMTSLGDVLADRTGWGEAVFGAVFFGLATSLSGIVMTAVSALGDQPGLAYSNAVGGIAAQTLALAVADFFYRRANLEHAAASSANLLFCCLLIGLLSVVVLTALGPDVTLLGVHPASVGMIAFYMGGLWLIRQENEQPMWQAVRTRETVVDVPDDDGADEEDGTGTGVLWVRFLAVGTVVAVGGWALAEAAGVIVESTGLSAGLVGAVAMGAVNAIPETVAAVAAVRRGAMTLAVSAIIGGNSLDALNVAVGDVFYRGGSLYHAASADELFLTVGALLMTVVLLAGLIIRQTKGWGRIGFEGVLLIVLYLGILGVLTF
>NC_014210.1|WP_013152894.1|2270004_2271612_+|ABC-F-family-ATP-binding-cassette-domain-containing-protein
MSTKSAVTLTDLTFAWPDGTVAIDHVSGTLTTGRTGLVGRNGAGKSTLLRLIAGHLRPTSGRVDAVGDVGYLPQTLTLGTEATVAELLGIDATLAALRAIEAGDADERHFDAVGDDWDIEARADEALHEIGFTAADLDRRVAQVSGGEAVLIAVTGMRLRRTPITLLDEPTNNLDRPTRARLAAFVDTWPGTLVVVSHDLELLEHMDSTAELHAGSLDVFGGPYSAWKEHLEQEQASAVQAARSAQQALKVEKRQRVEAETKLARRERTARRTQKDGGIPKILAGNRASKAQASAGAMRSTLDDKVQAAQAAVDAADARVREDEHIRLTLPDPDVPRGRRLAEFHAEGRTVVVQGPERVALVGPNGAGKSTLLQQLVHGGDPVPGRAHGTLLTDRVGYLPQRLDGLDDAASALENVRAVAPGTPPGEVRNQLARLLLRGDGVDRPVATLSGGERFRVCLATLLLAEPPAQLLVLDEPTNNLDTSSVEQLAEALDAYRGALLVVSHDHGFLRRIGIDTVLEIGREGGLRQRAELGD
>NC_014210.1|WP_013152895.1|2271916_2273350_-|OmpA-family-protein
MHHVERWEDRSVLRFTVTPLNDQDEDREDLILPAPFGTGALDRQHSAFNLVDPLEQAFYSPVRDESGETTIGSEVVPHWVMDADYEYQVHFPPLPEDTERITLVVNGSFGEFTGIPVIDGEPPAEPPGDSVDPSDINPGDTVAVPLREAEMTSEPEDYARDLYSIIEDSSRTRTSTTDEETIGLHADVLFDFDEATLTPEAEDVLAEVVQETRENADPSRPPIRVVGHTDGRGSEDYNQDLSERRAQAVLDVLEEGLGTEYEYETEGRGAEEPLVEEGGADDEEARATNRRVEISYKIRQPGDARTGTEQRTGSLDGRTGAAAPPAPFRAEDGEVIDTAEAGLVQGNAEYELGVRPLYRDGAYLVGVFDIRHMDTGGTVPPVLRPLNSRDYPGGWFTAFNLTVGGNEDVRYRAVRVGPRPTEDLERARYLSTPQWPVQPLETGHTERVFVYFPAPPTETDAVTLHAADFGTFEVPVE
>NC_014210.1|WP_013152897.1|2273641_2274109_-|GNAT-family-N-acetyltransferase
MIVRSARPGDGPGIAALIGRASPHLDEKGYPASLLPEDMVVLVAEADGNGAVVGWVEGVLDGVYEGSGSPAPPPHGYVLAVVVDPGWRRRGVGRGLLEGFVDRARAAGVEWVFLLPEEGEGAEGRVEFFLRCGFTPVHDPDREWPAMGRWTRDAG
>NC_014210.1|WP_013152898.1|2274583_2275849_+|GNAT-family-N-acetyltransferase
MNAGGDVTPTEWTVRGTDRDEYSEVMRVVGEALLSSDPPEDREPFLRPLLDAEGYDRVLVAVDGDEIVGAVNDFAFEMALPGGPRPVAGVTGVGVWPTYRRRGVLSALMRRQLADIHARGERYAALWASEGAIYGRFGYGPAVTEMETAVRQPHARLRADTPRDPALRVRLADPGQVRPDLERVHREVAAVQVGQFQRAAHWWDRVLRDQAQFREGRGPLRAAVVSGPDGPLGYALYRTRNRWERDGSRGEVYVKEITATTPAAWTALYDHLFNRDLVTEITFDFLAVDDPLRHLLVDSGRAAPTLYTSLWVRLVDVPGALSERSYAAPVEAVLEVADRFAPWNAGRWHVKADTGGARVEATDAAPDVSLDVSHLGAAHLGQTTLDGYLRAGLITEHTPGTVERLDAALRRSRAPFCGLIF
>NC_014210.1|WP_013152899.1|2275919_2276978_-|aminotransferase-class-V-fold-PLP-dependent-enzyme
MDEAGRARLRAAQQEFAAENTYLNTATHGLTPRRALRALEQHTRDVAAGRFQPGGADAGIERARSAYARLTGVPASHVAIGSHASQFVGTVAASLAPGARVLTAADEFSSVVHPFMARADAGISVREVPLADLASRVGPDTDLVAVSAVQSADGAIAPVEDLIAACADHGARLLLDTTQAAGWLPLPVDRVDYTVCATYKWLLGPRGSALLTGTEEALAKLSPLAANWYGAHEPWKSLYGGPLRLAEGARRLDLAPVWGAWVGLEETLSLVEEVGVEVIREHNAALGDRFREAVDMEPAGSAIVSVPVPEGAVERVAEAGIVTAARNGRMRAAFHLYNDESDVDRLVKALKG
>NC_014210.1|WP_013152900.1|2277067_2277601_-|winged-helix-turn-helix-transcriptional-regulator
MTHDTAPELTFWSFVDYAVRKAEQELPSVNADAMRMVLTLNRATSMVVYDLESSVHRPRGLTWPGFRVIFALWLAGPMEAKTTAEISGMSRAALSALLNTLERDGLIVRERAAHDRRALQLSLTEAGYRAILGGFRAHNRRESAWAEALEPDERRELVRLLNKLMAGSTEAKAKFRN
>NC_014210.1|WP_013152901.1|2277970_2278933_+|MBL-fold-metallo-hydrolase
MAAKPFASSADTEAKEQTLEVLADGVYALTAEGDPNVGAIEGEDFLVAFEALATPAAAGEWLAKLREHTDKPIRYLVLSHYHAVRVLGASAFDAEIILTHEKTRELIRERGEEDWASEFARMPRLAKDADSVPGLTWPTQTFADRTSIDLGGDRGELVLQYFGRGHTEGDIVAWLPKQRILFAGDLVEAQAALYTGDAFHHDWAGATLDGVKALEAEMLVGGRGAVSRGREEVDAAIEQTRGFLDVMIREVGAVHGRGGTLKEAFEATHAALVGDYGHWPIFEHCLPFDVSRLWDEFSGIERPVIWTAERDREVWDQLQG
>NC_014210.1|WP_013152902.1|2279007_2280792_+|pentachlorophenol-monooxygenase
MRPPAPRTPADTAADPVLVLGAGPVGQTAALLLARRGVPVLLMDARPERDAVGSKAICQQRDVLDVWDWLGAGRVAEEGLTWDTARTFYRDSELFSVRLPDPGASPLPPFVNISQSRTEQVLDERLAAAGVRTLWNHRVTGISQDARGVTVECRTPDGPVRLRGSHALSCLGAHGGVVREALGLSFDGTTFDDRFLICDIRADLAGWERERRFYFDPEWNPGRQVLIHPCPGSVYRIDWQVPSDFDLDAEEASGRLEARIRQIIGERPYEIVWHSVYRFHTRVAERMRAGRVLLLGDNAHLVAPFGARGLNSGVQDAENAAWKLAYVLAGWAGEELLESYHAERHAAALENADVTSATMRFLVPQDEEEHRTRLAVLEAALTEEAARARVDSGRLAEPFWYTDSSLTTPCPERPFGGRPPRGRAPAPCPGVVLPDAPVDLPGDDAPARLRPLLREGLTLLVGAAPEGADPDAFLEGVRAAARGATPAPVTALYLDRIDTTGALTRALVPEPGQVWLVRPDAHVAAVVAGADPDAVRAAVRTALGFAPAPAVPASTDGASGPAADRTSDPRASAAADRPAGTVPDPRGDEPAPTA
>NC_014210.1|WP_013152903.1|2280828_2282037_+|homogentisate-1,2-dioxygenase
MAYYRQVGEVPRTRHTQHRTPEGGLYYEELMGEEGFSADSSLLYHRAIPSAIVDAAEWEVPDQSRTRNAPMVPRHLKLHELFSDQEWKAADVVESRRLVLGNDDVRISYVVAGAPSELYRNGIGDECVYVESGTARVETVFGLLEVGQGDYVVLPRATTHRWVPTGDQPLRAYVVEANSHIAPPKRYLSRYGQFLEHAPYCERDLRGPSEPLLAEGENVDVLIKHRGDGPGGISGTRYTYPTHPFDVVGWDGFLYPYVFNVADFQPITGRVHQPPPVHQVFEGHNFVICNFVPRKVDYHPGAIPVPYYHSNVDSDEVMFYCGGDYEARKGSGIGQGSISLHPGGHSHGPQPGAYERSIGAEAFDELAVMVDTFRPLDLGEGGLASDDGVYAWTWAGGRRERR
>NC_014210.1|WP_013152904.1|2282033_2282882_+|hypothetical-protein
MSAELYRGLFDDAALFPPGNAPMGGALPAHRAHRAGQRAEYVGPFLVSDARVGELRAVLAREEPGHGPLAVVVTVPGGAEGVGPAVAAATADPALRLAGVEAAAAPGTAAEVAARLDEHLPEGAGGFVEVSRQADVPAELRSLAGTGHSAKFRTGGLTVEAHPSEEELAEFLHSAVELGVPFKCTAGLHHAVRHTTAEGFEQHGFLNVLLATAALLDGASEREAALVLADRDGPRLAALAAKLTDEEARAVRGRFRSFGTCSVTEPLEDLVVLGALPASRAR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_014210_17

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_014210_17

3087427-3087531

Orphan

Consensus_repeat	Method
GTCGGCACGGCGGAACGGGGAGGCGCGGCG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_014210_17

>merge|NC_014210|17|3087427-3087531|CRISPRCasFinder
GTCGGCACGGCGGAACGGGGAGGCGCGGCGGAACGGCGGCGCGGCAGCCCGGCGGTCCGGCTGAGCCCGAGGCGTGTCGGCTCGGCGGAACGGGGAGGCGCGGCG

>NC_014210|17|16|3087427-3087531|CRISPRCasFinder
GTCGGCACGGCGGAACGGGGAGGCGCGGCG	GAACGGCGGCGCGGCAGCCCGGCGGTCCGGCTGAGCCCGAGGCGT
GTCGGCTCGGCGGAACGGGGAGGCGCGGCG

Protein	Signature genes	Signature genes Name	Protein_function
NC_014210.1\|WP_013153611.1\|3078871_3080683_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173871
NC_014210.1\|WP_013153612.1\|3080753_3081779_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224094
NC_014210.1\|WP_013153619.1\|3089596_3091024_+\|lactate-utilization-protein	unknown	unknown	gnl\|CDD\|224062
NC_014210.1\|WP_041552747.1\|3091996_3093208_+\|acetylhydrolase	unknown	unknown	gnl\|CDD\|335313
NC_014210.1\|WP_013153624.1\|3096664_3097450_+\|RNA-ligase-family-protein	unknown	unknown	gnl\|CDD\|378183
NC_014210.1\|WP_013153626.1\|3098790_3100353_+\|hypothetical-protein	unknown	unknown	unknown
NC_014210.1\|WP_013153616.1\|3087079_3087415_+\|hypothetical-protein	unknown	unknown	unknown
NC_014210.1\|WP_013153608.1\|3075757_3075970_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|133390
NC_014210.1\|WP_013153613.1\|3082013_3083705_-\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|223562
NC_014210.1\|WP_013153615.1\|3086068_3086917_-\|ion-transporter	unknown	unknown	gnl\|CDD\|366146
NC_014210.1\|WP_013153618.1\|3088584_3089397_+\|(Fe-S)-binding-protein	unknown	unknown	gnl\|CDD\|223325
NC_014210.1\|WP_013153609.1\|3076044_3077109_-\|cobalamin-B12-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|227345
NC_014210.1\|WP_013153610.1\|3077098_3078457_-\|serine/threonine-protein-phosphatase	unknown	unknown	gnl\|CDD\|369272
NC_014210.1\|WP_013153622.1\|3093295_3094798_-\|cytochrome-P450	unknown	unknown	gnl\|CDD\|225035
NC_014210.1\|WP_013153623.1\|3095119_3096442_+\|DUF2786-domain-containing-protein	unknown	unknown	gnl\|CDD\|378525
NC_014210.1\|WP_013153620.1\|3091020_3091662_+\|LUD-domain-containing-protein	unknown	unknown	gnl\|CDD\|224473
NC_014210.1\|WP_013153617.1\|3087543_3088266_-\|FadR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225097
NC_014210.1\|WP_013153614.1\|3084173_3085883_-\|glucose-6-phosphate-isomerase	unknown	unknown	gnl\|CDD\|234679
NC_014210.1\|WP_013153607.1\|3075118_3075571_+\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|379279
NC_014210.1\|WP_013153625.1\|3097433_3098588_+\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|226986

Protein	Function_ID	Function_description	E-value
NC_014210.1\|WP_013153611.1\|3078871_3080683_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|173871	cd08506, PBP2_clavulanate_OppA2, The substrate-binding domain of an oligopeptide binding protein (OppA2) from the biosynthesis pathway of the beta-lactamase inhibitor clavulanic acid contains the type 2 periplasmic binding fold. Clavulanic acid (CA), a clinically important beta-lactamase inhibitor, is one of a family of clavams produced as secondary metabolites by fermentation of Streptomyces clavuligeru. The biosynthesis of CA proceeds via multiple steps from the precursors, glyceraldehyde-3-phosphate and arginine. CA possesses a characteristic (3R,5R) stereochemistry essential for reaction with penicillin-binding proteins and beta-lactamases. Two genes (oppA1 and oppA2) in the clavulanic acid gene cluster encode oligopeptide-binding proteins that are required for CA biosynthesis. OppA1/2 is involved in the binding and transport of peptides across the cell membrane of Streptomyces clavuligerus. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	1.73823e-172
NC_014210.1\|WP_013153612.1\|3080753_3081779_-\|ABC-transporter-permease	gnl\|CDD\|224094	COG1173, DppC, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	1.86446e-94
NC_014210.1\|WP_013153619.1\|3089596_3091024_+\|lactate-utilization-protein	gnl\|CDD\|224062	COG1139, COG1139, Uncharacterized conserved protein containing a ferredoxin-like domain [Energy production and conversion].	1.13087e-180
NC_014210.1\|WP_041552747.1\|3091996_3093208_+\|acetylhydrolase	gnl\|CDD\|335313	pfam03403, PAF-AH_p_II, Platelet-activating factor acetylhydrolase, isoform II. Platelet-activating factor acetylhydrolase (PAF-AH) is a subfamily of phospholipases A2, responsible for inactivation of platelet-activating factor through cleavage of an acetyl group. Three known PAF-AHs are the brain heterotrimeric PAF-AH Ib, whose catalytic beta and gamma subunits are aligned in pfam02266, the extracellular, plasma PAF-AH (pPAF-AH), and the intracellular PAF-AH isoform II (PAF-AH II). This family aligns pPAF-AH and PAF-AH II, whose similarity was previously noted.	2.48088e-12
NC_014210.1\|WP_013153624.1\|3096664_3097450_+\|RNA-ligase-family-protein	gnl\|CDD\|378183	pfam09414, RNA_ligase, RNA ligase. This is a family of RNA ligases. The enzyme repairs RNA strand breaks in nicked DNA:RNA and RNA:RNA but not in DNA:DNA duplexes.	2.34094e-18
NC_014210.1\|WP_013153608.1\|3075757_3075970_+\|hypothetical-protein	gnl\|CDD\|133390	cd04762, HTH_MerR-trunc, Helix-Turn-Helix DNA binding domain of truncated MerR-like proteins. Proteins in this family mostly have a truncated helix-turn-helix (HTH) MerR-like domain. They lack a portion of the C-terminal region, called Wing 2 and the long dimerization helix that is typically present in MerR-like proteins. These truncated domains are found in response regulator receiver (REC) domain proteins (i.e., CheY), cytosine-C5 specific DNA methylases, IS607 transposase-like proteins, and RacA, a bacterial protein that anchors chromosomes to cell poles.	1.57023e-09
NC_014210.1\|WP_013153613.1\|3082013_3083705_-\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|223562	COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only].	3.88647e-125
NC_014210.1\|WP_013153615.1\|3086068_3086917_-\|ion-transporter	gnl\|CDD\|366146	pfam00520, Ion_trans, Ion transport protein. This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.	8.95472e-40
NC_014210.1\|WP_013153618.1\|3088584_3089397_+\|(Fe-S)-binding-protein	gnl\|CDD\|223325	COG0247, GlpC, Fe-S oxidoreductase [Energy production and conversion].	3.81198e-55
NC_014210.1\|WP_013153609.1\|3076044_3077109_-\|cobalamin-B12-binding-domain-containing-protein	gnl\|CDD\|227345	COG5012, COG5012, Predicted cobalamin binding protein [General function prediction only].	4.89768e-14
NC_014210.1\|WP_013153610.1\|3077098_3078457_-\|serine/threonine-protein-phosphatase	gnl\|CDD\|369272	pfam07228, SpoIIE, Stage II sporulation protein E (SpoIIE). This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.	5.78079e-40
NC_014210.1\|WP_013153622.1\|3093295_3094798_-\|cytochrome-P450	gnl\|CDD\|225035	COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism].	9.4172e-39
NC_014210.1\|WP_013153623.1\|3095119_3096442_+\|DUF2786-domain-containing-protein	gnl\|CDD\|378525	pfam10979, DUF2786, Protein of unknown function (DUF2786). This family of proteins has no known function.	8.12918e-11
NC_014210.1\|WP_013153620.1\|3091020_3091662_+\|LUD-domain-containing-protein	gnl\|CDD\|224473	COG1556, COG1556, Uncharacterized conserved protein [Function unknown].	9.02931e-36
NC_014210.1\|WP_013153617.1\|3087543_3088266_-\|FadR-family-transcriptional-regulator	gnl\|CDD\|225097	COG2186, FadR, Transcriptional regulators [Transcription].	1.16082e-52
NC_014210.1\|WP_013153614.1\|3084173_3085883_-\|glucose-6-phosphate-isomerase	gnl\|CDD\|234679	PRK00179, pgi, glucose-6-phosphate isomerase; Reviewed.	0
NC_014210.1\|WP_013153607.1\|3075118_3075571_+\|ATP-binding-protein	gnl\|CDD\|379279	pfam13581, HATPase_c_2, Histidine kinase-like ATPase domain.	2.92118e-19
NC_014210.1\|WP_013153625.1\|3097433_3098588_+\|AAA-family-ATPase	gnl\|CDD\|226986	COG4639, COG4639, Predicted kinase [General function prediction only].	3.1131e-25

>NC_014210.1|WP_013153616.1|3087079_3087415_+|hypothetical-protein
MTESTEGFDEFDTGAWDPGYDDVDADTDVGAADQDSAVADFLRYFPEGHRIEEIEDHDVLGIDAELGQEIPEQAPEAAGERPPTARREDLARLLRAEEFADRVRDRGRRSG
>NC_014210.1|WP_013153615.1|3086068_3086917_-|ion-transporter
MRERVRVIVDAPWFQACVITLILVNAVILGAETSPRVTDSYGRLLRAVDLTILALFVLELGMRMYAHRREFFRDPWSWFDLVIVGIALLPASGPFSVLRVLRVLRVLRLLSVIPTLRHVVTGLFRALPGMMSILFLVILLLYVSAVMATELFADVSPQYFADLPASLFTLFQIATADGWGTIAKDVMEHKPMAWVFFVVFVLVSTLVALNLFIAVAVEALEKDDEESGGGGGGGGSAGRRGGGSDDGGPDGGQAVILAELRALRAEVAVLRREREEEASGLR
>NC_014210.1|WP_013153614.1|3084173_3085883_-|glucose-6-phosphate-isomerase
MSASTPLPRAEDTGERARPGVPLDQRDEWTALREHHGRWGSTDLRELFADDPGRAERYTLDVGDLHVDYSKNLVTDETLRLLADLAGATRVADLRDAMLGGEHVNLTEDRAVLHTALRAPRGQVISTDGRDVVPEVQEVLDRMAEFADRIRAREWLGHTGQPVRRIVNIGIGGSDLGPAMAYEALRPYTDRGLEFRFVSNVDGTDLHEALVDADPATTLFVVASKTFTTVETITNATEARTWLLDGLGLKGDDDDGAIARHFAAVSTNGEAVAEFGIDTRNMFGFWDWVGGRYSYDSAIGLSLMVAVGPERFREMLAGFHLMDTHFATAPVERNLPFLLGLLGVWYGNFHDARTHAVLPYSHHMSKFPAYLQQLDMESNGKSVQRDGRPVHWQTGPVVWGTPGTNGQHAYFQLLHQGTRFVPADLLGFANPAPDLPEHLVPQHDLLMANLFAQGQALAFGRTAEEVAAEGVSADLVPHRTFEGNRPTTTILADRLSPSVLGQLVALYEHKVFVQGAVWNINSFDQWGVQLGKVLAKRVEPALTEGADVPGLDASTTSLVRRYRSMRGRD
>NC_014210.1|WP_013153613.1|3082013_3083705_-|ABC-F-family-ATP-binding-cassette-domain-containing-protein
MTLGNTTGAASAPHTAQTGPPLLRARDLARAYGDHVVFDGVDLDVAPGQRLGLVGENGSGKSTLLRLLAGEEEPDAGRVERPADTGFLYQELPHAPDTTLARVIAEALEPARRVERRLTASAAALDGAPEDAEALREYSEALAEAELLEVWDAERRAELVVAGLGLDGIGPDRPVGRMSGGQRGRLGLAALLIRRPRALLLDEPTNHLDDQALEFLEGYLRGLPGVVVLASHDRVFLDAVCTGLLDLDPAVDGPVYYGGAYSFYLREKQLERERWEQRYRDEQDALKGLRESVRTTSRQVSHNRAPRDNDKMGYDFLGGRVDKQVSRRVRNARNRLEELERDQVRKPPRPLEFSASLTRDPGTADGHAITVRDLVVPGRLRLDRLDVPSDGRLLVTGPNGAGKSTLLYALGHRLRPESGQVLWRRGAAVALLEQDVVFPDPERTPRSLYDGLNGTLPGAPRLTDLGLVAPRDLDRPVGRLSVGQRRRLALAMLVGHAPDVLLLDEPTNHLSLALAEELEEALGTAPGAVVVASHDRWLRRNWAWSELRLADGAVAGQDTAGPV
>NC_014210.1|WP_013153612.1|3080753_3081779_-|ABC-transporter-permease
MSVPMDAPESSQHADPEAAAAGGRGSANRSLRQIAWRRFRRDRLGMAGGVVVILLILVAVFAPLLTSWFGYPPNQFNQELIDPLTGGVLRDPADPSLGLDPWGGISADHLLGVEPVNGRDLFSRIVHGARTSLLVATVATLVCVVIGTVLGMVAGYFGGWVDTVISRAMDIFLAFPLLLFAIALVGVIPDGSFGLSGNGLRIGVLVFIIGFFNWPYIGRIVRGQTLTLREREFVEASRSLGAGSAHIVFREILPNLVTPILVYSTLLIPTNILFEAALSFLGVGINPPMATWGGMLDNALRFYTVAPHFVLIPGLAIFVTVLAFNLFGDGLRDAFDPRSSD
>NC_014210.1|WP_013153611.1|3078871_3080683_-|ABC-transporter-substrate-binding-protein
MTTDHHTGAAPSRRRGRRRTTATLAAGTAAALLLAACGGADGGGGEGGPVDAEFNQGETEVVNPSDQTGGTLRYAISSDFDSPDPGNTYYAFGWNFSRYYARTLLTYVGAPGAEGTELQPDLAAEMPRPNEDLTEWTVPIKQGLRYEDGSEITAPDIEYAIARGNFGAQALPNGPKYFQDLLADSDDYEGPYADEDDPLAGFDGIETPDDHTLVFHLKDPFAEFPYLLIQPQTAPVPPEADRGEQYQSRVVSSGPYKFDGEYRPGVSLNLVRNDQWDPATDPTREALPDRVEVQLGVDQNEIDQRLASGDLDVDLAGAGVGPAMRGTLLTDEARKNSVDNPQSNTLRYVNISTVLEPLDDLACREAVMYAADRDALQRAWGGDTGGDIATQIMPASLPGADPGIDLYPSQDNQGDLDKARQKLEECGEPDGFSTSIGVRADRPSEVSTAEALQQALARVGIETRIKQYPSDTYTNTQAGSPSFVEDNDLGLTVYGWAPDWASGYGFMSKILDGDAIQDAGNANISELDDERINGWFDEVITVRDPEERASIYTRIDRRAMEQAAILPAVFERTVLYRPPNLTNVYYHSGYSMYDYMALGTTRE
>NC_014210.1|WP_013153610.1|3077098_3078457_-|serine/threonine-protein-phosphatase
MLASGTSDRAPLEGDGAGPVGGRRAGALPAPAAVARLRRAARELGNILHPVRLVEQAVRFPVPEAAQMCALFLTQPDGSVRWTAAFTSEGGRRRVGTGEGVWDRGTVDGAAWLNEVVDGARTVAEPTPGDPVEKLLLELAGYGGARGALCAVAVPGLSGTAGALLFHRARGYFDAADTEALTEYAERVGSALGAARMYQYQARTASTLKAALVPAPLPGVAHAVLGAAFRSAVEAERIGGDFYQVNELEEGFDFSFGDVCGKGNDAALLTGMIRQSLEALRLVEQDPRRLLELLNVLLLRTDPEKFSTMLLGLASPLPDGGLRVRAAGGGHPPPLVVGVDGTVREVSIGGLFVGAVEEAVFRETEFTLAPGETMVVFSDGVTEARNPLLGGEMLGEERLARLLSECGGMPAPAVSDRIVQVVGDWLDGGEHDDITVLTVQARATRGGVADDR
>NC_014210.1|WP_013153609.1|3076044_3077109_-|cobalamin-B12-binding-domain-containing-protein
MTADHDILPDAVAPVSPAVVADDFFARVRDLDDAGALAVVREALAAGVDHESLVLDVIAVSQMRVGMMWQANELSVAREHAATHIGELALGLVLEHGLARVAGERPLGSVVVACVEGEWHGLPARLLGDVLRLRGWRVTFLGASVPAHHLTLHLQETAPDVVALSCSLPSHLVNAHAMITAAARTGVPVIAGGRGFGPDSSLALRLGASLWAADARSAADLLERRMPLSSLRPREEALTPAAEYASLVQRRRDLVRTGVEHARALYEARGASLEGADLDRTVEDLGHITDFLLTSLYVGDGAVFTRFLAWTRGVLEVRGVPAVGVARVLELLEGELFDYPETCAALREGRAVLG
>NC_014210.1|WP_013153608.1|3075757_3075970_+|hypothetical-protein
MPDYSYLLDGRPDVLTPSEVAALFNIRPRSLHRGEWDNVLKPFRTPGGARRYPKEHIATLLNQPDPPTSP
>NC_014210.1|WP_013153607.1|3075118_3075571_+|ATP-binding-protein
MQKSTVPPIPLPRRLCGTSTKSGILLGPELGHVKIARRWAAQATRSRPSLAEPVGIAVSELVTNTLRHSASGLPGGTIRVEIERTPRRLELRVTDNGPRPGDEPSFPAVPDPEPLRPSGNGLRLVEALCSYWDWKQHSCGAITVRAVFPW
>NC_014210.1|WP_013153617.1|3087543_3088266_-|FadR-family-transcriptional-regulator
MSDPDAGRTTVTRRAADRIKAMIADGRVGPGERLPTERDLSAQLGVSRSSMREAIRSLTTLGVLESRHGAGVYVTALRPADLLETFSVLAEVSQGHTLLEVLQVRRMLEPAATALAAARASDEDLDRIGALLERIEGGDDTSGADTSGADTVAADLGFHQAIVASTGNATLAAVNDGLSSRTFHARVWAGHREAGLTAKLREDHLRIHEALVARDPDAARAAATVHVLRVERWLSADLGD
>NC_014210.1|WP_013153618.1|3088584_3089397_+|(Fe-S)-binding-protein
MRIALFITCVNDTLFPDTGRAVVRLLERLGHEVVFPEGQTCCGQMHYNTGYRRSASRLAVRFVRTFEGADAVVVPSASCAAMVRDNYPRLGSSGSRLSRKVADLAPRVYDLTEFLVDVLGVTDVGAYYPHKVAYHPTCHGLRMLGLGDRPYQLLRAVRGLELVELPGATECCGFGGTFAVKNGDVSSAMGADKARHAVETGAEVLCAVDNSCLMHIGGTLSRQRSGMRVAHLAEILASTEKEGAHGVLEGAEADSRGKNCAAGVDWGGGG
>NC_014210.1|WP_013153619.1|3089596_3091024_+|lactate-utilization-protein
MSATFLGIPPFPEAAAGAVNDARLRHNLRRATHTIRDKRASVVDELHEDWQRLRAEGAAVKEHTLRHLDHYLEQLEESVHRAGGRVHWASDAAEANEIVTRLVRDTGETDVVKVKSMATQEIELNDALAAAGITAYETDLAELIVQLGEDLPSHILVPAIHLGRAQIREIFLEQMAEWGVPAPRGLTDDPRALAEAARVHLRERFLRTRTAISGANFAVADSGTLVVLESEGNGRMCLTLPRTLISVVGIEKIVPTWSDLEVFLQLLPRSSTGERMNPYTSTWTGVTPGDGPQEFHLVLLDNGRTDVLADTVGRQALRCIRCSACLNTCPVYERTGGHSYGSVYPGPIGAILTPQLRGMSSPVDEALPYASSLCGACYEVCPVAIDIPEVLVHLREEVVERSGHAGEKALMAGAEAVLSSPRTLGAVQRAAGLGRRAVPRHLPGLAGAWTDTRDVPDVPAESFRQWWDRREGEGR
>NC_014210.1|WP_013153620.1|3091020_3091662_+|LUD-domain-containing-protein
MSSRERILARVRRALADVPADESPVREPGRGYADSHDAGPSLEVLEDRLLDYRALVRRVGADRVAAEVAAALERRGARRVVVPADAPPEWFTHARVERLADSREEPLAVADLTGVDGVVTGCAVAVAETGTIVLDGGPGQGRRAVTLVPDYHLCVVRAEQVVDGVPQAVRLLDPSRPLTWISGPSATSDIELNRVEGVHGPRTLEVLLVVPAP
>NC_014210.1|WP_041552747.1|3091996_3093208_+|acetylhydrolase
MPPSPHPSPSSRALRSGTALAAAAALALPLSLAASGTAAADTDPSSAPADALRAALPEPTGDHPVGRTTLHLVDGEREDVWVGGPRQLMVTLWYPARADSGRPAPYMTEAESAAMIAGLGLDLPADLMHSGVRTSSRLDVPPARTRDGFPLVVLSPGAGHNRIELSSLAEDLASHGFVVAGVDHAHEAAPVEFPDGLITECTGCQSGEWALGSSNRAEDVSFLLDRLTGPDPAWRWSRVIDASRIGMAGHSWGGTATAETLRAEERVDAGINLDGPYYPPAVEEGLDKPLALIENGQGNSWDGVEQMWPRLEGWRQWIRMEGSGHSNSIDRGVLVEQLGLTELFTPEQWRNLYGDVGVERGLELVRTYSLAFFDHHLRGGDQPLLEDPGAFHPELVVVDPDEG
>NC_014210.1|WP_013153622.1|3093295_3094798_-|cytochrome-P450
MRQGTGTDGRDDPPSAGSGGARCPVALPPRGDTGADTPWDALRDRHGGLVPVEVGPGVPGWLLLGYRENLQALRDHTLFSADPRPWGAEDAAPARSAALARDGEEHRRLRAAVVDTLARADTPRLVPVVERAAVHLLGRVAADGAADLIGGFAAPLPALVLNELFGLPDAYGRLLADLAPRLWSGEPDRAGPAATAVRSYFAGLVARKRADPGQDMASWLLAHPAGLTDDEAAGALALLWESGHEPTTHLIGNALLRLLEDPGVWTAYLGGTLTPEDFIDYVMWTDSPIRVLGGRYPVEDLSFSGARVRRGEPLLLGLASAHTDPSVARGDDAMARAGDRSHLSWGAGAHRCPATGLTRELARTAIDTAVDRLRGMVLAVEPEELRWRASLAVHGLEELPVWFTATGERAGSDAPVRERAPAPVTRRLRRKRGPAPRGARYQAPLAGEDGERAREERPAPAPRSRRVARGAGARYQAPFATERADPDALERLLAAWRSRD
>NC_014210.1|WP_013153623.1|3095119_3096442_+|DUF2786-domain-containing-protein
MGKKGRGRQRGGDRRTAGQGAQPWAGPAPGDSPEQVVSEAVDALVLGREGGGVDLAAARLADAEDPARAGAADRAVRDALLAGVASAWARGWQPAETVRQAGRVLDPVAAAVCADAVTADLDRHSPDTVDPRWTAQVRELGAAPAWGGTGDYLAHVGAGHGLLRFEAVETALRLLAALRVLPPLHRLCPPPGAFRPRPEGSARTPEAVDQGKLARVRALLAKAESTEFPSEAEALSARAQELMARHSIDRALLAEEPGQASEAASGRRLPVDAPYDEHKAVLLHEVAEANHCRAVWDRELGLCTVMGFPGDVEAVDLMFTSLLVQAETAMRASGSVRDRSGRAAGRAFRASFMSAFSVRVGERLVESARSAEEAAAAETGTDLVPVFAAREREVEAAVAEAFGELTYSRVRGPASEDGWYEGLAAADAASLGAHRRVADR
>NC_014210.1|WP_013153624.1|3096664_3097450_+|RNA-ligase-family-protein
MRKYPRTRHIRGSRLQRGDHDLAAVPFSALAGRHLVVEEKLDGANAGISFGPGGELRLQSRGHYLTGGPRERHFAPFKAWAATVAPLLRPRLGERYVLYGEWLYAKHTVFYDALPHLFCEFDVLDTREDAFLSTPRRRELLEGAPVVSVPVLHTGPLERLADLTRLVGPSTCRTPGWRGALAEAAGAAGADPGRALAESDGSDLMEGLYVKVEEGGRTVDRYKWVRPGFTSAVLDSGTHWLDRPLIANGLADPEVLYAGVR
>NC_014210.1|WP_013153625.1|3097433_3098588_+|AAA-family-ATPase
MRVFAELCPAPPRWDLDWARVREALPWVRDLAGVEQDPVHHAEGDVETHTRMACEALAELPAWRSRPAAERERLFAAVLLHDVAKPLCTRREEDGRVTAHGHSRRGDLLARRLLWEAAAEPGAAASPLEAVRWREHVAALVRHHQVPFWALERPDLRRIAFRVSLVARNDDLVLLATADILGRRCGDTAEVLENIGLYGEYCREQRCLDRPRGFPSDHARFWFFRKPDRDPDYAAHDDTRMTVTVMSGLPGAGKDTWIARERPGVPVVSLDALRAELGVRPTADQRPVAAAAHARAREHLRAGRSFVWNATNVSRSLRDQCVDLAAAYRARVEIVSVEAPPRVLRARLDRRRAPVPAAAVERLVRRWECPDPTEAHRLLRWTSA
>NC_014210.1|WP_013153626.1|3098790_3100353_+|hypothetical-protein
MTERIYSAVHACLDWAGTIEPRPVLNTDSLLFLLAAHLDAGAPDPGDWSTADVHDIARTVRVWDRVPDSLRDTWLTWCDFLVDQDRLLSAESPRRLRAAIATVDLAPGGPPPPEDRTDSAALPLLDRLGVGADGAPEALPTVVPADPADLDAAARRCRPLSDAARLAVWTGGGRPLCSEGDDALTPDDTARAAADLGVAPARVAALFAVARDAGLLRTTYTRVLPGRAARAWRDGVPGAAADAWADALLAMTDLRGVTAFLLLTDLFVHGDARTPAQLVTVYGPGIALRGEDPVEHVRQVLETLEDLGAVRRVGGGRFRVTGLGDHFMVRQLRQTGADIALARPLSGMDAEEVLALAERGRPVDTERLLERWVAARDTESAVCGLLEACDAPGSWRLRERVARVLASLEEDLAPVLDLYVHHPVLGGWARRLRGGAAGTPTSHQEVWAVLDDYAILLEGGGLLPGRDRDRYAGCAEGFVRTVRLTGHPASDTVLDLLAEGALGAPLAEAARRLRPAPVTP

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_014210_18

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_014210_18

3158305-3158388

Orphan

Consensus_repeat	Method
TCCTCCGCGTGCGCGGAGCTTGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_014210_18

>merge|NC_014210|18|3158305-3158388|CRISPRCasFinder
TCCTCCGCGTGCGCGGAGCTTGGGGCCGGACAACTACCCGCTGGACATCACGACACGGTTCACCTCCGCGTGCGCGGAGCTTGG

>NC_014210|18|17|3158305-3158388|CRISPRCasFinder
TCCTCCGCGTGCGCGGAGCTTGG	GGCCGGACAACTACCCGCTGGACATCACGACACGGTTC
ACCTCCGCGTGCGCGGAGCTTGG

Protein	Signature genes	Signature genes Name	Protein_function
NC_014210.1\|WP_013153667.1\|3152511_3153882_+\|SpoIIE-family-protein-phosphatase	unknown	unknown	gnl\|CDD\|369272
NC_014210.1\|WP_013153681.1\|3165054_3165705_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|100107
NC_014210.1\|WP_013153669.1\|3154293_3155181_+\|isocitrate-lyase/phosphoenolpyruvate-mutase-family-protein	unknown	unknown	gnl\|CDD\|379346
NC_014210.1\|WP_013153684.1\|3169396_3169630_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|284351
NC_014210.1\|WP_013153670.1\|3155302_3155995_-\|DUF1028-domain-containing-protein	unknown	unknown	gnl\|CDD\|377639
NC_014210.1\|WP_013153682.1\|3166333_3168262_-\|S9-family-peptidase	unknown	unknown	gnl\|CDD\|224423
NC_014210.1\|WP_013153683.1\|3168390_3169131_-\|MerR-family-DNA-binding-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133378
NC_014210.1\|WP_013153671.1\|3156225_3156894_+\|zinc-finger-SWIM-domain-containing-protein	unknown	unknown	gnl\|CDD\|227059
NC_014210.1\|WP_041552750.1\|3151702_3152515_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223669
NC_014210.1\|WP_013153664.1\|3149438_3150128_-\|SMI1/KNR4-family-protein	unknown	unknown	gnl\|CDD\|378155
NC_014210.1\|WP_041553158.1\|3163826_3164852_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|238568
NC_014210.1\|WP_041553156.1\|3157061_3157493_+\|Rrf2-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224870
NC_014210.1\|WP_013153677.1\|3161045_3161873_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224045
NC_014210.1\|WP_013153679.1\|3163014_3163827_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|379312
NC_014210.1\|WP_126625080.1\|3150330_3151503_+\|AI-2E-family-transporter	unknown	unknown	gnl\|CDD\|279875
NC_014210.1\|WP_013153675.1\|3158483_3160004_-\|SMI1/KNR4-family-protein	unknown	unknown	gnl\|CDD\|214864
NC_014210.1\|WP_013153676.1\|3160280_3160760_+\|NUDIX-hydrolase	unknown	unknown	gnl\|CDD\|239217
NC_014210.1\|WP_013153668.1\|3153878_3154202_+\|STAS-domain-containing-protein	unknown	unknown	gnl\|CDD\|132914
NC_014210.1\|WP_013153674.1\|3157784_3158201_+\|nuclear-transport-factor-2-family-protein	unknown	unknown	gnl\|CDD\|378915
NC_014210.1\|WP_049800371.1\|3161869_3162889_-\|iron-chelate-uptake-ABC-transporter-family-permease-subunit	unknown	unknown	gnl\|CDD\|163581

Protein	Function_ID	Function_description	E-value
NC_014210.1\|WP_013153667.1\|3152511_3153882_+\|SpoIIE-family-protein-phosphatase	gnl\|CDD\|369272	pfam07228, SpoIIE, Stage II sporulation protein E (SpoIIE). This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.	6.09112e-49
NC_014210.1\|WP_013153681.1\|3165054_3165705_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|100107	cd02440, AdoMet_MTases, S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy). There are at least five structurally distinct families of AdoMet-MTases, class I being the largest and most diverse. Within this class enzymes can be classified by different substrate specificities (small molecules, lipids, nucleic acids, etc.) and different target atoms for methylation (nitrogen, oxygen, carbon, sulfur, etc.).	1.63018e-10
NC_014210.1\|WP_013153669.1\|3154293_3155181_+\|isocitrate-lyase/phosphoenolpyruvate-mutase-family-protein	gnl\|CDD\|379346	pfam13714, PEP_mutase, Phosphoenolpyruvate phosphomutase. This domain includes the enzyme Phosphoenolpyruvate phosphomutase (EC:5.4.2.9). This protein has been characterized as catalyzing the formation of a carbon-phosphorus bond by converting phosphoenolpyruvate (PEP) to phosphonopyruvate (P-Pyr). This enzyme has a TIM barrel fold.	2.78909e-74
NC_014210.1\|WP_013153684.1\|3169396_3169630_+\|hypothetical-protein	gnl\|CDD\|284351	pfam06902, Fer4_19, Divergent 4Fe-4S mono-cluster. Members of this family contain three highly conserved cysteine residues. This family includes proteins containing divergent domains which are most likely to bind to iron-sulfur clusters.	4.57404e-28
NC_014210.1\|WP_013153670.1\|3155302_3155995_-\|DUF1028-domain-containing-protein	gnl\|CDD\|377639	pfam06267, DUF1028, Family of unknown function (DUF1028). Family of bacterial and archaeal proteins with unknown function. Some members are associated with a C-terminal peptidoglycan binding domain. So perhaps this could be an enzyme involved in peptidoglycan metabolism.	1.51436e-89
NC_014210.1\|WP_013153682.1\|3166333_3168262_-\|S9-family-peptidase	gnl\|CDD\|224423	COG1506, DAP2, Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism].	6.23534e-85
NC_014210.1\|WP_013153683.1\|3168390_3169131_-\|MerR-family-DNA-binding-transcriptional-regulator	gnl\|CDD\|133378	cd00592, HTH_MerR-like, Helix-Turn-Helix DNA binding domain of MerR-like transcription regulators. Helix-turn-helix (HTH) MerR-like transcription regulator, N-terminal domain. The MerR family transcription regulators have been shown to mediate responses to stress including exposure to heavy metals, drugs, or oxygen radicals in eubacterial and some archaeal species. They regulate transcription of multidrug/metal ion transporter genes and oxidative stress regulons by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.	5.53855e-22
NC_014210.1\|WP_013153671.1\|3156225_3156894_+\|zinc-finger-SWIM-domain-containing-protein	gnl\|CDD\|227059	COG4715, COG4715, Uncharacterized conserved protein [Function unknown].	1.38083e-12
NC_014210.1\|WP_041552750.1\|3151702_3152515_+\|alpha/beta-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	1.02697e-31
NC_014210.1\|WP_013153664.1\|3149438_3150128_-\|SMI1/KNR4-family-protein	gnl\|CDD\|378155	pfam09346, SMI1_KNR4, SMI1 / KNR4 family (SUKH-1). Proteins in this family are involved in the regulation of 1,3-beta-glucan synthase activity and cell-wall formation. Genome contextual information showed that SMI1 are primary immunity proteins in bacterial toxin systems.	9.97256e-07
NC_014210.1\|WP_041553158.1\|3163826_3164852_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|238568	cd01148, TroA_a, Metal binding protein TroA_a. These proteins are predicted to function as initial receptors in ABC transport of metal ions in eubacteria. They belong to the TroA superfamily of helical backbone metal receptor proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind the metal ion in the cleft between these domains.	3.14342e-73
NC_014210.1\|WP_041553156.1\|3157061_3157493_+\|Rrf2-family-transcriptional-regulator	gnl\|CDD\|224870	COG1959, COG1959, Predicted transcriptional regulator [Transcription].	1.50716e-28
NC_014210.1\|WP_013153677.1\|3161045_3161873_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224045	COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism].	7.05469e-108
NC_014210.1\|WP_013153679.1\|3163014_3163827_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	1.30491e-11
NC_014210.1\|WP_126625080.1\|3150330_3151503_+\|AI-2E-family-transporter	gnl\|CDD\|279875	pfam01594, AI-2E_transport, AI-2E family transporter. This family includes four different proteins from E. coli alone. One of them, YdgG or TqsA, has been shown to mediate transport of the quorum-sensing signal autoinducer 2 (AI-2). It is not clear if TqsA enhances secretion of AI-2 or inhibits AI-2 uptake. By altering the intracellular concentration of AI-2, TqsA affects gene expression in biofilms and biofilm formation. TsqA belongs to the AI-2 exporter (AI-2E) superfamily.	3.83621e-51
NC_014210.1\|WP_013153675.1\|3158483_3160004_-\|SMI1/KNR4-family-protein	gnl\|CDD\|214864	smart00860, SMI1_KNR4, SMI1 / KNR4 family. Proteins in this family are involved in the regulation of 1,3-beta-glucan synthase activity and cell-wall formation.	1.86071e-08
NC_014210.1\|WP_013153676.1\|3160280_3160760_+\|NUDIX-hydrolase	gnl\|CDD\|239217	cd02883, Nudix_Hydrolase, Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+ for their activity. Members of this family are recognized by a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which forms a structural motif that functions as a metal binding and catalytic site. Substrates of nudix hydrolase include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance and "house-cleaning" enzymes. Substrate specificity is used to define child families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required. This superfamily consists of at least nine families: IPP (isopentenyl diphosphate) isomerase, ADP ribose pyrophosphatase, mutT pyrophosphohydrolase, coenzyme-A pyrophosphatase, MTH1-7,8-dihydro-8-oxoguanine-triphosphatase, diadenosine tetraphosphate hydrolase, NADH pyrophosphatase, GDP-mannose hydrolase and the c-terminal portion of the mutY adenine glycosylase.	5.29966e-17
NC_014210.1\|WP_013153668.1\|3153878_3154202_+\|STAS-domain-containing-protein	gnl\|CDD\|132914	cd07043, STAS_anti-anti-sigma_factors, Sulphate Transporter and Anti-Sigma factor antagonist) domain of anti-anti-sigma factors, key regulators of anti-sigma factors by phosphorylation. Anti-anti-sigma factors play an important role in the regulation of several sigma factors and their corresponding anti-sigma factors. Upon dephosphorylation they bind the anti-sigma factor and induce the release of the sigma factor from the anti-sigma factor. In a feedback mechanism the anti-anti-sigma factor can be inactivated via phosphorylation by the anti-sigma factor. Well studied examples from Bacillus subtilis are SpoIIAA (regulating sigmaF and sigmaC which play an important role in sporulation) and RsbV (regulating sigmaB involved in the general stress response). The STAS domain is also found in the C- terminal region of sulphate transporters and stressosomes.	4.32696e-23
NC_014210.1\|WP_013153674.1\|3157784_3158201_+\|nuclear-transport-factor-2-family-protein	gnl\|CDD\|378915	pfam12680, SnoaL_2, SnoaL-like domain. This family contains a large number of proteins that share the SnoaL fold.	2.05593e-14
NC_014210.1\|WP_049800371.1\|3161869_3162889_-\|iron-chelate-uptake-ABC-transporter-family-permease-subunit	gnl\|CDD\|163581	TIGR03869, transport_system_permease_protein, proposed F420-0 ABC transporter, permease protein. his small clade of ABC-type transporter permease protein components is found as a three gene cassette along with a periplasmic substrate-binding protein (TIGR03868) and an ATPase (TIGR03873). The organisms containing this cassette are all Actinobacteria and all contain numerous genes requiring the coenzyme F420. This model was defined based on five such organisms, four of which are lacking all F420 biosynthetic capability save the final side-chain polyglutamate attachment step (via the gene cofE: TIGR01916). In Jonesia denitrificans DSM 20603 and marine actinobacterium PHSC20C1 this cassette is in an apparent operon with the cofE gene and, in PHSC20C1, also with an F420-dependent glucose-6-phosphate dehydrogenase (TIGR03554). Based on these observations we propose that this permease protein is a component of a F420-0 (that is, F420 lacking only the polyglutamate tail) transporter.	2.1873e-76

>NC_014210.1|WP_013153674.1|3157784_3158201_+|nuclear-transport-factor-2-family-protein
MTTDTQASRTVAEKFVERLGRQDPDGIQELFAEEIDWHVPGSDTFSWAGRRTRREEVAPYFTTMWPHFVHGKSEVVLERVIVDGGDVVLLAVWTHTVAATGKEFTTPAAIHLRVEDNRIVRMHLYEDTLTVEKAFNAD
>NC_014210.1|WP_041553156.1|3157061_3157493_+|Rrf2-family-transcriptional-regulator
MSANSRLTIAAHALTWIGLYQRRGHEVATSEQIATSVNTNPVVIRRLLAKLNKAGLADSRRGAGAGWMLARDLAAITLLDVYQAIEPGPVFALHRATPDPECVVGHGIGPAMTAVYDGVEAALRGELAKTTLEDVLRDVLNAA
>NC_014210.1|WP_013153671.1|3156225_3156894_+|zinc-finger-SWIM-domain-containing-protein
MPELSRDLLLELAGRKSFDRGLDHLGRVSGLRRDAKTVRATVRGQRRYRVRLTAEGAFSWRCDCPWAEEGDCCKHVVAVGLVHLYEREHGGTASSVPDVSSYLHTLDRERLLELLLEEADRSPGLTLALEARAAVASGSPEALRTLFEGALHVTEPVPCEQAAEYARAVHSAVDAVQELERSGRTEDAMELFNAVLSFTSEAKEMVEDPDGEVLSASERLHG
>NC_014210.1|WP_013153670.1|3155302_3155995_-|DUF1028-domain-containing-protein
MYAGTFSIVAHDVATGTCGVAVSSRFPAIGALSVFAHAEAGAVATQALINPLLGADALELLRSHSAEEALRRVLDADPDADSRQVAVVDREGRAAAHTGAQAHPWCGHRVGDGYAVAGNILTGADTLDAMAERFEAGAGERMDRRLLGALEAGQAAGGDRRGRQSAALYVHTGHPYPHLDLRVDEHPDPVAELRRIHGVAERELLPFVEAMPTRAHPAGRFERLLDTGDR
>NC_014210.1|WP_013153669.1|3154293_3155181_+|isocitrate-lyase/phosphoenolpyruvate-mutase-family-protein
MASRTAPGSGSADHDRPPPPSGADLPTEPESPGERFRALHLRGAPLLLPNAWDHASAAALAAAGFRAVGTTSLGVAAAAGLPDARGLAREETLRLARGLSRLDVPVSVDVEGGFSASPARVAALAAELKRTGIAGINLEDGLADGGLADTGHQRAVIRAVREAAPTLFLNARTDTRWLPGHAEQTADRAAAYEEAGADGVFVPGLRDEEEIAALAAALRVPLNILHSPDGPPLRVLADLGVRRVSCGSLLFRAALHGALAAAEAVASGLPLPEGVPDYGAVQGLARRFARGSADG
>NC_014210.1|WP_013153668.1|3153878_3154202_+|STAS-domain-containing-protein
MSTLTVTRRDSATGPVLDVTGSLDYDHASTLRHEVRLLALESGQCLSIDLSGLDFCDSSGISALLAARQHALAAGADIALLAVPANTLRIMSMVGLNRVFTIHPGTA
>NC_014210.1|WP_013153667.1|3152511_3153882_+|SpoIIE-family-protein-phosphatase
MSGETGPPGAGNGSATDAALSALLEDSAEELYESAPCGYLSTLMDGTVARINATLLRWLGLERAAVVGRMRFTDLLTVGGRLYHETHFAPLLHLRGEVNGIALEMRASDGGRLPVLVSSTVKRDGGGQPLLVRTTVFDATDRRSYEEELLRRRREAEQARAEAERAREEAERARAEAEEAHRRAEADRARLGEALVILQRALLPDTLPDVPGMEAAAYYHTASPYRLGGDFYDLFPLGDGCWAFFLGDVSGKGPEAATLTSQARYVLRTTALHSSEPADALGTLNTALLERYADNGDPRYCTAVFGVLEPDGDAGHVRARLAFGGHPPALALRGDGRAEFLFAPGGMLVGVLPDAHFATVETALAPGDTFVLYTDGLTEARTGAGPDTMYGEEALLSFVARHAPSTAHGVVDALAELLEGFGEGLEDDTALLALGVPAPPSTAPSGTGHHTMSGPR
>NC_014210.1|WP_041552750.1|3151702_3152515_+|alpha/beta-hydrolase
MDILRRNNVTVTGAADGPTVVLAHGFGCDQNLWRLVVPALAERYRVVLFDYVGSGGSDASAWSEDRYSSLEGYAQDAAEVCEALDLERAVFVGHSVSAMVGVLAARALPERIRALAMVTPSPRYIDDEGYRGGFTAADIDELLASLESNYLGWSSAMAPVIMGNPERPELGQELTTSFCAADPDIARVFARTTFLSDNREDLKGVEVPTLVLECAQDAIAPPEVGAFVHAAIPSSTLVTLDATGHCPQLSAPRATAAALLEFLESLRDAG
>NC_014210.1|WP_126625080.1|3150330_3151503_+|AI-2E-family-transporter
MPRWLPRAMLLALWLVTAFGLTLWLFVRLQSLIMLLLISLFLALALEPAVNWLHRHRWPRGPATGLVMLLVLALTVVFLSLLGSMLVGQILAFVSEIPAMIRAALAWVNTTFDTSYSPTTLLNEISSASGLIEQYASGIANNVWGAGTTVLALLFNALTIALFTFYLCADGPRFRRVICSVLPPRTQREVLRAWEIAITKTGGYLYSRALLALVCSGAHYVVLVALDIPFAFALALWVGVLSQFIPTVGTYIGGVVPVLVALMEGIWPAVWVLVFIVVYQQFENYLLQPRITARTLDMHPAVAFGSVLAGVAILGAPGALLALPMGASMQAFLGTYIRRYEVAEHPLLSDAEEDGKGGKPSPDPVAPVSEGDGGDARPPGPREREGGEGP
>NC_014210.1|WP_013153664.1|3149438_3150128_-|SMI1/KNR4-family-protein
MDTSTDVWAGVRERVRELARAPGAREVFGAGSHRFALLEPLTPEELAEAEGQLGIRLPTGYREFLLRVGAGGAGPAHGVFPLVRGVDGRWRWHGDGADLVAPARLAEPFPSTGPDPRSLAALRAEEPVEEDFGDGEEFDRVYEAWDARMADLLWAEERTVGALCLCHLGCALRQWLVVTGPEAGRMWSDGRVDDEDLTPLTGGDGAPLTFTDWYLGWLEEASRAVAVRS
>NC_014210.1|WP_013153675.1|3158483_3160004_-|SMI1/KNR4-family-protein
MTGHTTPLAFSTERRRVGAREWTRTPRLSVLIEPGEPVAPARIGWRDCEGGEAVAVFDPRMDAFTGTRVTLDGVQYEWRGTRLDEPPERPGHRFRIQGGGRELRLLVEDGGPPLARVDWADREGGGGTVLLRAVELDPTQSLGAEGLTRMVCSVRAGDEYTEVGDVALNLLDFAATKWRSRRRADRLDFTMSEPVTVRHYVLDSAGDSPDRDPADWSLLGSSDGREWTLLDARSGESFPARRLARDFTVTGPGADTPWRYLRLEVTRNAGADQTQLNRVRFFAEDRAYEAFHGLRHTARSGPETFMGLAVSPEGGDAPALPVTVEEWRTYLTEYSADMLRVAEAEGEEVGGEERTSSWFGNEGAPEERIAAVEERLGRRLPPSYRSFLAASDGWGRMGAFVYGMSSTAELEWDSLANMIGLDEEDLEDEDEGLVGPLMCVAYDTDAQFWFLDAGDASPDGEWAAYIWASWYPGLGDRHRSFASLVHAERVSFEELNAGKGRPVRVR
>NC_014210.1|WP_013153676.1|3160280_3160760_+|NUDIX-hydrolase
MPEIIKQKARAILFDRQGRLVLIKRTRPGRAPYWTTAGGGVEPEDDSVEAALHREVFEELGGRVDRVREVVVLTDERPEGTLVQHVFVARLTEMDPSSRTGPEFSDPTRGTYETVVLPSTDTALRSISLLPDSLARFLEGNLRDLRDLVADPRTETPRG
>NC_014210.1|WP_013153677.1|3161045_3161873_-|ABC-transporter-ATP-binding-protein
MTALEANGITWSVDRTRILDGVSIRARSNGVLAVLGPNGAGKTSLLRILAGLRRPDAGTVLLGGEPVRSLPRRAVARRVAIVEQSPEVHTDITVDDAVALGRTPYRGTFAGLDGEDRAAIEQALALTGMRAYRSRSWRTLSGGERQRAQLARALAQQPEVIVLDEPTNHLDIRYQLDVLTLLRSLDMTVVTALHDLNLAARYCDRVAVLHAGRIAATGTPAAVLTPELVRSVYGVEAVVDTSPHTGAPVVTYLGGVSGRSTPVPDPGPHRRRQTE
>NC_014210.1|WP_049800371.1|3161869_3162889_-|iron-chelate-uptake-ABC-transporter-family-permease-subunit
MRSSLVVAAFVLALCVTIVVAAFVGTANIGALDVLGIILRNIGLGALAPVPAAPPLIDALIWESRLPRVLLAAVVGLGLSVSGAVLQSITRNPLAEPYLLGVSSGASTGAVAIMVLGLGSGAVTLSTGAFAGALAAFAIVLVLIGGGRVSNPARVVLTGVLVSQFFSAITSLVLMLDGDADATRGFTYWLLGSLGGARWEPLLVASAVIVLGAVGCLFFAPALDAFTFGWDTASSLGINVTLARVTLMVLTALVTAAAVAASGAIGFIGLLVPHVVRLLAGPAHRLLLPLSGLGGAIFLVWVDTFARSAFSPHEIPVGVITALLGAPVFAVVLGRAARQ
>NC_014210.1|WP_013153679.1|3163014_3163827_-|class-I-SAM-dependent-methyltransferase
MTTTTTNTLEGNALERLIGDWDAQQAAYITHREQRFEIMLDVIARTCASSDAFGADGTGMTVLDLACGPGSLSQRVLDRFPGARVIGVDYDPVLLAIAGSWLGQRHGSRFTPVDVDLAAPGWRARLPEGPVHVAVSSTALHWLEPAQLVAVYDALGALLPADGVFMNADHLRYDPRSQPFLTGAAAADDERTQRDAHSRGVRTWDEWWSDAVAHDAFGQHHAERERRFADRPPTPHAPLELHLQALSTAGFAETGVIWRYYDDVVVFALR
>NC_014210.1|WP_041553158.1|3163826_3164852_-|ABC-transporter-substrate-binding-protein
MKIIIRTVGVVSALTLTGCAAAPASETDSAAAAGEGTTSYPLSIQNCDTEVTVEQAPERAVSLNQSATEIMVQLGLADRMAGTSYETDPVPSDIADAYESIPLLTDGLLKHETLLEAQPDFVYSSFASFLTAENAGERAELHELGVPTYLSEFDCTYHEAVEGGATFEMLFDEIETIARIFDVPDAGEELVAEQRAVVEEGLQAAEQIEGTPSLVWFYSTASSSSTPSVAGPGGLPQTVTEMLGAENAFGDASTKWPEVSWDEVAERDPDVLVLADLSRGYPGDTAEEKIEFLKNDPLTSTMDAVVNDRFIVVPGQHMDPSVHSVQAVPTIAQGLIDMEIE
>NC_014210.1|WP_013153681.1|3165054_3165705_-|class-I-SAM-dependent-methyltransferase
MTHDAQDPTSPSAEFWEPLHRSAETVTAPPPNVRLTELVRDLELAPGRACDLGSGRGGDARWLASLGWHVTATEVSATAVARIADMAAAQGLDRLRAERHDLSRSLPAGPFDLVYACYFHSPVAFGREDVLRRAARQVAVGGRLILVDHASTAPWSWRFGDEEPTFPTPEETLVTLMLGDGWTTERCESAERVANGPDGTTAGVTDNVIVVRRHSA
>NC_014210.1|WP_013153682.1|3166333_3168262_-|S9-family-peptidase
MTAPSKLITVEEFFGPPVRSRALLSPDGTRVAYLAPWRGRLNVFVRDPDSDWTAPDQVHEADAPGVRRVTSDTRRNIDAFFWTADGRYLLFQQDTDGDENWHLHRVDPNRPDEPAVDLTPFEGVRLLGAQLPPDRPGTAFVQLNMRRPDLADLFELDLETGRLTTAAENPGDVLSWLRTPDRLLAFTMEEGGDHVLSEHTEGARRAIARFPGTDALFGILPAVLTPDGNGLWIGSSRGSDRTRLVRLDLETGEQAGVDSHPVFDLDTPRPEADPRFPSSLILHPGTGDLLGARYLGTRQEIHALDPRFAEVLPRLAELSDGDLAHVSCDTAARRWVVDFTHDRDPGVTWFYDHATGRARRLFRPFPHLDPAELAPVTPVTVSARDGLTLPCHLTLPVGVEPRDLPTVLLVHGGPWYRDSWCYDPEVQLLANRGYAVLQVDFRGSTGYGKAHTQAAIGQFAGRMHDDLIDALDWAVEQGYTDPDRVAVYGCSYGGYAALVGAAFTPDRFAAAVSYTGMSDLVDLVESVVPFARRTVENSYLRYIGDPDDPRQRADMLARSPISRVDDITAPVLLIHGANDVRVHRRNSDRVFDALRSRGAEVEYLLNETEGHWFTNPDSNIELYGRLERFLARHLGGRSATGS
>NC_014210.1|WP_013153683.1|3168390_3169131_-|MerR-family-DNA-binding-transcriptional-regulator
MLSSELAELAGVTVRTLRHYHQIGLLPEPPRSAGGYRRYDVGHLVRLLRITRMTALGVPLSELPALLDDPAAAEELLDELDRRAAAEVERLLARRASIAALRRSGAPPDLPPELSELRSAPDPDMPEDMARYEHEQLVLVGHLLGGDGPAGLAALLGEVDDGTAALAPLTERFYALGPDTPEEEVAALTDDLVARLEPVVARLAGLFPSDARASTLMDELNGRTLRPVQHRVLRRVQRRLALSDGV
>NC_014210.1|WP_013153684.1|3169396_3169630_+|hypothetical-protein
MSGGHGKKAYEGESITVTFEAERCQHAAVCVNGLPEVFDTRRRPWIQPDGAAADRLAEVIRRCPSGALQYRLADGAR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_014210_19

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_014210_19

3414133-3414213

Unclear

Consensus_repeat	Method
CCGCTCACCGCACCCGCCCCGAACGCC	CRISPRCasFinder

1 spacers

Cas14u_CAS-V

The CRISPR arrays of NC_014210_19

>merge|NC_014210|19|3414133-3414213|CRISPRCasFinder
CCGCTCACCGCACCCGCCCCGAACGCCCGGGAGTAGGGCGGCGGGGTGGGGGGGCCGCTCACCGCACCCGCCCCGGACGCC

>NC_014210|19|18|3414133-3414213|CRISPRCasFinder
CCGCTCACCGCACCCGCCCCGAACGCC	CGGGAGTAGGGCGGCGGGGTGGGGGGG
CCGCTCACCGCACCCGCCCCGGACGCC

Protein	Signature genes	Signature genes Name	Protein_function
NC_014210.1\|WP_013153886.1\|3425330_3425918_+\|RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|224511
NC_014210.1\|WP_013153875.1\|3410488_3411379_-\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|378820
NC_014210.1\|WP_013153869.1\|3403818_3405099_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|226669
NC_014210.1\|WP_013153873.1\|3408561_3409752_-\|ROK-family-protein	unknown	unknown	gnl\|CDD\|224851
NC_014210.1\|WP_013153883.1\|3420508_3420940_-\|SRPBCC-family-protein	unknown	unknown	gnl\|CDD\|176859
NC_014210.1\|WP_013153877.1\|3412193_3412853_-\|two-pore-domain-potassium-channel-family-protein	unknown	unknown	gnl\|CDD\|369572
NC_014210.1\|WP_013153868.1\|3402149_3403415_-\|oxygenase	unknown	unknown	gnl\|CDD\|380046
NC_014210.1\|WP_041552774.1\|3416895_3418908_-\|hypothetical-protein	unknown	unknown	unknown
NC_014210.1\|WP_041552773.1\|3407319_3408489_+\|IS200/IS605-family-element-transposase-accessory-protein-TnpB	Cas14u_CAS-V	-	gnl\|CDD\|223747
NC_014210.1\|WP_013153874.1\|3409862_3410471_+\|phosphoribulokinase	unknown	unknown	gnl\|CDD\|235825
NC_014210.1\|WP_013153870.1\|3405098_3405896_-\|sugar-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224053
NC_014210.1\|WP_013153887.1\|3425914_3426715_+\|hypothetical-protein	unknown	unknown	unknown
NC_014210.1\|WP_013153885.1\|3424269_3425205_-\|LLM-class-F420-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|274648
NC_014210.1\|WP_013153871.1\|3405984_3406791_-\|substrate-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|380650
NC_014210.1\|WP_013153888.1\|3426711_3427602_+\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|213231
NC_014210.1\|WP_013153882.1\|3420069_3420339_+\|hypothetical-protein	unknown	unknown	unknown
NC_014210.1\|WP_013153881.1\|3419256_3419508_+\|hypothetical-protein	unknown	unknown	unknown
NC_014210.1\|WP_013153884.1\|3421146_3423870_-\|aconitate-hydratase-AcnA	unknown	unknown	gnl\|CDD\|236445
NC_014210.1\|WP_013153879.1\|3415544_3416906_-\|hypothetical-protein	unknown	unknown	unknown
NC_014210.1\|WP_013153876.1\|3411547_3412204_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228

Protein	Function_ID	Function_description	E-value
NC_014210.1\|WP_013153886.1\|3425330_3425918_+\|RNA-polymerase-sigma-factor	gnl\|CDD\|224511	COG1595, RpoE, DNA-directed RNA polymerase specialized sigma subunit, sigma24 homolog [Transcription].	2.56835e-30
NC_014210.1\|WP_013153875.1\|3410488_3411379_-\|alpha/beta-fold-hydrolase	gnl\|CDD\|378820	pfam12146, Hydrolase_4, Serine aminopeptidase, S33. This domain is found in bacteria and eukaryotes and is approximately 110 amino acids in length. It is found in association with pfam00561. The majority of the members in this family carry the exopeptidase active-site residues of Ser-122, Asp-239 and His-269 as in UniProtKB:Q7ZWC2.	3.5594e-07
NC_014210.1\|WP_013153869.1\|3403818_3405099_-\|ABC-transporter-permease	gnl\|CDD\|226669	COG4214, XylH, ABC-type xylose transport system, permease component [Carbohydrate transport and metabolism].	3.97338e-85
NC_014210.1\|WP_013153873.1\|3408561_3409752_-\|ROK-family-protein	gnl\|CDD\|224851	COG1940, NagC, Transcriptional regulator/sugar kinase [Transcription / Carbohydrate transport and metabolism].	3.35329e-57
NC_014210.1\|WP_013153877.1\|3412193_3412853_-\|two-pore-domain-potassium-channel-family-protein	gnl\|CDD\|369572	pfam07885, Ion_trans_2, Ion channel. This family includes the two membrane helix type ion channels found in bacteria.	9.79766e-07
NC_014210.1\|WP_013153868.1\|3402149_3403415_-\|oxygenase	gnl\|CDD\|380046	pfam17885, Smoa_sbd, Styrene monooxygenase A putative substrate binding domain. This domain is found in the 46 kDa FAD-specific styrene epoxidase (SMOA) protein, comprises a part of the styrene monooxygenase (SMO) two-component flavoprotein monooxygenase enzyme. Structural analysis indicates that SMOA monomer comprises two globular domains spanned by a long alpha-helix. This domain contains a putative substrate binding site.	1.58607e-37
NC_014210.1\|WP_041552773.1\|3407319_3408489_+\|IS200/IS605-family-element-transposase-accessory-protein-TnpB	gnl\|CDD\|223747	COG0675, COG0675, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	9.65729e-28
NC_014210.1\|WP_013153874.1\|3409862_3410471_+\|phosphoribulokinase	gnl\|CDD\|235825	PRK06547, PRK06547, hypothetical protein; Provisional.	2.17439e-22
NC_014210.1\|WP_013153870.1\|3405098_3405896_-\|sugar-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224053	COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism].	1.86128e-108
NC_014210.1\|WP_013153885.1\|3424269_3425205_-\|LLM-class-F420-dependent-oxidoreductase	gnl\|CDD\|274648	TIGR03560, F420_Rv1855c, probable F420-dependent oxidoreductase, Rv1855c family. Coenzyme F420 has a limited phylogenetic distribution, including methanogenic archaea, Mycobacterium tuberculosis and related species, Colwellia psychrerythraea 34H, Rhodopseudomonas palustris HaA2, and others. Partial phylogenetic profiling identifies protein subfamilies, within the larger family called luciferase-like monooxygenanases (pfam00296), that appear only in F420-positive genomes and are likely to be F420-dependent. This model describes one such subfamily, exemplified by Rv1855c from Mycobacterium tuberculosis. [Unknown function, Enzymes of unknown specificity].	5.21456e-103
NC_014210.1\|WP_013153871.1\|3405984_3406791_-\|substrate-binding-domain-containing-protein	gnl\|CDD\|380650	cd19995, PBP1_ABC_xylose_binding-like, periplasmic xylose-like sugar-binding component of the ABC-type transport systems. Periplasmic xylose-binding component of the ABC-type transport systems that belong to a family of pentose/hexose sugar-binding proteins of the type 1 periplasmic binding protein (PBP1) superfamily, which consists of two alpha/beta globular domains connected by a three-stranded hinge. This Venus flytrap-like domain undergoes a transition from an open to a closed conformational state upon ligand binding. Moreover, the periplasmic xylose-binding protein is homologous to the ligand-binding domain of eukaryotic receptors such as glutamate receptor (GluR) and DNA-binding transcriptional repressors such as LacI and GalR.	2.54851e-60
NC_014210.1\|WP_013153888.1\|3426711_3427602_+\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|213231	cd03264, ABC_drug_resistance_like, ABC-type multidrug transport system, ATPase component. The biological function of this family is not well characterized, but display ABC domains similar to members of ABCA subfamily. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.	1.42432e-91
NC_014210.1\|WP_013153883.1\|3420508_3420940_-\|SRPBCC-family-protein	gnl\|CDD\|176859	cd07817, SRPBCC_8, Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins. Uncharacterized group of the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily. SRPBCC domains have a deep hydrophobic ligand-binding pocket and they bind diverse ligands. SRPBCC domains include the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domains of mammalian STARD1-STARD15, the C-terminal catalytic domains of the alpha oxygenase subunit of Rieske-type non-heme iron aromatic ring-hydroxylating oxygenases (RHOs_alpha_C), Class I and II phosphatidylinositol transfer proteins (PITPs), Bet v 1 (the major pollen allergen of white birch, Betula verrucosa), CoxG, CalC, and related proteins. Other members of the superfamily include PYR/PYL/RCAR plant proteins, the aromatase/cyclase (ARO/CYC) domains of proteins such as Streptomyces glaucescens tetracenomycin, and the SRPBCC domains of Streptococcus mutans Smu.440 and related proteins.	3.53672e-44
NC_014210.1\|WP_013153884.1\|3421146_3423870_-\|aconitate-hydratase-AcnA	gnl\|CDD\|236445	PRK09277, PRK09277, aconitate hydratase AcnA.	0
NC_014210.1\|WP_013153876.1\|3411547_3412204_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	1.97118e-10

>NC_014210.1|WP_013153877.1|3412193_3412853_-|two-pore-domain-potassium-channel-family-protein
MRLGAFLVFVVLLQFGYPVTLHGPVWTGLYLVAYVGVVLSGVVLVRGAHDRIAPTAATGAALLCCAAWVGATGGGGAALVSMFAAGAAFQLALMYSLLRFVYRRSRTHELEIVLAAVCVYLLLGGLFTTVFGALESLWPGSFADSAHPGARVTWQQFVYFSYVTLATTGYGDVVPVSAWARSLSAAEGVVGTLFLTTVVARLVGAFTGPRREEGRAVTG
>NC_014210.1|WP_013153876.1|3411547_3412204_+|TetR/AcrR-family-transcriptional-regulator
MTARTDGRLQRGDQTRRAVLEHAVHTASVEGLEGLSLGRLAKELGVSKSGVFAHFGSKEELQLATLEAGRAVFVRHVVRDALEVRPGVERLWRLCVDWIGYSRGRVFRGGCLFYTAIAEFESRPGRVRDALRESSRQWRDLLARTAEDARQLGELSGGADPALLAFELRAFMETANSFSLLEDDLETPYAAARAAIAARLDSLAVPGAPRPWAGPVNR
>NC_014210.1|WP_013153875.1|3410488_3411379_-|alpha/beta-fold-hydrolase
MNTTRLVGTALNAAAVPAPRLAGRLLRRLWSHAGRPRAVAAADLDLHERARVQTLRVRGWEVAAYSWGDGALPVLLVHGWRSRASRFAPLVRRLLDLGYSPVSWDAPGHGATPGPVGTILDAREIMGLLQSRHGRFAAVVAHSLGAPFAVHALREGIEADRAVLVAGVSDFAFTVHTFAAALGLGPRAVAALRRAVEGHHFGGDPTVWTRFSAGEGAALTQPLLLLHDEHDTVVPAAQSHLTLAAHHGRARLVTTSGLGHSALLRDPAVLDAITGFVREPGGPARGEGEVPGAVGA
>NC_014210.1|WP_013153874.1|3409862_3410471_+|phosphoribulokinase
MSRARISTAEPGWADLLAEAVPPPASAPGRTRAVAVEGRSGAGKSTVADALRAALVRRGEAAALLTMEDLYPGWRGLEEGSELLREWVLAPLSRGERAAWRRYDWERGAFAREWTALPGDVAAGGVLVVEGGGSGAAAVRGLLDLLVWVEAPDDERARRLDGRWDASVYAPHRRTWAEQEEAFHRRDRPREHADAVVANPAR
>NC_014210.1|WP_013153873.1|3408561_3409752_-|ROK-family-protein
MTEAAATPGSQSALRRANERRVVDVLRREGTRTQAELARATGLSAASVSNIVRGLRAAGTVLVRDTSSNGRRAKAITLVRQPGAVVAVDFTADSVRVAVGDSDGNMLAREEIGYDVASDAERGVRRAAWLAETILLRSRVDRGTVSSVVASIPGPIDPGTGEVGGISCLPRWAGFRPARELTERLGLEVLAENDANLAVLAEQHRGAGVGAEHVVHLVLNDGVGAGIMMSGQLFRGAGGTAGEIGHIALDPRGHVCRCGNRGCLETFVGASYLLDMLPQNTDVARGPDPVRIPDMVAAALEGDPGSRRIIAEAGTALGQGTAIVANLFNPDRVVVGGELAQAGDLLLDPMRRSMELGSLSSALDRLELVPSALGRDASLYGALRMAAQQVKSASWS
>NC_014210.1|WP_041552773.1|3407319_3408489_+|IS200/IS605-family-element-transposase-accessory-protein-TnpB
MAGVSKIVVQLGLTPSPEQAAVLASTLRALNTHATRVAKVAHEQGVMRDYELRKHTYRQLRAAEVGSQAARHVIKKVCDAYRTRRANLDNGDYGPKGSVRRTRIGSTPIAFRAGSAHPYDARDLSFAMDARTISLWTFQGRLQDVPFTGSADQVKALAGHKRGEADLLRRDGAWFLAVTVEVPDAPEQEPDGFVGVDLRIINIATTSDGQVMAGRRINRYRRRRLRLRQKLQAKGTRSAKRLLRKRRRKEARHADTNHQISKRIVAEAERTGRGISLENLTGIRARVRQRRPQRATLHSWSFHQLGAFIAYKARLKGVPVVFVDPAHSSRECAACSYTHRANRVSQALFICRSCGVVAHADRNASRVLARRCQEAWNAGRKSHVPPGHP
>NC_014210.1|WP_013153871.1|3405984_3406791_-|substrate-binding-domain-containing-protein
MNARRFTPRHTTAGFAAAGAALALLVSGCGSLTTTGGEAEQETHTVEEGFHVGLLLPDLHTARYEAFDRPFFEEAMGELCPNCEISYANADQSVSEQQTQAQAMLTDGVDVLVLDPVDAAAAAGTVNEAKSQGVPVIAYDRLAEGGADMYVSFDNNRVGQVQAESLLEALEEEGSTGDGSIVVMHGSPTDPNAAMAVGLATGEDPELGEHTLTEVEDGGGETVPAVLLEPIAVTAENVGDTVVSDGIYSIEEICTDDYADTDFCQEAL
>NC_014210.1|WP_013153870.1|3405098_3405896_-|sugar-ABC-transporter-ATP-binding-protein
MSTPVLELSGISKTFGAVRALSDVDFHVGEGEVVALLGDNGAGKSTLVKVISGAHPADSGGVITWDGKPVSINAPSDAQRLGIATIYQDLALCDNLDIVGNLFLGNEKLHFPGTLDEVEMEGRAMELLDSLSVRIPSLRVPVASLSGGQRQIIAIARSLLGKPRVVMLDEPTAALGVAQTAQVLDLIERLRDQGLGVLLISHNMADVRAVADRAVVLRLGRNAGNFPVAETSYEEIVAAITGAADNPVSRRSERTGASALATEDK
>NC_014210.1|WP_013153869.1|3403818_3405099_-|ABC-transporter-permease
MTQQTPVSKAPATGAGGSAESKRDPRLLTTAASPKGWLDALRRNLRGGELGPIPVVVGLILIAVVFQSANDRFLSPQNLSNLTVQIAAIGLMTTGVIMVLLLGEIDLSIGSVAGLAAAVLGVLAVKQGVSEWLAIGAALAVGLVVGLLHGVVFAKLGVPAFVVTLAGLLGWQGLHLYLMGADGTINTSPSGPISLLTQTFFVPVVGWALAVLAVVLYVVSVAAVERRRRQANLPYKPWTEILFRAALLFVPILVAVWVLNQYKGVPLAFLIFVGFVVVLDLVLRKTRYGRMVYAVGGNAEAARRAGINVDMIRISVFGIASALAALGGIMLTSRNFAASVATGGGEELMMAIAAAVIGGTSLFGGRGNAYSALLGGLVLGAITSGLLLLQMDTSVRFMITAAVLLIAVILDSVSRRGRKTHARGGA
>NC_014210.1|WP_013153868.1|3402149_3403415_-|oxygenase
MRRILVVGAGQSGLQLAVGLLGEGYEVTLATEAGPEEVRAGRVTSTQCLFGPALRRERRHGLAFWDDRAPAVRGVGFRVADRAGAGAPALSWVGALDEHAQSVDQRLKMSAWLDLFVRRGGALLRGRVLAEDLERLAADHELTVVASGRGALSEVFPRDTRRSHFRSPQRSLALAYVTGAGPHPDGPVLSRTVVPGAGEVTTLPTYSLAGVCEAVMVEAVPGGPLDRPLPPGASGEEVLAGLLDVLYREAPWEYERLAHARLADPGAALRGGYAPVVREPVARLANGTPVLGMADSVVANDPVTAQGANMASFGAEVYRRAVVDHGRRPFDEAFMRSAFAAYWRLASQVTAWSRVLLTAPPHLEELYRLAARHQETADRFANCFSDPGDLIGWFLHPERALAYVDGVRRAEPARSSHLPIS
>NC_014210.1|WP_013153879.1|3415544_3416906_-|hypothetical-protein
MPADSPPARYTARTLAATCAVLLLYPATGALAQESDAQDPGAQSPQDRTQAIADALEESPVYVDPAYESAFPAQDQERVAGVIESSDLDLYVIAVPLTSGDVWNGDAATLVSVVHDRRGGGEAHYLAYDEVSGFHGEDYGPGVQEAAPAHHGALAASYGTDFDGSMLQQADAAVEAALSDDPRAAYEAALRSYEEANPHITGMGGDAGQGSGPGSGPLFAVGAVIAVLLAILLALFVRGRLTARVGRRRAASITQHAAFDNADRAQLDSLVEQGERDLIEVGERLSRMDADQGSDTRSGQSLQRALDARSAAAAVHDRMAAEGATLPDAVGVLVLLDIAEDALESAAGGARSAVRRRHCYANPLHGTNTKVTPWREFGGTRTIRVPLCADCAKAVRNRARPVVLPAEHEGAPVPYYEVPAEESVWAATGYGTLTDDLVQRVQRGDHRPRGRAR
>NC_014210.1|WP_041552774.1|3416895_3418908_-|hypothetical-protein
MPGPTSPLLRLMSAVVLPALLILLPVLGAAPASAQPEPGTGTREERVTPAEHYAALLAEQPEGAAVVVDDALAGRYDPEELEADLHDSFGALDVPYHVVASPFPGTEPRWGGDMLPALIDRVGADGLYVLLQPDSVPLARAAGADLPVDAASDAVRYSSGLDYYGAPLDEVADAFTAALADPDAQATADRLRQEYSAEQDAYRSPTAWEEFLEDLDPTTSVGPSNLGFLVSTATGALLTLSLCHVWWTRRRGGSTVAAVAVASVFGLALPAAGVAGALYYMDSVPLGASERPDPLEQARSQPPYVTSTVRVERVVDGLGGGPLYVDPLSPLSREGLADVAERAERSSVPVYAVLLPMADTDESEGDPARFAHAMRHVLGEDGVYAVITQESYEETPETTVLAFGTDLDSYYLGQALDEGAAMTPAQEFALLLEAVEEVPRDPEAGDPPPPYDSSATVPEPRTTRFWEDFWAGVLFLGPVVGALLLGAVLGTAALVRASRVRRRVRPSPRVLRRTAERERARLAALVSSDRAGRLPVSMMPPVEAALMVMDADPDDLDLVGVAVVSRRAHAALADPGSAEASPCMVNPLHGPAEAFERAGPRERRGLFPVCRACADLTDQQRTAALLRVRDGAGTRRDHLSMNERAWVEYRFGAKNPARMAERLLEEIDAR
>NC_014210.1|WP_013153881.1|3419256_3419508_+|hypothetical-protein
MQKKTLRRIAITAVAAPALAFGAPALASADAYYEVESSGANSHGAYNYELEAFAGDGKSWFEESFNVAGKGGAYSSSTESGAG
>NC_014210.1|WP_013153882.1|3420069_3420339_+|hypothetical-protein
MQRKTLRRFAFTVVAAPVLALGAPALASADSYYSSSWSGAGGDGAYSYVVKSGSGHGHGHGHGHSWYYHSWSHAGPHGAYHSSVSSGSH
>NC_014210.1|WP_013153883.1|3420508_3420940_-|SRPBCC-family-protein
MSEIIETVEVDVPVTAAYAQWTRFEEFPSFMEGVDKVVRTGDGHMLWTIEIGGQKREFEAVVTEQVPGERIAWKTTDGTTHAGVVTFHRLSDTSSRITLQLKTVPEGVVEQLGDKLGLVKTRAKGDMKRFKAFVEPGRENPTG
>NC_014210.1|WP_013153884.1|3421146_3423870_-|aconitate-hydratase-AcnA
MSANSFGARDTLRVGDESYEIFRLETVEGSSRLPYSLKVLLENLLRTEDGANVTADHIRALGGWDPKAQPNQEIQFTPARVIMQDFTGVPCVVDLATMREAVRDMGGDPDKINPLAPAELVIDHSVVVDLFGRPDAFERNVEIEYERNYERYKFLRWGQTAFDEFKVVPPGTGIVHQANIEHLARVTMSRGGQAYPDTCVGTDSHTTMQNGLGILGWGVGGIEAEAAMLGQPISMLIPRVVGFKLTGELQPGTTATDLVLTITEMLRQHGVVGKFVEFYGEGVASVPLANRATIGNMSPEFGSTAAIFPIDDETIRYMKLTGRSEQQVALTEAYAKANGFWHDPANEPEFSEYLELDLAEVVPSIAGPKRPQDRIALSEAKSTWRHDVRNYVEDSTDEAGEESFPASDAPSQTANGARPHKAVKVTMADGTETEIDHGAVVIAAITSCTNTSNPSVMLGAALLAKKAVEKGLTRKPWVKTSMAPGSKVVTDYYERSGLTPYLDKLGFNLVGYGCTTCIGNSGPLPEEISQAVQDNDLAVTAVLSGNRNFEGRINPDVKMNYLASPPLVVAYALAGSLDVDITTEPLGIDKDGEPVFLADIWPSAEEIQQVMDSAIASDMYESAYSDVFAGDERWRSLPTPTGNTFEWEGESTYVRKPPYFEGMETTPAPVTDITGARVLAKLGDSVTTDHISPAGAIKPGTPAAEYLKANGVERRDFNSYGSRRGNHEVMIRGTFANIRLRNQIAPGTEGGYTRDFTQPEGPVSFIYDAARNYAEQGTPLVVLGGKEYGSGSSRDWAAKGTSLLGVRAVITESYERIHRSNLIGMGVLPLQFPEGQSADSLGLTGEETFSITGVTELNEGTTPATVKVSTDTGVEFDAVVRIDTPGEADYYRNGGILQYVLRQLIAK
>NC_014210.1|WP_013153885.1|3424269_3425205_-|LLM-class-F420-dependent-oxidoreductase
MRLRIFLEPQQGATYEDQLTVARAVEDLGFDALFRSDHYLHMGDHVSGLPGPTDAWITLAGLARDTSRIRLGTLMTAATFRHPAPLAISVAQVDRMSDGRVEFGFGSGWFEEEHAVYGIPFPATARERFDRYEEQLDIITGLWSTPVGETFRYEGKHYRLAEGPALPKPQQGPRPPVLIGGTGPKRTPRLAAKYADEYNVPFNSIEDTSAAFERTRAAVRASGRSAPMVYSAAQVLCAGRDEAEVARRAERIGREVPELRENGLAGTPNELVDKIGRFAEAGAERMYLQMLDMSDLDHLELVASQVAPQLD
>NC_014210.1|WP_013153886.1|3425330_3425918_+|RNA-polymerase-sigma-factor
MKLLRRARRRAPSYDPDSTDPVLLAAVAAGETRALEFLHRRHATWLRARLRYRCSDPDQLDAALQETFLAVWRNAGSFTPRPGDTDAGAWLWTIAIRQLISQLRKRANRWIADSDSEPYETIGDASAEDTVLLNIEHGPLGAALHSLSPELRSAIQATVLDGLTVREAAQILQVPEGTVKTRVMRAKARLREALT
>NC_014210.1|WP_013153887.1|3425914_3426715_+|hypothetical-protein
MSWHLTPAQAHEYAHHRSDDVTAMSVEAHITHCAPCRDLLPADEPWLARSWEDLRDVVDRPRRGPVESLLSSLGLGEGTAKLLAATPSLYRAWLLATVVVLTAALLAAHHLPHGSLMFTFTAPVVPLAGVALAYGHGVDPAHSLTSVTPLAGQRLLFLRTCAVLVPALTLCMSAALLLPHAHTPWKAVFWLLPALTLVAGSLVLSRWMHLGAASAAVGLLWLVALGVLTASEDATPLHLLAPQAQVWWAGALTALLGALLLRVRTA
>NC_014210.1|WP_013153888.1|3426711_3427602_+|ATP-binding-cassette-domain-containing-protein
MSTTTARAAVSVRGLGHRYGTRTALAGIDLDLGPGVTGLLGRNGAGKTTLLRCLATDLEADDGELRVLGHDPARAAERTEIRRHLGYLPQNPEFYPYFTAFGLLDYMAVLKELGGRRARHDEVRRVLERVGLHDRRHSRVRRLSGGMRQRLGLASALLGDPRVLLLDEPTIGLDPEQRIRFRGLVSELAVRSTVVLSTHQIEDVAALCQRVVCLDAGRVIFDGTPRALVDGARGHVWERDGRPGREYTSWRLADGRYRVLTPAGGAAPGPSEGLEPVEPSLEDAYLLLTGVEQDDR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_014210_20

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_014210_20

3903353-3903451

Orphan

Consensus_repeat	Method
GCGGACCTGTTCCGCGACGACGAGGAG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_014210_20

>merge|NC_014210|20|3903353-3903451|CRISPRCasFinder
GCGGACCTGTTCCGCGACGACGAGGAGGAGACGACCGCCCCGGACCCCAACGCGACCGCGCGCATCTCCCGTGCGGACCTGTTCCGCGACGAGGAGGAG

>NC_014210|20|19|3903353-3903451|CRISPRCasFinder
GCGGACCTGTTCCGCGACGACGAGGAG	GAGACGACCGCCCCGGACCCCAACGCGACCGCGCGCATCTCCCGT
GCGGACCTGTTCCGCGACGAGGAGGAG

Protein	Signature genes	Signature genes Name	Protein_function
NC_014210.1\|WP_013154288.1\|3910460_3911189_-\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224715
NC_014210.1\|WP_013154279.1\|3900968_3902126_+\|acyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|173847
NC_014210.1\|WP_013154289.1\|3911314_3912697_+\|MHS-family-MFS-transporter	unknown	unknown	gnl\|CDD\|340927
NC_014210.1\|WP_013154283.1\|3906036_3906375_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|131660
NC_014210.1\|WP_013154280.1\|3902580_3903225_+\|hypothetical-protein	unknown	unknown	unknown
NC_014210.1\|WP_013154273.1\|3894758_3895028_-\|hypothetical-protein	unknown	unknown	unknown
NC_014210.1\|WP_013154278.1\|3898863_3900972_+\|acetyl/propionyl-CoA-carboxylase-subunit-alpha	unknown	unknown	gnl\|CDD\|227111
NC_014210.1\|WP_013154275.1\|3895758_3896358_-\|sulfite-oxidase-like-oxidoreductase	unknown	unknown	gnl\|CDD\|239027
NC_014210.1\|WP_013154276.1\|3896535_3897120_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|366102
NC_014210.1\|WP_013154271.1\|3892718_3894095_-\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|224172
NC_014210.1\|WP_013154284.1\|3907085_3907508_+\|SsgA-family-sporulation/cell-division-regulator	unknown	unknown	gnl\|CDD\|377399
NC_014210.1\|WP_013154291.1\|3913801_3915013_+\|D-galactonate-dehydratase-family-protein	unknown	unknown	gnl\|CDD\|237901
NC_014210.1\|WP_013154274.1\|3895024_3895759_-\|oxidoreductase	unknown	unknown	gnl\|CDD\|99813
NC_014210.1\|WP_013154272.1\|3894406_3894709_+\|hypothetical-protein	unknown	unknown	unknown
NC_014210.1\|WP_041552812.1\|3897245_3898856_+\|methylcrotonoyl-CoA-carboxylase	unknown	unknown	gnl\|CDD\|178415
NC_014210.1\|WP_013154282.1\|3903544_3905518_-\|threonine--tRNA-ligase	unknown	unknown	gnl\|CDD\|237050
NC_014210.1\|WP_013154287.1\|3910238_3910409_+\|hypothetical-protein	unknown	unknown	unknown
NC_014210.1\|WP_013154286.1\|3908840_3909272_+\|roadblock/LC7-domain-containing-protein	unknown	unknown	gnl\|CDD\|367422
NC_014210.1\|WP_013154290.1\|3912693_3913731_+\|L-idonate-5-dehydrogenase	unknown	unknown	gnl\|CDD\|176194
NC_014210.1\|WP_013154285.1\|3907612_3908455_-\|class-IV-aminotransferase	unknown	unknown	gnl\|CDD\|238254

Protein	Function_ID	Function_description	E-value
NC_014210.1\|WP_013154288.1\|3910460_3911189_-\|GntR-family-transcriptional-regulator	gnl\|CDD\|224715	COG1802, GntR, Transcriptional regulators [Transcription].	3.06501e-46
NC_014210.1\|WP_013154279.1\|3900968_3902126_+\|acyl-CoA-dehydrogenase	gnl\|CDD\|173847	cd01158, SCAD_SBCAD, Short chain acyl-CoA dehydrogenases and eukaryotic short/branched chain acyl-CoA dehydrogenases. Short chain acyl-CoA dehydrogenase (SCAD). SCAD is a mitochondrial beta-oxidation enzyme. It catalyzes the alpha,beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of SCAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. This subgroup also contains the eukaryotic short/branched chain acyl-CoA dehydrogenase(SBCAD), the bacterial butyryl-CoA dehydorgenase(BCAD) and 2-methylbutyryl-CoA dehydrogenase, which is involved in isoleucine catabolism. These enzymes are homotetramers.	7.51884e-160
NC_014210.1\|WP_013154289.1\|3911314_3912697_+\|MHS-family-MFS-transporter	gnl\|CDD\|340927	cd17369, MFS_ShiA_like, Shikimate transporter and similar proteins of the Major Facilitator Superfamily. This subfamily is composed of Escherichia coli shikimate transporter (ShiA), inner membrane metabolite transport protein YhjE, and other putative metabolite transporters. ShiA is involved in the uptake of shikimate, an aromatic compound involved in siderophore biosynthesis. It has been suggested that YhjE may mediate the uptake of osmoprotectants. The ShiA-like subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	3.91084e-149
NC_014210.1\|WP_041552812.1\|3897245_3898856_+\|methylcrotonoyl-CoA-carboxylase	gnl\|CDD\|178415	PLN02820, PLN02820, 3-methylcrotonyl-CoA carboxylase, beta chain.	0
NC_014210.1\|WP_013154278.1\|3898863_3900972_+\|acetyl/propionyl-CoA-carboxylase-subunit-alpha	gnl\|CDD\|227111	COG4770, COG4770, Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism].	0
NC_014210.1\|WP_013154275.1\|3895758_3896358_-\|sulfite-oxidase-like-oxidoreductase	gnl\|CDD\|239027	cd02109, arch_bact_SO_family_Moco, bacterial and archael members of the sulfite oxidase (SO) family of molybdopterin binding domains. This molybdopterin cofactor (Moco) binding domain is found in a variety of oxidoreductases, main members of this family are nitrate reductase (NR) and sulfite oxidase (SO). Common features of all known members of this family are that they contain one single pterin cofactor and part of the coordination of the metal (Mo) is a cysteine ligand of the protein and that they catalyze the transfer of an oxygen to or from a lone pair of electrons on the substrate. The specific function of this subgroup is unknown.	6.57332e-89
NC_014210.1\|WP_013154276.1\|3896535_3897120_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|366102	pfam00440, TetR_N, Bacterial regulatory proteins, tetR family.	1.20756e-12
NC_014210.1\|WP_013154271.1\|3892718_3894095_-\|FAD-dependent-oxidoreductase	gnl\|CDD\|224172	COG1252, Ndh, NADH dehydrogenase, FAD-containing subunit [Energy production and conversion].	6.63931e-101
NC_014210.1\|WP_013154284.1\|3907085_3907508_+\|SsgA-family-sporulation/cell-division-regulator	gnl\|CDD\|377399	pfam04686, SsgA, Streptomyces sporulation and cell division protein, SsgA. The precise function of SsgA is unknown. It has been found to be essential for spore formation, and to stimulate cell division.	1.32931e-42
NC_014210.1\|WP_013154291.1\|3913801_3915013_+\|D-galactonate-dehydratase-family-protein	gnl\|CDD\|237901	PRK15072, PRK15072, D-galactonate dehydratase family protein.	0
NC_014210.1\|WP_013154274.1\|3895024_3895759_-\|oxidoreductase	gnl\|CDD\|99813	cd06217, FNR_iron_sulfur_binding_3, Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain. Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin. Isoforms of these flavoproteins (i.e. having a non-covalently bound FAD as a prosthetic group) are present in chloroplasts, mitochondria, and bacteria in which they participate in a wide variety of redox metabolic pathways. The C-terminal domain contains most of the NADP(H) binding residues and the N-terminal domain interacts non-covalently with the isoalloxazine rings of the flavin molecule which lies largely in a large gap between the two domains. Ferredoxin-NADP+ reductase first accepts one electron from reduced ferredoxin to form a flavin semiquinone intermediate. The enzyme then accepts a second electron to form FADH2 which then transfers two electrons and a proton to NADP+ to form NADPH.	4.40228e-91
NC_014210.1\|WP_013154283.1\|3906036_3906375_+\|hypothetical-protein	gnl\|CDD\|131660	TIGR02611, Putative_membrane_protein, TIGR02611 family protein. Members of this family are Actinobacterial putative proteins of about 150 amino acids in length with three apparent transmembrane helix and an unusual motif with consensus sequence PGPGW. [Hypothetical proteins, Conserved].	3.42822e-12
NC_014210.1\|WP_013154282.1\|3903544_3905518_-\|threonine--tRNA-ligase	gnl\|CDD\|237050	PRK12305, thrS, threonyl-tRNA synthetase; Reviewed.	0
NC_014210.1\|WP_013154286.1\|3908840_3909272_+\|roadblock/LC7-domain-containing-protein	gnl\|CDD\|367422	pfam03259, Robl_LC7, Roadblock/LC7 domain. This family includes proteins that are about 100 amino acids long and have been shown to be related. Members of this family of proteins are associated with both flagellar outer arm dynein and Drosophila and rat brain cytoplasmic dynein. It is proposed that roadblock/LC7 family members may modulate specific dynein functions. This family also includes Golgi-associated MP1 adapter protein and MglB from Myxococcus xanthus, a protein involved in gliding motility. However the family also includes members from non-motile bacteria such as Streptomyces coelicolor, suggesting that the protein may play a structural or regulatory role.	2.70489e-23
NC_014210.1\|WP_013154290.1\|3912693_3913731_+\|L-idonate-5-dehydrogenase	gnl\|CDD\|176194	cd08232, idonate-5-DH, L-idonate 5-dehydrogenase. L-idonate 5-dehydrogenase (L-ido 5-DH ) catalyzes the conversion of L-lodonate to 5-ketogluconate in the metabolism of L-Idonate to 6-P-gluconate. In E. coli, this GntII pathway is a subsidiary pathway to the canonical GntI system, which also phosphorylates and transports gluconate. L-ido 5-DH is found in an operon with a regulator indR, transporter idnT, 5-keto-D-gluconate 5-reductase, and Gnt kinase. L-ido 5-DH is a zinc-dependent alcohol dehydrogenase-like protein. The alcohol dehydrogenase ADH-like family of proteins is a diverse group of proteins related to the first identified member, class I mammalian ADH. This group is also called the medium chain dehydrogenases/reductase family (MDR) which displays a broad range of activities and are distinguished from the smaller short chain dehydrogenases(~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal GroES-like catalytic domain. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines.	2.07029e-144
NC_014210.1\|WP_013154285.1\|3907612_3908455_-\|class-IV-aminotransferase	gnl\|CDD\|238254	cd00449, PLPDE_IV, PyridoxaL 5'-Phosphate Dependent Enzymes class IV (PLPDE_IV). This D-amino acid superfamily, one of five classes of PLPDE, consists of branched-chain amino acid aminotransferases (BCAT), D-amino acid transferases (DAAT), and 4-amino-4-deoxychorismate lyases (ADCL). BCAT catalyzes the reversible transamination reaction between the L-branched-chain amino and alpha-keto acids. DAAT catalyzes the synthesis of D-glutamic acid and D-alanine, and ADCL converts 4-amino-4-deoxychorismate to p-aminobenzoate and pyruvate. Except for a few enzymes, i. e., Escherichia coli and Salmonella BCATs, which are homohexamers arranged as a double trimer, the class IV PLPDEs are homodimers. Homodimer formation is required for catalytic activity.	8.46238e-64

>NC_014210.1|WP_013154280.1|3902580_3903225_+|hypothetical-protein
MEGALSVIALVAVVMSAGTIAVAAHFRKERSTELRGWARERGWTYTEQLPSPLGDAVLPRAALGPHPRAQHVLTGRRGQHLVVAFEQTHTAGRGTERIRRVHRVVAVRTPGPNAELQILRRWDPDASDDDFAGAFHATGNDPAFTGAVLDNVVTKWLLTDPRSRSLPVRFSGDYVLTWAAMRLDPDRAVTAADYLIALVERIPAEAWKRRAPGR
>NC_014210.1|WP_013154279.1|3900968_3902126_+|acyl-CoA-dehydrogenase
MNRHQLSTEHADLRAAVEEFAREEVAPVIGDYYEREAFPYEIVAKMGRMGLFGLPFPEEHGGMGGDYFALCLALEELARVDSSVAITLEAGVSLGAMPIFRFGTEDQKKAYLPRLTSGEALGAFGLTEPGGGSDAGATRTTARLEDGQWVVDGTKSFITNSGTDITALVTVTAVTGRREDGRPEISSILVPAGTPGFSVGQKYSKVGWNASDTNELVFEDCRVPEANLVGERGRGYAQFLRILDEGRIAIAALSVGLAQGCVDESVRYAHERHAFGSAIGTYQAIQFKIAEMEARAHTARLAYYDAASRMLAGEPFKKEAAVAKLVASNAAMDNARDATQVFGGYGFMNDYPVGRFYRDAKILEVGEGTSEVQKMLIARELGLPA
>NC_014210.1|WP_013154278.1|3898863_3900972_+|acetyl/propionyl-CoA-carboxylase-subunit-alpha
MTTTPRTNPGVRGPARIMVANRGEIALRVMRTLRRMGISPATVYTDADANAPHTLAADLALRVEHYLDAEAIVALALDCGATGVHPGYGFLSENAGFARACTDAGLVFVGPPASAIEAMGDKIRAKDTVAAAGVPVLGGFTEKPGRPLGDDELLRAAEETGYPLLIKPSAGGGGKGMRSVHSPDDLVAGAAAARREALASFGDSTLLVERLVERPRHIEVQVMADAHGNVLHLGERECSLQRRHQKVVEEAPSPLLTDTQRATMGEAAVAAARSCGYVGAGTVEFIAEAGRGGDLSFSFLEMNTRLQVEHPVTEEVVAVRGERGVDLVELQVRVAYGEELPFAQSDVSWVGHAVESRIYAEDADRGFLPTGGPILSLAEPRGHEVRVDSGIAEGGRITSDFDPMLAKVITWGADRAEALNRMDSALASYQLLGCVTNTAYLRRLLRHPRVVAGDLSTDLIASDPPAPAPERTLDEVYAAAALDHQLDLETEPGADRFAVPDGWRMGGPAWTPWRLRLSGREAVAVRVRRDGEPGRYLVSVAEGEPVAFGARRSADGTRLTVTDGYATRTYARADDPGTAHRWLGSGGAAWSLHEEPVAAALREDDAAADGTVRSPMPGTVLSVAVRVGQTVSAGTPLAVVEAMKMEHSVTSPVDGTVAAVAVRPGASVPMDAVLVTVEPVPNASADTPSDAPSPATSEESHA
>NC_014210.1|WP_041552812.1|3897245_3898856_+|methylcrotonoyl-CoA-carboxylase
MLGTAVDTAGPAFAANDAANRALALELRERIATAALGGPERTRTRHVERGKLLPRDRVDLLLDPGSPFLEIAPLAAYGLYGADGQDAPGAGMIAGVGRVMGRPTVVVANDATVKGGSYYPMTVKKHLRAQEVALHNRLPCVYLADSGGAFLPMQDDVFPDREHFGRIFYNQATMSRMGIPQIAAVLGSCTAGGAYVPAMSDEAVIVREQGTIFLGGPPLVKAATGEVVTAEELGGGDLHSRVSGVTDHLADDDAHALTLVRRIADTLGPPGPPAWEVREPRPPALDPGELYGVVPADTRTPYDVREVIGRIVDGSEFTEFKAEYGTTLVTGFAHLHGHPVGIVANNGILFAESALKGAHFIELCDRRGVPLVFLQNISGFMVGRDYEAGGIAKHGAKMVTAVACARVPKFTVVVGGSFGAGNYSMCGRAYSPRFLWMWPNARISVMGGEQAASVLSTVRRDQMAARGQEWSAEDEEAFKAPVRDQYEEQGSPYYSTARLWDDGVIDPADTRDVLAMALSAARHAPLEPVGYGVFRM
>NC_014210.1|WP_013154276.1|3896535_3897120_-|TetR/AcrR-family-transcriptional-regulator
MGARPAGERRTALLGAAARLFAEHGYRGVSIDDLGRAVGTTGPALYRHFRGKQALLGAVLVDISERLARQGGELVARASGAEEALEALLRGHIAFALDEPDLITVHDRELGNLTDADRRRVRRLQRGYVEQWVGVLGELRPDASATVLRAAVHAVFGLLNSTPHSRGELSRRHMARLLLEMGRAALTVPAAEPD
>NC_014210.1|WP_013154275.1|3895758_3896358_-|sulfite-oxidase-like-oxidoreductase
MNVVSRGFQGRRGGDPSRVPPGQYETHDFPVLSAGPTPHVDTAEWTFAIADEAGGTRSWTWDEFLDLPQERLRVDIHCVTRWSKLDTDWAGVSVDTLLEDVETAAEYALAVSHGGYTANLPLQDLTDGRAWVVHSFGGEPLAPEHGGPARLLVPHLYFWKSAKWVRGLRLLDEDEPGFWEQAGYHDYGDPWREQRYQGD
>NC_014210.1|WP_013154274.1|3895024_3895759_-|oxidoreductase
MAAWRPAELVADRWETASARTLVLEVPGWPGHRPGQHVDVRLTAEDGYTAQRGYSIASAADGERVELTVQRVEGGEVSPYLVDVFAPGDRVEVRGPLGGWFVWDAASPDPVVLVGGGSGVVPLMAMVRERRRTGGRALFRVLYSLRTPEDRYYRGELGAHRPGDGGVDVFLAYTRRAPEGAVRGPGRLGVAELNTHGFPAEFAPVCFVCGPTGFVETVADALVALGHDPRRVRTERFGSGGGGG
>NC_014210.1|WP_013154273.1|3894758_3895028_-|hypothetical-protein
MREPEHMDANVLAGPLSEIMSVDLTSAERRCSVCGACGTFAELYVTTDGPGLVASCPRCRTLVLRLVRTPDSVWLDLGGTGVVRIRLGL
>NC_014210.1|WP_013154272.1|3894406_3894709_+|hypothetical-protein
MRAFTRITAATVLAAGLSVAGTGAAVAATADQDDSRPGGVLGFLFDGVFGEDSKPPVVNEDPEAPAEEAPEAPAEEAPAQEAPAAPAEQSPDTGGATGGV
>NC_014210.1|WP_013154271.1|3892718_3894095_-|FAD-dependent-oxidoreductase
MSRPRIVVVGAGFGGLHTLRHLERRIPAGAADIALVAPHDYMLYSPLLPQVASGLLTPQSVAMSVHRLTRQTRFVPGHAVGVDPGDRVVVVRRPTGELAPVRYDRLVLAPGGVTRAFDIPGLAEHAYGAKTLAEAVLLRDHVLAQLELANDSRDPAEREERCRFVVVGGGYTGVETAASLMRLCQEAAKRYPDLRSVIRWHLVDIAPKVLPELGDRLGRKALDLLRSIGVEVKLKVSVREVTDDKVVLTDGRALPCRTLIWTAGVSPSPLMATLDKPTQKGRLEVGADLRVPGLDDVFAVGDAAAVPNLSHEDSDYCPPTAQYATRQAATVADNVVSSVLGRPMKEFRHRDMGLVVDLSGNDALARVMQLELSGLPALGVTRGYHLMAVPSATARARILANWGIRKATGGDTSRLGFADGGRPSSFVANESVDYLDAEGSRREGARLLENLHARYGVH
>NC_014210.1|WP_013154282.1|3903544_3905518_-|threonine--tRNA-ligase
MSAAPELHITLAGTPRAVAANTTAGQALEADGRTVIAALVNGEPRDLARELHEGDTVEPIAIDSEEGRAILRHSTAHVLAQAVQELFPEAKLGIGPPVENGFYYDFDVAEPFTPADLKSIEKKMQQIVKQGQRFDRRVVSDEEARAELATEPYKLELIGLKGGATEAAEGAGVEVGAGELTIYDNVHPRTGELCWKDLCRGPHLPTTRVIPAFKLMRTAAAYWRGKETNPQLQRVYGTAWESKEALKDHLTFLEEAEKRDHRKLGSELDLFSIPDEIGSGLAVFHPKGGTVRRVMEDYSRRRHEEDGYEFVYTPHATKGTLFEKSGHLDWYADGMYPPMQLDGGQDYYLKPMNCPMHHLIFDARGRSYRELPLRLFEFGTVYRYEKSGVVHGLTRARGFTQDDSHIYCTKEQMADELDSLLTFVLDLLRDYGLDDFYLELSTKDPEKYVGTDEVWEEATEILREAAQKQGLELVLDPAGAAFYGPKISVQAKDAIGRTWQMSTIQVDFNMPERFDLEYTAADGSRQRPVVIHRALFGSIERFFAVLLEHYAGAFPAWLAPVQAVGIPIADEHVPYLRELAARLRAEGIRVEVDASDDRMQKKIRNAQKQKVPFMLLAGDEDVSKNAVSFRYRDGSQNNGVPLDEAVAEIVAAVRERR
>NC_014210.1|WP_013154283.1|3906036_3906375_+|hypothetical-protein
MRARLRLFRSRMHTHPALRLPWSVLVGTVGVVVILAGLLMMVVPGPGLASVILGLVILSTEFRWAQKVVRPAQVWFHRAERYGMRLKDEFFRRLRERRAVRRGHPLPDTPSD
>NC_014210.1|WP_013154284.1|3907085_3907508_+|SsgA-family-sporulation/cell-division-regulator
MNSSDTTATAELGLRLVVPERTAVPLVARLDYSADDPYAIRVAFHTGEDNPVEWIFARELLTVGIVRPVGEGDVRVWPSKDDNGDRSVSIALSSPFGQAEFDTQVSPLAEFLHRTYEIVPAGQEGQFVNLDEEIQQHLHS
>NC_014210.1|WP_013154285.1|3907612_3908455_-|class-IV-aminotransferase
MKVWIAGAGYGRGTVVDESEARIPVVDHGITVGDGVFETVRARGGRPFALTRHLRRLARSAEGLGMAEPDLDLIADGVARAVAANPDLPDARVRITVTDGAGPLGSDRSPGEQTAIVALGPFPGIAPHADVATVPWPRNEFGALAGLKTTSYADNVRALAYAKQRGAGEALFRNVSGNLCEGTGSNVFVVLDGRLVTPPLSAGPLAGITRELVLEWFGGEEEDVPMERLPEVTEAFLTSTGRDVQAILHVDGRTVSAEPGPVTAKAASVFAERSAADIDP
>NC_014210.1|WP_013154286.1|3908840_3909272_+|roadblock/LC7-domain-containing-protein
MTPPSTARGELSWLLDDLLTRASGTQHAIVLSTDGLLMATSSGLDRPAAEHLSAIASGLHSLAGGASKQFAAGGIRQSIIEMDRAFLFVAAAGEGACMALMSDSDSDVGLIAYEMNKVIERVGQYLSAPPRPDMPSSPAHVEK
>NC_014210.1|WP_013154287.1|3910238_3910409_+|hypothetical-protein
MFAVIAAVLFGLALLLELLGENIQDLVTTTTLTLAGLLFLALHAGGYGSGWGRRRR
>NC_014210.1|WP_013154288.1|3910460_3911189_-|GntR-family-transcriptional-regulator
MADQTRSGGPLLSARDRTLDTIRRAIITLELKPGTPLSENELATELAVSRTPVRESLILLREEGLVEVYPQVGTFVSLVDPERVRQAQFIREAVECTSLAQARPPFSADHVGDLRVLLGAQREAGGGDHDRFFELDEDFHRSLLALAGNESAWRTVNAAKAHLDRARRLSLIDTRPIGELVDQHTLVVDAIEAGDTGTAVEALRSHLRAVFEDVGRIRAASPEFFSDGRPRRPVRRTVTSLR
>NC_014210.1|WP_013154289.1|3911314_3912697_+|MHS-family-MFS-transporter
MTEQAPPAPAGQGERSTRDLTKASVSGWLGTAMEFMDFQLYSLAAALVFNQIFFPDLNPAVGLIAAMGTYGVGYVARLVGAVYFGRMGDRLGPKKVLFITVALMGVSTTLIGALPTYQQVGLLAPILLVGLRLIQGFGAGAEIAGATVMLAEYAPARRRGFIASLVCLGTNSGTLGASAIWAVLVFALSEEQLLSWGWRLPFLASFLLLLLALWIRLSVKESPVFEQREDIVDGVAMSRSELAAAAVKEDRSGLETALHQRKGRAFLLALGLRFGQAGNSGIVQTFLVGYLSANLMLNDAVGTSAIVYGSLLGFVTVPLVGVLGDRFGRRPVYLFLTVASMLFAVPMMLMIETGDTVLVTVAMVVGLNLSVLGLFSVESVTMAELFGARTRFTQLALAKEIGGVLATAIGPVLAATLTAATGSWWPLSAMIIAYSLITLASAYLSPEVRGRDLVRLEDAV
>NC_014210.1|WP_013154290.1|3912693_3913731_+|L-idonate-5-dehydrogenase
MRAVTVHGAEDLRVDELPDPVPGEGEVVVAVEWGGICGSDLAYWRHGRSGTAVLRDPLVLGHEIAGRVARVGPGVTGVEEGLPVTVHPAELVGDGRMPERLAGRTNLYPRVRYFGSAAFSPHTDGGFCDLKKVAARQLRPLPEGVDTRSGALAEPLAVACHAVNRASGAVGGVEGRDVFVNGAGPIGSLVVAALRHAGAARITVADLGRAPLEVARAMGADDTRDLSRGDALPEDAELVFEASGAPAALGGVLRATARGGTLVQVGNLPGTQAPAALGELVTREITWIGSYRFVEEIDDALAAMAAGLDVTPLMTHSFPVGEAHEAMRTAADPASGSSKVMLRFA
>NC_014210.1|WP_013154291.1|3913801_3915013_+|D-galactonate-dehydratase-family-protein
MKITDARVVVSSPGRNYVTLVVETEDGVTGIGDATLNGRELAVASYLRDHVCPLLVGRDARRIEDTWQYLYKGAYWRRGPVTMTAIAAVDVALWDIKGKAAGMPLYQLLGGASREGVLVYGHASGTSLDGLSEDFQRHLDLGYRAIRVQAAVPGLEKTYGIAPADGRVYEPASGNRPQEDTWDTPAYLDFAPAMIAHVREQFGYGVHLLHDVHHRLTPIEAGRLGAALEPYRLFWMEDPTPAEDQSAFRILRQHTTTPVAVGEVFNSIWDCQQLITERLIDYVRASVSHTGGITHLRRVFSLAELYGVRSGSHGAGDLSPVAMAAALHLDLAIPNFGIQEHMGHTGPYAEVFRTSYSFSDGYMHPGDAPGLGVEFDEEAAARHPYEPRYLPVNRRLDGTVHDW

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_014210_21

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_014210_21

5094972-5095071

Orphan

Consensus_repeat	Method
GCCGGGTTCGAACCCGACCACCGCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_014210_21

>merge|NC_014210|21|5094972-5095071|CRISPRCasFinder
GCCGGGTTCGAACCCGACCACCGCCTCCGCGCCGTCGAGGTCGCGCCAGCCGAGCTGGGCCAACGGTACGGCCCCGCCGGGTTCGAACCCGACCACCAGC

>NC_014210|21|20|5094972-5095071|CRISPRCasFinder
GCCGGGTTCGAACCCGACCACCGCC	TCCGCGCCGTCGAGGTCGCGCCAGCCGAGCTGGGCCAACGGTACGGCCCC
GCCGGGTTCGAACCCGACCACCAGC

Protein	Signature genes	Signature genes Name	Protein_function
NC_014210.1\|WP_041552905.1\|5104153_5105251_-\|CPBP-family-intramembrane-metalloprotease	unknown	unknown	gnl\|CDD\|376806
NC_014210.1\|WP_013155285.1\|5105512_5106616_-\|alkene-reductase	unknown	unknown	gnl\|CDD\|239243
NC_014210.1\|WP_013155278.1\|5099101_5100028_-\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133378
NC_014210.1\|WP_013155269.1\|5087183_5088452_-\|beta-ketoacyl-[acyl-carrier-protein]-synthase-family-protein	unknown	unknown	gnl\|CDD\|238430
NC_014210.1\|WP_013155268.1\|5085975_5087187_-\|polyketide-beta-ketoacyl-synthase	unknown	unknown	gnl\|CDD\|238428
NC_014210.1\|WP_013155279.1\|5100236_5100779_-\|dihydrofolate-reductase	unknown	unknown	gnl\|CDD\|223340
NC_014210.1\|WP_049800393.1\|5088753_5089401_-\|HNH-endonuclease	unknown	unknown	gnl\|CDD\|377857
NC_014210.1\|WP_013155274.1\|5091800_5092820_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|238568
NC_014210.1\|WP_013155267.1\|5085594_5085855_-\|acyl-carrier-protein	unknown	unknown	gnl\|CDD\|376348
NC_014210.1\|WP_117198564.1\|5084331_5084829_-\|hypothetical-protein	unknown	unknown	unknown
NC_014210.1\|WP_013155280.1\|5101003_5101675_-\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|172294
NC_014210.1\|WP_013155281.1\|5101726_5102620_+\|CPBP-family-intramembrane-metalloprotease	unknown	unknown	gnl\|CDD\|376806
NC_014210.1\|WP_013155276.1\|5095449_5097612_-\|choline-BCCT-transporter-BetT	unknown	unknown	gnl\|CDD\|236635
NC_014210.1\|WP_013155272.1\|5089909_5091016_+\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376439
NC_014210.1\|WP_013155264.1\|5083530_5084214_-\|DUF305-domain-containing-protein	unknown	unknown	gnl\|CDD\|367619
NC_014210.1\|WP_013155283.1\|5103524_5104142_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|366102
NC_014210.1\|WP_013155273.1\|5091015_5091804_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224045
NC_014210.1\|WP_013155277.1\|5098370_5098922_+\|lytic-polysaccharide-monooxygenase	unknown	unknown	gnl\|CDD\|237309
NC_014210.1\|WP_013155266.1\|5085116_5085590_-\|polyketide-cyclase	unknown	unknown	gnl\|CDD\|176869
NC_014210.1\|WP_013155282.1\|5102750_5103383_-\|ACP-phosphodiesterase	unknown	unknown	gnl\|CDD\|234675

Protein	Function_ID	Function_description	E-value
NC_014210.1\|WP_041552905.1\|5104153_5105251_-\|CPBP-family-intramembrane-metalloprotease	gnl\|CDD\|376806	pfam02517, Abi, CAAX protease self-immunity. Members of this family are probably proteases (after a isoprenyl group is attached to the Cys residue in the C-terminal CAAX motif of a protein to attach it to the membrane, the AAX tripeptide being removed by one of the CAAX prenyl proteases). The family contains the CAAX prenyl protease. The proteins contain a highly conserved Glu-Glu motif at the amino end of the alignment. The alignment also contains two histidine residues that may be involved in zinc binding. While they are involved in membrane anchoring of proteins in eukaryotes, little is known about their function in prokaryotes. In some known bacteriocin loci, Abi genes have been found downstream of bacteriocin structural genes where they are probably involved in self-immunity. Investigation of the bacteriocin-like loci in the Gram positive bacteria locus from Lactobacillus sakei 23K confirmed that the bacteriocin-like genes (sak23Kalphabeta) exhibited antimicrobial activity when expressed in a heterologous host and that the associated Abi gene (sak23Ki) conferred immunity against the cognate bacteriocin. Interestingly, the immunity genes from three similar systems conferred a high degree of cross-immunity against each other's bacteriocins, suggesting the recognition of a common receptor. Site-directed mutagenesis demonstrated that the conserved motifs constituting the putative proteolytic active site of the Abi proteins are essential for the immunity function of Sak23Ki - thus a new concept in self-immunity.	3.52979e-11
NC_014210.1\|WP_013155285.1\|5105512_5106616_-\|alkene-reductase	gnl\|CDD\|239243	cd02933, OYE_like_FMN, Old yellow enzyme (OYE)-like FMN binding domain. OYE was the first flavin-dependent enzyme identified, however its true physiological role remains elusive to this day. Each monomer of OYE contains FMN as a non-covalently bound cofactor, uses NADPH as a reducing agent with oxygens, quinones, and alpha,beta-unsaturated aldehydes and ketones, and can act as electron acceptors in the catalytic reaction. Members of OYE family include 12-oxophytodienoate reductase, pentaerythritol tetranitrate reductase, morphinone reductase, and related enzymes.	8.54268e-151
NC_014210.1\|WP_013155278.1\|5099101_5100028_-\|MerR-family-transcriptional-regulator	gnl\|CDD\|133378	cd00592, HTH_MerR-like, Helix-Turn-Helix DNA binding domain of MerR-like transcription regulators. Helix-turn-helix (HTH) MerR-like transcription regulator, N-terminal domain. The MerR family transcription regulators have been shown to mediate responses to stress including exposure to heavy metals, drugs, or oxygen radicals in eubacterial and some archaeal species. They regulate transcription of multidrug/metal ion transporter genes and oxidative stress regulons by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.	1.60293e-20
NC_014210.1\|WP_013155269.1\|5087183_5088452_-\|beta-ketoacyl-[acyl-carrier-protein]-synthase-family-protein	gnl\|CDD\|238430	cd00834, KAS_I_II, Beta-ketoacyl-acyl carrier protein (ACP) synthase (KAS), type I and II. KASs are responsible for the elongation steps in fatty acid biosynthesis. KASIII catalyses the initial condensation and KAS I and II catalyze further elongation steps by Claisen condensation of malonyl-acyl carrier protein (ACP) with acyl-ACP.	1.561e-169
NC_014210.1\|WP_013155274.1\|5091800_5092820_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|238568	cd01148, TroA_a, Metal binding protein TroA_a. These proteins are predicted to function as initial receptors in ABC transport of metal ions in eubacteria. They belong to the TroA superfamily of helical backbone metal receptor proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind the metal ion in the cleft between these domains.	1.06788e-89
NC_014210.1\|WP_013155268.1\|5085975_5087187_-\|polyketide-beta-ketoacyl-synthase	gnl\|CDD\|238428	cd00832, CLF, Chain-length factor (CLF) is a factor required for polyketide chain initiation of aromatic antibiotic-producing polyketide synthases (PKSs) of filamentous bacteria. CLFs have been shown to have decarboxylase activity towards malonyl-acyl carrier protein (ACP). CLFs are similar to other elongation ketosynthase domains, but their active site cysteine is replaced by a conserved glutamine.	6.20907e-147
NC_014210.1\|WP_013155279.1\|5100236_5100779_-\|dihydrofolate-reductase	gnl\|CDD\|223340	COG0262, FolA, Dihydrofolate reductase [Coenzyme metabolism].	6.83983e-19
NC_014210.1\|WP_013155283.1\|5103524_5104142_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|366102	pfam00440, TetR_N, Bacterial regulatory proteins, tetR family.	1.74484e-11
NC_014210.1\|WP_013155277.1\|5098370_5098922_+\|lytic-polysaccharide-monooxygenase	gnl\|CDD\|237309	PRK13211, PRK13211, N-acetylglucosamine-binding protein GbpA.	9.1615e-39
NC_014210.1\|WP_013155267.1\|5085594_5085855_-\|acyl-carrier-protein	gnl\|CDD\|376348	pfam00550, PP-binding, Phosphopantetheine attachment site. A 4'-phosphopantetheine prosthetic group is attached through a serine. This prosthetic group acts as a a 'swinging arm' for the attachment of activated fatty acid and amino-acid groups. This domain forms a four helix bundle. This family includes members not included in Prosite. The inclusion of these members is supported by sequence analysis and functional evidence. The related domain of the anguibactin system regulator AngR has the attachment serine replaced by an alanine.	6.78052e-05
NC_014210.1\|WP_049800393.1\|5088753_5089401_-\|HNH-endonuclease	gnl\|CDD\|377857	pfam07510, DUF1524, Protein of unknown function (DUF1524). This family of uncharacterized proteins contain a conserved HXXP motif. A similar motif is seen in protein families in the His-Me finger endonuclease superfamily which suggests this family of proteins may also act as endonucleases.	4.06881e-16
NC_014210.1\|WP_013155280.1\|5101003_5101675_-\|TetR-family-transcriptional-regulator	gnl\|CDD\|172294	PRK13756, PRK13756, TetR family transcriptional regulator.	6.7044e-13
NC_014210.1\|WP_013155281.1\|5101726_5102620_+\|CPBP-family-intramembrane-metalloprotease	gnl\|CDD\|376806	pfam02517, Abi, CAAX protease self-immunity. Members of this family are probably proteases (after a isoprenyl group is attached to the Cys residue in the C-terminal CAAX motif of a protein to attach it to the membrane, the AAX tripeptide being removed by one of the CAAX prenyl proteases). The family contains the CAAX prenyl protease. The proteins contain a highly conserved Glu-Glu motif at the amino end of the alignment. The alignment also contains two histidine residues that may be involved in zinc binding. While they are involved in membrane anchoring of proteins in eukaryotes, little is known about their function in prokaryotes. In some known bacteriocin loci, Abi genes have been found downstream of bacteriocin structural genes where they are probably involved in self-immunity. Investigation of the bacteriocin-like loci in the Gram positive bacteria locus from Lactobacillus sakei 23K confirmed that the bacteriocin-like genes (sak23Kalphabeta) exhibited antimicrobial activity when expressed in a heterologous host and that the associated Abi gene (sak23Ki) conferred immunity against the cognate bacteriocin. Interestingly, the immunity genes from three similar systems conferred a high degree of cross-immunity against each other's bacteriocins, suggesting the recognition of a common receptor. Site-directed mutagenesis demonstrated that the conserved motifs constituting the putative proteolytic active site of the Abi proteins are essential for the immunity function of Sak23Ki - thus a new concept in self-immunity.	3.93464e-09
NC_014210.1\|WP_013155276.1\|5095449_5097612_-\|choline-BCCT-transporter-BetT	gnl\|CDD\|236635	PRK09928, PRK09928, choline transport protein BetT; Provisional.	0
NC_014210.1\|WP_013155272.1\|5089909_5091016_+\|iron-ABC-transporter-permease	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	1.11118e-80
NC_014210.1\|WP_013155264.1\|5083530_5084214_-\|DUF305-domain-containing-protein	gnl\|CDD\|367619	pfam03713, DUF305, Domain of unknown function (DUF305). Domain found in small family of bacterial secreted proteins with no known function. Also found in Paramecium bursaria chlorella virus 1. This domain is short and found in one or two copies. The domain has a conserved HH motif that may be functionally important. This domain belongs to the ferritin superfamily. It contains two sequence similar repeats each of which is composed of two alpha helices.	8.76023e-48
NC_014210.1\|WP_013155273.1\|5091015_5091804_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224045	COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism].	9.59678e-99
NC_014210.1\|WP_013155266.1\|5085116_5085590_-\|polyketide-cyclase	gnl\|CDD\|176869	cd08860, TcmN_ARO-CYC_like, N-terminal aromatase/cyclase domain of the multifunctional protein tetracenomycin (TcmN) and related domains. This family includes the N-terminal aromatase/cyclase (ARO/CYC) domain of Streptomyces glaucescens TcmN, and related domains. It belongs to the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. ARO/CYC domains participate in the diversification of aromatic polyketides by promoting polyketide cyclization. They occur in two architectural forms, monodomain and didomain. Monodomain aromatase/cyclases have a single ARO/CYC domain. For some, such as TcmN, this single domain is linked to a second domain of unrelated function. TcmN is a multifunctional cyclase-dehydratase-O-methyl transferase. Its N-terminal ARO/CYC domain participates in polyketide binding and catalysis; it promotes C9-C14 first-ring (and C7-C16 second-ring) cyclizations. Its C-terminal domain has O-methyltransferase activity. Didomain aromatase/cyclases contain two ARO/CYC domains, and they biosynthesize C7-C12 first ring cyclized polyketides. These latter domains belong to a different subfamily in the SRPBCC superfamily.	1.88856e-54
NC_014210.1\|WP_013155282.1\|5102750_5103383_-\|ACP-phosphodiesterase	gnl\|CDD\|234675	PRK00170, PRK00170, azoreductase; Reviewed.	3.15211e-24

>NC_014210.1|WP_013155274.1|5091800_5092820_+|ABC-transporter-substrate-binding-protein
MTHRTPLGTRASHRSLLPLTAVAVLVAGCGAQVEEGQEASAASTVTVQRCGEEVEYTTPQRVVAYEAGSADKLFALGLTDHVHGYVMPPANPPVEESPWAEEYARVEFLSDDLLNRELVVDAGADLVVAGWNSGFSEERGITPEILDGLGIQSFMHTESCFNYPGHPEEVTPFEGLYTDLERLGRIFGVEDRAGELVTDYRARVAAVEEQAPAGDPVPVFLYDSGTDQPFTAGGQVPPNDIISRAGGENIFAGLDERWTQVGWEAVVEAEPEVIIILDYGDQPAQEKIDFLTSFPAMAEVPAVVEENFFVLDYNEGISGPRNIDGLEKFAEYLRGLEQG
>NC_014210.1|WP_013155273.1|5091015_5091804_+|ABC-transporter-ATP-binding-protein
MDLRLDGLSVELGGARIVESLSLDVPAGQVVGLVGPNGSGKSTALRCVYRALRPSGGTVWVGDEDLSSLSLRRSAQRVAALTQESGSDLDFTVQEVVALGRAPHLRGNQPLDARERDLCRRAMERLEVAHLAHRGVMELSGGERQRVLVARALVQEPSVLVLDEPTNHLDIRHQIALLSLLRDSGLTVLVVLHDLNLAAAACDRIGVLHEGRLVAAGAPDQVLTPALLLEVFGIEASVVPHPLTGDPQLLYRLLPAVEKGLQ
>NC_014210.1|WP_013155272.1|5089909_5091016_+|iron-ABC-transporter-permease
MPDDAAPDGAASGRTGPAGVRWLATRAGTATAAVVLGVLLAVSAVLAIGLGSAVVPPAETVRYLWAALSGGVIQADEVVRYQIIWQIRTPRVLLAAVVGAGLGVVGVAVQAMVRNALADPYILGVSSGASVGAVLVSVLGALSALGIHAVSAGAFLGALGATLLVHLVARSPTGVTPLRLVLTGVALSFGFQAVMSVIVYLAPSSEATATVLFWTMGSFGAATWSSLPVVAVVVVLGILVLRGLARPLDVLALGDETSASLGVDAAGQRRVLFAVTAVMTGAMVAVSGAIGFVGLVIPHIVRIAVGADHRRVLTVAPLLGALLMVWVDLFSRVVVAPRELPLGVITALIGVPVFLGLMRRRGYLFGGR
>NC_014210.1|WP_049800393.1|5088753_5089401_-|HNH-endonuclease
MGTAAAVLSAAVLAPVTAPAPAAAHAAEAVPLAVAVAGLPVTDENRQGYDRSLFPHWADTDRDGCNTRAEVLIEEAVVMPEVDERCRLSGGQWESYYDGRAHTEARALDIDHMVPLAEAWDSGASEWTTDRRRDYANDMGEPVALVAVTAAQNRSKADKDPAQWLPASAEAHCRYVTEWTTVKVRWALTVDPAEHEALVALAAECPDAVVEAEAA
>NC_014210.1|WP_013155269.1|5087183_5088452_-|beta-ketoacyl-[acyl-carrier-protein]-synthase-family-protein
MRREAVVTGIGVVAPGAIGASAFWEMLTAGRTATRHVTLFDASDFRSRIAAEVDFDPAAHGLDEHQAERMDRYVQFAAVATAEALADSAPPLSEVSPWRVGVSMGTAVGGTTRLERDYVQMSRGGADWVVDPEAASPHLYRAVTPSALSGEIAELVGARGPVRTVSTGCTSGLDAVGYAAQAIEDDLADVVVAGAAESPISPIAMACFDAIRATSDSNDDPARASRPFDRERNGFVMGEGAAVLILEEASIARRRGARIRCRVAGFANHGNAFHMTGLRREGQEMARAITTALDQARRPATDVDYVNAHGSGTVQNDRHETDAVKRSLGEHARRVTMSSIKSMVGHSLGAIGSIELAACVLAMDTGVVPPTANLSTPDPECDLDYVPVTARERRTDVVLSVGSGFGGFQSAVVLDRGSEVRV
>NC_014210.1|WP_013155268.1|5085975_5087187_-|polyketide-beta-ketoacyl-synthase
MSTVITGLGTVSPAGVGVPEYWEAVREGRSLLAPIPDFDTDGFHVRVGGKIPGFDPHDHLDGRYVVQTDAFSWFAMVAAGEALRDSGLDPAADPYAVGVLICSCTGGVEFGQREIEALWSRGPDHVGPYQSIAWFYAASTGQISISNGLKGMCGVLVTDEPGMLDALGQSERALRRGTSAMLVGGSEAPIGSPFALACHAGAEVLSRGEDPRTAYLPFTEGAAGHVPAEGAAVAVVEDEAAARARGARIRARVAGHASTFGGVGSFDPGGAGLLHAAREAMRRAAVAPEDVDVVFADAVGTPKADADEAAVLRELFPGGVAVTAPKTGFGRAYAGSGALDVAAAVLSLEHQVVPPTPNVPDAPSGLDLVVRVPRAARLRTALVLSRGLGGGNSAVVLTRPDPV
>NC_014210.1|WP_013155267.1|5085594_5085855_-|acyl-carrier-protein
MPDRHIEMEELVELMSACAGVRTDAATASASTFDELGIDSLGVMGIVAEIERRVGRKLGADAEASPSPAVLSTLVNGGVAAPAKGM
>NC_014210.1|WP_013155266.1|5085116_5085590_-|polyketide-cyclase
MPGSIEHSVVIDAPYDFVWELTNDVASWPQIFTWHSSVEILEQDGDTTRFRVTKQPDKQGRVWSWVSERTVDREAGEAWSHRVQTEGFEYVRIHWNYEQVPEGVRLTWSYQFAMRPDAPFDDEQMTVKYNQNVPTEMEHIKRNVEAAARARMEEVTT
>NC_014210.1|WP_117198564.1|5084331_5084829_-|hypothetical-protein
MGRAARGRSAHPGLAWVRMLLLVSVLLGVAGMHTLGHASTDTEHASPVSTASVVAHADPVPEERAAPAAHAASEAGAHAAPVPEAHAAAGGYSDPDAHAASPVTDPTTMCLAVAALVAALVGLAAVVFLPWPGALPRPPSPTLRRAVRVAPPEPPCLAKLQVLRV
>NC_014210.1|WP_013155264.1|5083530_5084214_-|DUF305-domain-containing-protein
MTTQFRTRAFPAAPAALAAALFLASCGGGEAPDPAPGSAEQSTAEQSTAEQPTAEFNDADVVFARMMIPHHEQAVEMSRLAEDRAGEEVAALAAEIEAAQGPEIEQLRGMLDAWGVEPEGDGEHHGMSGMMTEEQMAELERAEGEAFDTLFLELMIAHHRGAVRMAEDQLENGVDPEAGELAREVVDTQEAEIEEMEAMLGRGGGSGEDGTGQGGSGQDAEGDHGGH
>NC_014210.1|WP_013155276.1|5095449_5097612_-|choline-BCCT-transporter-BetT
MATDGGQHRPDREPEPEAEPEPETGPETPEEAERGPSRLKPVVFYGSSALIVALSVWAIVAPTHAGNTIGAVVTWITEVFGWYYFLATTLYLGFVVVIALSRYGRVKLGPQHSKPDYGVFAWAAMLFAAGIGIDLLFFSVSGPVSHYLAPPEGDAQTVEAARQAVVWTLFHYGVTGWAMYALMGMALGYFSFRYHLPLAIRSALYPLIGRRIHGPVGDAVDLAAVIGTIFGISVSLGIGVVQLNYGLNFLFGVPEGVAAQLGLIIVAVLVATMSAVAGVDRGIRRLSEINVVLAVVLMLYVLVFEDPLYLLNALVLNIGDYLSRFPSMTLNTFAYDPPTDWLNAWTLFFWAWWIAWAPFVGMFLARISRGRTIRQFVAATLVVPLLFTLTFLSFFGNSALSVVREGGAAFGQTTMNHPEQGFYALLAQYPGVLFSAGLATVVGLLFYVTSADSGALVMGNLSSHLPTPLTDASPWLRVFWSAATGLLTLAMLLVGGVDTLTSATIIMGLPFSFVMFVIMWGLFKALRIEKFRKDAFRTTLSSSLSDRTAADRRGPERNWRQRIKRAVSFPGRRAAERFVRDVCRPAFRDVAEELREHGAEASVSEGVDEAVGIAYLELRAPMGEEEEFSYRVWPMEVPTPAFAMRSLAEHDTYVRFEVYLTEGSQGYDVMGYTKEQLIGNILDEYERHLEFLRLHREATSGSALPDHGPGTADVQDTEER
>NC_014210.1|WP_013155277.1|5098370_5098922_+|lytic-polysaccharide-monooxygenase
MLNRKSDTPRPRNRHRLRTAAALAAATTLFLGLMPAGTANAHGYISNPMSRQAQCAAGIVQCGGIQWEPQSVEGPKGLMQCNGGVGRFAELNDNSRGWRVTDVGRVQTFEWTITAAHSTSTWEYFIGNHRVAVFNDHGARPPWSFSHTVDLSGYSGRHTLLARWNVADTGNAFYACVDVNIRA
>NC_014210.1|WP_013155278.1|5099101_5100028_-|MerR-family-transcriptional-regulator
MPLSFTPPRRVKIGDAAAFVGSTPRAIRHYHEIGLLPEPERGVDGRRRYGYEDMIRLLWIRRMADAGIALDDIRDSFTTGTASADADADADADADGADGIAGILERLEESLADQEAELRRQRAAVRRMRTEGSRMGLLSDFVTQRLKSLPEGSLRQADLDDLLVTERVFGPLGAAVRAGRFIALATRPALREESDRLDDAEEALDDSVAVDDPRVARVAAERHAFESTLHAVIEESGLGEEDDALFDAWDALHPAPADDEADPGSGSREPGSMSAFEAFGKMPYDFSPARQRCMELAGELSARDSPAA
>NC_014210.1|WP_013155279.1|5100236_5100779_-|dihydrofolate-reductase
MSDVGIGTGRVVVNRAMSLDGFIAGPGHAMDWISEYLTADAVPEVMAATGAMLVGRRTYEVAKRMPDQGTAYDGGPQFVLTHEPPEEPDPTVTFLTCGLEEAVATARGAAGDRNLEILGADVAAQCLRRGLVDEILVYVLPVLLGDGVRFTPPGLGRIDLEPFGNTQSGAVTTLRFRVRK
>NC_014210.1|WP_013155280.1|5101003_5101675_-|TetR-family-transcriptional-regulator
MATSGSDQQFDSVFHRPQRRRRSQPALSRERIVAATIDLLDREGASSLTMRKVAAELGVHATSLYWYVERREDLVDLAVDEILAGAASVPPPPDAPWDEALKETALRFYAALTAHTWAAEFAGSRPLIGPNAVALSRRIIEALGEYGGGGEAQAVAIRAVSNQILGAATSAVAMRAMKSDREQEHEEAVAAAVSEADALAVENTYFDQTLDLILAGIRARRGS
>NC_014210.1|WP_013155281.1|5101726_5102620_+|CPBP-family-intramembrane-metalloprotease
MFLGMATDSSLTSPQTCAPSEFHAEAPDQSRTTVTDPRGLTAFLVIAFAFSWTAWWLGTRLLGGADPMPAVIVGSFGPMVAAAVVTAATQGRKGVGALFRRHSLRRRGGVMPYLITVLVVLALAGSAAIQVYLGQSTLDEAQLWAALPTLPVQFLVIALVGGGNEELGWRGFALPRLQGVLSPLAANVLLGAVWAMWHAPLFAMPGTLQAQMYFPAYALLCVGFTVVLGHVFNSARGGVVAAIITHAAINVVSGVKAVAVGDPASAPEVAMVALLAVLLAVCTRGRLGLRRSDSARG
>NC_014210.1|WP_013155282.1|5102750_5103383_-|ACP-phosphodiesterase
MNLFRLDASILPTVSCSAEIADRVEAEWAAAHPRGAVNRRHLGTDPLPADAWALATIGAGTDEADRTPEQVRALALAAELAAELQEADAVVLAVPLYNFGVSQHFKAWADLVIAGAGATTPLLKDTPTVLATTLGGGYGPGTPREGWDHSTPYLERVVGDIWQADLTLIKRELTLAATTPGMESLKDLAQQEHDRALVSASEAGRALAAR
>NC_014210.1|WP_013155283.1|5103524_5104142_+|TetR/AcrR-family-transcriptional-regulator
MTSPLVPFGKERGERADAARNRERLLETARAMIAEHGTRQVTMDGLAERAGLGKGTVFRRFGSRAGIFVALLEDAEHRFQEQVLSGPPPLGPGADPAERLVAYGCARIPFLLEHHAIARAAVDRSLPVPAGAVGMTQPHIRMLLGLAGLPADRVYGLSVQLTAALEGPLVLYMSTDEVAAPPPEPDAPNPLIDGWRFLVERLLGD
>NC_014210.1|WP_041552905.1|5104153_5105251_-|CPBP-family-intramembrane-metalloprotease
MNPNDDRHHAWSAPPPTDAFLPAPDADPSAGPSGHRSRRRGPRPVPPGVEYHRMLAGDKRRVLRGVLAIVLLLVGLFAISYAFAEASAFVDGQMGRTNPAAGGTDYTPVYHASGMLGLAMLIPLSMLIQRLLYGVRGASQHSVLSRFRFGVLGRALLFIGPFWLIAVTVMNVWTPPVQKDWPLADLVAMFVLTLLLVPLQAAGEEYGLRGLAFQVAGSWSRGPRVGLVLAVVVSSLLFTTIHGAGDPWINIWYFLLSLSLAVITWRTGGIEIPIVIHGLLNTLTFLICIVLQIDLGASVMDRSAGTGSPIMLVPAVTAVVIALVVFLRTRRTGPALTPGPLRTQPDTRSARVQPDARPGWVPTVR
>NC_014210.1|WP_013155285.1|5105512_5106616_-|alkene-reductase
MNAKETESPLLSPARLADTDLPNRLVIAPMTRNRAEPSGTPSELMAEYYAQRASAGLIIAEASTPSRVGRTYPDIAALYRPEHTEGWRRVNRRVAEAGGRMFAQIQHGGRVGHPDTSGLTPLAPSPIALPGTIHTPGGRQPAVTPRQMGRDDIATTVADFASAARRAVEAGFLGVEVHAANGYLLHQFLTPGTNRRRDAYGGAPENRMRFVLEVVQAVVAEVGPDRVGVRVSPGNTANGIAETDEDIAALYPELTTRLDALGPVYLHVAFADPDSSVWKRIRSRWSRTLIGNPVLPGGEIPADGGRDAAERMLRAGADLVALGRPFLANPDLVERIRTGAPVNPVRDRYLMYVGGATGYTDYPALGG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_014210_22

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_014210_22

5216893-5217236

Orphan

Consensus_repeat	Method
AGGGACGACCGGTGATCGGGTGGTCGCTTCGGCTAANCCG	CRT

5 spacers

The CRISPR arrays of NC_014210_22

>merge|NC_014210|22|5216893-5217236|CRT
AGGGACGACCGGTGATCGGGTGGTCGCTTCGGCTGATCCGTCACCCGGACCCTTCCCGACCAGGGACGACCGGTGATCGGGTGGTCGCTTCGGCTAAACCGTCACCCGGACCCTTCCCGACCAGGGACGACCGGTGATCGGGTGGTCGCTTCGGCTAAACCGTCACCCGGACCCTTCCCGACCAGGGACGACCGGTGATCGGGTGGTCGCTTCGGCTAAACCGCTGCTGATACCCCTCTGACCAGGGGCGACCGGTGATCGGGTGGTCGCTTCGGCTAAGCCGCTCCATCCACCCCTCCCCACCAGGGACGACCGGTGATGGGGTGGTCGCTTCGGTTAGACCG

>NC_014210|22|9|5216893-5217236|CRT
AGGGACGACCGGTGATCGGGTGGTCGCTTCGGCTGATCCG	TCACCCGGACCCTTCCCGACC
AGGGACGACCGGTGATCGGGTGGTCGCTTCGGCTAAACCG	TCACCCGGACCCTTCCCGACC
AGGGACGACCGGTGATCGGGTGGTCGCTTCGGCTAAACCG	TCACCCGGACCCTTCCCGACC
AGGGACGACCGGTGATCGGGTGGTCGCTTCGGCTAAACCG	CTGCTGATACCCCTCTGACC
AGGGGCGACCGGTGATCGGGTGGTCGCTTCGGCTAAGCCG	CTCCATCCACCCCTCCCCACC
AGGGACGACCGGTGATGGGGTGGTCGCTTCGGTTAGACCG

Protein	Signature genes	Signature genes Name	Protein_function
NC_014210.1\|WP_013155385.1\|5223666_5223894_-\|DUF3073-domain-containing-protein	unknown	unknown	gnl\|CDD\|378620
NC_014210.1\|WP_013155382.1\|5220306_5220783_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|380033
NC_014210.1\|WP_013155371.1\|5210005_5210263_-\|MoaD/ThiS-family-protein	unknown	unknown	gnl\|CDD\|340560
NC_014210.1\|WP_013155379.1\|5218397_5218748_+\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	unknown	unknown	gnl\|CDD\|377579
NC_014210.1\|WP_013155374.1\|5212669_5213662_+\|mycothiol-synthase	unknown	unknown	gnl\|CDD\|132489
NC_014210.1\|WP_013155368.1\|5206951_5208457_-\|glutamyl-tRNA-reductase	unknown	unknown	gnl\|CDD\|234592
NC_014210.1\|WP_013155375.1\|5213990_5214953_+\|phosphate-ABC-transporter-permease-subunit-PstC	unknown	unknown	gnl\|CDD\|273992
NC_014210.1\|WP_013155378.1\|5217313_5218279_+\|nucleoside-hydrolase	unknown	unknown	gnl\|CDD\|224868
NC_014210.1\|WP_013155369.1\|5208595_5209291_-\|redox-sensing-transcriptional-repressor-Rex	unknown	unknown	gnl\|CDD\|235486
NC_014210.1\|WP_013155373.1\|5211461_5212526_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|223044
NC_014210.1\|WP_026338063.1\|5220792_5222289_+\|amidophosphoribosyltransferase	unknown	unknown	gnl\|CDD\|236113
NC_014210.1\|WP_036552281.1\|5224127_5224979_+\|hypothetical-protein	unknown	unknown	unknown
NC_014210.1\|WP_013155377.1\|5216088_5216868_+\|phosphate-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|184587
NC_014210.1\|WP_013155387.1\|5225683_5225887_+\|developmental-transcriptional-regulator-BldC	unknown	unknown	gnl\|CDD\|133390
NC_014210.1\|WP_013155381.1\|5219264_5219882_-\|DUF47-domain-containing-protein	unknown	unknown	gnl\|CDD\|224310
NC_014210.1\|WP_013155372.1\|5210370_5211138_+\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|223816
NC_014210.1\|WP_013155370.1\|5209705_5209972_-\|glutaredoxin-family-protein	unknown	unknown	gnl\|CDD\|368604
NC_014210.1\|WP_013155376.1\|5214952_5216032_+\|phosphate-ABC-transporter-permease-PstA	unknown	unknown	gnl\|CDD\|223654
NC_014210.1\|WP_013155380.1\|5218747_5219074_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
NC_014210.1\|WP_013155384.1\|5222391_5223456_+\|phosphoribosylformylglycinamidine-cyclo-ligase	unknown	unknown	gnl\|CDD\|235439

Protein	Function_ID	Function_description	E-value
NC_014210.1\|WP_013155385.1\|5223666_5223894_-\|DUF3073-domain-containing-protein	gnl\|CDD\|378620	pfam11273, DUF3073, Protein of unknown function (DUF3073). This family of proteins with unknown function appears to be restricted to Actinobacteria.	1.51194e-17
NC_014210.1\|WP_013155382.1\|5220306_5220783_+\|hypothetical-protein	gnl\|CDD\|380033	pfam17844, SCP_3, Bacterial SCP ortholog. This domain is found in MSMEG_5817 gene product from M. smegmatis. It has been shown to be vital for mycobacterial survival within host macrophages. Crystal structure revealed a Rossmann-like fold alpha/beta two-layer sandwich forming a highly hydrophobic interface cavity and with high structural homology to the SCP family. Hence, it has been suggested that this domain may be involved in the interaction of apolar ligands through its hydrophobic cavity. Alanine-scanning mutagenesis of the hydrophobic cavity of MSMEG_5817 protein demonstrated that the conserved Val82 residue plays an important role in ligand binding.	1.19272e-46
NC_014210.1\|WP_013155371.1\|5210005_5210263_-\|MoaD/ThiS-family-protein	gnl\|CDD\|340560	cd17040, Ubl_MoaD_like, ubiquitin-like (Ubl) domain found in a group of small sulfide carrier proteins. Ubiquitin-like (Ubl) domain found in a group of small sulfide carrier proteins This family includes ThiS, MoaD, CysO, QbsE, and their homologs, which are structurally homologous to ubiquitin (Ub) and may function as the sulfide donor for the biosynthesis of thiamin, molybdopterin, cysteine, thioquinolobactin, and other sulfur-containing natural products. Ub is a protein modifier in eukaryotes that is involved in various cellular processes, including transcriptional regulation, cell cycle control, and DNA repair. Ubiquitination is comprised of a cascade of E1, E2 and E3 enzymes that results in a covalent bond between the C-terminus of Ub and the epsilon-amino group of a substrate lysine. Like Ub, small sulfide carrier proteins in this family are adenylated at a diglycyl C-terminus by specific activating proteins. The adenylated C-terminus is subsequently converted to a thiocarboxylate, serving as the sulfide source. Those activating proteins are diverse and show little sequence similarity. This family also includes the small archaeal modifier protein (SAMP), including SAMP1, SAMP2 and SAMP3, which are Ub-like proteins that function as protein modifiers and are required for the production of sulfur-containing biomolecules in the archaeon Haloferax volcanii. SAMP1 and SAMP2 are involved in sulfur transfer during molybdenum cofactor biosynthesis and tRNA thiolation much like MoaD and Urm1, respectively. They can form covalent conjugates with their protein targets through an isopeptide linkage via their C-terminal diglycine motif in a streamlined archaeal E1-dependent pathway. SAMP2 also forms homo-conjugates through the intermolecular isopeptide bond between the C-terminal Gly and the Lys58 side chain, a feature that likely resembles polyubiquitination. SAMP3 conjugates are dependent on the Ub-activating E1 enzyme homolog of archaea (UbaA) for synthesis and are cleaved by the JAMM/MPN+ domain metalloprotease HvJAMM1.	9.22095e-09
NC_014210.1\|WP_013155379.1\|5218397_5218748_+\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	gnl\|CDD\|377579	pfam05973, Gp49, Phage derived protein Gp49-like (DUF891). This family consists of hypothetical bacterial proteins of unknown function as well as phage Gp49 proteins.	7.51177e-15
NC_014210.1\|WP_013155374.1\|5212669_5213662_+\|mycothiol-synthase	gnl\|CDD\|132489	TIGR03448, mycothiol_MshD, mycothiol synthase. Members of this family are MshD, the acetyltransferase that catalyzes the final step of mycothiol biosynthesis in various members of the Actinomyctes, Mycothiol replaces glutathione in these species. [Biosynthesis of cofactors, prosthetic groups, and carriers, Glutathione and analogs].	8.03208e-90
NC_014210.1\|WP_013155368.1\|5206951_5208457_-\|glutamyl-tRNA-reductase	gnl\|CDD\|234592	PRK00045, hemA, glutamyl-tRNA reductase; Reviewed.	4.88216e-160
NC_014210.1\|WP_013155375.1\|5213990_5214953_+\|phosphate-ABC-transporter-permease-subunit-PstC	gnl\|CDD\|273992	TIGR02138, phosphate_transport_system_permease_protein_PstC, phosphate ABC transporter, permease protein PstC. The typical operon for the high affinity inorganic phosphate ABC transporter encodes an ATP-binding protein, a phosphate-binding protein, and two permease proteins. This family consists of one of the two permease proteins, PstC, which is homologous to PstA (TIGR00974). In the model bacterium Escherichia coli, this transport system is induced when the concentration of extrallular inorganic phosphate is low. A constitutive, lower affinity transporter operates otherwise. [Transport and binding proteins, Anions].	2.42052e-91
NC_014210.1\|WP_013155378.1\|5217313_5218279_+\|nucleoside-hydrolase	gnl\|CDD\|224868	COG1957, URH1, Inosine-uridine nucleoside N-ribohydrolase [Nucleotide transport and metabolism].	5.15581e-101
NC_014210.1\|WP_013155369.1\|5208595_5209291_-\|redox-sensing-transcriptional-repressor-Rex	gnl\|CDD\|235486	PRK05472, PRK05472, redox-sensing transcriptional repressor Rex; Provisional.	1.147e-113
NC_014210.1\|WP_013155373.1\|5211461_5212526_+\|hypothetical-protein	gnl\|CDD\|223044	PHA03325, PHA03325, nuclear-egress-membrane-like protein; Provisional.	0.00247371
NC_014210.1\|WP_026338063.1\|5220792_5222289_+\|amidophosphoribosyltransferase	gnl\|CDD\|236113	PRK07847, PRK07847, amidophosphoribosyltransferase; Provisional.	0
NC_014210.1\|WP_013155377.1\|5216088_5216868_+\|phosphate-ABC-transporter-ATP-binding-protein	gnl\|CDD\|184587	PRK14241, PRK14241, phosphate transporter ATP-binding protein; Provisional.	0
NC_014210.1\|WP_013155387.1\|5225683_5225887_+\|developmental-transcriptional-regulator-BldC	gnl\|CDD\|133390	cd04762, HTH_MerR-trunc, Helix-Turn-Helix DNA binding domain of truncated MerR-like proteins. Proteins in this family mostly have a truncated helix-turn-helix (HTH) MerR-like domain. They lack a portion of the C-terminal region, called Wing 2 and the long dimerization helix that is typically present in MerR-like proteins. These truncated domains are found in response regulator receiver (REC) domain proteins (i.e., CheY), cytosine-C5 specific DNA methylases, IS607 transposase-like proteins, and RacA, a bacterial protein that anchors chromosomes to cell poles.	9.75457e-14
NC_014210.1\|WP_013155381.1\|5219264_5219882_-\|DUF47-domain-containing-protein	gnl\|CDD\|224310	COG1392, COG1392, Phosphate transport regulator (distant homolog of PhoU) [Inorganic ion transport and metabolism].	3.1662e-28
NC_014210.1\|WP_013155372.1\|5210370_5211138_+\|response-regulator-transcription-factor	gnl\|CDD\|223816	COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription].	1.37037e-43
NC_014210.1\|WP_013155370.1\|5209705_5209972_-\|glutaredoxin-family-protein	gnl\|CDD\|368604	pfam05768, DUF836, Glutaredoxin-like domain (DUF836). These proteins are related to the pfam00462 family.	2.11702e-13
NC_014210.1\|WP_013155376.1\|5214952_5216032_+\|phosphate-ABC-transporter-permease-PstA	gnl\|CDD\|223654	COG0581, PstA, ABC-type phosphate transport system, permease component [Inorganic ion transport and metabolism].	2.31688e-84
NC_014210.1\|WP_013155380.1\|5218747_5219074_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	2.20747e-13
NC_014210.1\|WP_013155384.1\|5222391_5223456_+\|phosphoribosylformylglycinamidine-cyclo-ligase	gnl\|CDD\|235439	PRK05385, PRK05385, phosphoribosylaminoimidazole synthetase; Provisional.	4.59946e-179

>NC_014210.1|WP_013155377.1|5216088_5216868_+|phosphate-ABC-transporter-ATP-binding-protein
MAKRIDVSGLHVYYGDFKAVEDVSMTIEPRSVTAFIGSSGCGKSTFLRTLNRMHEVTPGARVQGKVLLDDLDIYGPDVDPVMVRSEVGMVFQKANPFPTMSIYDNVIAGARLNNRRMSKSEADELVEGSLRGANLWEEVKDRLNKPGSGLSGGQQQRLCIARATAVKPSVLLMDEPCSALDPISTLAIEDLIHQLKENYTIVIVTHNMQQAARVSDRTAFFNLSAPGKPGKLIEMGETNQMFTRPEKKETENYITGRFG
>NC_014210.1|WP_013155376.1|5214952_5216032_+|phosphate-ABC-transporter-permease-PstA
MDTTTTQPPGPEAGSTATDLRRGSLPQHFPAALLASSAAVVAGVLLAFSSFGFLLWGLLTAAAYVVIVVTASARVEGGRKAKDRLVTSLVYLCFLLAMLPLVSVLWTVLSNGIVRFDAYFLTVSMNGVLPSMDAGGVYHAIVGTLAITGMATLISVPIGVMTAVYLVEYAEGRMKRIIVFFVDVMTGIPSIVAGLFVVALWMILFGPGRTNGAAGAIALAVLMIPVVVRSSEEMLRLVPQDLREASYALGVPKWRTITKVVLPTSAAGLTTGIMLAIARVIGETAPLILTTGSSAVSINWNLFDGQMMNLPVFIYSQVRMGGAVNYERAWAAALTLILVVMLLFFLARMIGRLFAPKAR
>NC_014210.1|WP_013155375.1|5213990_5214953_+|phosphate-ABC-transporter-permease-subunit-PstC
MTTTDAPEAAPPPTGKRRIGDVAFAGLARGSGILILLILAGVAAFLLVQAWPSLTANTVNFLTSTEWDPNVREEPAFGVAALAFGTVLAAAIALLLATPVAIGIALFIVFYAPRRLASVLGYLVDLLAAIPSVVYGLWGIGFLAPELVPVYQALTRYLGWIPLFQGPASTSARTILTAGVVLAVMILPIITAMARDVFHQTPQGHREAALAMGATRWEMIRLAVLPFGRSGVVGGAMLGLGRALGETMAVAMILSPSLIVSWNLLQSGNQTIAAHIALQYPEATGYGVSALIAAGLVLFAITLVVNMGARYVVTRGSKES
>NC_014210.1|WP_013155374.1|5212669_5213662_+|mycothiol-synthase
MDTPLVTDDLDRTLAEQVLTLAEAARAADGVAPLSEHTLLRVRHGAPSGSSRFHLALEDGRAVGFAFVERVAGEPDSGEVVVHPDHRGRGHGTALLHSVDRDAGPDGVRVWAHGRTPQAVSVAREDGWTAVRELHKMRMPLRDIAGDEPGGPWEAPELPEPELRPEVAERVRLRPFVVGQDEQAWLAANARAFADHPEQGQLTLDDLLQREVEDWFDPDGFFLATAKDGGVAAFHWTKTHADGAGLTDGEPVGEVYVVGVDPEWQGSGLGRALTLAGLRHLRDAGLPWVHLYVDGDNEAAVRLYESLGFAMWDTDVMYAPPRDDAPRPNV
>NC_014210.1|WP_013155373.1|5211461_5212526_+|hypothetical-protein
MPTNAARPPLTPGRRRTAIALGAVFVGSSLVAAMSPAHAEPSPSASASPAPSTPPSSPEPDPSAVVSFERDSDEVKLGDSAVNPLTATNTGDASVCLLAMSVDTGGFGVRGFTPQEVAPGQEASAGEVTGATRERAEVTATLTYALAQEGVACAALEPASTHTVATGTWTVSIARPEPTTPPEQTGEPTDEPTETEEPDDTTSPSDTPRPDPTRDDDRGGNSGGGSGGSGGSGGGGSGGSDGAPRSSGRVDDVPTSDVPTTRDSFPDLPSDEAALPGVVPGAENLAELPTVTPGAQDDDLDGTEVAADHSDLGPNMAPAVLLAAFLLALLLAAPLAPVRRVRVGGGYQGRRRRK
>NC_014210.1|WP_013155372.1|5210370_5211138_+|response-regulator-transcription-factor
MSHLLLLTNSNEPSDHVLPALGLLLHSVRVAPAEAGALLASNAGGGSGAPVDAILVDARTDLAAARNFCRLLDTTGLDCPLMVILTEGGVAALTPDWQVNDFILSTAGPAEVEARLRLAVGSAEAGTDDPDEIRRGDLVIDEATYIARLRGRILDLTFKEFELLKFLAQHPGRVFTRAQLLQEVWGYDYFGGTRTIDVHVRRLRAKLGSEYESLIGTVRNVGYRFVPDPVAKAPSAVPEGVDAPPAARSAEPSAT
>NC_014210.1|WP_013155371.1|5210005_5210263_-|MoaD/ThiS-family-protein
MAKCTIRYWAAAKEAAGTAEETVGAATLAEALEAACRLHPDDRFQRVLGSSSLLVDERPVGRRAHGDVPVADGTVIEVLPPFAGG
>NC_014210.1|WP_013155370.1|5209705_5209972_-|glutaredoxin-family-protein
MAETPQWAGQARVVMLGKPGCHLCEDAWGVIERVTDELGASRAVRQLDEVGADEREEYWDKIPVTFVDGRRHDFWRVGEDRLRSALGG
>NC_014210.1|WP_013155369.1|5208595_5209291_-|redox-sensing-transcriptional-repressor-Rex
MTSRPPRPRERGIPEATVARLPVYLRALQTLQDRGTLTVSSEDLASAAGVNSAKLRKDLSHLGSYGTRGVGYEVEYLVYQISRELGLTQDWAVAIAGIGNLGRALANYGGFGTRGFRIAALLDADPAMVGQSVASLDVRHIDNLEEVVRSERVSIGVITTPAVSAQGVATRFVEAGVASILNFAPVVLNVPDGVDVRKVDLSIELQILAFHAQRRADGDGRGAERAGLELT
>NC_014210.1|WP_013155368.1|5206951_5208457_-|glutamyl-tRNA-reductase
MSVLAVGLSHRSSPVALLERVALNGETRANAVAEMVGSEPVNEVMVVSTCNRTEVYADVSAFHGGVSAITELLSWHTGVPLGELSEHLYVHYEDRAVQHLFSVTCGLDSMVLGEGQILGQVRDALKEGQETGSVGRVLNDLGQRALRVGKRAHTETHLDHAGADMVSFGLTVASGGLGLGPTGAPQTTALQTAQTVGSLPPAGCPMSAVPGDTADAPGLARPAHGPLTGVRVLVLGAGSMSALSANTVSRQGAEAVVVANRTFDRAARLAECLTEAYDTVEARAVPFADAAGVLAEVDLVISCTGAQGLVLTAEAVAAATAGRTRPLVFLDLALPRDIDPAVRELPGVRLVDIEDLRQAAATAPGADTGRDSALTLVRGIVDEEVTEFRAVRRAHQVTPTVVALRAQARDVVDAELSRLHGRLPADLDDRTREEISRAMRRVADKLLHRPTVRVKELAAAPDGESYEAALRELFALDPGSPEALTAPEGTATAARTAQEKS
>NC_014210.1|WP_013155378.1|5217313_5218279_+|nucleoside-hydrolase
MTTPLVIDTDTAQDDCVALLIGLLDPEADLRAITMVAGNVGFDQQVRNAFLTLSVAGRLGEVPVYLGCRRPLVRPWVSAENVHGDGSGGLSMDVSGLETEREHAADALVRLAAENPGELSIVAIGPLTNIAMAAAKDPDFARNVGALYVMGGSNNGRGNITAAAEFNFYVDPESAKAVFAAGFEITVVPWDPLTLRQAVFGQERLDALAALGTPLSDFFGRVCAATLEFDRSVGIDGTTHPDSLTAAVLLHPELVRRSARYHVDVETAGELTRGYSAMSWGVHGLEANATVIEEIDADGFFDHLAGLLSRRTVPNRTVTGL
>NC_014210.1|WP_013155379.1|5218397_5218748_+|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin
MSWGSIELEPEVELWLEALSDEEWAQAMFHLDLLESRGVGLGFPYTSQLDGKLRELRFYCGGQRVRVTYYIAGERRIIMLTVFRKTRARESAEVRRATRAMNECLRAGHTVDGEEE
>NC_014210.1|WP_013155380.1|5218747_5219074_+|helix-turn-helix-transcriptional-regulator
MSTSPRRTLSELKSSERFDRPGVREAYELTRLRFELAETVRLRREQLGWSQAELGRRAGMPQSSIARFEHGGTEPTLPTLERIAEALGLVLRVRMETPTEQEPDSSAA
>NC_014210.1|WP_013155381.1|5219264_5219882_-|DUF47-domain-containing-protein
MRLRLRPRDDSYYEMFTDSANNLVIAARLLVELMSDGADREAITEKMRACEHAGDDATHAIMRRLNKSSGTPIHREDIYRLASNLDDVMDSMEAAVDLIGLYGLERLPKGIIDQIEVLERAAELTAEAMPRLRTLEDLTRYWIEINQLENQADRIYRKLLARLFSGEYDALTVLKLKDVIEELETAADAFEHVANTVETIVVKNG
>NC_014210.1|WP_013155382.1|5220306_5220783_+|hypothetical-protein
MPSALSASAVRRLRASLDEQLSELGEAPFEGNDEAAVAACAEAVLRAGEPVRAALKAAVRGTLAVLADRAPGHSLEVRVPPYGAVQAVEGPRHTRGTPPGVVETDPLTWLRVATGRTPWEQAVSEHLVRASGVRSDLSGHLPLWPVPPPGGARPTARH
>NC_014210.1|WP_026338063.1|5220792_5222289_+|amidophosphoribosyltransferase
MSYSDGRLTMDLDPLERGPQDACGVFGVWAPGEEVSKLTYFGLYALQHRGQESAGIALSDGERIVVYKDMGLVSQVFNEATLDSLRGHLAIGHCRYSTTGSPVWENAQPTFYTAREGGLALGHNGNLINTPELAAMLPDTRRGATTDTEVLTNLLAERARSGSSVEDAALELLPQVRGAFSLVFMDEGTLYAARDPQGIRPFVLGRLGETSGAGGWVVASETAALDIVGAKVVREIEPGELLTIDERGVRSRRFAPARRKGCLFEYVYLARPDTTIAGRNVNSTRVEVGRRLAKEHPVEADLVIPVPESGTPAAVGYAEASGIPFAQGLVKNSYVGRTFIQPSQTLRQLGIRLKLNPLRDVIEGRRLVVVDDSIVRGNTQRALVRMLRDAGAAEVHVRISSPPVLWPCYYGIDFATRAELIAANMSVDEIAASVNADSLAYVDLDELIAASEVPKDNLCRACFDGVYPIEVRDDARGKYLLEKSCGTPEGSTLATSDK
>NC_014210.1|WP_013155384.1|5222391_5223456_+|phosphoribosylformylglycinamidine-cyclo-ligase
MAAESTGTSGAYAAAGVDIAAGERAVDLMKRHVARTRRPEQVTDASGFAGLFRLDTNKYKDPVLATSTDGVGTKVMLAQQMDRHDTIGIDLVAMVVDDLVVSGAEPLFMTDYVACGAVVPERIAEIVGGIAEGCHQAGCALVGGETAEHPGAMEPDEYDLAGAGTGVVEGDAILGQDRVREGDAVIAMGSSGPHSNGYSLVRSIVDRADLDLFAHVPELDGVLGEVLLTPTRVYAKDCVALTAAVEVHAYAHITGGGLAANLARSLPDHLDAELDRSTWAPAPVFGYLADKGGVGREDMEATFNMGVGMAAIVAADDAERALRVLSDRGVPAWRLGTVTAGSGRAVLTGEYRGA
>NC_014210.1|WP_013155385.1|5223666_5223894_-|DUF3073-domain-containing-protein
MGRGRAKAKQQKVARKLKYSSGGTDLERLRSELGVAEDEGSPSGPSGPDDSYADSHDDLVDRYADLADKYSDSDK
>NC_014210.1|WP_036552281.1|5224127_5224979_+|hypothetical-protein
MCHDAFVLPYTAYLRVYQPINAFSPYERGYWEEYAASPDRPRRINALAAEHAESLSRLVATPPVVAPAEESRNAYLRRVNERLYVCPWQTRLRSWRAFTEFTSTMPVGVSTAFVPVDEAERAEEEYREWRDSGALVRPGILSSNWTVPIPWFVPFEAQERCLVLSANSTRTLLYLTRTSLALRRLEQTAAVLREHIGEHAVSAATEQLTDWLTLTAHPDSLLELDYGGLPHLLSDDHLGEDHSVAEVAGAIEALATGDGRRVVELRERLTRRWRSVRALEHAN
>NC_014210.1|WP_013155387.1|5225683_5225887_+|developmental-transcriptional-regulator-BldC
MSTRTPEAEPLLTPAEVATMFRVDPKTVTRWAKAGKLTSIRTLGGHRRYRETEVRALLAGIPSQRTE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_014210_23

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_014210_23

5555560-5555954

Orphan

I-E:NA

Consensus_repeat	Method
GGGACCATCCCCGCGTGCGCGGGGAGCAC	CRISPRCasFinder
GGGACCATCCCCGCGTGCGCGGGGAG	CRT
GGGACCATCCCCGCGTGCGCGGGGAG	PILER-CR

6 spacers

The CRISPR arrays of NC_014210_23

>merge|NC_014210|23|5555560-5555954|CRISPRCasFinder,CRT,PILER-CR
TGGACCATCCCCGCGTGCGCGGGGAGCACTCCTTGTCCTCTACCTGGATGCGCCCAGCGCTGGGACCATCCCCGCGTGCGCGGGGAGCACGCCGTCACCAGGTTGCCCACGGTCGCGCCGAGGGGACCATCCCCGCGTGCGCGGGGAGCACCAGCTGGCCGCCCTCCAGGCGCAGACGCAGGCGGGACCATCCCCGCGTGCGCGGGGAGCACCTGCCCACCCAGCTCACCGCGCCGGACGCGGAGGGACCATCCCCGCGTGCGCGGGGAGAACCAGCGCGCCAAGCTCATCAGTAACCCGTCGGCGGGACCATCCCCGCGTGCGCGGGGAGAACAGCAACGGCTCACTCTCAGCGGACAAGTCATCGGGACCATCCCCGCGTGCGCGGGGAGAAC

>NC_014210|23|21|5555560-5555954|CRISPRCasFinder
TGGACCATCCCCGCGTGCGCGGGGAGCAC	TCCTTGTCCTCTACCTGGATGCGCCCAGCGCT
GGGACCATCCCCGCGTGCGCGGGGAGCAC	GCCGTCACCAGGTTGCCCACGGTCGCGCCGAG
GGGACCATCCCCGCGTGCGCGGGGAGCAC	CAGCTGGCCGCCCTCCAGGCGCAGACGCAGGC
GGGACCATCCCCGCGTGCGCGGGGAGCAC	CTGCCCACCCAGCTCACCGCGCCGGACGCGGA
GGGACCATCCCCGCGTGCGCGGGGAGAAC	CAGCGCGCCAAGCTCATCAGTAACCCGTCGGC
GGGACCATCCCCGCGTGCGCGGGGAGAAC	AGCAACGGCTCACTCTCAGCGGACAAGTCATC
GGGACCATCCCCGCGTGCGCGGGGAGAAC

>NC_014210|23|10|5555560-5555951|CRT
TGGACCATCCCCGCGTGCGCGGGGAG	CACTCCTTGTCCTCTACCTGGATGCGCCCAGCGCT
GGGACCATCCCCGCGTGCGCGGGGAG	CACGCCGTCACCAGGTTGCCCACGGTCGCGCCGAG
GGGACCATCCCCGCGTGCGCGGGGAG	CACCAGCTGGCCGCCCTCCAGGCGCAGACGCAGGC
GGGACCATCCCCGCGTGCGCGGGGAG	CACCTGCCCACCCAGCTCACCGCGCCGGACGCGGA
GGGACCATCCCCGCGTGCGCGGGGAG	AACCAGCGCGCCAAGCTCATCAGTAACCCGTCGGC
GGGACCATCCCCGCGTGCGCGGGGAG	AACAGCAACGGCTCACTCTCAGCGGACAAGTCATC
GGGACCATCCCCGCGTGCGCGGGGAG

>NC_014210|23|11|5555561-5555890|PILER-CR
GGACCATCCCCGCGTGCGCGGGGAGC	ACTCCTTGTCCTCTACCTGGATGCGCCCAGCGCTG
GGACCATCCCCGCGTGCGCGGGGAGC	ACGCCGTCACCAGGTTGCCCACGGTCGCGCCGAGG
GGACCATCCCCGCGTGCGCGGGGAGC	ACCAGCTGGCCGCCCTCCAGGCGCAGACGCAGGCG
GGACCATCCCCGCGTGCGCGGGGAGC	ACCTGCCCACCCAGCTCACCGCGCCGGACGCGGAG
GGACCATCCCCGCGTGCGCGGGGAGA	ACCAGCGCGCCAAGCTCATCAGTAACCCGTCGGCG
GGACCATCCCCGCGTGCGCGGGGAG

Protein	Signature genes	Signature genes Name	Protein_function
NC_014210.1\|WP_013155685.1\|5565921_5569578_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224055
NC_014210.1\|WP_013155672.1\|5553684_5553840_-\|hypothetical-protein	unknown	unknown	unknown
NC_014210.1\|WP_013155683.1\|5563805_5564747_-\|hypothetical-protein	unknown	unknown	unknown
NC_014210.1\|WP_013155682.1\|5562565_5563774_-\|cytochrome-P450	unknown	unknown	gnl\|CDD\|225035
NC_014210.1\|WP_013155679.1\|5559519_5560344_+\|NAD(P)H-binding-protein	unknown	unknown	gnl\|CDD\|187578
NC_014210.1\|WP_013155667.1\|5550627_5551458_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|366444
NC_014210.1\|WP_013155677.1\|5556876_5558487_-\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|223562
NC_014210.1\|WP_013155666.1\|5550014_5550623_+\|hypothetical-protein	unknown	unknown	unknown
NC_014210.1\|WP_013155680.1\|5560624_5561404_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|367243
NC_014210.1\|WP_013155675.1\|5555299_5555491_+\|DUF397-domain-containing-protein	unknown	unknown	gnl\|CDD\|377231
NC_014210.1\|WP_013155676.1\|5556209_5556773_+\|DNA-3-methyladenine-glycosylase-I	unknown	unknown	gnl\|CDD\|377025
NC_014210.1\|WP_013155678.1\|5558641_5559259_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|379883
NC_014210.1\|WP_041553280.1\|5561501_5562191_-\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|225107
NC_014210.1\|WP_126625105.1\|5554444_5555293_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|379262
NC_014210.1\|WP_013155668.1\|5551454_5552654_-\|daunorubicin-resistance-protein-DrrA-family-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|130256
NC_014210.1\|WP_013155671.1\|5553436_5553688_-\|hypothetical-protein	unknown	unknown	unknown
NC_014210.1\|WP_013155669.1\|5552801_5553044_-\|BldC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133390
NC_014210.1\|WP_013155670.1\|5553164_5553440_-\|hypothetical-protein	unknown	unknown	unknown
NC_014210.1\|WP_013155684.1\|5565051_5565777_+\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|379276
NC_014210.1\|WP_013155673.1\|5553836_5554088_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NC_014210.1\|WP_013155682.1\|5562565_5563774_-\|cytochrome-P450	gnl\|CDD\|225035	COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism].	1.63922e-74
NC_014210.1\|WP_013155679.1\|5559519_5560344_+\|NAD(P)H-binding-protein	gnl\|CDD\|187578	cd05269, TMR_SDR_a, triphenylmethane reductase (TMR)-like proteins, NMRa-like, atypical (a) SDRs. TMR is an atypical NADP-binding protein of the SDR family. It lacks the active site residues of the SDRs but has a glycine rich NAD(P)-binding motif that matches the extended SDRs. Proteins in this subgroup however, are more similar in length to the classical SDRs. TMR was identified as a reducer of triphenylmethane dyes, important environmental pollutants. This subgroup also includes Escherichia coli NADPH-dependent quinine oxidoreductase (QOR2), which catalyzes two-electron reduction of quinone; but is unlikely to play a major role in protecting against quinone cytotoxicity. Atypical SDRs are distinct from classical SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	1.90165e-50
NC_014210.1\|WP_013155667.1\|5550627_5551458_-\|ABC-transporter-permease	gnl\|CDD\|366444	pfam01061, ABC2_membrane, ABC-2 type transporter.	1.60713e-15
NC_014210.1\|WP_013155685.1\|5565921_5569578_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	4.88469e-161
NC_014210.1\|WP_013155680.1\|5560624_5561404_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|367243	pfam02909, TetR_C, Tetracyclin repressor, C-terminal all-alpha domain.	4.17742e-09
NC_014210.1\|WP_013155675.1\|5555299_5555491_+\|DUF397-domain-containing-protein	gnl\|CDD\|377231	pfam04149, DUF397, Domain of unknown function (DUF397). The function of this family is unknown.	3.15573e-19
NC_014210.1\|WP_013155676.1\|5556209_5556773_+\|DNA-3-methyladenine-glycosylase-I	gnl\|CDD\|377025	pfam03352, Adenine_glyco, Methyladenine glycosylase. The DNA-3-methyladenine glycosylase I is constitutively expressed and is specific for the alkylated 3-methyladenine DNA.	5.03476e-114
NC_014210.1\|WP_013155678.1\|5558641_5559259_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|379883	pfam16859, TetR_C_11, Bacterial transcriptional repressor C-terminal. This family of bacterial transcriptional repressors is characterized by the short approximately 50 amino acid stretch of residues constituting the helix-turn-helix DNA binding motif, around the YRFhY motif. The target proteins that are repressed are involved in the transcriptional control of multi-drug efflux pumps, pathways for the biosynthesis of antibiotics, response to osmotic stress and toxic chemicals, control of catabolic pathways, differentiation processes, and pathogenicity. Another target protein is BetI, an osmoprotectant which controls the choline-glycine betaine pathway in E.coli.	2.3476e-17
NC_014210.1\|WP_041553280.1\|5561501_5562191_-\|response-regulator-transcription-factor	gnl\|CDD\|225107	COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription].	3.60128e-50
NC_014210.1\|WP_126625105.1\|5554444_5555293_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|379262	pfam13560, HTH_31, Helix-turn-helix domain. This domain is a helix-turn-helix domain that probably binds to DNA.	6.90026e-10
NC_014210.1\|WP_013155668.1\|5551454_5552654_-\|daunorubicin-resistance-protein-DrrA-family-ABC-transporter-ATP-binding-protein	gnl\|CDD\|130256	TIGR01188, drrA, daunorubicin resistance ABC transporter ATP-binding subunit. This model describes daunorubicin resistance ABC transporter, ATP binding subunit in bacteria and archaea. This model is restricted in its scope to preferentially recognize the ATP binding subunit associated with effux of the drug, daunorubicin. This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily. The characteristic feature of these transporter is the obligatory coupling of ATP hydrolysis to substrate translocation. The minimal configuration of bacterial ABC transport system: an ATPase or ATP binding subunit; An integral membrane protein; a hydrophilic polypetpide, which likely functions as substrate binding protein. In eukaryotes proteins of similar function include p-gyco proteins, multidrug resistance protein etc. [Transport and binding proteins, Other].	6.44034e-116
NC_014210.1\|WP_013155677.1\|5556876_5558487_-\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|223562	COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only].	2.84902e-114
NC_014210.1\|WP_013155669.1\|5552801_5553044_-\|BldC-family-transcriptional-regulator	gnl\|CDD\|133390	cd04762, HTH_MerR-trunc, Helix-Turn-Helix DNA binding domain of truncated MerR-like proteins. Proteins in this family mostly have a truncated helix-turn-helix (HTH) MerR-like domain. They lack a portion of the C-terminal region, called Wing 2 and the long dimerization helix that is typically present in MerR-like proteins. These truncated domains are found in response regulator receiver (REC) domain proteins (i.e., CheY), cytosine-C5 specific DNA methylases, IS607 transposase-like proteins, and RacA, a bacterial protein that anchors chromosomes to cell poles.	1.33348e-14
NC_014210.1\|WP_013155684.1\|5565051_5565777_+\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|379276	pfam13578, Methyltransf_24, Methyltransferase domain. This family appears to be a methyltransferase domain.	1.87457e-23

>NC_014210.1|WP_013155675.1|5555299_5555491_+|DUF397-domain-containing-protein
MTSVPTLLNFRKSSYSQPSGGNCVEVADTGTGAAVRDTQNRHLGHLEAPSAEWAAFLTSVRSR
>NC_014210.1|WP_126625105.1|5554444_5555293_+|helix-turn-helix-domain-containing-protein
MRGIIATRYSPTIRRRRLSADLRRIRQAARMTSEEVAKAAELSKSTYSNIESGLKQRPKLPEIRAILNACGLSPGREYEEILDLCRQSLERGWWNRYRDVLAARYVGFETEANAISTWEPVVLPGLLQVPGYMEVIAQAALLRPEDIHRIVDVRMTRQRILDDEDAPELWAIFDETALLRLEQHPMVRQEQVRHLLDMAERPNLTLQMTRASQLNAGSGGPFVILEFPESVDPTVVYLETNTDGIYLEEPDEVARYRNLMNHLRLAALRPGETIDHLRQMIE
>NC_014210.1|WP_013155673.1|5553836_5554088_-|hypothetical-protein
MERDLIPPYYRAWEQKRADKRPAPDHLGGDLLHVIAPAVPLPRPRPSDDLTDLAAVVRQWHTAQTAQTTQAIQAARTFEGVRA
>NC_014210.1|WP_013155672.1|5553684_5553840_-|hypothetical-protein
MNSLAFRSRRSRSNRVRPFLTVLPTAWVSVATGAFPIVLTAAHQVLREAKR
>NC_014210.1|WP_013155671.1|5553436_5553688_-|hypothetical-protein
MMSATTAVTVTDLTCDDVRLCREANGSGSLASLAVAACHVDLSPGWSAHGRAARVAALEKLARLAQQAARELSESGQRPGREP
>NC_014210.1|WP_013155670.1|5553164_5553440_-|hypothetical-protein
MTAVPEPRREPRTVFEVREVESREALHAWARAHGVRVRYLGSTWQHEEVYGAQQGTQVRVCRTPWEHHRLHPVVWRSPLEKPPVIPRQRTP
>NC_014210.1|WP_013155669.1|5552801_5553044_-|BldC-family-transcriptional-regulator
MPNTPHTPHAPRKPHASHADLPVYLLTVAEVGDMFRVNPRTVNRWVAQGRIPVVRTPGGHLRFDPAEVRRLLWIDQPPTT
>NC_014210.1|WP_013155668.1|5551454_5552654_-|daunorubicin-resistance-protein-DrrA-family-ABC-transporter-ATP-binding-protein
MNTTGGAITARGLGKRYGRSWALRGFDLDVPAGSVCGLLGPNGAGKTTAVRVLATLLRADEGTARVAGYDVASQGDAVRRSIGLVGQNAAVDEVLSGRQNLEMFGRLYHLGARRAAARADELLERFRLADTGRKPVSAYSGGMRRRLDLAASMILSPPVLFLDEPTVGLDPRGRNEVWNAVRALVAGDTTVLLTTQYLEEADQLADRISVVDSGRVVAEGTPEELKSRLGGDRLDVVLHEAAALDRAAALIGRVTGERPEVEADARRIGVGVRNRVAALTEVVRALEEEEIEVEDVALRRPTLDEVFLHLTGGHEDRGDRGDRDGHGDRRGREGVGEAGEAGNGDDGGGGRDVSDGGDRDAGGGDGHDVRGERGDRGDRGDHGERGEHEDSDDRVGESR
>NC_014210.1|WP_013155667.1|5550627_5551458_-|ABC-transporter-permease
MNDTVIQGAVSAPADRLRWALADGWTIARRDVVHWLRQPGQLVAGLLFPVVMVLMFGFLFGGAMTVPGGGDYREFLMPGMFAMAMVFGVGETVTAVSQDAARGVTDRFRSMPMAPSAVVVGRCAADMLRSAITLVLLVLCGLLVGWQWNGGTGEAAAGIGLLLLLRFSLVWVGVYVGLAVRGEGAVTAVHMLEFPLGFLSNAFVATASMPVWLGAVADWNPLSSTVAATRELFGNPGWGGESWIAQNAVLMAVVWPLVLTAVFFPLCVRRFRALGR
>NC_014210.1|WP_013155666.1|5550014_5550623_+|hypothetical-protein
MNQQRPPLFLRIRAYAHRDPRGYAIRAGLVGGLFFGAVTGLFWALFLRSVGDSAVWALPFGAVSGAFFGVFITVVIVRSLPSTPLPPGTDRAGMREAARLVRGGVPGTDPLVNQIARHQAEAVLRQQYWPKTMSAVFGMGLATNLWAVTDSTTGLGFWGSIVGLVVFPLMLFVAMPLTARNRRRARAFLTALEEGPGPRPDA
>NC_014210.1|WP_013155676.1|5556209_5556773_+|DNA-3-methyladenine-glycosylase-I
MSDQRCAWARGSSELMVAYHDHEWGRPSRDDAHLFEMLVLEGAQAGLSWSTVLNKRENYRRALEGFDRERIAEYGQEDTDRLLQDTGIIRNRLKVASLPRNARAFGDVREEYGTFAAYLWGWVDGTPVVNRFTEPSEVPVSTPLSDRVSRDLKKRGFTFVGTTIVYSYLQAVGVVDDHLVACPAKPA
>NC_014210.1|WP_013155677.1|5556876_5558487_-|ABC-F-family-ATP-binding-cassette-domain-containing-protein
MSSAFSVVCTGLSFAWPDGTPVLTGLDAAFGTGRTGLVGRNGSGKSTLLRLVAGRLTPASGTVAVDGDVGYLDQGLTLDTGRTVAELLGVDRARTALHAIEAGEATEANFAAVGEDWDVEERVLAQLERFGVALTGDAPLDRPVGTLSGGEAVLVALAGLALRRPAVTLLDEPTNNLDRRARERLHDAVASWQGVLVVVSHDRELLERVDQIAELREGRMRVWGGNYSAYTEQLAAEQEAARRMVRVAEADVRREKRQLADAQVKLARRVRYGKKMYDTKREPRVVMKQRKRDAQVAAGKHRVMQEAKLVGAREELGRAEDAVRDDDAIRVALPGTGVPAGHGVLELGTPVGGRLYLRGPERVALVGPNGSGKTTLLRAVVGRGRHPQAEVVHAADRIGYLPQRLDVLDDGLSVLDNVRAAAPSATPHRVRAGLARFLIRGDRVEQRAGDLSGGERFRVALARLLLADEPPRLLVLDEPTNSLDLDSQRQLAEALADYRGALLVASHDHAFLREVGVGRWWRTERGHAPVEVSGAD
>NC_014210.1|WP_013155678.1|5558641_5559259_+|TetR/AcrR-family-transcriptional-regulator
MTSDTGTPGAARPGGRTARNTAAVLQATLDELGEHGYAGLTAERVATRSGVHKATVYRRWGGVDGLLSAALEWSTNRDWAPERTGSLRTDLRALNATVLHGFTEAPEGAMSAASIAAAFASPRVAGALRVFMADRHARAAVLVTEAVARGEAPEGTDAEEVVRSAIAPVYYRLFVSREPVTSADLDLAALVTAEAAARGAFVRRS
>NC_014210.1|WP_013155679.1|5559519_5560344_+|NAD(P)H-binding-protein
MTFLVAGATGNVGRHVVGQLLGAGHPVRALTRSPGRARLPEGAQVVGGDLTDPDGLAPHLEGVTGLHLITFGGDDYSPLTSAPRLVELAEKAGVRRVSVLCDFYPGPVEEALAASGLAWTLLQPVEFMANTLEWAGSVRAEGVVREARTAPSALVHEADIASVAVTALTGDGHGGRAYPLTGPEALTPAERVAVLSRGIGREVGLVRLTLEEEAERLRALGHDEEYVAFGLQLATDPPEVGTRVQDTVERVTGRPARTFAEWVGENADAFRPRS
>NC_014210.1|WP_013155680.1|5560624_5561404_+|TetR/AcrR-family-transcriptional-regulator
MPTQYTKSGDPARSLALLWRTQEPVSRRNKPDLSVDRIVAVASEMADNEGLAALSMRKVAERLGVGTMSLYTYVPGKGELVDLMLDAAYADMYADGERPEHWRERLSAVAYANWRLLLRHPWMLQTPRGRLLGPHLIAKYEYELSAVDGLGLSDVEMDSTVSLVNSYAEGAASQAAAVSETERATGMTDGQWWSTHGPLLAAFTRDSDYPLASRVGSTVGREHRTVYSSDHEFAFGLERVLDGVRVLVESRSARGAEGS
>NC_014210.1|WP_041553280.1|5561501_5562191_-|response-regulator-transcription-factor
MTRVLIIGDQDVVRLGLCTAFEATQDIKVVGTTGDLRVAVARARQLRPDVAVVDMAALGERGNEVVRELSELDDPRVRVLALAVPSDRDNLVSCLRAGACGYILTGSDMSVITDAVRSLREGHTVLDPAVVGTVVEEFVRYEAAVCVGADDPDSCWKEQFTDREKDVVALVATGASNAEIAGVLGLSETTIKSHVSSVLAKRGLRNRVQLVVWAFRSGLVPVRGRDAVL
>NC_014210.1|WP_013155682.1|5562565_5563774_-|cytochrome-P450
MADAPTPSACPVSLPTAREHALDPPPRFAELRERSPITRLALPDGTRGWLVTDYELACDVLVDQRFSARQDIRVPPPGQAPAPPAAPGFFVRMDAPEHTRYRRRLAGQFTRRRMLLLESRIGEIAEEHVERMLSAGAPADLVTDYALPVPSLVICELLGVPYGERERFQRDTAVAFDVGQPRERVSAALADLNAFLADLVRRKRREPGEDLLSGLLDAPDLTDEEVAAMAFLLLVAGHETTASMLALGAFALLTHPGPWRGALTATDPKPMTRLVDELLRYLTIMQFGAMRVAREDLEVRGERVRAGEAVVVSLAAANRDPRAFPGPDVLDPGRERPMHLAFGLGAHHCLGHQLARTELRLGYGTLFRRIPDLRLAVPPNSVRMRDSSAVYGVHSLPVAWGE
>NC_014210.1|WP_013155683.1|5563805_5564747_-|hypothetical-protein
MAATGGTGTTARTDASTASGVLDAALAWLTDHAEWFGPRWDDHFPPRDFAGATVMELLMLCRLLRRTDPAPPGAAGLERAAAELARDAVAATAPGGEGENPPYRLWTAALLADLGRPADGPLADARALAERRPPRPPGAGASPVLALELRHILDLAGLAAPADLPGTAPLYDACVAEHAGGTGEYDAYGVTHAVLYATDFGARPLPGDAARMGRVLDGLLRAYLDEDHLDLTAELLLCARIAGGVPSALERRAWDRLARAQRPDGSLPGPPFDAGVLAGRTGERATAYVFRTCYHTTLVTAMAAAHAGASARP
>NC_014210.1|WP_013155684.1|5565051_5565777_+|class-I-SAM-dependent-methyltransferase
MGDIDLALIGDLYRRYRDPLAKVRDAQREFLRRTRGRMTPQLDDLEAEITYLLLRETRPDTVMELGTFHGWSTTWILSALRDNGGGTLHSFDIVDNVVANVPSELSLGRWEFHKGDIRENMSQVPEGIGYLFVDAAHNGRFARWYLESLFPRVAPGTPVSVHDVFHGKRALPFTEGAVVLSWLRENGTDFFTPSRKKAPAPYTALLELREELGLGEPVRTSTDNPMIYFRMPEHRGARTGN
>NC_014210.1|WP_013155685.1|5565921_5569578_-|ABC-transporter-ATP-binding-protein
MPGSPPTEAPAARGRHWVLRLLSACRRHPGLAAGVAAAAVLGTGLTALAPLAAQIAVDDAVQGRTDRIGVLALALLGAAALQFAGAFARQFLSGKLALGVQHDLRTAVFDSVQRLDGGKQDTLRTGQVMSRAGTDLQLVQGLLATAPQALGGLVLIVFAFSAMLWLSPVLTVVAAAVVVSFVVVTARVSRRMPPATMAVQRRTAEIAQHVEETVTGVRVVKAFGQEERETRRLADLAARLFGERMRVARMQAAPSATLGVLPYLGQAAVLVVGAWLVARGEVSLGALVAFSGYMVTLTAPSASLSNLVMSAQLVRPAALRVFDLADSRPDVTDAPDAADVPEGPVGVELDGVRFGYTRDSTVLDGLSLSVRPGETLALVGPSGSGKSTVSLLLPRFYDTTGGAVRIGPPGGAVDVRSLRLRSLRAAVGVAFEEPFLFSGSVADNIAYGRPHATREQVRAAARAAGADGFVCALPDGYDTPVGERGLTLSGGQRQRVALARTLLGDPRVLVLDDATSAVDASTEAAMVATLADVTADRTVLLVAHRRSTLALADRIAVLDGGRVVDVGTEAELTRRCPLFARLCAGDGGGVEEPAPAPGGGGSPLWPEPVPEAADPDEAALPAADDRPAERLDRTPPEEPGTRFGVRRVLAPVRALLALAVLLVLADALATTALPVVLRWGLDRGVAPGDAGVVAAVGAAALALVAVNWWVLALQPRVVTRTGESALYALRLRVFRHLHRLGVDFHERERGGGTMTRMTTDVTALSTFVESGLTIVVVNGATVLGMVVAMLVLDPGLALVALAVLPVLLAATLYFRRCVSLAYHLSRERIGEVNADLQEQVAGARESQAAGAEDGASERFAALSDRYRRTRLTAQRHIALYFPFVTLLGDVSTAAVLGAGAYRVAEGTLSVGVLTAFLLYLGMFYAPFQQLSVVFDSYQQARVGVDRIGGLLRTPPTAAASRRAVPAPVRRGGGRVRLEGVGFAYPGAGGPALADVTLSADPGETVALVGETGAGKSTVVRLIARFHDPDRGAVLVDGTDVRDLDPAEHRRRLGVVPQEPHLFTGTVADNVRYGRPGAGDREVEEAVRAVGALDAVSALPRGLRHPVGERGRGLSTGQRQLVALARAQLVDPDVLLLDEPSAGLDPGTERAVLTAMERLSRGRTTFVVTHSLATAARADRIAVLDGGRVVETGTHAELSASGGAYARLWRSSGAGPVPV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_014210_24

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_014210_24

5559221-5559321

Orphan

Consensus_repeat	Method
GAGGCCGCCGCCCGGGGCGCCTTC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_014210_24

>merge|NC_014210|24|5559221-5559321|CRISPRCasFinder
GAGGCCGCCGCCCGGGGCGCCTTCGTCCGCAGGTCCTGAACCCGGCGCCGCCCCAGCGCCCCGGACCGAACGCGGGAGAGCCCGCCGCCCGGGGCGCCTTC

>NC_014210|24|22|5559221-5559321|CRISPRCasFinder
GAGGCCGCCGCCCGGGGCGCCTTC	GTCCGCAGGTCCTGAACCCGGCGCCGCCCCAGCGCCCCGGACCGAACGCGGGA
GAGCCCGCCGCCCGGGGCGCCTTC

Protein	Signature genes	Signature genes Name	Protein_function
NC_014210.1\|WP_013155688.1\|5573691_5574720_-\|LLM-class-flavin-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|225052
NC_014210.1\|WP_013155687.1\|5570731_5573695_-\|lantibiotic-dehydratase	unknown	unknown	gnl\|CDD\|377403
NC_014210.1\|WP_013155672.1\|5553684_5553840_-\|hypothetical-protein	unknown	unknown	unknown
NC_014210.1\|WP_013155671.1\|5553436_5553688_-\|hypothetical-protein	unknown	unknown	unknown
NC_014210.1\|WP_013155682.1\|5562565_5563774_-\|cytochrome-P450	unknown	unknown	gnl\|CDD\|225035
NC_014210.1\|WP_013155686.1\|5569577_5570735_-\|lanthionine-synthetase-C-family-protein	unknown	unknown	gnl\|CDD\|271201
NC_014210.1\|WP_013155679.1\|5559519_5560344_+\|NAD(P)H-binding-protein	unknown	unknown	gnl\|CDD\|187578
NC_014210.1\|WP_013155685.1\|5565921_5569578_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224055
NC_014210.1\|WP_013155680.1\|5560624_5561404_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|367243
NC_014210.1\|WP_013155675.1\|5555299_5555491_+\|DUF397-domain-containing-protein	unknown	unknown	gnl\|CDD\|377231
NC_014210.1\|WP_013155676.1\|5556209_5556773_+\|DNA-3-methyladenine-glycosylase-I	unknown	unknown	gnl\|CDD\|377025
NC_014210.1\|WP_013155683.1\|5563805_5564747_-\|hypothetical-protein	unknown	unknown	unknown
NC_014210.1\|WP_041553280.1\|5561501_5562191_-\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|225107
NC_014210.1\|WP_126625105.1\|5554444_5555293_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|379262
NC_014210.1\|WP_013155668.1\|5551454_5552654_-\|daunorubicin-resistance-protein-DrrA-family-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|130256
NC_014210.1\|WP_013155677.1\|5556876_5558487_-\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|223562
NC_014210.1\|WP_013155669.1\|5552801_5553044_-\|BldC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133390
NC_014210.1\|WP_013155670.1\|5553164_5553440_-\|hypothetical-protein	unknown	unknown	unknown
NC_014210.1\|WP_013155684.1\|5565051_5565777_+\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|379276
NC_014210.1\|WP_013155673.1\|5553836_5554088_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NC_014210.1\|WP_013155688.1\|5573691_5574720_-\|LLM-class-flavin-dependent-oxidoreductase	gnl\|CDD\|225052	COG2141, COG2141, Coenzyme F420-dependent N5,N10-methylene tetrahydromethanopterin reductase and related flavin-dependent oxidoreductases [Energy production and conversion].	5.77938e-21
NC_014210.1\|WP_013155668.1\|5551454_5552654_-\|daunorubicin-resistance-protein-DrrA-family-ABC-transporter-ATP-binding-protein	gnl\|CDD\|130256	TIGR01188, drrA, daunorubicin resistance ABC transporter ATP-binding subunit. This model describes daunorubicin resistance ABC transporter, ATP binding subunit in bacteria and archaea. This model is restricted in its scope to preferentially recognize the ATP binding subunit associated with effux of the drug, daunorubicin. This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily. The characteristic feature of these transporter is the obligatory coupling of ATP hydrolysis to substrate translocation. The minimal configuration of bacterial ABC transport system: an ATPase or ATP binding subunit; An integral membrane protein; a hydrophilic polypetpide, which likely functions as substrate binding protein. In eukaryotes proteins of similar function include p-gyco proteins, multidrug resistance protein etc. [Transport and binding proteins, Other].	6.44034e-116
NC_014210.1\|WP_013155687.1\|5570731_5573695_-\|lantibiotic-dehydratase	gnl\|CDD\|377403	pfam04738, Lant_dehydr_N, Lantibiotic dehydratase, C-terminus. Lantibiotics are ribosomally synthesized antimicrobial agents derived from ribosomally synthesized peptides. They are produced by bacteria of the Firmicutes phylum, and include mutacin, subtilin, and nisin. Lantibiotic peptides contain thioether bridges termed lanthionines that are thought to be generated by dehydration of serine and threonine residues followed by addition of cysteine residues. This family constitutes the N-terminus of the enzyme proposed to catalyze the dehydration step, via glutamylation of the substrate during lantibiotic biosynthesis. The enzyme dehydrates Ser/Thr residues in the precursor by glutamylation.	2.15042e-63
NC_014210.1\|WP_013155679.1\|5559519_5560344_+\|NAD(P)H-binding-protein	gnl\|CDD\|187578	cd05269, TMR_SDR_a, triphenylmethane reductase (TMR)-like proteins, NMRa-like, atypical (a) SDRs. TMR is an atypical NADP-binding protein of the SDR family. It lacks the active site residues of the SDRs but has a glycine rich NAD(P)-binding motif that matches the extended SDRs. Proteins in this subgroup however, are more similar in length to the classical SDRs. TMR was identified as a reducer of triphenylmethane dyes, important environmental pollutants. This subgroup also includes Escherichia coli NADPH-dependent quinine oxidoreductase (QOR2), which catalyzes two-electron reduction of quinone; but is unlikely to play a major role in protecting against quinone cytotoxicity. Atypical SDRs are distinct from classical SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	1.90165e-50
NC_014210.1\|WP_013155686.1\|5569577_5570735_-\|lanthionine-synthetase-C-family-protein	gnl\|CDD\|271201	cd04793, LanC, Cyclases involved in the biosynthesis of lantibiotics. LanC is the cyclase enzyme of the lanthionine synthetase. Lanthinoine is a lantibiotic, a unique class of peptide antibiotics. They are ribosomally synthesized as precursor peptides and then post-translationally modified to contain thioether cross-links called lanthionines (Lans) or methyllanthionines (MeLans) in addition to 2,3-didehydroalanine (Dha) and (Z)-2,3-didehydrobutyrine (Dhb). These unusual amino acids are introduced by the dehydration of serine and threonine residues, followed by thioether formation via addition of cysteine thiols, catalysed by LanB and LanC or LanM. LanC, the cyclase component, is a zinc metalloprotein, whose bound metal has been proposed to activate the thiol substrate for nucleophilic addition. Also contains SpaC (the cyclase involved in the biosynthesis of subtilin), NisC, and homologs.	8.11306e-69
NC_014210.1\|WP_013155680.1\|5560624_5561404_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|367243	pfam02909, TetR_C, Tetracyclin repressor, C-terminal all-alpha domain.	4.17742e-09
NC_014210.1\|WP_013155682.1\|5562565_5563774_-\|cytochrome-P450	gnl\|CDD\|225035	COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism].	1.63922e-74
NC_014210.1\|WP_013155676.1\|5556209_5556773_+\|DNA-3-methyladenine-glycosylase-I	gnl\|CDD\|377025	pfam03352, Adenine_glyco, Methyladenine glycosylase. The DNA-3-methyladenine glycosylase I is constitutively expressed and is specific for the alkylated 3-methyladenine DNA.	5.03476e-114
NC_014210.1\|WP_013155675.1\|5555299_5555491_+\|DUF397-domain-containing-protein	gnl\|CDD\|377231	pfam04149, DUF397, Domain of unknown function (DUF397). The function of this family is unknown.	3.15573e-19
NC_014210.1\|WP_041553280.1\|5561501_5562191_-\|response-regulator-transcription-factor	gnl\|CDD\|225107	COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription].	3.60128e-50
NC_014210.1\|WP_126625105.1\|5554444_5555293_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|379262	pfam13560, HTH_31, Helix-turn-helix domain. This domain is a helix-turn-helix domain that probably binds to DNA.	6.90026e-10
NC_014210.1\|WP_013155684.1\|5565051_5565777_+\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|379276	pfam13578, Methyltransf_24, Methyltransferase domain. This family appears to be a methyltransferase domain.	1.87457e-23
NC_014210.1\|WP_013155677.1\|5556876_5558487_-\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|223562	COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only].	2.84902e-114
NC_014210.1\|WP_013155669.1\|5552801_5553044_-\|BldC-family-transcriptional-regulator	gnl\|CDD\|133390	cd04762, HTH_MerR-trunc, Helix-Turn-Helix DNA binding domain of truncated MerR-like proteins. Proteins in this family mostly have a truncated helix-turn-helix (HTH) MerR-like domain. They lack a portion of the C-terminal region, called Wing 2 and the long dimerization helix that is typically present in MerR-like proteins. These truncated domains are found in response regulator receiver (REC) domain proteins (i.e., CheY), cytosine-C5 specific DNA methylases, IS607 transposase-like proteins, and RacA, a bacterial protein that anchors chromosomes to cell poles.	1.33348e-14
NC_014210.1\|WP_013155685.1\|5565921_5569578_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	4.88469e-161

>NC_014210.1|WP_013155677.1|5556876_5558487_-|ABC-F-family-ATP-binding-cassette-domain-containing-protein
MSSAFSVVCTGLSFAWPDGTPVLTGLDAAFGTGRTGLVGRNGSGKSTLLRLVAGRLTPASGTVAVDGDVGYLDQGLTLDTGRTVAELLGVDRARTALHAIEAGEATEANFAAVGEDWDVEERVLAQLERFGVALTGDAPLDRPVGTLSGGEAVLVALAGLALRRPAVTLLDEPTNNLDRRARERLHDAVASWQGVLVVVSHDRELLERVDQIAELREGRMRVWGGNYSAYTEQLAAEQEAARRMVRVAEADVRREKRQLADAQVKLARRVRYGKKMYDTKREPRVVMKQRKRDAQVAAGKHRVMQEAKLVGAREELGRAEDAVRDDDAIRVALPGTGVPAGHGVLELGTPVGGRLYLRGPERVALVGPNGSGKTTLLRAVVGRGRHPQAEVVHAADRIGYLPQRLDVLDDGLSVLDNVRAAAPSATPHRVRAGLARFLIRGDRVEQRAGDLSGGERFRVALARLLLADEPPRLLVLDEPTNSLDLDSQRQLAEALADYRGALLVASHDHAFLREVGVGRWWRTERGHAPVEVSGAD
>NC_014210.1|WP_013155676.1|5556209_5556773_+|DNA-3-methyladenine-glycosylase-I
MSDQRCAWARGSSELMVAYHDHEWGRPSRDDAHLFEMLVLEGAQAGLSWSTVLNKRENYRRALEGFDRERIAEYGQEDTDRLLQDTGIIRNRLKVASLPRNARAFGDVREEYGTFAAYLWGWVDGTPVVNRFTEPSEVPVSTPLSDRVSRDLKKRGFTFVGTTIVYSYLQAVGVVDDHLVACPAKPA
>NC_014210.1|WP_013155675.1|5555299_5555491_+|DUF397-domain-containing-protein
MTSVPTLLNFRKSSYSQPSGGNCVEVADTGTGAAVRDTQNRHLGHLEAPSAEWAAFLTSVRSR
>NC_014210.1|WP_126625105.1|5554444_5555293_+|helix-turn-helix-domain-containing-protein
MRGIIATRYSPTIRRRRLSADLRRIRQAARMTSEEVAKAAELSKSTYSNIESGLKQRPKLPEIRAILNACGLSPGREYEEILDLCRQSLERGWWNRYRDVLAARYVGFETEANAISTWEPVVLPGLLQVPGYMEVIAQAALLRPEDIHRIVDVRMTRQRILDDEDAPELWAIFDETALLRLEQHPMVRQEQVRHLLDMAERPNLTLQMTRASQLNAGSGGPFVILEFPESVDPTVVYLETNTDGIYLEEPDEVARYRNLMNHLRLAALRPGETIDHLRQMIE
>NC_014210.1|WP_013155673.1|5553836_5554088_-|hypothetical-protein
MERDLIPPYYRAWEQKRADKRPAPDHLGGDLLHVIAPAVPLPRPRPSDDLTDLAAVVRQWHTAQTAQTTQAIQAARTFEGVRA
>NC_014210.1|WP_013155672.1|5553684_5553840_-|hypothetical-protein
MNSLAFRSRRSRSNRVRPFLTVLPTAWVSVATGAFPIVLTAAHQVLREAKR
>NC_014210.1|WP_013155671.1|5553436_5553688_-|hypothetical-protein
MMSATTAVTVTDLTCDDVRLCREANGSGSLASLAVAACHVDLSPGWSAHGRAARVAALEKLARLAQQAARELSESGQRPGREP
>NC_014210.1|WP_013155670.1|5553164_5553440_-|hypothetical-protein
MTAVPEPRREPRTVFEVREVESREALHAWARAHGVRVRYLGSTWQHEEVYGAQQGTQVRVCRTPWEHHRLHPVVWRSPLEKPPVIPRQRTP
>NC_014210.1|WP_013155669.1|5552801_5553044_-|BldC-family-transcriptional-regulator
MPNTPHTPHAPRKPHASHADLPVYLLTVAEVGDMFRVNPRTVNRWVAQGRIPVVRTPGGHLRFDPAEVRRLLWIDQPPTT
>NC_014210.1|WP_013155668.1|5551454_5552654_-|daunorubicin-resistance-protein-DrrA-family-ABC-transporter-ATP-binding-protein
MNTTGGAITARGLGKRYGRSWALRGFDLDVPAGSVCGLLGPNGAGKTTAVRVLATLLRADEGTARVAGYDVASQGDAVRRSIGLVGQNAAVDEVLSGRQNLEMFGRLYHLGARRAAARADELLERFRLADTGRKPVSAYSGGMRRRLDLAASMILSPPVLFLDEPTVGLDPRGRNEVWNAVRALVAGDTTVLLTTQYLEEADQLADRISVVDSGRVVAEGTPEELKSRLGGDRLDVVLHEAAALDRAAALIGRVTGERPEVEADARRIGVGVRNRVAALTEVVRALEEEEIEVEDVALRRPTLDEVFLHLTGGHEDRGDRGDRDGHGDRRGREGVGEAGEAGNGDDGGGGRDVSDGGDRDAGGGDGHDVRGERGDRGDRGDHGERGEHEDSDDRVGESR
>NC_014210.1|WP_013155679.1|5559519_5560344_+|NAD(P)H-binding-protein
MTFLVAGATGNVGRHVVGQLLGAGHPVRALTRSPGRARLPEGAQVVGGDLTDPDGLAPHLEGVTGLHLITFGGDDYSPLTSAPRLVELAEKAGVRRVSVLCDFYPGPVEEALAASGLAWTLLQPVEFMANTLEWAGSVRAEGVVREARTAPSALVHEADIASVAVTALTGDGHGGRAYPLTGPEALTPAERVAVLSRGIGREVGLVRLTLEEEAERLRALGHDEEYVAFGLQLATDPPEVGTRVQDTVERVTGRPARTFAEWVGENADAFRPRS
>NC_014210.1|WP_013155680.1|5560624_5561404_+|TetR/AcrR-family-transcriptional-regulator
MPTQYTKSGDPARSLALLWRTQEPVSRRNKPDLSVDRIVAVASEMADNEGLAALSMRKVAERLGVGTMSLYTYVPGKGELVDLMLDAAYADMYADGERPEHWRERLSAVAYANWRLLLRHPWMLQTPRGRLLGPHLIAKYEYELSAVDGLGLSDVEMDSTVSLVNSYAEGAASQAAAVSETERATGMTDGQWWSTHGPLLAAFTRDSDYPLASRVGSTVGREHRTVYSSDHEFAFGLERVLDGVRVLVESRSARGAEGS
>NC_014210.1|WP_041553280.1|5561501_5562191_-|response-regulator-transcription-factor
MTRVLIIGDQDVVRLGLCTAFEATQDIKVVGTTGDLRVAVARARQLRPDVAVVDMAALGERGNEVVRELSELDDPRVRVLALAVPSDRDNLVSCLRAGACGYILTGSDMSVITDAVRSLREGHTVLDPAVVGTVVEEFVRYEAAVCVGADDPDSCWKEQFTDREKDVVALVATGASNAEIAGVLGLSETTIKSHVSSVLAKRGLRNRVQLVVWAFRSGLVPVRGRDAVL
>NC_014210.1|WP_013155682.1|5562565_5563774_-|cytochrome-P450
MADAPTPSACPVSLPTAREHALDPPPRFAELRERSPITRLALPDGTRGWLVTDYELACDVLVDQRFSARQDIRVPPPGQAPAPPAAPGFFVRMDAPEHTRYRRRLAGQFTRRRMLLLESRIGEIAEEHVERMLSAGAPADLVTDYALPVPSLVICELLGVPYGERERFQRDTAVAFDVGQPRERVSAALADLNAFLADLVRRKRREPGEDLLSGLLDAPDLTDEEVAAMAFLLLVAGHETTASMLALGAFALLTHPGPWRGALTATDPKPMTRLVDELLRYLTIMQFGAMRVAREDLEVRGERVRAGEAVVVSLAAANRDPRAFPGPDVLDPGRERPMHLAFGLGAHHCLGHQLARTELRLGYGTLFRRIPDLRLAVPPNSVRMRDSSAVYGVHSLPVAWGE
>NC_014210.1|WP_013155683.1|5563805_5564747_-|hypothetical-protein
MAATGGTGTTARTDASTASGVLDAALAWLTDHAEWFGPRWDDHFPPRDFAGATVMELLMLCRLLRRTDPAPPGAAGLERAAAELARDAVAATAPGGEGENPPYRLWTAALLADLGRPADGPLADARALAERRPPRPPGAGASPVLALELRHILDLAGLAAPADLPGTAPLYDACVAEHAGGTGEYDAYGVTHAVLYATDFGARPLPGDAARMGRVLDGLLRAYLDEDHLDLTAELLLCARIAGGVPSALERRAWDRLARAQRPDGSLPGPPFDAGVLAGRTGERATAYVFRTCYHTTLVTAMAAAHAGASARP
>NC_014210.1|WP_013155684.1|5565051_5565777_+|class-I-SAM-dependent-methyltransferase
MGDIDLALIGDLYRRYRDPLAKVRDAQREFLRRTRGRMTPQLDDLEAEITYLLLRETRPDTVMELGTFHGWSTTWILSALRDNGGGTLHSFDIVDNVVANVPSELSLGRWEFHKGDIRENMSQVPEGIGYLFVDAAHNGRFARWYLESLFPRVAPGTPVSVHDVFHGKRALPFTEGAVVLSWLRENGTDFFTPSRKKAPAPYTALLELREELGLGEPVRTSTDNPMIYFRMPEHRGARTGN
>NC_014210.1|WP_013155685.1|5565921_5569578_-|ABC-transporter-ATP-binding-protein
MPGSPPTEAPAARGRHWVLRLLSACRRHPGLAAGVAAAAVLGTGLTALAPLAAQIAVDDAVQGRTDRIGVLALALLGAAALQFAGAFARQFLSGKLALGVQHDLRTAVFDSVQRLDGGKQDTLRTGQVMSRAGTDLQLVQGLLATAPQALGGLVLIVFAFSAMLWLSPVLTVVAAAVVVSFVVVTARVSRRMPPATMAVQRRTAEIAQHVEETVTGVRVVKAFGQEERETRRLADLAARLFGERMRVARMQAAPSATLGVLPYLGQAAVLVVGAWLVARGEVSLGALVAFSGYMVTLTAPSASLSNLVMSAQLVRPAALRVFDLADSRPDVTDAPDAADVPEGPVGVELDGVRFGYTRDSTVLDGLSLSVRPGETLALVGPSGSGKSTVSLLLPRFYDTTGGAVRIGPPGGAVDVRSLRLRSLRAAVGVAFEEPFLFSGSVADNIAYGRPHATREQVRAAARAAGADGFVCALPDGYDTPVGERGLTLSGGQRQRVALARTLLGDPRVLVLDDATSAVDASTEAAMVATLADVTADRTVLLVAHRRSTLALADRIAVLDGGRVVDVGTEAELTRRCPLFARLCAGDGGGVEEPAPAPGGGGSPLWPEPVPEAADPDEAALPAADDRPAERLDRTPPEEPGTRFGVRRVLAPVRALLALAVLLVLADALATTALPVVLRWGLDRGVAPGDAGVVAAVGAAALALVAVNWWVLALQPRVVTRTGESALYALRLRVFRHLHRLGVDFHERERGGGTMTRMTTDVTALSTFVESGLTIVVVNGATVLGMVVAMLVLDPGLALVALAVLPVLLAATLYFRRCVSLAYHLSRERIGEVNADLQEQVAGARESQAAGAEDGASERFAALSDRYRRTRLTAQRHIALYFPFVTLLGDVSTAAVLGAGAYRVAEGTLSVGVLTAFLLYLGMFYAPFQQLSVVFDSYQQARVGVDRIGGLLRTPPTAAASRRAVPAPVRRGGGRVRLEGVGFAYPGAGGPALADVTLSADPGETVALVGETGAGKSTVVRLIARFHDPDRGAVLVDGTDVRDLDPAEHRRRLGVVPQEPHLFTGTVADNVRYGRPGAGDREVEEAVRAVGALDAVSALPRGLRHPVGERGRGLSTGQRQLVALARAQLVDPDVLLLDEPSAGLDPGTERAVLTAMERLSRGRTTFVVTHSLATAARADRIAVLDGGRVVETGTHAELSASGGAYARLWRSSGAGPVPV
>NC_014210.1|WP_013155686.1|5569577_5570735_-|lanthionine-synthetase-C-family-protein
MNDADTLDLARRFLDDMDAQVRENPTFPLLLDQAVARMEFARALGEDHRAEDAFHEAMGLLRSGGGTGPWLYRGAAQAGWTALRLARERGTEPSGLGAVDDAVLRWIADYPAEGEVDLPMGVLGLGAYALAHPDAGFRDKATSGVLDVVEERAERDGDGLFLRLGDSPARRADQSAGCRVLGAAHGTAGLVSYLASAAGTAAAPRARPLLDDSVRWLRAQRGDFSHAVFPHRVETRYTPARATWCSGDPGIALALTAAAGVTGDPRDADLARATASAVATRPERDCGITDGCVCHGAAGLVWFGRRAHDDHGLPEGLECVRRWTGWLAERRAEGPLTYFNPAGMIRDASFLEGDAGVALALLYAATGARPAWEQLVLARPVTPEV
>NC_014210.1|WP_013155687.1|5570731_5573695_-|lantibiotic-dehydratase
MSGPDFGLVRVPLLSVEESARMVAAGDVHDPVAAMAVDLAADPHLRTASASEERARATLLRYLARMGGRATPYGLFAGTAPLSVGDRRDLEADRRDQHRVRVRVDVRALEETVADALADADPDHVPLRLNPLAGVGPSAVRFAAPGDATAAVVSVRRTEAIDTALEVLGGAEMSAADLAEALSERLPGVEPDRLRAFVRGLRDRGLLQPSDGLIAPGDEPADRAVRLLDAVGDRDRAAAVRVLLADAAGERPFEPGLRDRLDTAWDRAADHAPALARTRYAERFDLHPELAMRAASLDRRTVADLRSAVRRLTALSSPGGGPGFDMASFRAAFAQRFEDAEVPLLSALDLESGVLRPARRGASELAARAGLRAGSRPAEPTVNPELLDLLGRWTADGGHLDGGSVDIAHLPESDTDGSRALLAVLLGDADPSSHDGPHSMLVGGVGRAPHALVARFGLHRPAVADRVREQVDRARGRHGAADPARNPLHAELVYHPGGRIGNVLVRPRVLDETIALTGAHAGTLHLDRLLLRLCPDGFRLRDARTGRPVLVELNTAHNVDFHGLDPVYAVLGHLATSGGAGWSWGPLARLPHLPRVTCGRVVVTPERWLLRPGDVAAVLSAPSPAAALRDRLPGLGGRTWVGTGEYDHVLPVDLREDASVRAALARAGERDTAFVEMPQAEAPAVRGPGGGHVAEVVVPTGPVLREPPGTGAGTAVLDRGHGRAWIYARLYCGHATADQVVARAHRLSSDLRAAGEADQWFFLRYQDGDGYHVRVRVRPAEPAARPGVLTAVDALGARLAAEGLVSRVVLDEYVPEVARYGGTEGLRAAEGLFTASSDRVAAALPELADESARLYRAVADVTHWCTELFAAFDEREEFLRACQGGLDVAPTREGNRLGKFARTHEAALRAHLEGVRSDEGVAKALGALAAALEPGTGTRDRWSVFGSALHLHLNRTFAFDAVRMEYLAHELARRHLRRLHALEGRKR
>NC_014210.1|WP_013155688.1|5573691_5574720_-|LLM-class-flavin-dependent-oxidoreductase
MHDDTAQDREETPLDAAPPLGLLEYLDLTEGRPVRDKRDTAFASALLAERLGYSRVWLPEHHASGVPSTNPLLLAAVLGSHTRRVRVGTAVTLSRIRDPHLTAEDVAAAAHFCPDRLDVGFGRGDVSGGAAEDLAHLRERGEDVGAVIDATVALLRGGAEWIDPVDTGFQLWSHGAGNRSAEIAARTGTHYCHALFFNTDVDACVSTLRAYRAAHPGGRTAVALALVANDDPATARADSLRQGVRVNCAGTADQCAEAVHRVLAITGADEAVVTELSSDPEDHLRAVEEVFAAVRRRAASPAGAAAPPVGTVPAGNAVPTGDTARSDGAVPSATAATGSGAR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NC_014210_14	14.1\|2013540\|32\|NC_014210\|PILER-CR,CRISPRCasFinder	2013540-2013571	32	NC_014210.1	157333-157364	0	1.0
NC_014210_22	22.4\|5217116\|20\|NC_014210\|CRT	5217116-5217135	20	NC_014210.1	5216873-5216892	0	1.0
NC_014210_22	22.1\|5216933\|21\|NC_014210\|CRT	5216933-5216953	21	NC_014210.1	3397181-3397201	2	0.905
NC_014210_22	22.2\|5216994\|21\|NC_014210\|CRT	5216994-5217014	21	NC_014210.1	3397181-3397201	2	0.905
NC_014210_22	22.3\|5217055\|21\|NC_014210\|CRT	5217055-5217075	21	NC_014210.1	3397181-3397201	2	0.905

1. spacer 14.1|2013540|32|NC_014210|PILER-CR,CRISPRCasFinder matches to position: 157333-157364, mismatch: 0, identity: 1.0

ggcagcaggtcctccagggaaccgccgccccg	CRISPR spacer
ggcagcaggtcctccagggaaccgccgccccg	Protospacer
********************************

2. spacer 22.4|5217116|20|NC_014210|CRT matches to position: 5216873-5216892, mismatch: 0, identity: 1.0

ctgctgatacccctctgacc	CRISPR spacer
ctgctgatacccctctgacc	Protospacer
********************

3. spacer 22.1|5216933|21|NC_014210|CRT matches to position: 3397181-3397201, mismatch: 2, identity: 0.905

tcacccggacccttcccgacc	CRISPR spacer
tcacccggacctctcccgacc	Protospacer
***********..********

4. spacer 22.2|5216994|21|NC_014210|CRT matches to position: 3397181-3397201, mismatch: 2, identity: 0.905

tcacccggacccttcccgacc	CRISPR spacer
tcacccggacctctcccgacc	Protospacer
***********..********

5. spacer 22.3|5217055|21|NC_014210|CRT matches to position: 3397181-3397201, mismatch: 2, identity: 0.905

tcacccggacccttcccgacc	CRISPR spacer
tcacccggacctctcccgacc	Protospacer
***********..********

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_014210_22	22.5\|5217176\|21\|NC_014210\|CRT	5217176-5217196	21	MN694508	Marine virus AFVG_250M817, complete genome	6119-6139	1	0.952
NC_014210_10	10.9\|1603262\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603262-1603293	32	CP054934	Nocardiopsis flavescens strain NA01583 plasmid unnamed1, complete sequence	39244-39275	2	0.938
NC_014210_22	22.1\|5216933\|21\|NC_014210\|CRT	5216933-5216953	21	NZ_CP020040	Streptomyces sp. 3211 isolate 3 plasmid p3211-1, complete sequence	263994-264014	2	0.905
NC_014210_22	22.1\|5216933\|21\|NC_014210\|CRT	5216933-5216953	21	NZ_CP020041	Streptomyces sp. 3211 isolate 3 plasmid p3211-2, complete sequence	220084-220104	2	0.905
NC_014210_22	22.2\|5216994\|21\|NC_014210\|CRT	5216994-5217014	21	NZ_CP020040	Streptomyces sp. 3211 isolate 3 plasmid p3211-1, complete sequence	263994-264014	2	0.905
NC_014210_22	22.2\|5216994\|21\|NC_014210\|CRT	5216994-5217014	21	NZ_CP020041	Streptomyces sp. 3211 isolate 3 plasmid p3211-2, complete sequence	220084-220104	2	0.905
NC_014210_22	22.3\|5217055\|21\|NC_014210\|CRT	5217055-5217075	21	NZ_CP020040	Streptomyces sp. 3211 isolate 3 plasmid p3211-1, complete sequence	263994-264014	2	0.905
NC_014210_22	22.3\|5217055\|21\|NC_014210\|CRT	5217055-5217075	21	NZ_CP020041	Streptomyces sp. 3211 isolate 3 plasmid p3211-2, complete sequence	220084-220104	2	0.905
NC_014210_7	7.9\|1581936\|32\|NC_014210\|CRISPRCasFinder,CRT	1581936-1581967	32	NZ_CP021083	Deinococcus ficus strain CC-FR2-10 plasmid pDFI2, complete sequence	139792-139823	4	0.875
NC_014210_8	8.4\|1587672\|33\|NC_014210\|PILER-CR	1587672-1587704	33	MK359349	Mycobacterium phage FoxtrotP1, complete genome	137679-137711	5	0.848
NC_014210_8	8.15\|1587673\|32\|NC_014210\|CRISPRCasFinder,CRT	1587673-1587704	32	MK359349	Mycobacterium phage FoxtrotP1, complete genome	137679-137710	5	0.844
NC_014210_12	12.4\|1645572\|31\|NC_014210\|CRT	1645572-1645602	31	NZ_CP024314	Rhizobium sp. NXC24 plasmid pRspNXC24c, complete sequence	1221746-1221776	5	0.839
NC_014210_14	14.21\|2014758\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014758-2014789	32	NZ_CP013265	Sphingobium baderi strain DE-13 plasmid pDE1, complete sequence	191162-191193	5	0.844
NC_014210_14	14.62\|2014026\|31\|NC_014210\|PILER-CR	2014026-2014056	31	MT684599	Gordonia Phage Sephiroth, complete genome	4624-4654	5	0.839
NC_014210_7	7.8\|1581877\|30\|NC_014210\|CRISPRCasFinder,CRT	1581877-1581906	30	NZ_CP017076	Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence	1281063-1281092	6	0.8
NC_014210_7	7.10\|1581997\|32\|NC_014210\|CRISPRCasFinder,CRT	1581997-1582028	32	NZ_CP050092	Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b6, complete sequence	246614-246645	6	0.812
NC_014210_8	8.3\|1587611\|33\|NC_014210\|PILER-CR	1587611-1587643	33	NZ_CP015231	Epibacterium mobile F1926 plasmid unnamed1, complete sequence	209741-209773	6	0.818
NC_014210_8	8.3\|1587611\|33\|NC_014210\|PILER-CR	1587611-1587643	33	NZ_CP015231	Epibacterium mobile F1926 plasmid unnamed1, complete sequence	930167-930199	6	0.818
NC_014210_8	8.14\|1587612\|32\|NC_014210\|CRISPRCasFinder,CRT	1587612-1587643	32	NZ_CP015231	Epibacterium mobile F1926 plasmid unnamed1, complete sequence	209741-209772	6	0.812
NC_014210_8	8.14\|1587612\|32\|NC_014210\|CRISPRCasFinder,CRT	1587612-1587643	32	NZ_CP015231	Epibacterium mobile F1926 plasmid unnamed1, complete sequence	930168-930199	6	0.812
NC_014210_9	9.3\|1595182\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595182-1595213	32	NZ_CP021032	Rhizobium sp. NXC14 plasmid pRspNXC14b, complete sequence	585910-585941	6	0.812
NC_014210_9	9.3\|1595182\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595182-1595213	32	NZ_CP053208	Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1B, complete sequence	377446-377477	6	0.812
NC_014210_9	9.4\|1595243\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595243-1595274	32	NZ_CP009803	Streptomyces sp. FR-008 plasmid pSSFR1, complete sequence	15135-15166	6	0.812
NC_014210_9	9.4\|1595243\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595243-1595274	32	NZ_CP016618	Microvirga ossetica strain V5/3m plasmid unnamed3, complete sequence	536243-536274	6	0.812
NC_014210_9	9.4\|1595243\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595243-1595274	32	NZ_CP016620	Microvirga ossetica strain V5/3m plasmid unnamed4, complete sequence	166608-166639	6	0.812
NC_014210_9	9.7\|1595426\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595426-1595457	32	NC_017805	Deinococcus gobiensis I-0 plasmid P1, complete sequence	377470-377501	6	0.812
NC_014210_9	9.8\|1595487\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595487-1595518	32	NZ_CP054616	Azospirillum oryzae strain KACC 14407 plasmid unnamed2, complete sequence	519192-519223	6	0.812
NC_014210_9	9.8\|1595487\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595487-1595518	32	LN997843	Streptomyces reticuli genome assembly TUE45, plasmid : II	324069-324100	6	0.812
NC_014210_10	10.4\|1602957\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1602957-1602988	32	NZ_CP034782	Pseudomonas sp. MPC6 plasmid pMPC6-328K, complete sequence	231948-231979	6	0.812
NC_014210_10	10.4\|1602957\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1602957-1602988	32	NZ_CP049701	Bradyrhizobium sp. 1S5 strain 323S2 plasmid pB323S2b, complete sequence	27432-27463	6	0.812
NC_014210_10	10.4\|1602957\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1602957-1602988	32	NZ_CP049702	Bradyrhizobium sp. 1S5 strain 323S2 plasmid pB323S2c, complete sequence	15766-15797	6	0.812
NC_014210_10	10.4\|1602957\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1602957-1602988	32	NZ_CP049702	Bradyrhizobium sp. 1S5 strain 323S2 plasmid pB323S2c, complete sequence	197842-197873	6	0.812
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	NZ_CP029357	Azospirillum sp. CFH 70021 plasmid unnamed2	37383-37414	6	0.812
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	NZ_CP022367	Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence	1191525-1191556	6	0.812
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	NC_009339	Mycolicibacterium gilvum PYR-GCK plasmid pMFLV01, complete sequence	8236-8267	6	0.812
NC_014210_12	12.4\|1645572\|31\|NC_014210\|CRT	1645572-1645602	31	NZ_CP019316	Tateyamaria omphalii strain DOK1-4 plasmid pDOK1-4-4, complete sequence	51820-51850	6	0.806
NC_014210_12	12.4\|1645572\|31\|NC_014210\|CRT	1645572-1645602	31	NZ_CP017943	Phyllobacterium zundukense strain Tri-48 plasmid unnamed2, complete sequence	88930-88960	6	0.806
NC_014210_12	12.4\|1645572\|31\|NC_014210\|CRT	1645572-1645602	31	NZ_CP025505	Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvC, complete sequence	133521-133551	6	0.806
NC_014210_12	12.4\|1645572\|31\|NC_014210\|CRT	1645572-1645602	31	NZ_LR594660	Variovorax sp. PBL-H6 plasmid 2	243970-244000	6	0.806
NC_014210_12	12.4\|1645572\|31\|NC_014210\|CRT	1645572-1645602	31	NZ_CP032324	Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence	556593-556623	6	0.806
NC_014210_12	12.4\|1645572\|31\|NC_014210\|CRT	1645572-1645602	31	NZ_LR594667	Variovorax sp. SRS16 plasmid 2	556403-556433	6	0.806
NC_014210_12	12.4\|1645572\|31\|NC_014210\|CRT	1645572-1645602	31	NZ_CP022366	Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence	215856-215886	6	0.806
NC_014210_12	12.4\|1645572\|31\|NC_014210\|CRT	1645572-1645602	31	NZ_CP015737	Shinella sp. HZN7 plasmid pShin-01, complete sequence	18895-18925	6	0.806
NC_014210_12	12.4\|1645572\|31\|NC_014210\|CRT	1645572-1645602	31	NZ_LR594672	Variovorax sp. PBL-E5 plasmid 2	556536-556566	6	0.806
NC_014210_12	12.4\|1645572\|31\|NC_014210\|CRT	1645572-1645602	31	NZ_CP032348	Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence	654176-654206	6	0.806
NC_014210_12	12.4\|1645572\|31\|NC_014210\|CRT	1645572-1645602	31	NZ_CP016083	Streptomyces sp. SAT1 plasmid unnamed3, complete sequence	499719-499749	6	0.806
NC_014210_13	13.2\|1662532\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1662532-1662563	32	NZ_CP015008	Aminobacter aminovorans strain KCTC 2477 plasmid pAA03, complete sequence	58170-58201	6	0.812
NC_014210_13	13.2\|1662532\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1662532-1662563	32	NZ_CP029831	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed7, complete sequence	225101-225132	6	0.812
NC_014210_14	14.8\|2013965\|32\|NC_014210\|CRISPRCasFinder	2013965-2013996	32	NZ_CP023000	Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-B, complete sequence	563364-563395	6	0.812
NC_014210_14	14.17\|2014514\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014514-2014545	32	NZ_CP016820	Rhodococcus sp. p52 plasmid pDF02, complete sequence	119222-119253	6	0.812
NC_014210_14	14.17\|2014514\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014514-2014545	32	NZ_CP016820	Rhodococcus sp. p52 plasmid pDF02, complete sequence	232893-232924	6	0.812
NC_014210_14	14.18\|2014575\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014575-2014606	32	NZ_CP050105	Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b6, complete sequence	270622-270653	6	0.812
NC_014210_14	14.18\|2014575\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014575-2014606	32	NZ_CP025508	Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvB, complete sequence	179439-179470	6	0.812
NC_014210_14	14.18\|2014575\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014575-2014606	32	NZ_CP050110	Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b4, complete sequence	270624-270655	6	0.812
NC_014210_14	14.18\|2014575\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014575-2014606	32	NZ_CP030764	Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed4, complete sequence	147868-147899	6	0.812
NC_014210_14	14.18\|2014575\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014575-2014606	32	NZ_CP022667	Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR2, complete sequence	458196-458227	6	0.812
NC_014210_14	14.18\|2014575\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014575-2014606	32	NZ_CP050087	Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b5, complete sequence	179456-179487	6	0.812
NC_014210_14	14.24\|2014941\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014941-2014972	32	NC_022044	Paracoccus aminophilus JCM 7686 plasmid pAMI6, complete sequence	79563-79594	6	0.812
NC_014210_14	14.26\|2015063\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2015063-2015094	32	NZ_CP017242	Rhizobium etli 8C-3 plasmid pRsp8C3a, complete sequence	173140-173171	6	0.812
NC_014210_14	14.27\|2015124\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2015124-2015155	32	MK814752	Gordonia phage Lutum, complete genome	49359-49390	6	0.812
NC_014210_14	14.27\|2015124\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2015124-2015155	32	MH779504	Gordonia phage Getalong, complete genome	51379-51410	6	0.812
NC_014210_14	14.27\|2015124\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2015124-2015155	32	NC_048141	Gordonia phage Kenna, complete genome	48197-48228	6	0.812
NC_014210_14	14.27\|2015124\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2015124-2015155	32	NC_031267	Gordonia phage Lucky10, complete genome	40501-40532	6	0.812
NC_014210_14	14.27\|2015124\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2015124-2015155	32	NC_047891	Gordonia phage BENtherdunthat, complete genome	48924-48955	6	0.812
NC_014210_14	14.29\|2015246\|32\|NC_014210\|CRISPRCasFinder	2015246-2015277	32	NZ_LT900339	Gluconobacter oxydans 621H isolate WT-DSMZ plasmid 2	43107-43138	6	0.812
NC_014210_14	14.29\|2015246\|32\|NC_014210\|CRISPRCasFinder	2015246-2015277	32	NC_006672	Gluconobacter oxydans 621H plasmid pGOX1, complete sequence	43106-43137	6	0.812
NC_014210_14	14.61\|2013965\|31\|NC_014210\|PILER-CR	2013965-2013995	31	NZ_CP023000	Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-B, complete sequence	563364-563394	6	0.806
NC_014210_19	19.1\|3414160\|27\|NC_014210\|CRISPRCasFinder	3414160-3414186	27	NZ_CP022366	Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence	262499-262525	6	0.778
NC_014210_19	19.1\|3414160\|27\|NC_014210\|CRISPRCasFinder	3414160-3414186	27	NZ_CP032348	Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence	16047-16073	6	0.778
NC_014210_23	23.2\|5555650\|32\|NC_014210\|CRISPRCasFinder	5555650-5555681	32	NZ_CP022417	Sulfitobacter pseudonitzschiae strain SMR1 plasmid pSMR1-2, complete sequence	23798-23829	6	0.812
NC_014210_23	23.3\|5555711\|32\|NC_014210\|CRISPRCasFinder	5555711-5555742	32	NZ_CP045390	Roseivivax sp. THAF30 plasmid pTHAF30_a, complete sequence	51680-51711	6	0.812
NC_014210_23	23.3\|5555711\|32\|NC_014210\|CRISPRCasFinder	5555711-5555742	32	NZ_CP045362	Roseivivax sp. THAF40 plasmid pTHAF40_b, complete sequence	51684-51715	6	0.812
NC_014210_23	23.3\|5555711\|32\|NC_014210\|CRISPRCasFinder	5555711-5555742	32	NZ_CP040820	Paraoceanicella profunda strain D4M1 plasmid pD4M1B, complete sequence	164338-164369	6	0.812
NC_014210_23	23.3\|5555711\|32\|NC_014210\|CRISPRCasFinder	5555711-5555742	32	NC_013855	Azospirillum sp. B510 plasmid pAB510a, complete sequence	611352-611383	6	0.812
NC_014210_23	23.4\|5555772\|32\|NC_014210\|CRISPRCasFinder	5555772-5555803	32	MH744420	Streptomyces phage Kromp, complete genome	51872-51903	6	0.812
NC_014210_7	7.9\|1581936\|32\|NC_014210\|CRISPRCasFinder,CRT	1581936-1581967	32	MN369761	Mycobacterium phage Malthus, complete genome	34552-34583	7	0.781
NC_014210_7	7.9\|1581936\|32\|NC_014210\|CRISPRCasFinder,CRT	1581936-1581967	32	MK224497	Mycobacterium phage Henu3, complete genome	23449-23480	7	0.781
NC_014210_7	7.9\|1581936\|32\|NC_014210\|CRISPRCasFinder,CRT	1581936-1581967	32	KJ944841	Mycobacterium phage Cheetobro, complete genome	34637-34668	7	0.781
NC_014210_7	7.9\|1581936\|32\|NC_014210\|CRISPRCasFinder,CRT	1581936-1581967	32	MN945904	Mycobacterium phage Eponine, complete genome	35393-35424	7	0.781
NC_014210_7	7.9\|1581936\|32\|NC_014210\|CRISPRCasFinder,CRT	1581936-1581967	32	KY087992	Mycobacterium phage Mitti, complete genome	34728-34759	7	0.781
NC_014210_7	7.9\|1581936\|32\|NC_014210\|CRISPRCasFinder,CRT	1581936-1581967	32	MF140402	Mycobacterium phage Chancellor, complete genome	34640-34671	7	0.781
NC_014210_7	7.9\|1581936\|32\|NC_014210\|CRISPRCasFinder,CRT	1581936-1581967	32	MK524485	Mycobacterium phage MissDaisy, complete genome	34037-34068	7	0.781
NC_014210_7	7.9\|1581936\|32\|NC_014210\|CRISPRCasFinder,CRT	1581936-1581967	32	KT361920	Mycobacterium phage Slarp, complete genome	34640-34671	7	0.781
NC_014210_7	7.9\|1581936\|32\|NC_014210\|CRISPRCasFinder,CRT	1581936-1581967	32	MH926058	Mycobacterium phage Reptar3000, complete genome	33752-33783	7	0.781
NC_014210_7	7.9\|1581936\|32\|NC_014210\|CRISPRCasFinder,CRT	1581936-1581967	32	KX621007	Mycobacterium phage Taquito, complete genome	35027-35058	7	0.781
NC_014210_7	7.9\|1581936\|32\|NC_014210\|CRISPRCasFinder,CRT	1581936-1581967	32	MH051258	Mycobacterium phage SamScheppers, complete genome	35031-35062	7	0.781
NC_014210_7	7.9\|1581936\|32\|NC_014210\|CRISPRCasFinder,CRT	1581936-1581967	32	MK524488	Mycobacterium phage Patt, complete genome	33761-33792	7	0.781
NC_014210_7	7.9\|1581936\|32\|NC_014210\|CRISPRCasFinder,CRT	1581936-1581967	32	MF140435	Mycobacterium phage Wintermute, complete genome	34789-34820	7	0.781
NC_014210_7	7.9\|1581936\|32\|NC_014210\|CRISPRCasFinder,CRT	1581936-1581967	32	NC_013857	Azospirillum sp. B510 plasmid pAB510c, complete sequence	267411-267442	7	0.781
NC_014210_7	7.9\|1581936\|32\|NC_014210\|CRISPRCasFinder,CRT	1581936-1581967	32	NZ_CP054621	Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence	1001524-1001555	7	0.781
NC_014210_8	8.5\|1587733\|33\|NC_014210\|PILER-CR	1587733-1587765	33	NZ_CP044989	Deinococcus sp. AJ005 plasmid p380k, complete sequence	276748-276780	7	0.788
NC_014210_8	8.7\|1587855\|33\|NC_014210\|PILER-CR	1587855-1587887	33	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	674569-674601	7	0.788
NC_014210_8	8.14\|1587612\|32\|NC_014210\|CRISPRCasFinder,CRT	1587612-1587643	32	NZ_CP032325	Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence	312404-312435	7	0.781
NC_014210_8	8.14\|1587612\|32\|NC_014210\|CRISPRCasFinder,CRT	1587612-1587643	32	NZ_CP046906	Streptomyces sp. QHH-9511 plasmid unnamed, complete sequence	25482-25513	7	0.781
NC_014210_8	8.14\|1587612\|32\|NC_014210\|CRISPRCasFinder,CRT	1587612-1587643	32	NZ_CP007794	Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence	1782092-1782123	7	0.781
NC_014210_8	8.14\|1587612\|32\|NC_014210\|CRISPRCasFinder,CRT	1587612-1587643	32	NZ_CP050104	Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b2, complete sequence	442368-442399	7	0.781
NC_014210_8	8.14\|1587612\|32\|NC_014210\|CRISPRCasFinder,CRT	1587612-1587643	32	NZ_CP018229	Rhizobium leguminosarum strain Vaf-108 plasmid unnamed1, complete sequence	787611-787642	7	0.781
NC_014210_8	8.14\|1587612\|32\|NC_014210\|CRISPRCasFinder,CRT	1587612-1587643	32	NZ_CP025507	Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvA, complete sequence	143027-143058	7	0.781
NC_014210_8	8.14\|1587612\|32\|NC_014210\|CRISPRCasFinder,CRT	1587612-1587643	32	NZ_CP016287	Rhizobium leguminosarum strain Vaf10 plasmid unnamed1, complete sequence	115847-115878	7	0.781
NC_014210_8	8.14\|1587612\|32\|NC_014210\|CRISPRCasFinder,CRT	1587612-1587643	32	NZ_CP022191	Yangia pacifica strain YSBP01 plasmid unnamed1, complete sequence	361118-361149	7	0.781
NC_014210_8	8.14\|1587612\|32\|NC_014210\|CRISPRCasFinder,CRT	1587612-1587643	32	NZ_CP050109	Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b2, complete sequence	442368-442399	7	0.781
NC_014210_8	8.14\|1587612\|32\|NC_014210\|CRISPRCasFinder,CRT	1587612-1587643	32	NZ_CP022666	Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR1, complete sequence	880800-880831	7	0.781
NC_014210_8	8.14\|1587612\|32\|NC_014210\|CRISPRCasFinder,CRT	1587612-1587643	32	NZ_CP022565	Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK01, complete sequence	505666-505697	7	0.781
NC_014210_8	8.14\|1587612\|32\|NC_014210\|CRISPRCasFinder,CRT	1587612-1587643	32	NZ_CP050086	Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b7, complete sequence	477936-477967	7	0.781
NC_014210_8	8.14\|1587612\|32\|NC_014210\|CRISPRCasFinder,CRT	1587612-1587643	32	MN908687	Gordonia phage Skog, complete genome	37967-37998	7	0.781
NC_014210_8	8.16\|1587734\|32\|NC_014210\|CRISPRCasFinder,CRT	1587734-1587765	32	NZ_CP044989	Deinococcus sp. AJ005 plasmid p380k, complete sequence	276748-276779	7	0.781
NC_014210_8	8.18\|1587856\|32\|NC_014210\|CRISPRCasFinder,CRT	1587856-1587887	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	674569-674600	7	0.781
NC_014210_8	8.18\|1587856\|32\|NC_014210\|CRISPRCasFinder,CRT	1587856-1587887	32	NZ_LR134460	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 18, complete sequence	239151-239182	7	0.781
NC_014210_8	8.20\|1587978\|32\|NC_014210\|CRISPRCasFinder,CRT	1587978-1588009	32	NZ_CP022567	Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK03, complete sequence	102452-102483	7	0.781
NC_014210_8	8.22\|1588100\|32\|NC_014210\|CRISPRCasFinder,CRT	1588100-1588131	32	NC_011892	Methylobacterium nodulans ORS 2060 plasmid pMNOD01, complete sequence	71197-71228	7	0.781
NC_014210_8	8.22\|1588100\|32\|NC_014210\|CRISPRCasFinder,CRT	1588100-1588131	32	MF417927	Uncultured Caudovirales phage clone 9F_2, partial genome	4018-4049	7	0.781
NC_014210_9	9.3\|1595182\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595182-1595213	32	NZ_CP050093	Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b5, complete sequence	276792-276823	7	0.781
NC_014210_9	9.3\|1595182\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595182-1595213	32	NZ_CP050099	Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b5, complete sequence	224464-224495	7	0.781
NC_014210_9	9.3\|1595182\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595182-1595213	32	NZ_CP050105	Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b6, complete sequence	438719-438750	7	0.781
NC_014210_9	9.3\|1595182\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595182-1595213	32	NZ_CP053441	Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eE, complete sequence	232688-232719	7	0.781
NC_014210_9	9.3\|1595182\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595182-1595213	32	NZ_CP025508	Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvB, complete sequence	343810-343841	7	0.781
NC_014210_9	9.3\|1595182\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595182-1595213	32	NZ_CP016289	Rhizobium leguminosarum strain Vaf10 plasmid unnamed2, complete sequence	38335-38366	7	0.781
NC_014210_9	9.3\|1595182\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595182-1595213	32	NZ_CP050110	Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b4, complete sequence	438721-438752	7	0.781
NC_014210_9	9.3\|1595182\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595182-1595213	32	NZ_CP048282	Rhizobium leguminosarum bv. viciae 248 plasmid pRle248d, complete sequence	289273-289304	7	0.781
NC_014210_9	9.3\|1595182\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595182-1595213	32	NZ_CP054023	Rhizobium sp. JKLM12A2 plasmid pPR12A202, complete sequence	35934-35965	7	0.781
NC_014210_9	9.3\|1595182\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595182-1595213	32	NZ_CP022667	Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR2, complete sequence	293836-293867	7	0.781
NC_014210_9	9.3\|1595182\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595182-1595213	32	NZ_CP050087	Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b5, complete sequence	343808-343839	7	0.781
NC_014210_9	9.7\|1595426\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595426-1595457	32	NZ_CP032327	Azospirillum brasilense strain MTCC4035 plasmid p6, complete sequence	83156-83187	7	0.781
NC_014210_9	9.8\|1595487\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595487-1595518	32	MK524490	Mycobacterium phage Donny, complete genome	55176-55207	7	0.781
NC_014210_9	9.8\|1595487\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595487-1595518	32	NC_022063	Mycobacterium phage Phelemich, complete genome	55248-55279	7	0.781
NC_014210_9	9.8\|1595487\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595487-1595518	32	JN699007	Mycobacterium phage Acadian, complete genome	55130-55161	7	0.781
NC_014210_9	9.8\|1595487\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595487-1595518	32	KF024727	Mycobacterium phage Reprobate, complete genome	55253-55284	7	0.781
NC_014210_9	9.8\|1595487\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595487-1595518	32	MT889381	Mycobacterium phage Suigeneris, complete genome	55328-55359	7	0.781
NC_014210_9	9.8\|1595487\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595487-1595518	32	KP966108	Burkholderia phage vB_BceM_AP3, complete genome	22579-22610	7	0.781
NC_014210_9	9.10\|1595610\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595610-1595641	32	NZ_CP013104	Paraburkholderia caribensis strain MWAP64 plasmid 1, complete sequence	1768872-1768903	7	0.781
NC_014210_9	9.10\|1595610\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595610-1595641	32	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	46271-46302	7	0.781
NC_014210_10	10.2\|1602835\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1602835-1602866	32	NZ_CP006368	Aureimonas sp. AU20 plasmid pAU20a, complete sequence	273202-273233	7	0.781
NC_014210_10	10.2\|1602835\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1602835-1602866	32	NZ_CP054621	Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence	701867-701898	7	0.781
NC_014210_10	10.4\|1602957\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1602957-1602988	32	NC_012586	Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence	2323119-2323150	7	0.781
NC_014210_10	10.4\|1602957\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1602957-1602988	32	NZ_CP020331	Martelella mediterranea DSM 17316 strain MACL11 plasmid pMM593, complete sequence	216944-216975	7	0.781
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	NZ_CP029830	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed1, complete sequence	306100-306131	7	0.781
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	1689580-1689611	7	0.781
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	123681-123712	7	0.781
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	NZ_AP014705	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence	73649-73680	7	0.781
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	NC_013855	Azospirillum sp. B510 plasmid pAB510a, complete sequence	1099102-1099133	7	0.781
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	NZ_CP032323	Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence	436017-436048	7	0.781
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	CP021131	Meiothermus taiwanensis strain WR-220 plasmid pMtWR-220, complete sequence	195066-195097	7	0.781
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	LN997843	Streptomyces reticuli genome assembly TUE45, plasmid : II	233179-233210	7	0.781
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	MN284895	Mycobacterium phage Marshawn, complete genome	30195-30226	7	0.781
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	MT310859	Mycobacterium phage MarkPhew, complete genome	29782-29813	7	0.781
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	HM486077	Tsukamurella phage TPA2, complete sequence	10147-10178	7	0.781
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	NC_015210	Tsukamurella phage TPA2, complete genome	10147-10178	7	0.781
NC_014210_10	10.6\|1603079\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603079-1603110	32	NC_015579	Novosphingobium sp. PP1Y plasmid Lpl, complete sequence	71305-71336	7	0.781
NC_014210_10	10.6\|1603079\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603079-1603110	32	NC_012811	Methylorubrum extorquens AM1 megaplasmid, complete sequence	910487-910518	7	0.781
NC_014210_10	10.6\|1603079\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603079-1603110	32	NZ_CP024895	Amycolatopsis sp. AA4 plasmid unnamed1, complete sequence	67441-67472	7	0.781
NC_014210_10	10.8\|1603201\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603201-1603232	32	NZ_CP021355	Rhodococcus sp. S2-17 plasmid pRB98, complete sequence	821730-821761	7	0.781
NC_014210_10	10.8\|1603201\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603201-1603232	32	NZ_CP016452	Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence	680222-680253	7	0.781
NC_014210_11	11.1\|1638373\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1638373-1638404	32	NZ_CP017077	Novosphingobium resinovorum strain SA1 plasmid pSA2, complete sequence	106143-106174	7	0.781
NC_014210_11	11.1\|1638373\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1638373-1638404	32	NZ_CP017078	Novosphingobium resinovorum strain SA1 plasmid pSA3, complete sequence	45719-45750	7	0.781
NC_014210_11	11.1\|1638373\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1638373-1638404	32	NZ_CP049157	Caballeronia sp. SBC1 plasmid pSBC1_1, complete sequence	111451-111482	7	0.781
NC_014210_11	11.1\|1638373\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1638373-1638404	32	NZ_CP049317	Caballeronia sp. SBC2 plasmid pSBC2-1, complete sequence	1531193-1531224	7	0.781
NC_014210_11	11.5\|1638616\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1638616-1638647	32	NZ_CP034351	Streptomyces sp. W1SF4 plasmid p1, complete sequence	251736-251767	7	0.781
NC_014210_11	11.5\|1638616\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1638616-1638647	32	NZ_CP050953	Rhodococcus sp. DMU1 plasmid unnamed	444233-444264	7	0.781
NC_014210_12	12.1\|1645389\|31\|NC_014210\|PILER-CR,CRT	1645389-1645419	31	NZ_CP054618	Azospirillum oryzae strain KACC 14407 plasmid unnamed4, complete sequence	244151-244181	7	0.774
NC_014210_12	12.2\|1645450\|31\|NC_014210\|PILER-CR,CRT	1645450-1645480	31	NZ_CP054618	Azospirillum oryzae strain KACC 14407 plasmid unnamed4, complete sequence	244151-244181	7	0.774
NC_014210_12	12.4\|1645572\|31\|NC_014210\|CRT	1645572-1645602	31	NZ_CP032324	Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence	528706-528736	7	0.774
NC_014210_12	12.4\|1645572\|31\|NC_014210\|CRT	1645572-1645602	31	NZ_CP035092	Paracoccus denitrificans strain ATCC 19367 plasmid unnamed1, complete sequence	41646-41676	7	0.774
NC_014210_12	12.4\|1645572\|31\|NC_014210\|CRT	1645572-1645602	31	NZ_CP022366	Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence	240413-240443	7	0.774
NC_014210_12	12.4\|1645572\|31\|NC_014210\|CRT	1645572-1645602	31	NC_008688	Paracoccus denitrificans PD1222 plasmid 1, complete sequence	288993-289023	7	0.774
NC_014210_12	12.4\|1645572\|31\|NC_014210\|CRT	1645572-1645602	31	NC_017958	Tistrella mobilis KA081020-065 plasmid pTM3, complete sequence	918327-918357	7	0.774
NC_014210_12	12.4\|1645572\|31\|NC_014210\|CRT	1645572-1645602	31	NZ_CP032348	Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence	682100-682130	7	0.774
NC_014210_12	12.4\|1645572\|31\|NC_014210\|CRT	1645572-1645602	31	NZ_CP018236	Rhizobium leguminosarum strain Vaf-108 plasmid unnamed8	42067-42097	7	0.774
NC_014210_12	12.4\|1645572\|31\|NC_014210\|CRT	1645572-1645602	31	NZ_CP018236	Rhizobium leguminosarum strain Vaf-108 plasmid unnamed8	63310-63340	7	0.774
NC_014210_12	12.4\|1645572\|31\|NC_014210\|CRT	1645572-1645602	31	NZ_AP022623	Mycobacteroides abscessus strain JCM 30620 plasmid pJCM30620_2	28910-28940	7	0.774
NC_014210_12	12.4\|1645572\|31\|NC_014210\|CRT	1645572-1645602	31	NZ_CP029832	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence	99484-99514	7	0.774
NC_014210_12	12.4\|1645572\|31\|NC_014210\|CRT	1645572-1645602	31	NC_021278	Mycobacteroides abscessus subsp. bolletii 50594 plasmid 1, complete sequence	169855-169885	7	0.774
NC_014210_12	12.4\|1645572\|31\|NC_014210\|CRT	1645572-1645602	31	NZ_CP026518	Deinococcus sp. NW-56 plasmid unnamed2, complete sequence	238027-238057	7	0.774
NC_014210_13	13.2\|1662532\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1662532-1662563	32	MN694449	Marine virus AFVG_250M57, complete genome	2742-2773	7	0.781
NC_014210_13	13.5\|1662715\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1662715-1662746	32	NZ_CP011665	Streptomyces sp. Mg1 plasmid pSMg1-1, complete sequence	272240-272271	7	0.781
NC_014210_13	13.5\|1662715\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1662715-1662746	32	NZ_CP033582	Streptomyces sp. ADI95-16 plasmid pADI95-16a, complete sequence	414526-414557	7	0.781
NC_014210_14	14.1\|2013540\|32\|NC_014210\|PILER-CR,CRISPRCasFinder	2013540-2013571	32	NC_047905	Streptomyces phage Attoomi, complete genome	14379-14410	7	0.781
NC_014210_14	14.6\|2013843\|32\|NC_014210\|CRISPRCasFinder	2013843-2013874	32	AP018698	Arthrobacter sp. MN05-02 plasmid plasmid1 DNA, complete genome	124626-124657	7	0.781
NC_014210_14	14.7\|2013904\|32\|NC_014210\|CRISPRCasFinder	2013904-2013935	32	AP018698	Arthrobacter sp. MN05-02 plasmid plasmid1 DNA, complete genome	124626-124657	7	0.781
NC_014210_14	14.18\|2014575\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014575-2014606	32	NZ_CP006993	Methylobacterium sp. AMS5 plasmid pAMS5a, complete sequence	114040-114071	7	0.781
NC_014210_14	14.18\|2014575\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014575-2014606	32	MH727543	Mycobacterium phage CharlieB, complete genome	314-345	7	0.781
NC_014210_14	14.23\|2014880\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014880-2014911	32	NZ_CP009405	Mycobacterium avium subsp. hominissuis strain OCU464 plasmid p78K, complete sequence	65145-65176	7	0.781
NC_014210_14	14.25\|2015002\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2015002-2015033	32	NZ_LR594668	Variovorax sp. SRS16 plasmid 3	60654-60685	7	0.781
NC_014210_14	14.29\|2015246\|32\|NC_014210\|CRISPRCasFinder	2015246-2015277	32	NZ_CP015007	Aminobacter aminovorans strain KCTC 2477 plasmid pAA02, complete sequence	222602-222633	7	0.781
NC_014210_14	14.29\|2015246\|32\|NC_014210\|CRISPRCasFinder	2015246-2015277	32	NZ_CP016455	Sphingobium sp. RAC03 plasmid pBSY17_3, complete sequence	27616-27647	7	0.781
NC_014210_14	14.50\|2014753\|37\|NC_014210\|CRT	2014753-2014789	37	NZ_CP013265	Sphingobium baderi strain DE-13 plasmid pDE1, complete sequence	191157-191193	7	0.811
NC_014210_14	14.59\|2013843\|31\|NC_014210\|PILER-CR	2013843-2013873	31	AP018698	Arthrobacter sp. MN05-02 plasmid plasmid1 DNA, complete genome	124627-124657	7	0.774
NC_014210_14	14.60\|2013904\|31\|NC_014210\|PILER-CR	2013904-2013934	31	AP018698	Arthrobacter sp. MN05-02 plasmid plasmid1 DNA, complete genome	124627-124657	7	0.774
NC_014210_14	14.61\|2013965\|31\|NC_014210\|PILER-CR	2013965-2013995	31	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	848488-848518	7	0.774
NC_014210_14	14.62\|2014026\|31\|NC_014210\|PILER-CR	2014026-2014056	31	NC_017958	Tistrella mobilis KA081020-065 plasmid pTM3, complete sequence	986917-986947	7	0.774
NC_014210_23	23.2\|5555650\|32\|NC_014210\|CRISPRCasFinder	5555650-5555681	32	NC_012725	Burkholderia glumae BGR1 plasmid bglu_4p, complete sequence	41542-41573	7	0.781
NC_014210_23	23.2\|5555650\|32\|NC_014210\|CRISPRCasFinder	5555650-5555681	32	NC_012720	Burkholderia glumae BGR1 plasmid bglu_3p, complete sequence	36968-36999	7	0.781
NC_014210_23	23.2\|5555650\|32\|NC_014210\|CRISPRCasFinder	5555650-5555681	32	NZ_CP035902	Burkholderia glumae strain 257sh-1 plasmid plas1, complete sequence	84851-84882	7	0.781
NC_014210_23	23.3\|5555711\|32\|NC_014210\|CRISPRCasFinder	5555711-5555742	32	NZ_CP035511	Haematobacter massiliensis strain OT1 plasmid pOT1-1, complete sequence	116-147	7	0.781
NC_014210_23	23.3\|5555711\|32\|NC_014210\|CRISPRCasFinder	5555711-5555742	32	NZ_CP054621	Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence	386438-386469	7	0.781
NC_014210_23	23.3\|5555711\|32\|NC_014210\|CRISPRCasFinder	5555711-5555742	32	CP011998	Ralstonia solanacearum strain YC45 plasmid, complete sequence	1528110-1528141	7	0.781
NC_014210_23	23.3\|5555711\|32\|NC_014210\|CRISPRCasFinder	5555711-5555742	32	NZ_CP032346	Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence	724992-725023	7	0.781
NC_014210_23	23.4\|5555772\|32\|NC_014210\|CRISPRCasFinder	5555772-5555803	32	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	2683141-2683172	7	0.781
NC_014210_23	23.4\|5555772\|32\|NC_014210\|CRISPRCasFinder	5555772-5555803	32	NZ_CP022747	Sphingobium hydrophobicum strain C1 plasmid p1, complete sequence	186614-186645	7	0.781
NC_014210_7	7.7\|1581816\|32\|NC_014210\|CRISPRCasFinder,CRT	1581816-1581847	32	NZ_LR134463	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 21, complete sequence	10447-10478	8	0.75
NC_014210_7	7.9\|1581936\|32\|NC_014210\|CRISPRCasFinder,CRT	1581936-1581967	32	NZ_CP032322	Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence	1030778-1030809	8	0.75
NC_014210_7	7.9\|1581936\|32\|NC_014210\|CRISPRCasFinder,CRT	1581936-1581967	32	NZ_CP007794	Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence	1848460-1848491	8	0.75
NC_014210_7	7.9\|1581936\|32\|NC_014210\|CRISPRCasFinder,CRT	1581936-1581967	32	NZ_CP032340	Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence	773123-773154	8	0.75
NC_014210_7	7.9\|1581936\|32\|NC_014210\|CRISPRCasFinder,CRT	1581936-1581967	32	NZ_CP032346	Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence	1601725-1601756	8	0.75
NC_014210_7	7.9\|1581936\|32\|NC_014210\|CRISPRCasFinder,CRT	1581936-1581967	32	NZ_CP012915	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence	1359260-1359291	8	0.75
NC_014210_7	7.9\|1581936\|32\|NC_014210\|CRISPRCasFinder,CRT	1581936-1581967	32	NC_027365	Mycobacterium virus Fionnbarth, complete genome	34790-34821	8	0.75
NC_014210_7	7.10\|1581997\|32\|NC_014210\|CRISPRCasFinder,CRT	1581997-1582028	32	NZ_CP016619	Microvirga ossetica strain V5/3m plasmid unnamed2, complete sequence	811139-811170	8	0.75
NC_014210_7	7.10\|1581997\|32\|NC_014210\|CRISPRCasFinder,CRT	1581997-1582028	32	NZ_CP016620	Microvirga ossetica strain V5/3m plasmid unnamed4, complete sequence	168427-168458	8	0.75
NC_014210_7	7.10\|1581997\|32\|NC_014210\|CRISPRCasFinder,CRT	1581997-1582028	32	NZ_CP024583	Roseomonas sp. FDAARGOS_362 plasmid unnamed2, complete sequence	229982-230013	8	0.75
NC_014210_7	7.10\|1581997\|32\|NC_014210\|CRISPRCasFinder,CRT	1581997-1582028	32	MN103401	Bordetella phage vB_BbrS_PHB09, complete genome	10584-10615	8	0.75
NC_014210_7	7.10\|1581997\|32\|NC_014210\|CRISPRCasFinder,CRT	1581997-1582028	32	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	968963-968994	8	0.75
NC_014210_7	7.12\|1582119\|32\|NC_014210\|CRISPRCasFinder,CRT	1582119-1582150	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	727937-727968	8	0.75
NC_014210_7	7.12\|1582119\|32\|NC_014210\|CRISPRCasFinder,CRT	1582119-1582150	32	NZ_CP022369	Azospirillum sp. TSH58 plasmid TSH58_p05, complete sequence	370356-370387	8	0.75
NC_014210_8	8.3\|1587611\|33\|NC_014210\|PILER-CR	1587611-1587643	33	NZ_CP032325	Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence	312403-312435	8	0.758
NC_014210_8	8.3\|1587611\|33\|NC_014210\|PILER-CR	1587611-1587643	33	NZ_CP046906	Streptomyces sp. QHH-9511 plasmid unnamed, complete sequence	25482-25514	8	0.758
NC_014210_8	8.3\|1587611\|33\|NC_014210\|PILER-CR	1587611-1587643	33	NZ_CP023408	Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence	163120-163152	8	0.758
NC_014210_8	8.3\|1587611\|33\|NC_014210\|PILER-CR	1587611-1587643	33	NZ_CP007794	Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence	1782091-1782123	8	0.758
NC_014210_8	8.7\|1587855\|33\|NC_014210\|PILER-CR	1587855-1587887	33	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	5568721-5568753	8	0.758
NC_014210_8	8.7\|1587855\|33\|NC_014210\|PILER-CR	1587855-1587887	33	NZ_CP020701	Streptomyces tsukubensis strain NRRL 18488 plasmid pSTS1, complete sequence	8818-8850	8	0.758
NC_014210_8	8.11\|1588099\|33\|NC_014210\|PILER-CR	1588099-1588131	33	NC_011892	Methylobacterium nodulans ORS 2060 plasmid pMNOD01, complete sequence	71197-71229	8	0.758
NC_014210_8	8.12\|1587490\|32\|NC_014210\|CRISPRCasFinder,CRT	1587490-1587521	32	MH834608	Arthrobacter phage Cote, complete genome	21160-21191	8	0.75
NC_014210_8	8.14\|1587612\|32\|NC_014210\|CRISPRCasFinder,CRT	1587612-1587643	32	NZ_CP016453	Sphingobium sp. RAC03 plasmid pBSY17_1, complete sequence	390022-390053	8	0.75
NC_014210_8	8.14\|1587612\|32\|NC_014210\|CRISPRCasFinder,CRT	1587612-1587643	32	NC_016586	Azospirillum lipoferum 4B plasmid AZO_p2, complete sequence	152912-152943	8	0.75
NC_014210_8	8.14\|1587612\|32\|NC_014210\|CRISPRCasFinder,CRT	1587612-1587643	32	NZ_CP032324	Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence	305792-305823	8	0.75
NC_014210_8	8.14\|1587612\|32\|NC_014210\|CRISPRCasFinder,CRT	1587612-1587643	32	NZ_CP023408	Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence	163121-163152	8	0.75
NC_014210_8	8.14\|1587612\|32\|NC_014210\|CRISPRCasFinder,CRT	1587612-1587643	32	NC_008381	Rhizobium leguminosarum bv. viciae 3841 plasmid pRL10, complete sequence	141190-141221	8	0.75
NC_014210_8	8.14\|1587612\|32\|NC_014210\|CRISPRCasFinder,CRT	1587612-1587643	32	NZ_CP025013	Rhizobium leguminosarum strain Norway plasmid pRLN1, complete sequence	174815-174846	8	0.75
NC_014210_8	8.14\|1587612\|32\|NC_014210\|CRISPRCasFinder,CRT	1587612-1587643	32	NZ_CP022369	Azospirillum sp. TSH58 plasmid TSH58_p05, complete sequence	402475-402506	8	0.75
NC_014210_8	8.14\|1587612\|32\|NC_014210\|CRISPRCasFinder,CRT	1587612-1587643	32	NZ_CP048281	Rhizobium leguminosarum bv. viciae 248 plasmid pRle248e, complete sequence	203757-203788	8	0.75
NC_014210_8	8.14\|1587612\|32\|NC_014210\|CRISPRCasFinder,CRT	1587612-1587643	32	NZ_CP032349	Azospirillum brasilense strain MTCC4039 plasmid p3, complete sequence	90130-90161	8	0.75
NC_014210_8	8.18\|1587856\|32\|NC_014210\|CRISPRCasFinder,CRT	1587856-1587887	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	5568721-5568752	8	0.75
NC_014210_8	8.18\|1587856\|32\|NC_014210\|CRISPRCasFinder,CRT	1587856-1587887	32	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	1714508-1714539	8	0.75
NC_014210_8	8.18\|1587856\|32\|NC_014210\|CRISPRCasFinder,CRT	1587856-1587887	32	NZ_CP012940	Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence	1809983-1810014	8	0.75
NC_014210_8	8.18\|1587856\|32\|NC_014210\|CRISPRCasFinder,CRT	1587856-1587887	32	NZ_CP012944	Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence	1826673-1826704	8	0.75
NC_014210_8	8.18\|1587856\|32\|NC_014210\|CRISPRCasFinder,CRT	1587856-1587887	32	NC_013858	Azospirillum sp. B510 plasmid pAB510d, complete sequence	459154-459185	8	0.75
NC_014210_8	8.18\|1587856\|32\|NC_014210\|CRISPRCasFinder,CRT	1587856-1587887	32	NC_017575	Ralstonia solanacearum Po82 megaplasmid, complete sequence	192331-192362	8	0.75
NC_014210_8	8.18\|1587856\|32\|NC_014210\|CRISPRCasFinder,CRT	1587856-1587887	32	NZ_CP026308	Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence	192329-192360	8	0.75
NC_014210_8	8.18\|1587856\|32\|NC_014210\|CRISPRCasFinder,CRT	1587856-1587887	32	NZ_CP051295	Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence	1789911-1789942	8	0.75
NC_014210_8	8.18\|1587856\|32\|NC_014210\|CRISPRCasFinder,CRT	1587856-1587887	32	NZ_CP020701	Streptomyces tsukubensis strain NRRL 18488 plasmid pSTS1, complete sequence	8819-8850	8	0.75
NC_014210_8	8.18\|1587856\|32\|NC_014210\|CRISPRCasFinder,CRT	1587856-1587887	32	KY092483	Streptomyces phage Bioscum, complete genome	17049-17080	8	0.75
NC_014210_8	8.18\|1587856\|32\|NC_014210\|CRISPRCasFinder,CRT	1587856-1587887	32	MT701591	Burkholderia phage Mana, complete genome	35671-35702	8	0.75
NC_014210_8	8.18\|1587856\|32\|NC_014210\|CRISPRCasFinder,CRT	1587856-1587887	32	MK305888	Streptomyces phage Austintatious, complete genome	17013-17044	8	0.75
NC_014210_8	8.18\|1587856\|32\|NC_014210\|CRISPRCasFinder,CRT	1587856-1587887	32	NC_047792	Streptomyces phage Ididsumtinwong, complete genome	17049-17080	8	0.75
NC_014210_8	8.18\|1587856\|32\|NC_014210\|CRISPRCasFinder,CRT	1587856-1587887	32	KY092481	Streptomyces phage PapayaSalad, complete genome	17024-17055	8	0.75
NC_014210_8	8.20\|1587978\|32\|NC_014210\|CRISPRCasFinder,CRT	1587978-1588009	32	NZ_CP032325	Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence	41840-41871	8	0.75
NC_014210_8	8.20\|1587978\|32\|NC_014210\|CRISPRCasFinder,CRT	1587978-1588009	32	NZ_CP022191	Yangia pacifica strain YSBP01 plasmid unnamed1, complete sequence	411080-411111	8	0.75
NC_014210_8	8.20\|1587978\|32\|NC_014210\|CRISPRCasFinder,CRT	1587978-1588009	32	LN997843	Streptomyces reticuli genome assembly TUE45, plasmid : II	806158-806189	8	0.75
NC_014210_8	8.22\|1588100\|32\|NC_014210\|CRISPRCasFinder,CRT	1588100-1588131	32	NZ_CP022748	Sphingobium hydrophobicum strain C1 plasmid p2, complete sequence	205339-205370	8	0.75
NC_014210_8	8.22\|1588100\|32\|NC_014210\|CRISPRCasFinder,CRT	1588100-1588131	32	NZ_CP034185	Deinococcus sp. S14-83 strain S14-83T plasmid unnamed1, complete sequence	71285-71316	8	0.75
NC_014210_8	8.22\|1588100\|32\|NC_014210\|CRISPRCasFinder,CRT	1588100-1588131	32	NC_022087	Mycobacterium phage AnnaL29, complete genome	50316-50347	8	0.75
NC_014210_9	9.3\|1595182\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595182-1595213	32	NC_008384	Rhizobium leguminosarum bv. viciae 3841 plasmid pRL11, complete sequence	440619-440650	8	0.75
NC_014210_9	9.3\|1595182\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595182-1595213	32	NZ_CP025014	Rhizobium leguminosarum strain Norway plasmid pRLN2, complete sequence	362467-362498	8	0.75
NC_014210_9	9.3\|1595182\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595182-1595213	32	NZ_CP049732	Rhizobium leguminosarum strain A1 plasmid pRL11, complete sequence	413248-413279	8	0.75
NC_014210_9	9.3\|1595182\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595182-1595213	32	NZ_CP018230	Rhizobium leguminosarum strain Vaf-108 plasmid unnamed2, complete sequence	122492-122523	8	0.75
NC_014210_9	9.3\|1595182\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595182-1595213	32	NC_011366	Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG202, complete sequence	228911-228942	8	0.75
NC_014210_9	9.3\|1595182\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595182-1595213	32	NZ_CP013503	Rhizobium esperanzae strain N561 plasmid pRspN561c, complete sequence	320883-320914	8	0.75
NC_014210_9	9.3\|1595182\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595182-1595213	32	NZ_CP013509	Rhizobium sp. N1341 plasmid pRspN1341d, complete sequence	320883-320914	8	0.75
NC_014210_9	9.3\|1595182\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595182-1595213	32	NZ_CP013520	Rhizobium sp. N113 plasmid pRspN113c, complete sequence	320883-320914	8	0.75
NC_014210_9	9.3\|1595182\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595182-1595213	32	NZ_CP013493	Rhizobium sp. N6212 plasmid pRspN6212c, complete sequence	320883-320914	8	0.75
NC_014210_9	9.3\|1595182\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595182-1595213	32	NZ_CP013516	Rhizobium sp. N1314 plasmid pRspN1314e, complete sequence	321311-321342	8	0.75
NC_014210_9	9.3\|1595182\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595182-1595213	32	NZ_CP054029	Rhizobium sp. JKLM19E plasmid pPR19E02, complete sequence	54606-54637	8	0.75
NC_014210_9	9.3\|1595182\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595182-1595213	32	NZ_CP022566	Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK02, complete sequence	526926-526957	8	0.75
NC_014210_9	9.3\|1595182\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595182-1595213	32	NZ_CP035001	Rhizobium acidisoli strain FH23 plasmid pRapFH23c, complete sequence	188021-188052	8	0.75
NC_014210_9	9.7\|1595426\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595426-1595457	32	NZ_CP035092	Paracoccus denitrificans strain ATCC 19367 plasmid unnamed1, complete sequence	239529-239560	8	0.75
NC_014210_9	9.7\|1595426\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595426-1595457	32	NC_008688	Paracoccus denitrificans PD1222 plasmid 1, complete sequence	486877-486908	8	0.75
NC_014210_9	9.8\|1595487\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595487-1595518	32	CP047137	Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence	1080840-1080871	8	0.75
NC_014210_9	9.8\|1595487\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595487-1595518	32	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	1412643-1412674	8	0.75
NC_014210_9	9.8\|1595487\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595487-1595518	32	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	303208-303239	8	0.75
NC_014210_9	9.8\|1595487\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595487-1595518	32	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	400614-400645	8	0.75
NC_014210_9	9.8\|1595487\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595487-1595518	32	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	1509858-1509889	8	0.75
NC_014210_9	9.8\|1595487\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595487-1595518	32	NZ_AP014705	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence	225004-225035	8	0.75
NC_014210_9	9.8\|1595487\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595487-1595518	32	NZ_CP047174	Rathayibacter sp. VKM Ac-2760 plasmid unnamed1, complete sequence	50586-50617	8	0.75
NC_014210_9	9.8\|1595487\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595487-1595518	32	NZ_LR134465	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 23, complete sequence	263549-263580	8	0.75
NC_014210_9	9.8\|1595487\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595487-1595518	32	NC_002699	Frankia sp. CpI1 plasmid pFQ12, complete plasmid sequence	17835-17866	8	0.75
NC_014210_9	9.8\|1595487\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595487-1595518	32	NC_013531	Xylanimonas cellulosilytica DSM 15894 plasmid pXCEL01, complete sequence	87859-87890	8	0.75
NC_014210_9	9.8\|1595487\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595487-1595518	32	CP022016	Salmonella enterica subsp. enterica serovar India str. SA20085604 plasmid unnamed1, complete sequence	229380-229411	8	0.75
NC_014210_9	9.8\|1595487\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595487-1595518	32	MG757154	Streptomyces phage Bing, complete genome	33373-33404	8	0.75
NC_014210_9	9.10\|1595610\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595610-1595641	32	NZ_CP022195	Yangia pacifica strain YSBP01 plasmid unnamed5, complete sequence	21157-21188	8	0.75
NC_014210_9	9.10\|1595610\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595610-1595641	32	CP062157	Pseudomonas lundensis strain 2T.2.5.2 plasmid pPL-38ph, complete sequence	28713-28744	8	0.75
NC_014210_10	10.1\|1602774\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1602774-1602805	32	NZ_CP034782	Pseudomonas sp. MPC6 plasmid pMPC6-328K, complete sequence	148768-148799	8	0.75
NC_014210_10	10.2\|1602835\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1602835-1602866	32	NC_012811	Methylorubrum extorquens AM1 megaplasmid, complete sequence	599722-599753	8	0.75
NC_014210_10	10.2\|1602835\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1602835-1602866	32	NZ_CP021405	Celeribacter manganoxidans strain DY25 plasmid pDY25-A, complete sequence	10356-10387	8	0.75
NC_014210_10	10.3\|1602896\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1602896-1602927	32	NZ_CP049906	Diaphorobacter sp. HDW4B plasmid unnamed1, complete sequence	133581-133612	8	0.75
NC_014210_10	10.4\|1602957\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1602957-1602988	32	NZ_CP023071	Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence	111138-111169	8	0.75
NC_014210_10	10.4\|1602957\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1602957-1602988	32	NZ_CP029232	Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence	121333-121364	8	0.75
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	NZ_CP025013	Rhizobium leguminosarum strain Norway plasmid pRLN1, complete sequence	358206-358237	8	0.75
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	NZ_CP054022	Rhizobium sp. JKLM12A2 plasmid pPR12A201, complete sequence	32886-32917	8	0.75
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	NC_012848	Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132501, complete sequence	132459-132490	8	0.75
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	NZ_CP034351	Streptomyces sp. W1SF4 plasmid p1, complete sequence	52623-52654	8	0.75
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	NZ_CP032343	Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence	188276-188307	8	0.75
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	NZ_CP012917	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence	539924-539955	8	0.75
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	NZ_CP054616	Azospirillum oryzae strain KACC 14407 plasmid unnamed2, complete sequence	372722-372753	8	0.75
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	NZ_CP054616	Azospirillum oryzae strain KACC 14407 plasmid unnamed2, complete sequence	621070-621101	8	0.75
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	NZ_CP026091	Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence	367748-367779	8	0.75
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	NZ_CP021653	Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence	667950-667981	8	0.75
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	NZ_CP026093	Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence	367766-367797	8	0.75
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	NZ_CP021767	Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence	667964-667995	8	0.75
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	NZ_CP012940	Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence	1633916-1633947	8	0.75
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	NZ_CP012944	Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence	1505427-1505458	8	0.75
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	NZ_CP012688	Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence	667959-667990	8	0.75
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	NC_013857	Azospirillum sp. B510 plasmid pAB510c, complete sequence	592227-592258	8	0.75
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	NC_017575	Ralstonia solanacearum Po82 megaplasmid, complete sequence	367573-367604	8	0.75
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	NZ_CP026308	Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence	367560-367591	8	0.75
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	NZ_CP021119	Streptomyces sp. CLI2509 strain CLI2905 plasmid unnamed1, complete sequence	1954-1985	8	0.75
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	NZ_CP021119	Streptomyces sp. CLI2509 strain CLI2905 plasmid unnamed1, complete sequence	143148-143179	8	0.75
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	CP047139	Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence	687258-687289	8	0.75
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	NZ_CP051295	Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence	1616803-1616834	8	0.75
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	CP047137	Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence	653982-654013	8	0.75
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	MN945901	Mycobacterium phage Ximenita, complete genome	39539-39570	8	0.75
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	MH910042	Mycobacterium phage Scarlett, complete genome	29892-29923	8	0.75
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	MH910038	Mycobacterium phage LeMond, complete genome	29890-29921	8	0.75
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	MK460246	Mycobacterium phage Nibb, complete genome	29347-29378	8	0.75
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	MH910039	Mycobacterium phage Oscar, complete genome	29892-29923	8	0.75
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	MK376955	Mycobacterium phage KiSi, complete genome	29819-29850	8	0.75
NC_014210_10	10.6\|1603079\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603079-1603110	32	NZ_CP007129	Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence	291240-291271	8	0.75
NC_014210_10	10.7\|1603140\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603140-1603171	32	NZ_CP010625	Phaeobacter inhibens strain P51 plasmid pP51_b, complete sequence	77914-77945	8	0.75
NC_014210_10	10.7\|1603140\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603140-1603171	32	NZ_CP010670	Phaeobacter inhibens strain P57 plasmid pP57_b, complete sequence	77915-77946	8	0.75
NC_014210_10	10.7\|1603140\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603140-1603171	32	NZ_CP031959	Phaeobacter sp. LSS9 plasmid unnamed3, complete sequence	23282-23313	8	0.75
NC_014210_10	10.7\|1603140\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603140-1603171	32	NZ_CP010719	Phaeobacter piscinae strain P18 plasmid pP18_d, complete sequence	69099-69130	8	0.75
NC_014210_10	10.7\|1603140\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603140-1603171	32	NZ_CP010743	Phaeobacter inhibens strain P59 plasmid pP59_b, complete sequence	77903-77934	8	0.75
NC_014210_10	10.7\|1603140\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603140-1603171	32	NZ_CP010620	Phaeobacter inhibens strain P30 isolate M4-3.1A plasmid pP30_c, complete sequence	85254-85285	8	0.75
NC_014210_10	10.7\|1603140\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603140-1603171	32	NZ_CP010772	Phaeobacter piscinae strain P13 plasmid pP13_e, complete sequence	69099-69130	8	0.75
NC_014210_10	10.7\|1603140\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603140-1603171	32	NZ_CP010701	Phaeobacter inhibens strain P24 plasmid pP24_e, complete sequence	77915-77946	8	0.75
NC_014210_10	10.7\|1603140\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603140-1603171	32	NZ_CP010747	Phaeobacter inhibens strain P48 isolate M21-2.3 plasmid pP48_b, complete sequence	77909-77940	8	0.75
NC_014210_10	10.7\|1603140\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603140-1603171	32	NZ_CP013104	Paraburkholderia caribensis strain MWAP64 plasmid 1, complete sequence	274042-274073	8	0.75
NC_014210_10	10.7\|1603140\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603140-1603171	32	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	633791-633822	8	0.75
NC_014210_10	10.9\|1603262\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603262-1603293	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	4417033-4417064	8	0.75
NC_014210_10	10.9\|1603262\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603262-1603293	32	NZ_CP040760	Paracoccus sp. 2251 plasmid unnamed6, complete sequence	98132-98163	8	0.75
NC_014210_10	10.10\|1603323\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603323-1603354	32	NC_014753	Oceanithermus profundus DSM 14977 plasmid pOCEPR01, complete sequence	38927-38958	8	0.75
NC_014210_11	11.1\|1638373\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1638373-1638404	32	NZ_LR134449	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 7, complete sequence	58900-58931	8	0.75
NC_014210_11	11.1\|1638373\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1638373-1638404	32	CP027479	Pseudomonas koreensis strain P19E3 plasmid p2, complete sequence	24659-24690	8	0.75
NC_014210_11	11.4\|1638555\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1638555-1638586	32	NZ_CP033873	Caulobacter sp. FWC26 plasmid p1, complete sequence	35693-35724	8	0.75
NC_014210_11	11.4\|1638555\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1638555-1638586	32	NZ_CP039693	Agrobacterium larrymoorei strain CFBP5473 plasmid pAlCFBP5473, complete sequence	246567-246598	8	0.75
NC_014210_11	11.5\|1638616\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1638616-1638647	32	NZ_CP037902	Cupriavidus metallidurans strain BS1 plasmid p1, complete sequence	300497-300528	8	0.75
NC_014210_11	11.5\|1638616\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1638616-1638647	32	NZ_CP010410	Xanthomonas sacchari strain R1 plasmid unnamed, complete sequence	313574-313605	8	0.75
NC_014210_11	11.5\|1638616\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1638616-1638647	32	NZ_CP020556	Streptomyces sp. Sge12 plasmid pSGE, complete sequence	125938-125969	8	0.75
NC_014210_11	11.5\|1638616\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1638616-1638647	32	MF919510	Gordonia phage Kabluna, complete genome	10666-10697	8	0.75
NC_014210_11	11.5\|1638616\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1638616-1638647	32	MK376962	Gordonia phage NosilaM, complete genome	11545-11576	8	0.75
NC_014210_12	12.4\|1645572\|31\|NC_014210\|CRT	1645572-1645602	31	NZ_CP016452	Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence	882030-882060	8	0.742
NC_014210_12	12.4\|1645572\|31\|NC_014210\|CRT	1645572-1645602	31	NC_016586	Azospirillum lipoferum 4B plasmid AZO_p2, complete sequence	485987-486017	8	0.742
NC_014210_12	12.4\|1645572\|31\|NC_014210\|CRT	1645572-1645602	31	NC_012529	Deinococcus deserti VCD115 plasmid 2, complete sequence	19564-19594	8	0.742
NC_014210_12	12.4\|1645572\|31\|NC_014210\|CRT	1645572-1645602	31	NC_014718	Paraburkholderia rhizoxinica HKI 454 plasmid pBRH01, complete sequence	345036-345066	8	0.742
NC_014210_12	12.4\|1645572\|31\|NC_014210\|CRT	1645572-1645602	31	NZ_CP044425	Paracoccus pantotrophus strain DSM 2944 plasmid pPAN2, complete sequence	351217-351247	8	0.742
NC_014210_12	12.4\|1645572\|31\|NC_014210\|CRT	1645572-1645602	31	NZ_CP019242	Rhodoferax antarcticus strain DSMZ24876 plasmid unnamed2	321-351	8	0.742
NC_014210_12	12.4\|1645572\|31\|NC_014210\|CRT	1645572-1645602	31	NZ_CP019242	Rhodoferax antarcticus strain DSMZ24876 plasmid unnamed2	91264-91294	8	0.742
NC_014210_12	12.4\|1645572\|31\|NC_014210\|CRT	1645572-1645602	31	NZ_CP045549	Streptomyces sp. SYP-A7193 plasmid unnamed2, complete sequence	21491-21521	8	0.742
NC_014210_12	12.4\|1645572\|31\|NC_014210\|CRT	1645572-1645602	31	NZ_CP029232	Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence	834522-834552	8	0.742
NC_014210_13	13.2\|1662532\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1662532-1662563	32	NZ_CP021653	Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence	1807729-1807760	8	0.75
NC_014210_13	13.2\|1662532\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1662532-1662563	32	NZ_CP015091	Pelagibaca abyssi strain JLT2014 plasmid pPABY1, complete sequence	110945-110976	8	0.75
NC_014210_13	13.2\|1662532\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1662532-1662563	32	NZ_CP012688	Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence	1807727-1807758	8	0.75
NC_014210_13	13.2\|1662532\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1662532-1662563	32	CP047139	Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence	290217-290248	8	0.75
NC_014210_13	13.2\|1662532\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1662532-1662563	32	CP047137	Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence	270558-270589	8	0.75
NC_014210_13	13.2\|1662532\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1662532-1662563	32	NZ_CP022371	Bosea sp. AS-1 plasmid unnamed2, complete sequence	61449-61480	8	0.75
NC_014210_13	13.2\|1662532\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1662532-1662563	32	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	2438169-2438200	8	0.75
NC_014210_13	13.2\|1662532\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1662532-1662563	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2390008-2390039	8	0.75
NC_014210_13	13.2\|1662532\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1662532-1662563	32	NZ_CP030829	Neorhizobium sp. NCHU2750 plasmid pNCHU2750b, complete sequence	304773-304804	8	0.75
NC_014210_13	13.2\|1662532\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1662532-1662563	32	NC_007950	Polaromonas sp. JS666 plasmid 2, complete sequence	26264-26295	8	0.75
NC_014210_13	13.4\|1662654\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1662654-1662685	32	NC_008713	Paenarthrobacter aurescens TC1 plasmid pTC2, complete sequence	6860-6891	8	0.75
NC_014210_13	13.5\|1662715\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1662715-1662746	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	4199074-4199105	8	0.75
NC_014210_13	13.5\|1662715\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1662715-1662746	32	NZ_CP050104	Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b2, complete sequence	1137460-1137491	8	0.75
NC_014210_13	13.5\|1662715\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1662715-1662746	32	NC_014818	Asticcacaulis excentricus CB 48 plasmid pASTEX01, complete sequence	114767-114798	8	0.75
NC_014210_13	13.5\|1662715\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1662715-1662746	32	NZ_CP025507	Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvA, complete sequence	881370-881401	8	0.75
NC_014210_13	13.5\|1662715\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1662715-1662746	32	NZ_CP050109	Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b2, complete sequence	1137463-1137494	8	0.75
NC_014210_13	13.5\|1662715\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1662715-1662746	32	NZ_CP030761	Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed1, complete sequence	703881-703912	8	0.75
NC_014210_13	13.5\|1662715\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1662715-1662746	32	NZ_CP022666	Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR1, complete sequence	302340-302371	8	0.75
NC_014210_13	13.5\|1662715\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1662715-1662746	32	NZ_CP050086	Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b7, complete sequence	1113409-1113440	8	0.75
NC_014210_13	13.6\|1662776\|32\|NC_014210\|CRISPRCasFinder,CRT	1662776-1662807	32	CP023013	Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence	1874940-1874971	8	0.75
NC_014210_13	13.6\|1662776\|32\|NC_014210\|CRISPRCasFinder,CRT	1662776-1662807	32	CP000662	Rhodobacter sphaeroides ATCC 17025 plasmid pRSPA01, complete sequence	141873-141904	8	0.75
NC_014210_14	14.1\|2013540\|32\|NC_014210\|PILER-CR,CRISPRCasFinder	2013540-2013571	32	NC_008010	Deinococcus geothermalis DSM 11300 plasmid pDGEO01, complete sequence	498611-498642	8	0.75
NC_014210_14	14.1\|2013540\|32\|NC_014210\|PILER-CR,CRISPRCasFinder	2013540-2013571	32	KY555145	Caulobacter phage Ccr29, complete genome	24515-24546	8	0.75
NC_014210_14	14.1\|2013540\|32\|NC_014210\|PILER-CR,CRISPRCasFinder	2013540-2013571	32	KY555143	Caulobacter phage Ccr2, complete genome	22348-22379	8	0.75
NC_014210_14	14.1\|2013540\|32\|NC_014210\|PILER-CR,CRISPRCasFinder	2013540-2013571	32	KY555142	Caulobacter phage Ccr10, complete genome	21873-21904	8	0.75
NC_014210_14	14.5\|2013782\|32\|NC_014210\|CRISPRCasFinder	2013782-2013813	32	NC_011961	Thermomicrobium roseum DSM 5159 plasmid unnamed, complete sequence	835193-835224	8	0.75
NC_014210_14	14.5\|2013782\|32\|NC_014210\|CRISPRCasFinder	2013782-2013813	32	NZ_CP026745	Nocardia cyriacigeorgica strain MDA3349 isolate MDA3349 ancestor plasmid p_unnamed, complete sequence	74253-74284	8	0.75
NC_014210_14	14.8\|2013965\|32\|NC_014210\|CRISPRCasFinder	2013965-2013996	32	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	848488-848519	8	0.75
NC_014210_14	14.8\|2013965\|32\|NC_014210\|CRISPRCasFinder	2013965-2013996	32	NZ_CP043499	Rhizobium grahamii strain BG7 plasmid unnamed, complete sequence	1449985-1450016	8	0.75
NC_014210_14	14.9\|2014026\|32\|NC_014210\|CRISPRCasFinder	2014026-2014057	32	NC_017958	Tistrella mobilis KA081020-065 plasmid pTM3, complete sequence	986917-986948	8	0.75
NC_014210_14	14.11\|2014148\|32\|NC_014210\|CRISPRCasFinder	2014148-2014179	32	NZ_CP016891	Pantoea agglomerans strain C410P1 plasmid unnamed2, complete sequence	74574-74605	8	0.75
NC_014210_14	14.18\|2014575\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014575-2014606	32	NZ_LR134456	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 14, complete sequence	253787-253818	8	0.75
NC_014210_14	14.18\|2014575\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014575-2014606	32	MH590593	Mycobacterium phage Rabinovish, complete genome	297-328	8	0.75
NC_014210_14	14.18\|2014575\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014575-2014606	32	MH590593	Mycobacterium phage Rabinovish, complete genome	318-349	8	0.75
NC_014210_14	14.18\|2014575\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014575-2014606	32	MK450432	Mycobacterium phage ValleyTerrace, complete genome	297-328	8	0.75
NC_014210_14	14.18\|2014575\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014575-2014606	32	MH697586	Mycobacterium phage InigoMontoya, complete genome	297-328	8	0.75
NC_014210_14	14.18\|2014575\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014575-2014606	32	NC_023714	Mycobacterium phage LinStu, complete genome	297-328	8	0.75
NC_014210_14	14.18\|2014575\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014575-2014606	32	KJ595575	Mycobacterium phage Willis, complete genome	297-328	8	0.75
NC_014210_14	14.18\|2014575\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014575-2014606	32	MK359339	Mycobacterium phage Naija, complete genome	297-328	8	0.75
NC_014210_14	14.18\|2014575\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014575-2014606	32	JN699625	Mycobacterium phage Wally, complete genome	297-328	8	0.75
NC_014210_14	14.18\|2014575\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014575-2014606	32	MK359335	Mycobacterium phage Patter, complete genome	314-345	8	0.75
NC_014210_14	14.18\|2014575\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014575-2014606	32	MT889395	Mycobacterium phage Shifa, complete genome	297-328	8	0.75
NC_014210_14	14.18\|2014575\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014575-2014606	32	MT723944	Mycobacterium phage ChaylaJr, complete genome	297-328	8	0.75
NC_014210_14	14.18\|2014575\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014575-2014606	32	MT723944	Mycobacterium phage ChaylaJr, complete genome	318-349	8	0.75
NC_014210_14	14.18\|2014575\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014575-2014606	32	KR080196	Mycobacterium phage Momo, complete genome	297-328	8	0.75
NC_014210_14	14.18\|2014575\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014575-2014606	32	MH910040	Mycobacterium phage Sauce, complete genome	297-328	8	0.75
NC_014210_14	14.18\|2014575\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014575-2014606	32	KF024734	Mycobacterium phage Shrimp, complete genome	297-328	8	0.75
NC_014210_14	14.18\|2014575\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014575-2014606	32	MK359338	Mycobacterium phage Amataga, complete genome	297-328	8	0.75
NC_014210_14	14.18\|2014575\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014575-2014606	32	MT723945	Mycobacterium phage Quasimodo, complete genome	297-328	8	0.75
NC_014210_14	14.18\|2014575\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014575-2014606	32	JF704096	Mycobacterium phage Ghost, complete sequence	297-328	8	0.75
NC_014210_14	14.18\|2014575\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014575-2014606	32	MN062707	Mycobacterium phage Grungle, complete genome	297-328	8	0.75
NC_014210_14	14.18\|2014575\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014575-2014606	32	MK359345	Mycobacterium phage QBert, complete genome	297-328	8	0.75
NC_014210_14	14.18\|2014575\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014575-2014606	32	MK359362	Mycobacterium phage Atlantean, complete genome	297-328	8	0.75
NC_014210_14	14.18\|2014575\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014575-2014606	32	KX369583	Mycobacterium phage Littleton, complete genome	297-328	8	0.75
NC_014210_14	14.18\|2014575\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014575-2014606	32	MK359353	Mycobacterium phage BadAgartude, complete genome	314-345	8	0.75
NC_014210_14	14.18\|2014575\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014575-2014606	32	MH697590	Mycobacterium phage Phlegm, complete genome	297-328	8	0.75
NC_014210_14	14.18\|2014575\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014575-2014606	32	MN428066	Mycobacterium phage JPickles, complete genome	297-328	8	0.75
NC_014210_14	14.18\|2014575\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014575-2014606	32	DQ398053	Mycobacteriophage Catera, complete genome	297-328	8	0.75
NC_014210_14	14.18\|2014575\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014575-2014606	32	NC_028986	Mycobacterium phage Alice, complete sequence	297-328	8	0.75
NC_014210_14	14.18\|2014575\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014575-2014606	32	JN204348	Mycobacterium phage Sebata, complete genome	297-328	8	0.75
NC_014210_14	14.18\|2014575\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014575-2014606	32	NC_008207	Mycobacterium phage Catera, complete genome	297-328	8	0.75
NC_014210_14	14.18\|2014575\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014575-2014606	32	MK359326	Mycobacterium phage Pivoine, complete genome	297-328	8	0.75
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	NZ_CP050093	Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b5, complete sequence	150187-150218	8	0.75
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	NZ_CP050105	Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b6, complete sequence	267393-267424	8	0.75
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	NC_008384	Rhizobium leguminosarum bv. viciae 3841 plasmid pRL11, complete sequence	265241-265272	8	0.75
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	NZ_CP025014	Rhizobium leguminosarum strain Norway plasmid pRLN2, complete sequence	182024-182055	8	0.75
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	NZ_CP050110	Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b4, complete sequence	267395-267426	8	0.75
NC_014210_14	14.20\|2014697\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014697-2014728	32	KY092483	Streptomyces phage Bioscum, complete genome	3906-3937	8	0.75
NC_014210_14	14.20\|2014697\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014697-2014728	32	MK305888	Streptomyces phage Austintatious, complete genome	3903-3934	8	0.75
NC_014210_14	14.20\|2014697\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014697-2014728	32	NC_047958	Burkholderia phage vB_BmuP_KL4, complete genome	30504-30535	8	0.75
NC_014210_14	14.20\|2014697\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014697-2014728	32	NC_047792	Streptomyces phage Ididsumtinwong, complete genome	3906-3937	8	0.75
NC_014210_14	14.20\|2014697\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014697-2014728	32	KY092481	Streptomyces phage PapayaSalad, complete genome	3903-3934	8	0.75
NC_014210_14	14.21\|2014758\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014758-2014789	32	NZ_CP032695	Rhizobium jaguaris strain CCGE525 plasmid pRCCGE525c, complete sequence	1994561-1994592	8	0.75
NC_014210_14	14.22\|2014819\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014819-2014850	32	NC_015583	Novosphingobium sp. PP1Y plasmid Mpl, complete sequence	357787-357818	8	0.75
NC_014210_14	14.23\|2014880\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014880-2014911	32	NC_011962	Rhodobacter sphaeroides KD131 plasmid pRSKD131A, complete sequence	100943-100974	8	0.75
NC_014210_14	14.23\|2014880\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014880-2014911	32	KU252585	Gordonia phage Howe, complete genome	36729-36760	8	0.75
NC_014210_14	14.23\|2014880\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014880-2014911	32	MK878902	Gordonia phage Twinkle, complete genome	37788-37819	8	0.75
NC_014210_14	14.23\|2014880\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014880-2014911	32	MK061406	Gordonia phage Adora, complete genome	35374-35405	8	0.75
NC_014210_14	14.23\|2014880\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014880-2014911	32	MN428055	Gordonia phage Mcklovin, complete genome	38196-38227	8	0.75
NC_014210_14	14.26\|2015063\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2015063-2015094	32	KT281796	Mycobacterium phage Zakhe101, complete genome	51821-51852	8	0.75
NC_014210_14	14.26\|2015063\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2015063-2015094	32	AY129335	Mycobacterium virus Corndog, complete genome	51683-51714	8	0.75
NC_014210_14	14.26\|2015063\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2015063-2015094	32	MN428058	Mycobacterium phage Krili, complete genome	50140-50171	8	0.75
NC_014210_14	14.26\|2015063\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2015063-2015094	32	MH020246	Mycobacterium phage SchoolBus, complete genome	50563-50594	8	0.75
NC_014210_14	14.26\|2015063\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2015063-2015094	32	MT818418	Mycobacterium phage Shida, complete genome	50252-50283	8	0.75
NC_014210_14	14.26\|2015063\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2015063-2015094	32	NC_004685	Mycobacterium phage Corndog, complete genome	51683-51714	8	0.75
NC_014210_14	14.26\|2015063\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2015063-2015094	32	JN698993	Mycobacterium phage Firecracker, complete genome	51975-52006	8	0.75
NC_014210_14	14.26\|2015063\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2015063-2015094	32	MH926062	Mycobacterium phage Vorrps, complete genome	50669-50700	8	0.75
NC_014210_14	14.26\|2015063\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2015063-2015094	32	MG099943	Mycobacterium phage Familton, complete genome	50585-50616	8	0.75
NC_014210_14	14.26\|2015063\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2015063-2015094	32	MG872838	Mycobacterium phage JangDynasty, complete genome	50646-50677	8	0.75
NC_014210_14	14.26\|2015063\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2015063-2015094	32	MH590592	Mycobacterium phage Ryadel, complete genome	51415-51446	8	0.75
NC_014210_14	14.26\|2015063\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2015063-2015094	32	MN585964	Mycobacterium phage Blessica, complete genome	50892-50923	8	0.75
NC_014210_14	14.26\|2015063\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2015063-2015094	32	KJ829260	Mycobacterium phage YungJamal, complete genome	52631-52662	8	0.75
NC_014210_14	14.26\|2015063\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2015063-2015094	32	NC_022057	Mycobacterium phage Catdawg, complete genome	50628-50659	8	0.75
NC_014210_14	14.26\|2015063\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2015063-2015094	32	MT818425	Mycobacterium phage NiebruSaylor, complete genome	50059-50090	8	0.75
NC_014210_14	14.26\|2015063\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2015063-2015094	32	NC_022325	Mycobacterium phage Dylan, complete genome	51817-51848	8	0.75
NC_014210_14	14.26\|2015063\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2015063-2015094	32	MN428052	Mycobacterium phage Smooch, complete genome	53316-53347	8	0.75
NC_014210_14	14.29\|2015246\|32\|NC_014210\|CRISPRCasFinder	2015246-2015277	32	NZ_CP009293	Novosphingobium pentaromativorans US6-1 plasmid pLA4, complete sequence	276056-276087	8	0.75
NC_014210_14	14.29\|2015246\|32\|NC_014210\|CRISPRCasFinder	2015246-2015277	32	NZ_CP029832	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence	450768-450799	8	0.75
NC_014210_14	14.29\|2015246\|32\|NC_014210\|CRISPRCasFinder	2015246-2015277	32	MF477236	Nocardia phage NTR1, complete genome	18550-18581	8	0.75
NC_014210_14	14.29\|2015246\|32\|NC_014210\|CRISPRCasFinder	2015246-2015277	32	NC_023498	Mycobacterium phage Validus, complete genome	58341-58372	8	0.75
NC_014210_14	14.61\|2013965\|31\|NC_014210\|PILER-CR	2013965-2013995	31	NZ_CP043499	Rhizobium grahamii strain BG7 plasmid unnamed, complete sequence	1449986-1450016	8	0.742
NC_014210_23	23.3\|5555711\|32\|NC_014210\|CRISPRCasFinder	5555711-5555742	32	NZ_CP011627	Klebsiella oxytoca strain CAV1374 plasmid pCAV1374-14, complete sequence	6469-6500	8	0.75
NC_014210_23	23.3\|5555711\|32\|NC_014210\|CRISPRCasFinder	5555711-5555742	32	NZ_CP025945	Escherichia coli strain SCEC020023 plasmid p1_020023, complete sequence	7580-7611	8	0.75
NC_014210_23	23.3\|5555711\|32\|NC_014210\|CRISPRCasFinder	5555711-5555742	32	NZ_CP036322	Klebsiella pneumoniae strain VBA2172 plasmid pCol440I	6046-6077	8	0.75
NC_014210_23	23.3\|5555711\|32\|NC_014210\|CRISPRCasFinder	5555711-5555742	32	NZ_CP033949	Klebsiella pneumoniae subsp. pneumoniae strain ARLG-3135 plasmid p3, complete sequence	5037-5068	8	0.75
NC_014210_23	23.3\|5555711\|32\|NC_014210\|CRISPRCasFinder	5555711-5555742	32	NZ_CP024491	Klebsiella pneumoniae strain INF249 plasmid unnamed2, complete sequence	2668-2699	8	0.75
NC_014210_23	23.3\|5555711\|32\|NC_014210\|CRISPRCasFinder	5555711-5555742	32	NZ_CP034676	Klebsiella quasipneumoniae strain D120-1 plasmid pD120-1_6kb, complete sequence	464-495	8	0.75
NC_014210_23	23.3\|5555711\|32\|NC_014210\|CRISPRCasFinder	5555711-5555742	32	NZ_CP040599	Klebsiella pneumoniae subsp. pneumoniae strain KpvST15_NDM plasmid unnamed4, complete sequence	108-139	8	0.75
NC_014210_23	23.3\|5555711\|32\|NC_014210\|CRISPRCasFinder	5555711-5555742	32	NZ_CP050828	Klebsiella pneumoniae strain Bckp212 plasmid pBckp212-2, complete sequence	8565-8596	8	0.75
NC_014210_23	23.3\|5555711\|32\|NC_014210\|CRISPRCasFinder	5555711-5555742	32	NZ_CP038459	Escherichia coli strain EC-129 plasmid pEC129_6, complete sequence	2629-2660	8	0.75
NC_014210_23	23.3\|5555711\|32\|NC_014210\|CRISPRCasFinder	5555711-5555742	32	NZ_CP050824	Klebsiella pneumoniae strain Bckp091 plasmid pBckp091-2, complete sequence	46-77	8	0.75
NC_014210_23	23.3\|5555711\|32\|NC_014210\|CRISPRCasFinder	5555711-5555742	32	NZ_CP034050	Klebsiella pneumoniae strain KP_NORM_BLD_2014_104014 plasmid unnamed5, complete sequence	2617-2648	8	0.75
NC_014210_23	23.3\|5555711\|32\|NC_014210\|CRISPRCasFinder	5555711-5555742	32	CP052340	Klebsiella pneumoniae strain D17KP0018 plasmid pD17KP0018-3, complete sequence	843-874	8	0.75
NC_014210_23	23.3\|5555711\|32\|NC_014210\|CRISPRCasFinder	5555711-5555742	32	NZ_CP044044	Klebsiella pneumoniae strain FDAARGOS_629 plasmid unnamed2, complete sequence	6780-6811	8	0.75
NC_014210_23	23.3\|5555711\|32\|NC_014210\|CRISPRCasFinder	5555711-5555742	32	NZ_CP045296	Paenibacillus cellulositrophicus strain KACC 16577 plasmid unnamed1, complete sequence	742794-742825	8	0.75
NC_014210_23	23.3\|5555711\|32\|NC_014210\|CRISPRCasFinder	5555711-5555742	32	NZ_CP013541	Rhizobium phaseoli strain R630 plasmid pRphaR630d, complete sequence	966741-966772	8	0.75
NC_014210_23	23.3\|5555711\|32\|NC_014210\|CRISPRCasFinder	5555711-5555742	32	NC_013449	Streptomyces sp. W9 plasmid pCQ3, complete sequence	8956-8987	8	0.75
NC_014210_23	23.3\|5555711\|32\|NC_014210\|CRISPRCasFinder	5555711-5555742	32	NZ_CP024314	Rhizobium sp. NXC24 plasmid pRspNXC24c, complete sequence	1840319-1840350	8	0.75
NC_014210_23	23.3\|5555711\|32\|NC_014210\|CRISPRCasFinder	5555711-5555742	32	NZ_CP053567	Pseudonocardia sp. Gen01 plasmid unnamed3, complete sequence	20886-20917	8	0.75
NC_014210_23	23.4\|5555772\|32\|NC_014210\|CRISPRCasFinder	5555772-5555803	32	NC_019847	Sinorhizobium meliloti GR4 plasmid pRmeGR4b, complete sequence	23313-23344	8	0.75
NC_014210_23	23.4\|5555772\|32\|NC_014210\|CRISPRCasFinder	5555772-5555803	32	NC_017327	Sinorhizobium meliloti SM11 plasmid pSmeSM11c, complete sequence	135717-135748	8	0.75
NC_014210_23	23.4\|5555772\|32\|NC_014210\|CRISPRCasFinder	5555772-5555803	32	NZ_CP029453	Sinorhizobium fredii CCBAU 25509 plasmid pSF25509a, complete sequence	157008-157039	8	0.75
NC_014210_23	23.4\|5555772\|32\|NC_014210\|CRISPRCasFinder	5555772-5555803	32	NC_017324	Sinorhizobium meliloti BL225C plasmid pSINMEB01, complete sequence	187848-187879	8	0.75
NC_014210_23	23.4\|5555772\|32\|NC_014210\|CRISPRCasFinder	5555772-5555803	32	NZ_AP013104	Bradyrhizobium elkanii USDA 61 plasmid pBel61, complete sequence	89115-89146	8	0.75
NC_014210_23	23.4\|5555772\|32\|NC_014210\|CRISPRCasFinder	5555772-5555803	32	NZ_CP024309	Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3b, complete sequence	194861-194892	8	0.75
NC_014210_23	23.4\|5555772\|32\|NC_014210\|CRISPRCasFinder	5555772-5555803	32	NZ_CP021803	Sinorhizobium meliloti strain USDA1021 plasmid accessoryA, complete sequence	161098-161129	8	0.75
NC_014210_23	23.4\|5555772\|32\|NC_014210\|CRISPRCasFinder	5555772-5555803	32	NZ_CP011000	Sinorhizobium meliloti strain USDA1963 plasmid pHRB800, complete sequence	45689-45720	8	0.75
NC_014210_23	23.4\|5555772\|32\|NC_014210\|CRISPRCasFinder	5555772-5555803	32	NZ_CP023069	Ensifer sojae CCBAU 05684 plasmid pSJ05684a, complete sequence	172054-172085	8	0.75
NC_014210_23	23.4\|5555772\|32\|NC_014210\|CRISPRCasFinder	5555772-5555803	32	NZ_CP021821	Sinorhizobium meliloti strain M162 plasmid accessoryA, complete sequence	15636-15667	8	0.75
NC_014210_23	23.4\|5555772\|32\|NC_014210\|CRISPRCasFinder	5555772-5555803	32	NZ_CP013053	Sinorhizobium americanum CCGM7 plasmid B, complete sequence	329768-329799	8	0.75
NC_014210_23	23.4\|5555772\|32\|NC_014210\|CRISPRCasFinder	5555772-5555803	32	NZ_CP023072	Sinorhizobium fredii CCBAU 83666 plasmid pSF83666a, complete sequence	31829-31860	8	0.75
NC_014210_23	23.4\|5555772\|32\|NC_014210\|CRISPRCasFinder	5555772-5555803	32	NZ_CP023072	Sinorhizobium fredii CCBAU 83666 plasmid pSF83666a, complete sequence	156895-156926	8	0.75
NC_014210_23	23.4\|5555772\|32\|NC_014210\|CRISPRCasFinder	5555772-5555803	32	NZ_CP021817	Sinorhizobium meliloti strain M270 plasmid accessoryC, complete sequence	8707-8738	8	0.75
NC_014210_23	23.4\|5555772\|32\|NC_014210\|CRISPRCasFinder	5555772-5555803	32	NZ_CP021794	Sinorhizobium meliloti strain USDA1157 plasmid psymA, complete sequence	754387-754418	8	0.75
NC_014210_23	23.4\|5555772\|32\|NC_014210\|CRISPRCasFinder	5555772-5555803	32	NZ_CP021217	Sinorhizobium meliloti RU11/001 plasmid pSymA, complete sequence	1148359-1148390	8	0.75
NC_014210_23	23.4\|5555772\|32\|NC_014210\|CRISPRCasFinder	5555772-5555803	32	NZ_CP024313	Rhizobium sp. NXC24 plasmid pRspNXC24b, complete sequence	48262-48293	8	0.75
NC_014210_23	23.4\|5555772\|32\|NC_014210\|CRISPRCasFinder	5555772-5555803	32	NZ_CP026526	Sinorhizobium meliloti strain AK21 plasmid pSymA, complete sequence	643436-643467	8	0.75
NC_014210_23	23.4\|5555772\|32\|NC_014210\|CRISPRCasFinder	5555772-5555803	32	NZ_CP023065	Sinorhizobium sp. CCBAU 05631 plasmid pSS05631a, complete sequence	31333-31364	8	0.75
NC_014210_23	23.4\|5555772\|32\|NC_014210\|CRISPRCasFinder	5555772-5555803	32	NC_019313	Sinorhizobium meliloti plasmid pHRC017, complete sequence	20403-20434	8	0.75
NC_014210_23	23.4\|5555772\|32\|NC_014210\|CRISPRCasFinder	5555772-5555803	32	NZ_CP029233	Sinorhizobium fredii CCBAU 45436 plasmid pSF45436a, complete sequence	175467-175498	8	0.75
NC_014210_23	23.4\|5555772\|32\|NC_014210\|CRISPRCasFinder	5555772-5555803	32	NZ_CP030864	Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence	497790-497821	8	0.75
NC_014210_23	23.9\|5555708\|35\|NC_014210\|CRT	5555708-5555742	35	NZ_CP045390	Roseivivax sp. THAF30 plasmid pTHAF30_a, complete sequence	51680-51714	8	0.771
NC_014210_23	23.9\|5555708\|35\|NC_014210\|CRT	5555708-5555742	35	NZ_CP045362	Roseivivax sp. THAF40 plasmid pTHAF40_b, complete sequence	51684-51718	8	0.771
NC_014210_23	23.9\|5555708\|35\|NC_014210\|CRT	5555708-5555742	35	CP011998	Ralstonia solanacearum strain YC45 plasmid, complete sequence	1528110-1528144	8	0.771
NC_014210_23	23.15\|5555709\|35\|NC_014210\|PILER-CR	5555709-5555743	35	NZ_CP045390	Roseivivax sp. THAF30 plasmid pTHAF30_a, complete sequence	51680-51714	8	0.771
NC_014210_23	23.15\|5555709\|35\|NC_014210\|PILER-CR	5555709-5555743	35	NZ_CP045362	Roseivivax sp. THAF40 plasmid pTHAF40_b, complete sequence	51684-51718	8	0.771
NC_014210_23	23.15\|5555709\|35\|NC_014210\|PILER-CR	5555709-5555743	35	CP011998	Ralstonia solanacearum strain YC45 plasmid, complete sequence	1528110-1528144	8	0.771
NC_014210_7	7.9\|1581936\|32\|NC_014210\|CRISPRCasFinder,CRT	1581936-1581967	32	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	435154-435185	9	0.719
NC_014210_7	7.9\|1581936\|32\|NC_014210\|CRISPRCasFinder,CRT	1581936-1581967	32	NZ_CP031159	Deinococcus wulumuqiensis strain NEB 479 plasmid pDrdA, complete sequence	303337-303368	9	0.719
NC_014210_7	7.9\|1581936\|32\|NC_014210\|CRISPRCasFinder,CRT	1581936-1581967	32	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	663635-663666	9	0.719
NC_014210_7	7.10\|1581997\|32\|NC_014210\|CRISPRCasFinder,CRT	1581997-1582028	32	NZ_CP006368	Aureimonas sp. AU20 plasmid pAU20a, complete sequence	290103-290134	9	0.719
NC_014210_7	7.10\|1581997\|32\|NC_014210\|CRISPRCasFinder,CRT	1581997-1582028	32	NZ_CP013110	Sinorhizobium americanum strain CFNEI 73 plasmid C, complete sequence	663143-663174	9	0.719
NC_014210_7	7.10\|1581997\|32\|NC_014210\|CRISPRCasFinder,CRT	1581997-1582028	32	NZ_CP013054	Sinorhizobium americanum CCGM7 plasmid C, complete sequence	1714603-1714634	9	0.719
NC_014210_7	7.10\|1581997\|32\|NC_014210\|CRISPRCasFinder,CRT	1581997-1582028	32	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	826539-826570	9	0.719
NC_014210_7	7.12\|1582119\|32\|NC_014210\|CRISPRCasFinder,CRT	1582119-1582150	32	NZ_KY865323	Escherichia coli strain SY286M plasmid pECM13, complete sequence	7934-7965	9	0.719
NC_014210_8	8.3\|1587611\|33\|NC_014210\|PILER-CR	1587611-1587643	33	NC_016586	Azospirillum lipoferum 4B plasmid AZO_p2, complete sequence	152912-152944	9	0.727
NC_014210_8	8.3\|1587611\|33\|NC_014210\|PILER-CR	1587611-1587643	33	NZ_CP016453	Sphingobium sp. RAC03 plasmid pBSY17_1, complete sequence	390021-390053	9	0.727
NC_014210_8	8.3\|1587611\|33\|NC_014210\|PILER-CR	1587611-1587643	33	NZ_CP032324	Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence	305791-305823	9	0.727
NC_014210_8	8.9\|1587977\|33\|NC_014210\|PILER-CR	1587977-1588009	33	NZ_CP022191	Yangia pacifica strain YSBP01 plasmid unnamed1, complete sequence	411079-411111	9	0.727
NC_014210_8	8.11\|1588099\|33\|NC_014210\|PILER-CR	1588099-1588131	33	CP052389	Klebsiella pneumoniae strain C17KP0052 plasmid pC17KP0052-1	227803-227835	9	0.727
NC_014210_8	8.14\|1587612\|32\|NC_014210\|CRISPRCasFinder,CRT	1587612-1587643	32	NZ_CP051471	Rhodobacter sphaeroides strain CH10 plasmid pRspCH10B, complete sequence	33629-33660	9	0.719
NC_014210_8	8.14\|1587612\|32\|NC_014210\|CRISPRCasFinder,CRT	1587612-1587643	32	NZ_AP020327	Mycobacterium avium subsp. hominissuis strain JP-H-1 plasmid p1-JPH1	17659-17690	9	0.719
NC_014210_8	8.14\|1587612\|32\|NC_014210\|CRISPRCasFinder,CRT	1587612-1587643	32	NZ_CP030274	Rhodobacter sphaeroides 2.4.1 plasmid pB, complete sequence	55097-55128	9	0.719
NC_014210_8	8.14\|1587612\|32\|NC_014210\|CRISPRCasFinder,CRT	1587612-1587643	32	CP047034	Rhodobacter sphaeroides strain DSM 158 plasmid pB, complete sequence	58119-58150	9	0.719
NC_014210_8	8.14\|1587612\|32\|NC_014210\|CRISPRCasFinder,CRT	1587612-1587643	32	NZ_CP015291	Rhodobacter sphaeroides strain MBTLJ-20 plasmid c, complete sequence	72441-72472	9	0.719
NC_014210_8	8.14\|1587612\|32\|NC_014210\|CRISPRCasFinder,CRT	1587612-1587643	32	NZ_CP047040	Rhodobacter sphaeroides strain 2.4.1 substr. H2 plasmid pB, complete sequence	58064-58095	9	0.719
NC_014210_8	8.14\|1587612\|32\|NC_014210\|CRISPRCasFinder,CRT	1587612-1587643	32	NZ_CP007795	Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence	70575-70606	9	0.719
NC_014210_8	8.14\|1587612\|32\|NC_014210\|CRISPRCasFinder,CRT	1587612-1587643	32	NC_011962	Rhodobacter sphaeroides KD131 plasmid pRSKD131A, complete sequence	111880-111911	9	0.719
NC_014210_8	8.14\|1587612\|32\|NC_014210\|CRISPRCasFinder,CRT	1587612-1587643	32	NZ_AP014579	Burkholderia sp. RPE67 plasmid p1, complete sequence	8608-8639	9	0.719
NC_014210_8	8.14\|1587612\|32\|NC_014210\|CRISPRCasFinder,CRT	1587612-1587643	32	NZ_CP015215	Rhodobacter sphaeroides strain MBTLJ-13 plasmid d, complete sequence	18910-18941	9	0.719
NC_014210_8	8.14\|1587612\|32\|NC_014210\|CRISPRCasFinder,CRT	1587612-1587643	32	NZ_CP034185	Deinococcus sp. S14-83 strain S14-83T plasmid unnamed1, complete sequence	67430-67461	9	0.719
NC_014210_8	8.14\|1587612\|32\|NC_014210\|CRISPRCasFinder,CRT	1587612-1587643	32	MN694708	Marine virus AFVG_250M243, complete genome	5746-5777	9	0.719
NC_014210_8	8.18\|1587856\|32\|NC_014210\|CRISPRCasFinder,CRT	1587856-1587887	32	NC_012811	Methylorubrum extorquens AM1 megaplasmid, complete sequence	1003832-1003863	9	0.719
NC_014210_8	8.18\|1587856\|32\|NC_014210\|CRISPRCasFinder,CRT	1587856-1587887	32	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	1311329-1311360	9	0.719
NC_014210_8	8.18\|1587856\|32\|NC_014210\|CRISPRCasFinder,CRT	1587856-1587887	32	NZ_CP026305	Streptomyces lunaelactis strain MM109 plasmid pSLUN1, complete sequence	87854-87885	9	0.719
NC_014210_8	8.18\|1587856\|32\|NC_014210\|CRISPRCasFinder,CRT	1587856-1587887	32	NZ_CP032054	Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence	913425-913456	9	0.719
NC_014210_8	8.18\|1587856\|32\|NC_014210\|CRISPRCasFinder,CRT	1587856-1587887	32	NZ_CP016560	Streptomyces clavuligerus strain F613-1 plasmid pSCL4, complete sequence	570315-570346	9	0.719
NC_014210_8	8.20\|1587978\|32\|NC_014210\|CRISPRCasFinder,CRT	1587978-1588009	32	NZ_CP014519	Sinomonas atrocyanea strain KCTC 3377 plasmid pSA01, complete sequence	54921-54952	9	0.719
NC_014210_8	8.20\|1587978\|32\|NC_014210\|CRISPRCasFinder,CRT	1587978-1588009	32	NZ_CP007796	Azospirillum brasilense strain Az39 plasmid AbAZ39_p3, complete sequence	649318-649349	9	0.719
NC_014210_8	8.20\|1587978\|32\|NC_014210\|CRISPRCasFinder,CRT	1587978-1588009	32	NC_013857	Azospirillum sp. B510 plasmid pAB510c, complete sequence	174329-174360	9	0.719
NC_014210_8	8.21\|1588039\|32\|NC_014210\|CRISPRCasFinder,CRT	1588039-1588070	32	NZ_CP022991	Paraburkholderia aromaticivorans strain BN5 plasmid pBN1, complete sequence	520839-520870	9	0.719
NC_014210_8	8.22\|1588100\|32\|NC_014210\|CRISPRCasFinder,CRT	1588100-1588131	32	CP052389	Klebsiella pneumoniae strain C17KP0052 plasmid pC17KP0052-1	227803-227834	9	0.719
NC_014210_8	8.22\|1588100\|32\|NC_014210\|CRISPRCasFinder,CRT	1588100-1588131	32	NC_017791	Deinococcus gobiensis I-0 plasmid P2, complete sequence	99890-99921	9	0.719
NC_014210_8	8.22\|1588100\|32\|NC_014210\|CRISPRCasFinder,CRT	1588100-1588131	32	NZ_CP020811	Mycobacterium dioxanotrophicus strain PH-06 plasmid unnamed2, complete sequence	20798-20829	9	0.719
NC_014210_8	8.22\|1588100\|32\|NC_014210\|CRISPRCasFinder,CRT	1588100-1588131	32	NZ_CP054615	Azospirillum oryzae strain KACC 14407 plasmid unnamed1, complete sequence	144129-144160	9	0.719
NC_014210_8	8.22\|1588100\|32\|NC_014210\|CRISPRCasFinder,CRT	1588100-1588131	32	NZ_CP032346	Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence	817387-817418	9	0.719
NC_014210_9	9.3\|1595182\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595182-1595213	32	MN096379	Streptomyces phage Yasdnil, complete genome	23274-23305	9	0.719
NC_014210_9	9.3\|1595182\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595182-1595213	32	NZ_CP020951	Rhizobium sp. CIAT894 plasmid pRheCIAT894d, complete sequence	276149-276180	9	0.719
NC_014210_9	9.8\|1595487\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595487-1595518	32	CP042595	Streptomyces albogriseolus strain LBX-2 plasmid pSALBX2, complete sequence	139739-139770	9	0.719
NC_014210_9	9.8\|1595487\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595487-1595518	32	NC_024145	Mycobacterium phage Hosp, complete genome	58957-58988	9	0.719
NC_014210_9	9.9\|1595548\|33\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595548-1595580	33	NZ_CP024791	Nostoc flagelliforme CCNUN1 plasmid pNFSY06, complete sequence	21642-21674	9	0.727
NC_014210_9	9.9\|1595548\|33\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595548-1595580	33	NZ_CP024793	Nostoc flagelliforme CCNUN1 plasmid pNFSY08, complete sequence	76325-76357	9	0.727
NC_014210_9	9.10\|1595610\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595610-1595641	32	NZ_CP015419	Rhodovulum sulfidophilum DSM 1374 plasmid unnamed1, complete sequence	78210-78241	9	0.719
NC_014210_9	9.10\|1595610\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595610-1595641	32	NC_008269	Rhodococcus jostii RHA1 plasmid pRHL1, complete sequence	347552-347583	9	0.719
NC_014210_9	9.10\|1595610\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595610-1595641	32	NZ_CP015422	Rhodovulum sulfidophilum strain SNK001 plasmid, complete sequence	78110-78141	9	0.719
NC_014210_9	9.10\|1595610\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595610-1595641	32	NZ_CP007129	Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence	631832-631863	9	0.719
NC_014210_9	9.10\|1595610\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595610-1595641	32	KT001914	Caulobacter phage Seuss, complete genome	65948-65979	9	0.719
NC_014210_10	10.2\|1602835\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1602835-1602866	32	MF766046	Streptomyces phage Diane, complete genome	20499-20530	9	0.719
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	NZ_CP050092	Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b6, complete sequence	459499-459530	9	0.719
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	CP023013	Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence	1358545-1358576	9	0.719
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	NZ_CP050098	Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b4, complete sequence	316148-316179	9	0.719
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	NZ_CP050104	Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b2, complete sequence	620197-620228	9	0.719
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	NZ_CP053440	Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eF, complete sequence	321669-321700	9	0.719
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	NZ_CP018229	Rhizobium leguminosarum strain Vaf-108 plasmid unnamed1, complete sequence	610537-610568	9	0.719
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	NZ_CP025507	Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvA, complete sequence	320808-320839	9	0.719
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	NZ_CP050109	Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b2, complete sequence	620197-620228	9	0.719
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	NZ_CP030761	Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed1, complete sequence	1165128-1165159	9	0.719
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	NZ_CP022783	Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence	1364721-1364752	9	0.719
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	NZ_CP022795	Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence	1361449-1361480	9	0.719
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	NZ_CP022666	Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR1, complete sequence	1059117-1059148	9	0.719
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	CP023015	Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence	628150-628181	9	0.719
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	NZ_CP054032	Rhizobium sp. JKLM13E plasmid pPR13E01, complete sequence	993320-993351	9	0.719
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	NZ_CP050086	Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b7, complete sequence	656253-656284	9	0.719
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	MN175603	Microbacterium phage Tyrumbra, complete genome	10312-10343	9	0.719
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	MH271312	Microbacterium phage RobsFeet, complete genome	11236-11267	9	0.719
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	MK524510	Microbacterium phage Fireman, complete genome	10969-11000	9	0.719
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	NC_047988	Microbacterium phage Metamorphoo, complete genome	10955-10986	9	0.719
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	NZ_CP016613	Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence	1270270-1270301	9	0.719
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	NZ_CP022766	Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence	1436499-1436530	9	0.719
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	NZ_CP050953	Rhodococcus sp. DMU1 plasmid unnamed	625848-625879	9	0.719
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	NZ_CP052069	Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence	1360643-1360674	9	0.719
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	NZ_CP016313	Thermus brockianus strain GE-1 plasmid pTB1, complete sequence	188436-188467	9	0.719
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	NZ_CP022769	Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence	1443940-1443971	9	0.719
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	NZ_CP029358	Azospirillum sp. CFH 70021 plasmid unnamed3	29855-29886	9	0.719
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	NZ_CP022773	Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence	1153636-1153667	9	0.719
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	NZ_CP023549	Rhodobacter sp. CZR27 plasmid unnamed1, complete sequence	336914-336945	9	0.719
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	NZ_CP022482	Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence	1677209-1677240	9	0.719
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	NZ_CP046573	Rhodococcus sp. WAY2 plasmid pRWAY01, complete sequence	486290-486321	9	0.719
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	NZ_CP022779	Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence	1455421-1455452	9	0.719
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	NZ_CP022781	Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence	598488-598519	9	0.719
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	CP003957	Rhodococcus opacus PD630 plasmid 8, complete sequence	124254-124285	9	0.719
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	NZ_CP022793	Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence	1361571-1361602	9	0.719
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	NZ_CP022785	Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence	1342231-1342262	9	0.719
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	NZ_CP022787	Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence	1395411-1395442	9	0.719
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	NZ_CP022756	Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence	1434352-1434383	9	0.719
NC_014210_10	10.6\|1603079\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603079-1603110	32	NZ_CP025188	Roseomonas mucosa strain AD2 plasmid p1-AD2, complete sequence	166795-166826	9	0.719
NC_014210_10	10.6\|1603079\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603079-1603110	32	NZ_CP015881	Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence	99626-99657	9	0.719
NC_014210_10	10.6\|1603079\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603079-1603110	32	NZ_CP030263	Ensifer adhaerens strain Corn53 plasmid AA, complete sequence	329344-329375	9	0.719
NC_014210_10	10.6\|1603079\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603079-1603110	32	NZ_CP023549	Rhodobacter sp. CZR27 plasmid unnamed1, complete sequence	682497-682528	9	0.719
NC_014210_10	10.7\|1603140\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603140-1603171	32	NZ_CP010613	Phaeobacter inhibens strain P92 plasmid pP92_c, complete sequence	77924-77955	9	0.719
NC_014210_10	10.7\|1603140\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603140-1603171	32	NZ_CP010597	Phaeobacter inhibens strain P10 plasmid pP10_b, complete sequence	77928-77959	9	0.719
NC_014210_10	10.7\|1603140\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603140-1603171	32	NC_018287	Phaeobacter inhibens DSM 17395 plasmid pPGA1_78, complete sequence	1673-1704	9	0.719
NC_014210_10	10.7\|1603140\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603140-1603171	32	NZ_CP010632	Phaeobacter inhibens strain P78 plasmid pP78_c, complete sequence	72429-72460	9	0.719
NC_014210_10	10.7\|1603140\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603140-1603171	32	NZ_CP031954	Phaeobacter inhibens strain 2.10 plasmid unnamed2, complete sequence	1767-1798	9	0.719
NC_014210_10	10.7\|1603140\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603140-1603171	32	NC_018423	Phaeobacter inhibens 2.10 plasmid pPGA2_95, complete sequence	1655-1686	9	0.719
NC_014210_10	10.7\|1603140\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603140-1603171	32	NZ_CP010761	Phaeobacter inhibens strain P80 plasmid pP80_e, complete sequence	77915-77946	9	0.719
NC_014210_10	10.7\|1603140\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603140-1603171	32	NZ_CP010604	Phaeobacter inhibens strain P83 plasmid pP83_e, complete sequence	77915-77946	9	0.719
NC_014210_10	10.7\|1603140\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603140-1603171	32	NZ_CP031950	Phaeobacter inhibens strain BS107 plasmid unnamed2, complete sequence	1673-1704	9	0.719
NC_014210_10	10.7\|1603140\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603140-1603171	32	NZ_CP010731	Phaeobacter inhibens strain P88 plasmid pP88_f, complete sequence	77914-77945	9	0.719
NC_014210_10	10.7\|1603140\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603140-1603171	32	NZ_CP010653	Phaeobacter inhibens strain P54 plasmid pP54_c, complete sequence	77902-77933	9	0.719
NC_014210_10	10.7\|1603140\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603140-1603171	32	NZ_CP010710	Phaeobacter inhibens strain P66 plasmid pP66_e, complete sequence	77915-77946	9	0.719
NC_014210_10	10.7\|1603140\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603140-1603171	32	NZ_CP019310	Phaeobacter inhibens strain DOK1-1 plasmid pDOK1-1-3, complete sequence	61574-61605	9	0.719
NC_014210_10	10.7\|1603140\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603140-1603171	32	NZ_CP010738	Phaeobacter inhibens strain P72 plasmid pP72_c, complete sequence	77918-77949	9	0.719
NC_014210_10	10.8\|1603201\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603201-1603232	32	NC_022590	Brevibacterium sp. Ap13 plasmid pAP13, complete sequence	72667-72698	9	0.719
NC_014210_10	10.9\|1603262\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603262-1603293	32	NZ_CP012477	Arthrobacter sp. ERGS1:01 isolate water plasmid unnamed2, complete sequence	52583-52614	9	0.719
NC_014210_10	10.9\|1603262\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603262-1603293	32	NZ_AP014705	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence	1252508-1252539	9	0.719
NC_014210_11	11.1\|1638373\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1638373-1638404	32	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	72864-72895	9	0.719
NC_014210_11	11.1\|1638373\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1638373-1638404	32	NC_022995	Burkholderia sp. M701 plasmid pM7012 DNA, complete sequence	483977-484008	9	0.719
NC_014210_11	11.1\|1638373\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1638373-1638404	32	NZ_CP024582	Roseomonas sp. FDAARGOS_362 plasmid unnamed1, complete sequence	138155-138186	9	0.719
NC_014210_11	11.4\|1638555\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1638555-1638586	32	KX119197	Helicobacter phage PtB92G, complete genome	6323-6354	9	0.719
NC_014210_11	11.4\|1638555\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1638555-1638586	32	KX119205	Helicobacter phage DeM53M, complete genome	6250-6281	9	0.719
NC_014210_11	11.4\|1638555\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1638555-1638586	32	KX119189	Helicobacter phage Pt21299RU, complete genome	6058-6089	9	0.719
NC_014210_11	11.5\|1638616\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1638616-1638647	32	NZ_CP030864	Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence	104784-104815	9	0.719
NC_014210_11	11.5\|1638616\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1638616-1638647	32	NZ_CP017759	Cupriavidus necator strain NH9 plasmid pENH92, complete sequence	196280-196311	9	0.719
NC_014210_11	11.5\|1638616\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1638616-1638647	32	JX182371	Streptomyces phage SV1, complete genome	16139-16170	9	0.719
NC_014210_12	12.4\|1645572\|31\|NC_014210\|CRT	1645572-1645602	31	NZ_CP054616	Azospirillum oryzae strain KACC 14407 plasmid unnamed2, complete sequence	74542-74572	9	0.71
NC_014210_12	12.4\|1645572\|31\|NC_014210\|CRT	1645572-1645602	31	NC_013857	Azospirillum sp. B510 plasmid pAB510c, complete sequence	152492-152522	9	0.71
NC_014210_13	13.1\|1662471\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1662471-1662502	32	NZ_CP032343	Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence	238801-238832	9	0.719
NC_014210_13	13.1\|1662471\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1662471-1662502	32	NZ_CP012917	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence	489397-489428	9	0.719
NC_014210_13	13.3\|1662593\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1662593-1662624	32	NC_006569	Ruegeria pomeroyi DSS-3 megaplasmid, complete sequence	477726-477757	9	0.719
NC_014210_13	13.5\|1662715\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1662715-1662746	32	NZ_CP011515	Mitsuaria sp. 7 plasmid, complete sequence	52015-52046	9	0.719
NC_014210_13	13.5\|1662715\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1662715-1662746	32	NZ_CP031166	Euzebya sp. DY32-46 plasmid pEDY32-46I, complete sequence	538642-538673	9	0.719
NC_014210_13	13.6\|1662776\|32\|NC_014210\|CRISPRCasFinder,CRT	1662776-1662807	32	KT351734	Pectobacterium carotovorum plasmid Drgb3, complete sequence	5057-5088	9	0.719
NC_014210_14	14.4\|2013721\|32\|NC_014210\|CRISPRCasFinder	2013721-2013752	32	MK864266	Gordonia phage Arri, complete genome	55925-55956	9	0.719
NC_014210_14	14.4\|2013721\|32\|NC_014210\|CRISPRCasFinder	2013721-2013752	32	MN284907	Gordonia phage Fireball, complete genome	56199-56230	9	0.719
NC_014210_14	14.4\|2013721\|32\|NC_014210\|CRISPRCasFinder	2013721-2013752	32	MK864264	Gordonia phage VanDeWege, complete genome	56248-56279	9	0.719
NC_014210_14	14.4\|2013721\|32\|NC_014210\|CRISPRCasFinder	2013721-2013752	32	MT639651	Gordonia phage Portcullis, complete genome	55639-55670	9	0.719
NC_014210_14	14.4\|2013721\|32\|NC_014210\|CRISPRCasFinder	2013721-2013752	32	MH479917	Gordonia phage KimmyK, complete genome	56030-56061	9	0.719
NC_014210_14	14.4\|2013721\|32\|NC_014210\|CRISPRCasFinder	2013721-2013752	32	MH669015	Gordonia phage TillyBobJoe, complete genome	55617-55648	9	0.719
NC_014210_14	14.4\|2013721\|32\|NC_014210\|CRISPRCasFinder	2013721-2013752	32	MK814761	Gordonia phage SmokingBunny, complete genome	56731-56762	9	0.719
NC_014210_14	14.4\|2013721\|32\|NC_014210\|CRISPRCasFinder	2013721-2013752	32	KX557286	Gordonia phage Twister6, complete genome	55080-55111	9	0.719
NC_014210_14	14.4\|2013721\|32\|NC_014210\|CRISPRCasFinder	2013721-2013752	32	MK864267	Gordonia phage Valary, complete genome	56723-56754	9	0.719
NC_014210_14	14.4\|2013721\|32\|NC_014210\|CRISPRCasFinder	2013721-2013752	32	MK967381	Gordonia phage RogerDodger, complete genome	56398-56429	9	0.719
NC_014210_14	14.4\|2013721\|32\|NC_014210\|CRISPRCasFinder	2013721-2013752	32	MT310872	Gordonia phage Evamon, complete genome	55737-55768	9	0.719
NC_014210_14	14.4\|2013721\|32\|NC_014210\|CRISPRCasFinder	2013721-2013752	32	NC_030913	Gordonia phage Wizard, complete genome	55583-55614	9	0.719
NC_014210_14	14.5\|2013782\|32\|NC_014210\|CRISPRCasFinder	2013782-2013813	32	NZ_LR594669	Variovorax sp. SRS16 plasmid 4	192833-192864	9	0.719
NC_014210_14	14.5\|2013782\|32\|NC_014210\|CRISPRCasFinder	2013782-2013813	32	NC_008308	Sphingomonas sp. KA1 plasmid pCAR3 DNA, complete sequence	153660-153691	9	0.719
NC_014210_14	14.8\|2013965\|32\|NC_014210\|CRISPRCasFinder	2013965-2013996	32	CP023013	Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence	1086896-1086927	9	0.719
NC_014210_14	14.8\|2013965\|32\|NC_014210\|CRISPRCasFinder	2013965-2013996	32	NZ_CP021763	Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence	1171868-1171899	9	0.719
NC_014210_14	14.8\|2013965\|32\|NC_014210\|CRISPRCasFinder	2013965-2013996	32	NZ_CP015116	Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence	1344363-1344394	9	0.719
NC_014210_14	14.8\|2013965\|32\|NC_014210\|CRISPRCasFinder	2013965-2013996	32	NZ_CP022783	Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence	1092580-1092611	9	0.719
NC_014210_14	14.8\|2013965\|32\|NC_014210\|CRISPRCasFinder	2013965-2013996	32	NZ_CP022795	Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence	1089283-1089314	9	0.719
NC_014210_14	14.8\|2013965\|32\|NC_014210\|CRISPRCasFinder	2013965-2013996	32	NZ_CP022482	Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence	1935731-1935762	9	0.719
NC_014210_14	14.8\|2013965\|32\|NC_014210\|CRISPRCasFinder	2013965-2013996	32	NZ_CP009763	Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence	1060140-1060171	9	0.719
NC_014210_14	14.8\|2013965\|32\|NC_014210\|CRISPRCasFinder	2013965-2013996	32	CP023015	Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence	900110-900141	9	0.719
NC_014210_14	14.8\|2013965\|32\|NC_014210\|CRISPRCasFinder	2013965-2013996	32	NZ_CP052111	Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence	870057-870088	9	0.719
NC_014210_14	14.8\|2013965\|32\|NC_014210\|CRISPRCasFinder	2013965-2013996	32	NZ_CP052113	Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence	870057-870088	9	0.719
NC_014210_14	14.9\|2014026\|32\|NC_014210\|CRISPRCasFinder	2014026-2014057	32	NZ_CP029452	Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence	1615310-1615341	9	0.719
NC_014210_14	14.9\|2014026\|32\|NC_014210\|CRISPRCasFinder	2014026-2014057	32	NZ_CP023071	Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence	1591772-1591803	9	0.719
NC_014210_14	14.18\|2014575\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014575-2014606	32	NC_016907	Gordonia polyisoprenivorans VH2 plasmid p174, complete sequence	163766-163797	9	0.719
NC_014210_14	14.18\|2014575\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014575-2014606	32	MH590593	Mycobacterium phage Rabinovish, complete genome	276-307	9	0.719
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	NZ_CP050082	Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b4, complete sequence	315327-315358	9	0.719
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	NZ_CP049732	Rhizobium leguminosarum strain A1 plasmid pRL11, complete sequence	265224-265255	9	0.719
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	NZ_CP054023	Rhizobium sp. JKLM12A2 plasmid pPR12A202, complete sequence	395396-395427	9	0.719
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	NZ_CP053208	Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1B, complete sequence	238503-238534	9	0.719
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	NZ_CP032324	Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence	223178-223209	9	0.719
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	NZ_CP022366	Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence	642503-642534	9	0.719
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	NZ_CP018230	Rhizobium leguminosarum strain Vaf-108 plasmid unnamed2, complete sequence	237506-237537	9	0.719
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	NZ_CP007797	Azospirillum brasilense strain Az39 plasmid AbAZ39_p4, complete sequence	374731-374762	9	0.719
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	NC_016624	Azospirillum lipoferum 4B plasmid AZO_p5, complete sequence	408709-408740	9	0.719
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	NC_013859	Azospirillum sp. B510 plasmid pAB510e, complete sequence	465649-465680	9	0.719
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	NZ_CP022566	Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK02, complete sequence	149666-149697	9	0.719
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	NZ_CP032348	Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence	367716-367747	9	0.719
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	MH051250	Mycobacterium phage Coog, complete genome	31522-31553	9	0.719
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	MK494087	Mycobacterium phage DBQu4n, complete genome	32549-32580	9	0.719
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	AP018480	Mycobacterium virus D29 DNA, complete sequence	32559-32590	9	0.719
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	MN617844	Mycobacterium phage Bluefalcon, complete genome	31700-31731	9	0.719
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	KC787102	Mycobacterium phage Chy1, partial genome	32406-32437	9	0.719
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	MN586062	Mycobacterium phage Lev2, complete genome	31337-31368	9	0.719
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	NC_001900	Mycobacterium phage D29, complete genome	32559-32590	9	0.719
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	NC_022973	Mycobacterium phage Conspiracy, complete genome	31424-31455	9	0.719
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	MN586016	Mycobacterium phage MarysWell, complete genome	31531-31562	9	0.719
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	MH051256	Mycobacterium phage Midas2, complete genome	31522-31553	9	0.719
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	KF493882	Mycobacterium phage Jovo, complete genome	31705-31736	9	0.719
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	AF022214	Mycobacterium virus D29, complete genome	32559-32590	9	0.719
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	MN096372	Mycobacterium phage Zolita, complete genome	32199-32230	9	0.719
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	KX897981	Mycobacterium phage StarStuff, complete genome	32552-32583	9	0.719
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	MN234169	Mycobacterium phage Naji, complete genome	32550-32581	9	0.719
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	MT310883	Mycobacterium phage D32, complete genome	32550-32581	9	0.719
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	NC_021318	Mycobacterium phage Chy5, complete genome	32965-32996	9	0.719
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	NC_041984	Mycobacterium phage Tiger, complete genome	31003-31034	9	0.719
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	NC_021338	Mycobacterium phage Chy4, complete genome	32623-32654	9	0.719
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	NC_028960	Mycobacterium phage Theia, complete genome	31470-31501	9	0.719
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	MG099944	Mycobacterium phage ForGetIt, complete genome	31449-31480	9	0.719
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	MG099934	Mycobacterium phage AgentM, complete genome	31182-31213	9	0.719
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	MN586039	Mycobacterium phage Blinn1, complete genome	31878-31909	9	0.719
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	KX574455	Mycobacterium phage Pomar16, complete genome	32590-32621	9	0.719
NC_014210_14	14.20\|2014697\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014697-2014728	32	NZ_CP033583	Streptomyces sp. ADI95-16 plasmid pADI95-16b, complete sequence	55273-55304	9	0.719
NC_014210_14	14.20\|2014697\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014697-2014728	32	NC_012811	Methylorubrum extorquens AM1 megaplasmid, complete sequence	196860-196891	9	0.719
NC_014210_14	14.20\|2014697\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014697-2014728	32	NZ_CP042998	Aquisphaera giovannonii strain OJF2 plasmid pOJF2_1, complete sequence	61851-61882	9	0.719
NC_014210_14	14.22\|2014819\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014819-2014850	32	MG872842	Mycobacterium phage Scherzo, complete genome	47027-47058	9	0.719
NC_014210_14	14.22\|2014819\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014819-2014850	32	KT285706	Mycobacterium phage Pioneer, complete genome	46995-47026	9	0.719
NC_014210_14	14.22\|2014819\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014819-2014850	32	MN585978	Mycobacterium phage Beemo, complete genome	46996-47027	9	0.719
NC_014210_14	14.22\|2014819\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014819-2014850	32	MG872840	Mycobacterium phage Phonnegut, complete genome	46995-47026	9	0.719
NC_014210_14	14.23\|2014880\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014880-2014911	32	NZ_CP027239	Dietzia sp. oral taxon 368 strain W5195 plasmid unnamed1, complete sequence	130826-130857	9	0.719
NC_014210_14	14.23\|2014880\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014880-2014911	32	NC_005205	Pseudomonas syringae pv. syringae A2 plasmid pPSR1, complete sequence	54262-54293	9	0.719
NC_014210_14	14.24\|2014941\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014941-2014972	32	NZ_CP014514	Frondihabitans sp. PAMC 28766 strain SR6 plasmid 1, complete sequence	163705-163736	9	0.719
NC_014210_14	14.24\|2014941\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014941-2014972	32	NZ_CP031166	Euzebya sp. DY32-46 plasmid pEDY32-46I, complete sequence	191103-191134	9	0.719
NC_014210_14	14.25\|2015002\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2015002-2015033	32	NZ_AP017656	Sphingobium cloacae strain JCM 10874 plasmid pSCLO_2, complete sequence	279387-279418	9	0.719
NC_014210_14	14.25\|2015002\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2015002-2015033	32	NZ_CP032326	Azospirillum brasilense strain MTCC4035 plasmid p5, complete sequence	102961-102992	9	0.719
NC_014210_14	14.26\|2015063\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2015063-2015094	32	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	1643475-1643506	9	0.719
NC_014210_14	14.26\|2015063\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2015063-2015094	32	NZ_CP029831	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed7, complete sequence	478567-478598	9	0.719
NC_014210_14	14.26\|2015063\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2015063-2015094	32	NZ_CP054621	Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence	30871-30902	9	0.719
NC_014210_14	14.26\|2015063\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2015063-2015094	32	NZ_CP045548	Streptomyces sp. SYP-A7193 plasmid unnamed1, complete sequence	200974-201005	9	0.719
NC_014210_14	14.28\|2015185\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2015185-2015216	32	NZ_CP021355	Rhodococcus sp. S2-17 plasmid pRB98, complete sequence	813376-813407	9	0.719
NC_014210_14	14.29\|2015246\|32\|NC_014210\|CRISPRCasFinder	2015246-2015277	32	NZ_AP013104	Bradyrhizobium elkanii USDA 61 plasmid pBel61, complete sequence	40863-40894	9	0.719
NC_014210_14	14.61\|2013965\|31\|NC_014210\|PILER-CR	2013965-2013995	31	CP023013	Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence	1086896-1086926	9	0.71
NC_014210_14	14.61\|2013965\|31\|NC_014210\|PILER-CR	2013965-2013995	31	NZ_CP021763	Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence	1171868-1171898	9	0.71
NC_014210_14	14.61\|2013965\|31\|NC_014210\|PILER-CR	2013965-2013995	31	NZ_CP015116	Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence	1344363-1344393	9	0.71
NC_014210_14	14.61\|2013965\|31\|NC_014210\|PILER-CR	2013965-2013995	31	NZ_CP022783	Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence	1092580-1092610	9	0.71
NC_014210_14	14.61\|2013965\|31\|NC_014210\|PILER-CR	2013965-2013995	31	NZ_CP022795	Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence	1089283-1089313	9	0.71
NC_014210_14	14.61\|2013965\|31\|NC_014210\|PILER-CR	2013965-2013995	31	NZ_CP022482	Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence	1935732-1935762	9	0.71
NC_014210_14	14.61\|2013965\|31\|NC_014210\|PILER-CR	2013965-2013995	31	NZ_CP009763	Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence	1060140-1060170	9	0.71
NC_014210_14	14.61\|2013965\|31\|NC_014210\|PILER-CR	2013965-2013995	31	CP023015	Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence	900111-900141	9	0.71
NC_014210_14	14.61\|2013965\|31\|NC_014210\|PILER-CR	2013965-2013995	31	NZ_CP052111	Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence	870058-870088	9	0.71
NC_014210_14	14.61\|2013965\|31\|NC_014210\|PILER-CR	2013965-2013995	31	NZ_CP052113	Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence	870058-870088	9	0.71
NC_014210_14	14.62\|2014026\|31\|NC_014210\|PILER-CR	2014026-2014056	31	NZ_CP007129	Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence	491938-491968	9	0.71
NC_014210_14	14.62\|2014026\|31\|NC_014210\|PILER-CR	2014026-2014056	31	NZ_CP032341	Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence	605331-605361	9	0.71
NC_014210_14	14.62\|2014026\|31\|NC_014210\|PILER-CR	2014026-2014056	31	NZ_CP012916	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence	443276-443306	9	0.71
NC_014210_14	14.62\|2014026\|31\|NC_014210\|PILER-CR	2014026-2014056	31	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	1395844-1395874	9	0.71
NC_014210_14	14.62\|2014026\|31\|NC_014210\|PILER-CR	2014026-2014056	31	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	181399-181429	9	0.71
NC_014210_14	14.62\|2014026\|31\|NC_014210\|PILER-CR	2014026-2014056	31	NZ_CP029452	Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence	1615310-1615340	9	0.71
NC_014210_14	14.62\|2014026\|31\|NC_014210\|PILER-CR	2014026-2014056	31	NZ_CP023071	Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence	1591772-1591802	9	0.71
NC_014210_14	14.62\|2014026\|31\|NC_014210\|PILER-CR	2014026-2014056	31	NZ_CP029542	Streptomyces sp. NEAU-S7GS2 plasmid unnamed1, complete sequence	13635-13665	9	0.71
NC_014210_15	15.2\|2020811\|35\|NC_014210\|CRISPRCasFinder	2020811-2020845	35	MF417941	Uncultured Caudovirales phage clone 7F_14, partial genome	14325-14359	9	0.743
NC_014210_15	15.2\|2020811\|35\|NC_014210\|CRISPRCasFinder	2020811-2020845	35	MF417869	Uncultured Caudovirales phage clone 3S_4, partial genome	26249-26283	9	0.743
NC_014210_15	15.2\|2020811\|35\|NC_014210\|CRISPRCasFinder	2020811-2020845	35	MF417878	Uncultured Caudovirales phage clone 8S_7, partial genome	23611-23645	9	0.743
NC_014210_15	15.2\|2020811\|35\|NC_014210\|CRISPRCasFinder	2020811-2020845	35	MF417876	Uncultured Caudovirales phage clone 3F_6, partial genome	18247-18281	9	0.743
NC_014210_15	15.2\|2020811\|35\|NC_014210\|CRISPRCasFinder	2020811-2020845	35	MF417877	Uncultured Caudovirales phage clone 9F_7, partial genome	52625-52659	9	0.743
NC_014210_15	15.2\|2020811\|35\|NC_014210\|CRISPRCasFinder	2020811-2020845	35	NZ_CP033582	Streptomyces sp. ADI95-16 plasmid pADI95-16a, complete sequence	2738-2772	9	0.743
NC_014210_23	23.2\|5555650\|32\|NC_014210\|CRISPRCasFinder	5555650-5555681	32	NZ_CP039699	Novosphingobium sp. ABRDHK2 plasmid pABRDHK234, complete sequence	149366-149397	9	0.719
NC_014210_23	23.2\|5555650\|32\|NC_014210\|CRISPRCasFinder	5555650-5555681	32	MN270889	Ralstonia phage P-PSG-11, complete genome	17822-17853	9	0.719
NC_014210_23	23.2\|5555650\|32\|NC_014210\|CRISPRCasFinder	5555650-5555681	32	MN270890	Ralstonia phage P-PSG-11-1, complete genome	17822-17853	9	0.719
NC_014210_23	23.2\|5555650\|32\|NC_014210\|CRISPRCasFinder	5555650-5555681	32	MN685189	UNVERIFIED: Ralstonia phage vRsoP-WF2 genomic sequence	34235-34266	9	0.719
NC_014210_23	23.2\|5555650\|32\|NC_014210\|CRISPRCasFinder	5555650-5555681	32	MF979559	Ralstonia phage DU_RP_I, complete genome	33619-33650	9	0.719
NC_014210_23	23.2\|5555650\|32\|NC_014210\|CRISPRCasFinder	5555650-5555681	32	MN685191	UNVERIFIED: Ralstonia phage vRsoP-WR2 genomic sequence	34235-34266	9	0.719
NC_014210_23	23.2\|5555650\|32\|NC_014210\|CRISPRCasFinder	5555650-5555681	32	MN685190	UNVERIFIED: Ralstonia phage vRsoP-WM2 genomic sequence	34691-34722	9	0.719
NC_014210_23	23.2\|5555650\|32\|NC_014210\|CRISPRCasFinder	5555650-5555681	32	NC_047946	Ralstonia phage RsoP1EGY, complete genome	4929-4960	9	0.719
NC_014210_23	23.3\|5555711\|32\|NC_014210\|CRISPRCasFinder	5555711-5555742	32	NZ_CP032323	Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence	239920-239951	9	0.719
NC_014210_23	23.3\|5555711\|32\|NC_014210\|CRISPRCasFinder	5555711-5555742	32	NZ_CP019902	Raoultella planticola strain GODA plasmid unnamed3, complete sequence	4490-4521	9	0.719
NC_014210_23	23.3\|5555711\|32\|NC_014210\|CRISPRCasFinder	5555711-5555742	32	NC_004929	Ruegeria sp. PR1b plasmid pSD20, complete sequence	14933-14964	9	0.719
NC_014210_23	23.3\|5555711\|32\|NC_014210\|CRISPRCasFinder	5555711-5555742	32	NC_013855	Azospirillum sp. B510 plasmid pAB510a, complete sequence	539668-539699	9	0.719
NC_014210_23	23.3\|5555711\|32\|NC_014210\|CRISPRCasFinder	5555711-5555742	32	NZ_CP024314	Rhizobium sp. NXC24 plasmid pRspNXC24c, complete sequence	1928955-1928986	9	0.719
NC_014210_23	23.3\|5555711\|32\|NC_014210\|CRISPRCasFinder	5555711-5555742	32	NZ_CP022304	Thalassococcus sp. S3 plasmid pS3A, complete sequence	29514-29545	9	0.719
NC_014210_23	23.3\|5555711\|32\|NC_014210\|CRISPRCasFinder	5555711-5555742	32	NC_019307	Streptomyces sp. W75 plasmid pCQ4, complete sequence	14361-14392	9	0.719
NC_014210_23	23.3\|5555711\|32\|NC_014210\|CRISPRCasFinder	5555711-5555742	32	JX100810	Caulobacter phage CcrColossus, complete genome	236171-236202	9	0.719
NC_014210_23	23.4\|5555772\|32\|NC_014210\|CRISPRCasFinder	5555772-5555803	32	NZ_LR134451	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 9, complete sequence	40536-40567	9	0.719
NC_014210_23	23.4\|5555772\|32\|NC_014210\|CRISPRCasFinder	5555772-5555803	32	NZ_CP049043	Pseudohalocynthiibacter aestuariivivens strain RR4-35 plasmid pRR4-35_6, complete sequence	5524-5555	9	0.719
NC_014210_23	23.8\|5555647\|35\|NC_014210\|CRT	5555647-5555681	35	NZ_CP022417	Sulfitobacter pseudonitzschiae strain SMR1 plasmid pSMR1-2, complete sequence	23798-23832	9	0.743
NC_014210_23	23.9\|5555708\|35\|NC_014210\|CRT	5555708-5555742	35	NZ_CP035511	Haematobacter massiliensis strain OT1 plasmid pOT1-1, complete sequence	113-147	9	0.743
NC_014210_23	23.9\|5555708\|35\|NC_014210\|CRT	5555708-5555742	35	NZ_CP054621	Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence	386438-386472	9	0.743
NC_014210_23	23.11\|5555830\|35\|NC_014210\|CRT	5555830-5555864	35	MG592671	Vibrio phage 2.275.O._10N.286.54.E11, partial genome	88955-88989	9	0.743
NC_014210_23	23.14\|5555648\|35\|NC_014210\|PILER-CR	5555648-5555682	35	NZ_CP022417	Sulfitobacter pseudonitzschiae strain SMR1 plasmid pSMR1-2, complete sequence	23798-23832	9	0.743
NC_014210_23	23.15\|5555709\|35\|NC_014210\|PILER-CR	5555709-5555743	35	NZ_CP035511	Haematobacter massiliensis strain OT1 plasmid pOT1-1, complete sequence	113-147	9	0.743
NC_014210_23	23.15\|5555709\|35\|NC_014210\|PILER-CR	5555709-5555743	35	NZ_CP054621	Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence	386438-386472	9	0.743
NC_014210_23	23.17\|5555831\|35\|NC_014210\|PILER-CR	5555831-5555865	35	MG592671	Vibrio phage 2.275.O._10N.286.54.E11, partial genome	88955-88989	9	0.743
NC_014210_7	7.9\|1581936\|32\|NC_014210\|CRISPRCasFinder,CRT	1581936-1581967	32	NC_017958	Tistrella mobilis KA081020-065 plasmid pTM3, complete sequence	311085-311116	10	0.688
NC_014210_8	8.3\|1587611\|33\|NC_014210\|PILER-CR	1587611-1587643	33	NZ_LR134456	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 14, complete sequence	347137-347169	10	0.697
NC_014210_8	8.3\|1587611\|33\|NC_014210\|PILER-CR	1587611-1587643	33	NC_009717	Xanthobacter autotrophicus Py2 plasmid pXAUT01, complete sequence	279475-279507	10	0.697
NC_014210_8	8.7\|1587855\|33\|NC_014210\|PILER-CR	1587855-1587887	33	NC_012811	Methylorubrum extorquens AM1 megaplasmid, complete sequence	1003831-1003863	10	0.697
NC_014210_8	8.9\|1587977\|33\|NC_014210\|PILER-CR	1587977-1588009	33	NZ_CP014519	Sinomonas atrocyanea strain KCTC 3377 plasmid pSA01, complete sequence	54920-54952	10	0.697
NC_014210_8	8.11\|1588099\|33\|NC_014210\|PILER-CR	1588099-1588131	33	NZ_CP018784	Curtobacterium pusillum strain AA3 plasmid pCPAA3, complete sequence	323908-323940	10	0.697
NC_014210_8	8.14\|1587612\|32\|NC_014210\|CRISPRCasFinder,CRT	1587612-1587643	32	NZ_CP032324	Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence	537174-537205	10	0.688
NC_014210_8	8.14\|1587612\|32\|NC_014210\|CRISPRCasFinder,CRT	1587612-1587643	32	NZ_LR134456	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 14, complete sequence	347137-347168	10	0.688
NC_014210_8	8.14\|1587612\|32\|NC_014210\|CRISPRCasFinder,CRT	1587612-1587643	32	NC_009717	Xanthobacter autotrophicus Py2 plasmid pXAUT01, complete sequence	279475-279506	10	0.688
NC_014210_8	8.16\|1587734\|32\|NC_014210\|CRISPRCasFinder,CRT	1587734-1587765	32	JN638751	Bacillus phage G, complete genome	413994-414025	10	0.688
NC_014210_8	8.22\|1588100\|32\|NC_014210\|CRISPRCasFinder,CRT	1588100-1588131	32	NZ_CP018784	Curtobacterium pusillum strain AA3 plasmid pCPAA3, complete sequence	323908-323939	10	0.688
NC_014210_8	8.22\|1588100\|32\|NC_014210\|CRISPRCasFinder,CRT	1588100-1588131	32	NZ_CP016620	Microvirga ossetica strain V5/3m plasmid unnamed4, complete sequence	490649-490680	10	0.688
NC_014210_9	9.7\|1595426\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595426-1595457	32	NC_017958	Tistrella mobilis KA081020-065 plasmid pTM3, complete sequence	998638-998669	10	0.688
NC_014210_9	9.8\|1595487\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595487-1595518	32	MT114166	Microbacterium phage Nike, complete genome	28820-28851	10	0.688
NC_014210_9	9.8\|1595487\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595487-1595518	32	NC_047975	Microbacterium phage Squash, complete genome	28831-28862	10	0.688
NC_014210_9	9.10\|1595610\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595610-1595641	32	NZ_CP020385	Rhodovulum sp. MB263 plasmid pRSMBA, complete sequence	35509-35540	10	0.688
NC_014210_10	10.3\|1602896\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1602896-1602927	32	MN694036	Marine virus AFVG_250M883, complete genome	34195-34226	10	0.688
NC_014210_10	10.3\|1602896\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1602896-1602927	32	MN694324	Marine virus AFVG_250M884, complete genome	1665-1696	10	0.688
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	NC_016623	Azospirillum lipoferum 4B plasmid AZO_p3, complete sequence	245480-245511	10	0.688
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	NC_023286	Streptomyces sp. F12 plasmid pFRL6, complete sequence	387985-388016	10	0.688
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	560131-560162	10	0.688
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	NC_013856	Azospirillum sp. B510 plasmid pAB510b, complete sequence	61701-61732	10	0.688
NC_014210_10	10.8\|1603201\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603201-1603232	32	NZ_CP032325	Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence	363872-363903	10	0.688
NC_014210_10	10.8\|1603201\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603201-1603232	32	NZ_CP007796	Azospirillum brasilense strain Az39 plasmid AbAZ39_p3, complete sequence	317524-317555	10	0.688
NC_014210_10	10.8\|1603201\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603201-1603232	32	NZ_CP032342	Azospirillum brasilense strain MTCC4038 plasmid p3, complete sequence	177069-177100	10	0.688
NC_014210_10	10.8\|1603201\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603201-1603232	32	NZ_CP033321	Azospirillum brasilense strain Cd plasmid p3, complete sequence	610958-610989	10	0.688
NC_014210_10	10.8\|1603201\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603201-1603232	32	NZ_CP033315	Azospirillum brasilense strain Sp 7 plasmid p3, complete sequence	26557-26588	10	0.688
NC_014210_10	10.10\|1603323\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603323-1603354	32	NZ_LR594673	Variovorax sp. PBL-E5 plasmid 3	194654-194685	10	0.688
NC_014210_10	10.10\|1603323\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603323-1603354	32	NZ_CP039640	Azospirillum sp. TSH100 plasmid p1, complete sequence	15006-15037	10	0.688
NC_014210_11	11.1\|1638373\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1638373-1638404	32	NZ_CP032688	Rhizobium sp. CCGE531 plasmid pRCCGE531a, complete sequence	242576-242607	10	0.688
NC_014210_11	11.1\|1638373\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1638373-1638404	32	NZ_CP032693	Rhizobium sp. CCGE532 plasmid pRCCGE532a, complete sequence	242565-242596	10	0.688
NC_014210_11	11.1\|1638373\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1638373-1638404	32	NZ_CP006987	Rhizobium sp. IE4771 plasmid pRetIE4771a, complete sequence	87049-87080	10	0.688
NC_014210_11	11.1\|1638373\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1638373-1638404	32	NZ_CP013523	Rhizobium phaseoli strain R744 plasmid pRphaR744a, complete sequence	129418-129449	10	0.688
NC_014210_11	11.1\|1638373\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1638373-1638404	32	NZ_CP017103	Rhizobium gallicum strain IE4872 plasmid pRgalIE4872a, complete sequence	29281-29312	10	0.688
NC_014210_11	11.1\|1638373\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1638373-1638404	32	CP006878	Rhizobium gallicum bv. gallicum R602 plasmid pRgalR602a, complete sequence	60293-60324	10	0.688
NC_014210_11	11.1\|1638373\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1638373-1638404	32	NZ_CP034999	Rhizobium acidisoli strain FH23 plasmid pRapFH23a, complete sequence	361423-361454	10	0.688
NC_014210_11	11.1\|1638373\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1638373-1638404	32	NC_022235	Sphingomonas sp. ERG5 plasmid pCADAB1, complete sequence	46580-46611	10	0.688
NC_014210_11	11.5\|1638616\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1638616-1638647	32	NZ_CP025506	Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvE, complete sequence	149369-149400	10	0.688
NC_014210_11	11.5\|1638616\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1638616-1638647	32	NZ_CP022668	Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR3, complete sequence	38677-38708	10	0.688
NC_014210_12	12.4\|1645572\|31\|NC_014210\|CRT	1645572-1645602	31	NZ_CP025431	Paracoccus zhejiangensis strain J6 plasmid pPZ01, complete sequence	194972-195002	10	0.677
NC_014210_13	13.1\|1662471\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1662471-1662502	32	NC_017958	Tistrella mobilis KA081020-065 plasmid pTM3, complete sequence	838342-838373	10	0.688
NC_014210_13	13.2\|1662532\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1662532-1662563	32	NZ_CP039340	Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence	1500969-1501000	10	0.688
NC_014210_13	13.2\|1662532\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1662532-1662563	32	NZ_HG938356	Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141 plasmid pHAMBI1141a, complete sequence	203197-203228	10	0.688
NC_014210_13	13.2\|1662532\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1662532-1662563	32	NZ_CP017563	Paraburkholderia sprentiae WSM5005 plasmid pl1WSM5005, complete sequence	198072-198103	10	0.688
NC_014210_13	13.4\|1662654\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1662654-1662685	32	NZ_AP022319	Burkholderia sp. THE68 plasmid BTHE68_p1, complete sequence	454056-454087	10	0.688
NC_014210_13	13.5\|1662715\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1662715-1662746	32	NC_008271	Rhodococcus jostii RHA1 plasmid pRHL3, complete sequence	135828-135859	10	0.688
NC_014210_14	14.1\|2013540\|32\|NC_014210\|PILER-CR,CRISPRCasFinder	2013540-2013571	32	MN961671	Pseudomonas aeruginosa strain 201330 plasmid p201330-IMP, complete sequence	4807-4838	10	0.688
NC_014210_14	14.1\|2013540\|32\|NC_014210\|PILER-CR,CRISPRCasFinder	2013540-2013571	32	MN961672	Pseudomonas aeruginosa strain PA15W plasmid pPA15W-NR, complete sequence	4804-4835	10	0.688
NC_014210_14	14.4\|2013721\|32\|NC_014210\|CRISPRCasFinder	2013721-2013752	32	NC_011273	Mycobacterium phage Myrna, complete genome	89108-89139	10	0.688
NC_014210_14	14.5\|2013782\|32\|NC_014210\|CRISPRCasFinder	2013782-2013813	32	NZ_CP013268	Sphingobium baderi strain DE-13 plasmid pDE4, complete sequence	11256-11287	10	0.688
NC_014210_14	14.8\|2013965\|32\|NC_014210\|CRISPRCasFinder	2013965-2013996	32	NZ_CP016613	Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence	1541516-1541547	10	0.688
NC_014210_14	14.8\|2013965\|32\|NC_014210\|CRISPRCasFinder	2013965-2013996	32	NZ_CP049790	Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence	966798-966829	10	0.688
NC_014210_14	14.8\|2013965\|32\|NC_014210\|CRISPRCasFinder	2013965-2013996	32	NZ_CP049794	Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence	1705049-1705080	10	0.688
NC_014210_14	14.8\|2013965\|32\|NC_014210\|CRISPRCasFinder	2013965-2013996	32	NZ_CP049788	Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence	1013293-1013324	10	0.688
NC_014210_14	14.8\|2013965\|32\|NC_014210\|CRISPRCasFinder	2013965-2013996	32	NZ_CP022766	Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence	1156950-1156981	10	0.688
NC_014210_14	14.8\|2013965\|32\|NC_014210\|CRISPRCasFinder	2013965-2013996	32	NZ_CP016555	Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence	724634-724665	10	0.688
NC_014210_14	14.8\|2013965\|32\|NC_014210\|CRISPRCasFinder	2013965-2013996	32	NZ_CP049792	Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence	1480210-1480241	10	0.688
NC_014210_14	14.8\|2013965\|32\|NC_014210\|CRISPRCasFinder	2013965-2013996	32	NZ_CP052069	Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence	1089397-1089428	10	0.688
NC_014210_14	14.8\|2013965\|32\|NC_014210\|CRISPRCasFinder	2013965-2013996	32	NZ_CP016915	Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence	1562287-1562318	10	0.688
NC_014210_14	14.8\|2013965\|32\|NC_014210\|CRISPRCasFinder	2013965-2013996	32	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	1394144-1394175	10	0.688
NC_014210_14	14.8\|2013965\|32\|NC_014210\|CRISPRCasFinder	2013965-2013996	32	NZ_CP022769	Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence	1164701-1164732	10	0.688
NC_014210_14	14.8\|2013965\|32\|NC_014210\|CRISPRCasFinder	2013965-2013996	32	NZ_CP015851	Ralstonia solanacearum strain YC40-M plasmid, complete sequence	1273663-1273694	10	0.688
NC_014210_14	14.8\|2013965\|32\|NC_014210\|CRISPRCasFinder	2013965-2013996	32	NZ_CP022773	Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence	879556-879587	10	0.688
NC_014210_14	14.8\|2013965\|32\|NC_014210\|CRISPRCasFinder	2013965-2013996	32	NZ_CP052071	Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence	1086558-1086589	10	0.688
NC_014210_14	14.8\|2013965\|32\|NC_014210\|CRISPRCasFinder	2013965-2013996	32	NZ_CP022779	Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence	1164690-1164721	10	0.688
NC_014210_14	14.8\|2013965\|32\|NC_014210\|CRISPRCasFinder	2013965-2013996	32	NZ_CP052075	Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence	1086525-1086556	10	0.688
NC_014210_14	14.8\|2013965\|32\|NC_014210\|CRISPRCasFinder	2013965-2013996	32	NZ_CP052085	Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence	1147337-1147368	10	0.688
NC_014210_14	14.8\|2013965\|32\|NC_014210\|CRISPRCasFinder	2013965-2013996	32	NZ_CP052095	Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence	1174943-1174974	10	0.688
NC_014210_14	14.8\|2013965\|32\|NC_014210\|CRISPRCasFinder	2013965-2013996	32	NZ_CP052105	Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence	1086526-1086557	10	0.688
NC_014210_14	14.8\|2013965\|32\|NC_014210\|CRISPRCasFinder	2013965-2013996	32	NZ_CP052077	Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence	1068853-1068884	10	0.688
NC_014210_14	14.8\|2013965\|32\|NC_014210\|CRISPRCasFinder	2013965-2013996	32	NZ_CP052087	Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence	1147337-1147368	10	0.688
NC_014210_14	14.8\|2013965\|32\|NC_014210\|CRISPRCasFinder	2013965-2013996	32	NZ_CP052097	Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence	1174943-1174974	10	0.688
NC_014210_14	14.8\|2013965\|32\|NC_014210\|CRISPRCasFinder	2013965-2013996	32	NZ_CP052115	Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence	1086539-1086570	10	0.688
NC_014210_14	14.8\|2013965\|32\|NC_014210\|CRISPRCasFinder	2013965-2013996	32	NZ_CP052127	Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence	1147337-1147368	10	0.688
NC_014210_14	14.8\|2013965\|32\|NC_014210\|CRISPRCasFinder	2013965-2013996	32	NZ_CP052079	Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence	1068876-1068907	10	0.688
NC_014210_14	14.8\|2013965\|32\|NC_014210\|CRISPRCasFinder	2013965-2013996	32	NZ_CP052089	Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence	1147341-1147372	10	0.688
NC_014210_14	14.8\|2013965\|32\|NC_014210\|CRISPRCasFinder	2013965-2013996	32	NZ_CP052093	Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence	1174943-1174974	10	0.688
NC_014210_14	14.8\|2013965\|32\|NC_014210\|CRISPRCasFinder	2013965-2013996	32	NZ_CP052101	Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence	1174943-1174974	10	0.688
NC_014210_14	14.8\|2013965\|32\|NC_014210\|CRISPRCasFinder	2013965-2013996	32	NZ_CP052099	Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence	1174943-1174974	10	0.688
NC_014210_14	14.8\|2013965\|32\|NC_014210\|CRISPRCasFinder	2013965-2013996	32	NZ_CP052107	Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence	1086539-1086570	10	0.688
NC_014210_14	14.8\|2013965\|32\|NC_014210\|CRISPRCasFinder	2013965-2013996	32	NZ_CP022781	Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence	879292-879323	10	0.688
NC_014210_14	14.8\|2013965\|32\|NC_014210\|CRISPRCasFinder	2013965-2013996	32	NZ_CP052117	Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence	1086528-1086559	10	0.688
NC_014210_14	14.8\|2013965\|32\|NC_014210\|CRISPRCasFinder	2013965-2013996	32	NZ_CP052125	Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence	1068876-1068907	10	0.688
NC_014210_14	14.8\|2013965\|32\|NC_014210\|CRISPRCasFinder	2013965-2013996	32	NZ_CP022793	Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence	1087493-1087524	10	0.688
NC_014210_14	14.8\|2013965\|32\|NC_014210\|CRISPRCasFinder	2013965-2013996	32	NZ_CP022785	Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence	1068162-1068193	10	0.688
NC_014210_14	14.8\|2013965\|32\|NC_014210\|CRISPRCasFinder	2013965-2013996	32	NZ_CP022787	Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence	1115826-1115857	10	0.688
NC_014210_14	14.8\|2013965\|32\|NC_014210\|CRISPRCasFinder	2013965-2013996	32	NZ_CP022756	Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence	1162270-1162301	10	0.688
NC_014210_14	14.8\|2013965\|32\|NC_014210\|CRISPRCasFinder	2013965-2013996	32	NZ_CP052129	Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence	1010217-1010248	10	0.688
NC_014210_14	14.8\|2013965\|32\|NC_014210\|CRISPRCasFinder	2013965-2013996	32	NZ_CP052121	Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence	1086528-1086559	10	0.688
NC_014210_14	14.8\|2013965\|32\|NC_014210\|CRISPRCasFinder	2013965-2013996	32	NZ_CP052123	Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence	1068876-1068907	10	0.688
NC_014210_14	14.8\|2013965\|32\|NC_014210\|CRISPRCasFinder	2013965-2013996	32	NZ_CP052131	Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence	1147336-1147367	10	0.688
NC_014210_14	14.8\|2013965\|32\|NC_014210\|CRISPRCasFinder	2013965-2013996	32	NZ_CP052073	Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence	1086524-1086555	10	0.688
NC_014210_14	14.8\|2013965\|32\|NC_014210\|CRISPRCasFinder	2013965-2013996	32	NZ_CP052081	Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence	1068876-1068907	10	0.688
NC_014210_14	14.8\|2013965\|32\|NC_014210\|CRISPRCasFinder	2013965-2013996	32	NZ_CP052083	Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence	1068876-1068907	10	0.688
NC_014210_14	14.8\|2013965\|32\|NC_014210\|CRISPRCasFinder	2013965-2013996	32	NZ_CP052109	Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence	1086539-1086570	10	0.688
NC_014210_14	14.8\|2013965\|32\|NC_014210\|CRISPRCasFinder	2013965-2013996	32	NZ_CP052091	Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence	1174944-1174975	10	0.688
NC_014210_14	14.8\|2013965\|32\|NC_014210\|CRISPRCasFinder	2013965-2013996	32	NZ_CP052103	Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence	1086550-1086581	10	0.688
NC_014210_14	14.8\|2013965\|32\|NC_014210\|CRISPRCasFinder	2013965-2013996	32	NZ_CP052119	Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence	1086528-1086559	10	0.688
NC_014210_14	14.9\|2014026\|32\|NC_014210\|CRISPRCasFinder	2014026-2014057	32	NZ_CP007129	Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence	491938-491969	10	0.688
NC_014210_14	14.9\|2014026\|32\|NC_014210\|CRISPRCasFinder	2014026-2014057	32	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	1395843-1395874	10	0.688
NC_014210_14	14.9\|2014026\|32\|NC_014210\|CRISPRCasFinder	2014026-2014057	32	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	181398-181429	10	0.688
NC_014210_14	14.9\|2014026\|32\|NC_014210\|CRISPRCasFinder	2014026-2014057	32	NZ_CP029542	Streptomyces sp. NEAU-S7GS2 plasmid unnamed1, complete sequence	13634-13665	10	0.688
NC_014210_14	14.12\|2014209\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014209-2014240	32	NZ_CP030829	Neorhizobium sp. NCHU2750 plasmid pNCHU2750b, complete sequence	54729-54760	10	0.688
NC_014210_14	14.14\|2014331\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014331-2014362	32	NZ_CP009619	Vibrio coralliilyticus strain RE98 plasmid p380, complete sequence	21931-21962	10	0.688
NC_014210_14	14.17\|2014514\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014514-2014545	32	CP031285	Escherichia fergusonii strain 40A plasmid p46_40A, complete sequence	32140-32171	10	0.688
NC_014210_14	14.17\|2014514\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014514-2014545	32	NZ_CP022502	Salmonella enterica subsp. enterica serovar Kentucky str. SA20030505 plasmid unnamed2, complete sequence	42921-42952	10	0.688
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	MG925355	Mycobacterium phage OlanP, complete genome	32997-33028	10	0.688
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	AP018479	Mycobacterium phage GS4E DNA, complete sequence	33290-33321	10	0.688
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	NC_023606	Mycobacterium phage CRB1, complete genome	33655-33686	10	0.688
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	KX523125	Mycobacterium phage BuzzBuzz, complete genome	32967-32998	10	0.688
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	MH047632	Mycobacterium phage Puppy, complete genome	32396-32427	10	0.688
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	MK494094	Mycobacterium phage DirtyDunning, complete genome	32511-32542	10	0.688
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	MT310878	Mycobacterium phage MK4, complete genome	32190-32221	10	0.688
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	MH047633	Mycobacterium phage Pistachio, complete genome	32323-32354	10	0.688
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	NC_028914	Mycobacterium phage Sheen, complete genome	34745-34776	10	0.688
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	MF185729	Mycobacterium phage KADY, complete genome	32967-32998	10	0.688
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	MH051259	Mycobacterium phage TNguyen7, complete genome	32743-32774	10	0.688
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	MN096368	Mycobacterium phage Soshari, complete genome	32963-32994	10	0.688
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	KY204250	Mycobacterium phage Kratark, complete genome	32653-32684	10	0.688
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	MN062706	Mycobacterium phage Heathen, complete genome	32405-32436	10	0.688
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	NC_004682	Mycobacterium virus Bxz2, complete genome	32974-33005	10	0.688
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	KY464936	Mycobacterium phage Idleandcovert, complete genome	32776-32807	10	0.688
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	MK433273	Mycobacterium phage Daishi, complete genome	31808-31839	10	0.688
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	MH513984	Mycobacterium phage Steamy, complete genome	32249-32280	10	0.688
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	KM233455	Mycobacterium phage Farber, complete genome	32929-32960	10	0.688
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	KX670788	Mycobacterium phage Louie6, complete genome	32968-32999	10	0.688
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	NC_042036	Mycobacterium phage Rockstar, complete genome	32199-32230	10	0.688
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	MT658804	Mycobacterium phage BengiVuitton, complete genome	33265-33296	10	0.688
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	MN586063	Mycobacterium phage Isca, complete genome	32205-32236	10	0.688
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	MN585984	Mycobacterium phage AgronaGT15, complete genome	32788-32819	10	0.688
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	NC_023597	Mycobacterium phage 20ES, complete genome	33312-33343	10	0.688
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	MF140403	Mycobacterium phage Changeling, complete genome	33364-33395	10	0.688
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	MK494093	Mycobacterium phage Phighter1804, complete genome	32556-32587	10	0.688
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	NC_042328	Mycobacterium virus HelDan, complete genome	32657-32688	10	0.688
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	MH513975	Mycobacterium phage Misomonster, complete genome	32966-32997	10	0.688
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	MF373840	Mycobacterium phage Fred313, complete genome	32349-32380	10	0.688
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	KC172839	Mycobacterium phage BTCU-1, complete genome	32351-32382	10	0.688
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	KP017310	Mycobacterium phage Phoxy, complete genome	32964-32995	10	0.688
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	KT588442	Mycobacterium phage LadyBird, complete genome	33623-33654	10	0.688
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	MT310886	Mycobacterium phage AN3, complete genome	33683-33714	10	0.688
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	JX899358	Mycobacterium phage First, complete genome	33188-33219	10	0.688
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	KJ510415	Mycobacterium phage Phantastic, complete genome	32394-32425	10	0.688
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	NC_042339	Mycobacterium virus Arturo, complete genome	32770-32801	10	0.688
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	MF472895	Mycobacterium phage Kimona, complete genome	31098-31129	10	0.688
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	KP017311	Mycobacterium phage Spike509, complete genome	32964-32995	10	0.688
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	KU761559	Mycobacterium phage ArcherNM, complete genome	32781-32812	10	0.688
NC_014210_14	14.23\|2014880\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014880-2014911	32	NZ_CP030263	Ensifer adhaerens strain Corn53 plasmid AA, complete sequence	1623829-1623860	10	0.688
NC_014210_14	14.28\|2015185\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2015185-2015216	32	JF974300	Synechococcus phage S-CBP42, * SEQUENCING IN PROGRESS *, 8 unordered pieces	9054-9085	10	0.688
NC_014210_14	14.28\|2015185\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2015185-2015216	32	KC310805	Synechococcus phage S-CBP42, complete genome	22266-22297	10	0.688
NC_014210_14	14.29\|2015246\|32\|NC_014210\|CRISPRCasFinder	2015246-2015277	32	MN175386	Klebsiella pneumoniae strain KP-13-14 plasmid pKP-13-14-NDM-9, complete sequence	212108-212139	10	0.688
NC_014210_14	14.29\|2015246\|32\|NC_014210\|CRISPRCasFinder	2015246-2015277	32	NZ_CP035002	Rhizobium acidisoli strain FH23 plasmid pRapFH23d, complete sequence	798817-798848	10	0.688
NC_014210_14	14.29\|2015246\|32\|NC_014210\|CRISPRCasFinder	2015246-2015277	32	MH697582	Mycobacterium phage Ejimix, complete genome	79566-79597	10	0.688
NC_014210_14	14.29\|2015246\|32\|NC_014210\|CRISPRCasFinder	2015246-2015277	32	MF919504	Mycobacterium phage DmpstrDiver, complete genome	79417-79448	10	0.688
NC_014210_14	14.29\|2015246\|32\|NC_014210\|CRISPRCasFinder	2015246-2015277	32	MH077579	Mycobacterium phage Halley, complete genome	79882-79913	10	0.688
NC_014210_14	14.29\|2015246\|32\|NC_014210\|CRISPRCasFinder	2015246-2015277	32	MK524521	Mycobacterium phage Schatzie, complete genome	79674-79705	10	0.688
NC_014210_14	14.29\|2015246\|32\|NC_014210\|CRISPRCasFinder	2015246-2015277	32	MN062701	Mycobacterium phage Dallas, complete genome	79498-79529	10	0.688
NC_014210_14	14.61\|2013965\|31\|NC_014210\|PILER-CR	2013965-2013995	31	NZ_CP016613	Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence	1541517-1541547	10	0.677
NC_014210_14	14.61\|2013965\|31\|NC_014210\|PILER-CR	2013965-2013995	31	NZ_CP049790	Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence	966799-966829	10	0.677
NC_014210_14	14.61\|2013965\|31\|NC_014210\|PILER-CR	2013965-2013995	31	NZ_CP049794	Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence	1705049-1705079	10	0.677
NC_014210_14	14.61\|2013965\|31\|NC_014210\|PILER-CR	2013965-2013995	31	NZ_CP049788	Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence	1013293-1013323	10	0.677
NC_014210_14	14.61\|2013965\|31\|NC_014210\|PILER-CR	2013965-2013995	31	NZ_CP022766	Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence	1156950-1156980	10	0.677
NC_014210_14	14.61\|2013965\|31\|NC_014210\|PILER-CR	2013965-2013995	31	NZ_CP016555	Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence	724635-724665	10	0.677
NC_014210_14	14.61\|2013965\|31\|NC_014210\|PILER-CR	2013965-2013995	31	NZ_CP049792	Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence	1480210-1480240	10	0.677
NC_014210_14	14.61\|2013965\|31\|NC_014210\|PILER-CR	2013965-2013995	31	NZ_CP052069	Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence	1089397-1089427	10	0.677
NC_014210_14	14.61\|2013965\|31\|NC_014210\|PILER-CR	2013965-2013995	31	NZ_CP016915	Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence	1562288-1562318	10	0.677
NC_014210_14	14.61\|2013965\|31\|NC_014210\|PILER-CR	2013965-2013995	31	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	1394144-1394174	10	0.677
NC_014210_14	14.61\|2013965\|31\|NC_014210\|PILER-CR	2013965-2013995	31	NZ_CP022769	Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence	1164701-1164731	10	0.677
NC_014210_14	14.61\|2013965\|31\|NC_014210\|PILER-CR	2013965-2013995	31	NZ_CP015851	Ralstonia solanacearum strain YC40-M plasmid, complete sequence	1273663-1273693	10	0.677
NC_014210_14	14.61\|2013965\|31\|NC_014210\|PILER-CR	2013965-2013995	31	NZ_CP022773	Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence	879556-879586	10	0.677
NC_014210_14	14.61\|2013965\|31\|NC_014210\|PILER-CR	2013965-2013995	31	NZ_CP052071	Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence	1086559-1086589	10	0.677
NC_014210_14	14.61\|2013965\|31\|NC_014210\|PILER-CR	2013965-2013995	31	NZ_CP022779	Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence	1164690-1164720	10	0.677
NC_014210_14	14.61\|2013965\|31\|NC_014210\|PILER-CR	2013965-2013995	31	NZ_CP052075	Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence	1086526-1086556	10	0.677
NC_014210_14	14.61\|2013965\|31\|NC_014210\|PILER-CR	2013965-2013995	31	NZ_CP052085	Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence	1147337-1147367	10	0.677
NC_014210_14	14.61\|2013965\|31\|NC_014210\|PILER-CR	2013965-2013995	31	NZ_CP052095	Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence	1174943-1174973	10	0.677
NC_014210_14	14.61\|2013965\|31\|NC_014210\|PILER-CR	2013965-2013995	31	NZ_CP052105	Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence	1086527-1086557	10	0.677
NC_014210_14	14.61\|2013965\|31\|NC_014210\|PILER-CR	2013965-2013995	31	NZ_CP052077	Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence	1068853-1068883	10	0.677
NC_014210_14	14.61\|2013965\|31\|NC_014210\|PILER-CR	2013965-2013995	31	NZ_CP052087	Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence	1147337-1147367	10	0.677
NC_014210_14	14.61\|2013965\|31\|NC_014210\|PILER-CR	2013965-2013995	31	NZ_CP052097	Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence	1174943-1174973	10	0.677
NC_014210_14	14.61\|2013965\|31\|NC_014210\|PILER-CR	2013965-2013995	31	NZ_CP052115	Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence	1086540-1086570	10	0.677
NC_014210_14	14.61\|2013965\|31\|NC_014210\|PILER-CR	2013965-2013995	31	NZ_CP052127	Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence	1147337-1147367	10	0.677
NC_014210_14	14.61\|2013965\|31\|NC_014210\|PILER-CR	2013965-2013995	31	NZ_CP052079	Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence	1068876-1068906	10	0.677
NC_014210_14	14.61\|2013965\|31\|NC_014210\|PILER-CR	2013965-2013995	31	NZ_CP052089	Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence	1147341-1147371	10	0.677
NC_014210_14	14.61\|2013965\|31\|NC_014210\|PILER-CR	2013965-2013995	31	NZ_CP052093	Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence	1174943-1174973	10	0.677
NC_014210_14	14.61\|2013965\|31\|NC_014210\|PILER-CR	2013965-2013995	31	NZ_CP052101	Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence	1174943-1174973	10	0.677
NC_014210_14	14.61\|2013965\|31\|NC_014210\|PILER-CR	2013965-2013995	31	NZ_CP052099	Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence	1174943-1174973	10	0.677
NC_014210_14	14.61\|2013965\|31\|NC_014210\|PILER-CR	2013965-2013995	31	NZ_CP052107	Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence	1086540-1086570	10	0.677
NC_014210_14	14.61\|2013965\|31\|NC_014210\|PILER-CR	2013965-2013995	31	NZ_CP022781	Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence	879293-879323	10	0.677
NC_014210_14	14.61\|2013965\|31\|NC_014210\|PILER-CR	2013965-2013995	31	NZ_CP052117	Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence	1086529-1086559	10	0.677
NC_014210_14	14.61\|2013965\|31\|NC_014210\|PILER-CR	2013965-2013995	31	NZ_CP052125	Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence	1068876-1068906	10	0.677
NC_014210_14	14.61\|2013965\|31\|NC_014210\|PILER-CR	2013965-2013995	31	NZ_CP022793	Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence	1087493-1087523	10	0.677
NC_014210_14	14.61\|2013965\|31\|NC_014210\|PILER-CR	2013965-2013995	31	NZ_CP022785	Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence	1068162-1068192	10	0.677
NC_014210_14	14.61\|2013965\|31\|NC_014210\|PILER-CR	2013965-2013995	31	NZ_CP022787	Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence	1115826-1115856	10	0.677
NC_014210_14	14.61\|2013965\|31\|NC_014210\|PILER-CR	2013965-2013995	31	NZ_CP022756	Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence	1162270-1162300	10	0.677
NC_014210_14	14.61\|2013965\|31\|NC_014210\|PILER-CR	2013965-2013995	31	NZ_CP052129	Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence	1010218-1010248	10	0.677
NC_014210_14	14.61\|2013965\|31\|NC_014210\|PILER-CR	2013965-2013995	31	NZ_CP052121	Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence	1086529-1086559	10	0.677
NC_014210_14	14.61\|2013965\|31\|NC_014210\|PILER-CR	2013965-2013995	31	NZ_CP052123	Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence	1068876-1068906	10	0.677
NC_014210_14	14.61\|2013965\|31\|NC_014210\|PILER-CR	2013965-2013995	31	NZ_CP052131	Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence	1147336-1147366	10	0.677
NC_014210_14	14.61\|2013965\|31\|NC_014210\|PILER-CR	2013965-2013995	31	NZ_CP052073	Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence	1086525-1086555	10	0.677
NC_014210_14	14.61\|2013965\|31\|NC_014210\|PILER-CR	2013965-2013995	31	NZ_CP052081	Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence	1068876-1068906	10	0.677
NC_014210_14	14.61\|2013965\|31\|NC_014210\|PILER-CR	2013965-2013995	31	NZ_CP052083	Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence	1068876-1068906	10	0.677
NC_014210_14	14.61\|2013965\|31\|NC_014210\|PILER-CR	2013965-2013995	31	NZ_CP052109	Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence	1086540-1086570	10	0.677
NC_014210_14	14.61\|2013965\|31\|NC_014210\|PILER-CR	2013965-2013995	31	NZ_CP052091	Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence	1174944-1174974	10	0.677
NC_014210_14	14.61\|2013965\|31\|NC_014210\|PILER-CR	2013965-2013995	31	NZ_CP052103	Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence	1086551-1086581	10	0.677
NC_014210_14	14.61\|2013965\|31\|NC_014210\|PILER-CR	2013965-2013995	31	NZ_CP052119	Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence	1086529-1086559	10	0.677
NC_014210_23	23.3\|5555711\|32\|NC_014210\|CRISPRCasFinder	5555711-5555742	32	NZ_CP032326	Azospirillum brasilense strain MTCC4035 plasmid p5, complete sequence	80139-80170	10	0.688
NC_014210_23	23.3\|5555711\|32\|NC_014210\|CRISPRCasFinder	5555711-5555742	32	LN997843	Streptomyces reticuli genome assembly TUE45, plasmid : II	452395-452426	10	0.688
NC_014210_23	23.4\|5555772\|32\|NC_014210\|CRISPRCasFinder	5555772-5555803	32	NZ_CP034812	Paracoccus sp. Arc7-R13 plasmid unnamed3, complete sequence	50677-50708	10	0.688
NC_014210_23	23.4\|5555772\|32\|NC_014210\|CRISPRCasFinder	5555772-5555803	32	NZ_CP034812	Paracoccus sp. Arc7-R13 plasmid unnamed3, complete sequence	120501-120532	10	0.688
NC_014210_23	23.9\|5555708\|35\|NC_014210\|CRT	5555708-5555742	35	NZ_CP011627	Klebsiella oxytoca strain CAV1374 plasmid pCAV1374-14, complete sequence	6469-6503	10	0.714
NC_014210_23	23.15\|5555709\|35\|NC_014210\|PILER-CR	5555709-5555743	35	NZ_CP011627	Klebsiella oxytoca strain CAV1374 plasmid pCAV1374-14, complete sequence	6469-6503	10	0.714
NC_014210_7	7.4\|1581993\|36\|NC_014210\|PILER-CR	1581993-1582028	36	NZ_CP006368	Aureimonas sp. AU20 plasmid pAU20a, complete sequence	290099-290134	11	0.694
NC_014210_8	8.12\|1587490\|32\|NC_014210\|CRISPRCasFinder,CRT	1587490-1587521	32	MK095207	Pectobacterium phage Nobby_B3, complete genome	28256-28287	11	0.656
NC_014210_8	8.12\|1587490\|32\|NC_014210\|CRISPRCasFinder,CRT	1587490-1587521	32	MK095208	Pectobacterium phage Nobby_B4, complete genome	12535-12566	11	0.656
NC_014210_8	8.12\|1587490\|32\|NC_014210\|CRISPRCasFinder,CRT	1587490-1587521	32	MK095192	Pectobacterium phage Astalicious, complete genome	12212-12243	11	0.656
NC_014210_8	8.12\|1587490\|32\|NC_014210\|CRISPRCasFinder,CRT	1587490-1587521	32	MK095205	Pectobacterium phage Nobby_B1, complete genome	30512-30543	11	0.656
NC_014210_8	8.12\|1587490\|32\|NC_014210\|CRISPRCasFinder,CRT	1587490-1587521	32	MH807819	Pectobacterium phage Slant, complete genome	32262-32293	11	0.656
NC_014210_8	8.12\|1587490\|32\|NC_014210\|CRISPRCasFinder,CRT	1587490-1587521	32	MK095206	Pectobacterium phage Nobby_B2, complete genome	30414-30445	11	0.656
NC_014210_8	8.12\|1587490\|32\|NC_014210\|CRISPRCasFinder,CRT	1587490-1587521	32	MH807818	Pectobacterium phage Nobby, complete genome	30674-30705	11	0.656
NC_014210_8	8.14\|1587612\|32\|NC_014210\|CRISPRCasFinder,CRT	1587612-1587643	32	NZ_HG938354	Neorhizobium galegae bv. orientalis str. HAMBI 540 plasmid pHAMBI540a, complete sequence	359375-359406	11	0.656
NC_014210_8	8.22\|1588100\|32\|NC_014210\|CRISPRCasFinder,CRT	1588100-1588131	32	NC_018022	Mycolicibacterium chubuense NBB4 plasmid pMYCCH.01, complete sequence	335264-335295	11	0.656
NC_014210_9	9.8\|1595487\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1595487-1595518	32	NZ_CP031116	Rubrobacter indicoceani strain SCSIO 08198 plasmid unnamed1, complete sequence	168467-168498	11	0.656
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	MK112543	Mycobacterium Phage Kalb97, complete genome	32826-32857	11	0.656
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	MN497953	Mycobacterium phage GtownJaz, complete genome	32938-32969	11	0.656
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	MK967399	Mycobacterium phage Groupthink, complete genome	32827-32858	11	0.656
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	MG925341	Mycobacteriophage EpicPhail, complete genome	32940-32971	11	0.656
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	KX808129	Mycobacterium phage Sabinator, complete genome	32935-32966	11	0.656
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	MK359341	Mycobacterium phage GingkoMaracino, complete genome	32822-32853	11	0.656
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	JF704114	Mycobacterium phage Vix, complete genome	33019-33050	11	0.656
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	MK279913	Mycobacterium phage PotatoSplit, complete genome	32940-32971	11	0.656
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	MG757161	Mycobacterium phage LugYA, complete genome	32937-32968	11	0.656
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	MH536825	Mycobacterium phage Ollie, complete genome	32807-32838	11	0.656
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	MH020238	Mycobacterium phage Lilith, complete genome	32929-32960	11	0.656
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	MH077583	Mycobacterium phage PGHhamlin, complete genome	32928-32959	11	0.656
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	MT897907	Mycobacterium phage Grif, complete genome	33011-33042	11	0.656
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	MK310140	Mycobacterium phage Gemma, complete genome	32823-32854	11	0.656
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	MH155864	Mycobacterium phage Beauxregard13, complete genome	32940-32971	11	0.656
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	MH727554	Mycobacterium phage MuchMore, complete genome	32928-32959	11	0.656
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	MH338240	Mycobacterium phage Sabia, complete genome	32930-32961	11	0.656
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	KY965063	Mycobacterium phage PurpleHaze, complete genome	32826-32857	11	0.656
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	MN813699	Mycobacterium phage P28Green, complete genome	32939-32970	11	0.656
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	MT657331	Mycobacterium phage Manu, complete genome	32827-32858	11	0.656
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	MK494128	Mycobacterium phage Heliosoles, complete genome	32830-32861	11	0.656
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	MK279903	Mycobacterium phage Zetzy, complete genome	32499-32530	11	0.656
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	MN284900	Mycobacterium phage JeppNRM, complete genome	32828-32859	11	0.656
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	HM755814	Mycobacterium phage Wonder, complete genome	32377-32408	11	0.656
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	KU578077	Mycobacterium phage Marie, complete genome	32936-32967	11	0.656
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	MH450128	Mycobacterium phage Reba, complete genome	32486-32517	11	0.656
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	KT381277	Mycobacterium phage Wooldri, complete genome	32848-32879	11	0.656
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	MK875800	Mycobacterium phage MoneyMay, complete genome	32936-32967	11	0.656
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	KX664448	Mycobacterium phage Watson, complete genome	32928-32959	11	0.656
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	KX507362	Mycobacterium phage Aglet, complete genome	32937-32968	11	0.656
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	MN586048	Mycobacterium phage Fernando, complete genome	32936-32967	11	0.656
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	KU985091	Mycobacterium phage Hercules11, complete genome	32945-32976	11	0.656
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	NC_042310	Mycobacterium virus JHC117, complete genome	32935-32966	11	0.656
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	MH576949	Mycobacterium phage BreSam8, complete genome	32930-32961	11	0.656
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	MH450124	Mycobacterium phage Marius, complete genome	32824-32855	11	0.656
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	KP027202	Mycobacterium phage Taurus, complete genome	32936-32967	11	0.656
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	MH399776	Mycobacterium phage Grum1, complete genome	32936-32967	11	0.656
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	MN585969	Mycobacterium phage Dieselweasel, complete genome	32939-32970	11	0.656
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	KU255188	Mycobacterium phage JenCasNa, complete genome	32936-32967	11	0.656
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	KX458237	Mycobacterium phage Penny1, complete genome	32940-32971	11	0.656
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	NC_021535	Mycobacterium phage Jobu08, complete genome	32768-32799	11	0.656
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	MH536813	Mycobacterium phage AugsMagnumOpus, complete genome	32928-32959	11	0.656
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	MH450126	Mycobacterium phage PhishRPhriends, complete genome	32005-32036	11	0.656
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	MF185733	Mycobacterium phage StepMih, complete genome	32930-32961	11	0.656
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	MH450119	Mycobacterium phage Kalnoky, complete genome	32824-32855	11	0.656
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	MF185732	Mycobacterium phage Stagni, complete genome	32939-32970	11	0.656
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	MK494096	Mycobacterium phage Mainiac, complete genome	32930-32961	11	0.656
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	KU984914	Mycobacterium phage Malinsilva, complete genome	32928-32959	11	0.656
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	JF704101	Mycobacterium virus Microwolf, complete genome	32937-32968	11	0.656
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	NC_028757	Mycobacterium phage Tiffany, complete genome	32822-32853	11	0.656
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	MN062718	Mycobacterium phage SoilDragon, complete genome	32384-32415	11	0.656
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	KT359365	Mycobacterium phage DaHudson, complete genome	32929-32960	11	0.656
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	MH651179	Mycobacterium phage MadMarie, complete genome	32938-32969	11	0.656
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	MH371121	Mycobacterium phage Phranny, complete genome	32813-32844	11	0.656
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	KF279418	Mycobacterium phage Anubis, complete genome	32823-32854	11	0.656
NC_014210_14	14.19\|2014636\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014636-2014667	32	NC_028798	Mycobacterium phage MarQuardt, complete genome	32938-32969	11	0.656
NC_014210_14	14.23\|2014880\|32\|NC_014210\|CRISPRCasFinder,PILER-CR	2014880-2014911	32	NZ_CP015232	Epibacterium mobile F1926 plasmid unnamed2, complete sequence	107753-107784	11	0.656
NC_014210_23	23.3\|5555711\|32\|NC_014210\|CRISPRCasFinder	5555711-5555742	32	NC_017958	Tistrella mobilis KA081020-065 plasmid pTM3, complete sequence	589549-589580	11	0.656
NC_014210_23	23.4\|5555772\|32\|NC_014210\|CRISPRCasFinder	5555772-5555803	32	NC_011892	Methylobacterium nodulans ORS 2060 plasmid pMNOD01, complete sequence	112929-112960	11	0.656
NC_014210_14	14.47\|2014570\|37\|NC_014210\|CRT	2014570-2014606	37	NZ_CP009112	Rhodococcus opacus strain 1CP plasmid pR1CP1, complete sequence	215556-215592	12	0.676
NC_014210_10	10.5\|1603018\|32\|NC_014210\|PILER-CR,CRISPRCasFinder,CRT	1603018-1603049	32	CP000662	Rhodobacter sphaeroides ATCC 17025 plasmid pRSPA01, complete sequence	167814-167845	15	0.531

1. spacer 22.5|5217176|21|NC_014210|CRT matches to MN694508 (Marine virus AFVG_250M817, complete genome) position: , mismatch: 1, identity: 0.952

ctccatccacccctccccacc	CRISPR spacer
ctccacccacccctccccacc	Protospacer
*****.***************

2. spacer 10.9|1603262|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to CP054934 (Nocardiopsis flavescens strain NA01583 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.938

tgcgcggccgccgccttgtttgcccacgtccc	CRISPR spacer
tgcgcggccgccgccctgttcgcccacgtccc	Protospacer
***************.****.***********

3. spacer 22.1|5216933|21|NC_014210|CRT matches to NZ_CP020040 (Streptomyces sp. 3211 isolate 3 plasmid p3211-1, complete sequence) position: , mismatch: 2, identity: 0.905

tcacccggacccttcccgacc	CRISPR spacer
ccacccggacccttcccgacg	Protospacer
.*******************

4. spacer 22.1|5216933|21|NC_014210|CRT matches to NZ_CP020041 (Streptomyces sp. 3211 isolate 3 plasmid p3211-2, complete sequence) position: , mismatch: 2, identity: 0.905

tcacccggacccttcccgacc	CRISPR spacer
ccacccggacccttcccgacg	Protospacer
.*******************

5. spacer 22.2|5216994|21|NC_014210|CRT matches to NZ_CP020040 (Streptomyces sp. 3211 isolate 3 plasmid p3211-1, complete sequence) position: , mismatch: 2, identity: 0.905

tcacccggacccttcccgacc	CRISPR spacer
ccacccggacccttcccgacg	Protospacer
.*******************

6. spacer 22.2|5216994|21|NC_014210|CRT matches to NZ_CP020041 (Streptomyces sp. 3211 isolate 3 plasmid p3211-2, complete sequence) position: , mismatch: 2, identity: 0.905

tcacccggacccttcccgacc	CRISPR spacer
ccacccggacccttcccgacg	Protospacer
.*******************

7. spacer 22.3|5217055|21|NC_014210|CRT matches to NZ_CP020040 (Streptomyces sp. 3211 isolate 3 plasmid p3211-1, complete sequence) position: , mismatch: 2, identity: 0.905

tcacccggacccttcccgacc	CRISPR spacer
ccacccggacccttcccgacg	Protospacer
.*******************

8. spacer 22.3|5217055|21|NC_014210|CRT matches to NZ_CP020041 (Streptomyces sp. 3211 isolate 3 plasmid p3211-2, complete sequence) position: , mismatch: 2, identity: 0.905

tcacccggacccttcccgacc	CRISPR spacer
ccacccggacccttcccgacg	Protospacer
.*******************

9. spacer 7.9|1581936|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP021083 (Deinococcus ficus strain CC-FR2-10 plasmid pDFI2, complete sequence) position: , mismatch: 4, identity: 0.875

gacgacggggtcgctgctgctggccagggtgg	CRISPR spacer
gaccacggggtcgctgctgccggccaggacgg	Protospacer
*** ****************.*******..**

10. spacer 8.4|1587672|33|NC_014210|PILER-CR matches to MK359349 (Mycobacterium phage FoxtrotP1, complete genome) position: , mismatch: 5, identity: 0.848

caagaagttgcgcgggcgctggtccggactggt-	CRISPR spacer
caagaagttgcgcaggctctggt-cggcctgctg	Protospacer
*************.*** ***** *** *** *

11. spacer 8.15|1587673|32|NC_014210|CRISPRCasFinder,CRT matches to MK359349 (Mycobacterium phage FoxtrotP1, complete genome) position: , mismatch: 5, identity: 0.844

aagaagttgcgcgggcgctggtccggactggt-	CRISPR spacer
aagaagttgcgcaggctctggt-cggcctgctg	Protospacer
************.*** ***** *** *** *

12. spacer 12.4|1645572|31|NC_014210|CRT matches to NZ_CP024314 (Rhizobium sp. NXC24 plasmid pRspNXC24c, complete sequence) position: , mismatch: 5, identity: 0.839

acggcgtcaccgtgctcctggtcgat-gccgc	CRISPR spacer
tcggcgtcaccgtgcacctggtcgatcatcg-	Protospacer
 ************** ********** ..**

13. spacer 14.21|2014758|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NZ_CP013265 (Sphingobium baderi strain DE-13 plasmid pDE1, complete sequence) position: , mismatch: 5, identity: 0.844

ggatgacgcaagccgagatcgtccgggccacg	CRISPR spacer
gattgacgcaagccgcgatcgtcctggccatg	Protospacer
*. ************ ******** *****.*

14. spacer 14.62|2014026|31|NC_014210|PILER-CR matches to MT684599 (Gordonia Phage Sephiroth, complete genome) position: , mismatch: 5, identity: 0.839

gtgacgtcgtcgggcgtgtagagctcgcgct-	CRISPR spacer
ttgacgtcgtcgtgcgtgtagag-tagcgttg	Protospacer
 *********** ********** * ***.*

15. spacer 7.8|1581877|30|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP017076 (Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence) position: , mismatch: 6, identity: 0.8

ctccaagctctgacccagctcacgcctgaa	CRISPR spacer
ctcactgcgctgacccagcccacgcctgat	Protospacer
***   ** **********.*********

16. spacer 7.10|1581997|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP050092 (Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b6, complete sequence) position: , mismatch: 6, identity: 0.812

atcctcctgccgccgccctgggacgcgatgag	CRISPR spacer
atccgcctgccgccgccctggggcgcgacctc	Protospacer
**** *****************.*****.

17. spacer 8.3|1587611|33|NC_014210|PILER-CR matches to NZ_CP015231 (Epibacterium mobile F1926 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.818

cgccatcaacgccgccgcccgctccggtggtat--	CRISPR spacer
cgcaatcaacgccgccacccgctc--gcggtaggt	Protospacer
*** ************.*******  *.****

18. spacer 8.3|1587611|33|NC_014210|PILER-CR matches to NZ_CP015231 (Epibacterium mobile F1926 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.818

cgccatcaacgccgccgcccgctccggtggtat--	CRISPR spacer
cgcaatcaacgccgccacccgctc--gcggtaggt	Protospacer
*** ************.*******  *.****

19. spacer 8.14|1587612|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP015231 (Epibacterium mobile F1926 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.812

gccatcaacgccgccgcccgctccggtggtat--	CRISPR spacer
gcaatcaacgccgccacccgctc--gcggtaggt	Protospacer
** ************.*******  *.****

20. spacer 8.14|1587612|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP015231 (Epibacterium mobile F1926 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.812

gccatcaacgccgccgcccgctccggtggtat--	CRISPR spacer
gcaatcaacgccgccacccgctc--gcggtaggt	Protospacer
** ************.*******  *.****

21. spacer 9.3|1595182|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP021032 (Rhizobium sp. NXC14 plasmid pRspNXC14b, complete sequence) position: , mismatch: 6, identity: 0.812

cagcgtcgtcgaccccaggctg--acggaggtct	CRISPR spacer
cagcgtcgtcgatcccaggctgaaactaaggg--	Protospacer
************.*********  ** .***

22. spacer 9.3|1595182|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP053208 (Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1B, complete sequence) position: , mismatch: 6, identity: 0.812

cagcgtcgtcgaccccaggctga----cggaggtct	CRISPR spacer
cagcgtcgtcgatcccaggctgagattccgag----	Protospacer
************.**********    * ***

23. spacer 9.4|1595243|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP009803 (Streptomyces sp. FR-008 plasmid pSSFR1, complete sequence) position: , mismatch: 6, identity: 0.812

-cctgcggttgcggggttgtccgcgagcgggag	CRISPR spacer
ccctgtcg-tgcgggtttgtccgtgagcgggat	Protospacer
 ****. * ****** *******.********

24. spacer 9.4|1595243|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP016618 (Microvirga ossetica strain V5/3m plasmid unnamed3, complete sequence) position: , mismatch: 6, identity: 0.812

--cctgcggttgcggggttgtccgcgagcgggag	CRISPR spacer
atgctgcag--gcgtggttgtcggcgagcgggag	Protospacer
   ****.*  *** ******* ***********

25. spacer 9.4|1595243|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP016620 (Microvirga ossetica strain V5/3m plasmid unnamed4, complete sequence) position: , mismatch: 6, identity: 0.812

--cctgcggttgcggggttgtccgcgagcgggag	CRISPR spacer
atgctgcag--gcgtggttgtcggcgagcgggag	Protospacer
   ****.*  *** ******* ***********

26. spacer 9.7|1595426|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NC_017805 (Deinococcus gobiensis I-0 plasmid P1, complete sequence) position: , mismatch: 6, identity: 0.812

gcggaccg--gcccacccggctggcgaccgtcgc	CRISPR spacer
--gacccgctgcccacccggcggccgaccgtcgc	Protospacer
  *. ***  *********** * **********

27. spacer 9.8|1595487|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP054616 (Azospirillum oryzae strain KACC 14407 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.812

gccgt-cgccgcctacgcgaccgccctcgggct	CRISPR spacer
-cagcgcgccgcctacgcgaccgccctcgacca	Protospacer
 * *. ***********************. *

28. spacer 9.8|1595487|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to LN997843 (Streptomyces reticuli genome assembly TUE45, plasmid : II) position: , mismatch: 6, identity: 0.812

gccgtcgccgcctacgcgaccgccctcgggct-	CRISPR spacer
gtcgtggccgcctacgcgaccgctct-gacctg	Protospacer
*.*** *****************.** *. **

29. spacer 10.4|1602957|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP034782 (Pseudomonas sp. MPC6 plasmid pMPC6-328K, complete sequence) position: , mismatch: 6, identity: 0.812

tcgtcggccttgaccatcatctgcac-cccgcg	CRISPR spacer
tcggcagccttgaccatcatctgcatggccac-	Protospacer
*** *.*******************.  **.*

30. spacer 10.4|1602957|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP049701 (Bradyrhizobium sp. 1S5 strain 323S2 plasmid pB323S2b, complete sequence) position: , mismatch: 6, identity: 0.812

tcgtcggccttgaccatcatctgca-ccccgcg	CRISPR spacer
gggtcggccttggccatcatccgcagcgccgc-	Protospacer
  **********.********.*** * ****

31. spacer 10.4|1602957|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP049702 (Bradyrhizobium sp. 1S5 strain 323S2 plasmid pB323S2c, complete sequence) position: , mismatch: 6, identity: 0.812

tcgtcggccttgaccatcatctgca-ccccgcg	CRISPR spacer
gggtcggccttggccatcatccgcagcgccgc-	Protospacer
  **********.********.*** * ****

32. spacer 10.4|1602957|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP049702 (Bradyrhizobium sp. 1S5 strain 323S2 plasmid pB323S2c, complete sequence) position: , mismatch: 6, identity: 0.812

tcgtcggccttgaccatcatctgca-ccccgcg	CRISPR spacer
gggtcggccttggccatcatccgcagcgccgc-	Protospacer
  **********.********.*** * ****

33. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP029357 (Azospirillum sp. CFH 70021 plasmid unnamed2) position: , mismatch: 6, identity: 0.812

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
cggccggcgggccgccgcggcggccatcagcg	Protospacer
****** *************.***** *  *

34. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022367 (Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence) position: , mismatch: 6, identity: 0.812

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
cggccgtcgggccgccgcggtggtcctccccg	Protospacer
******.****************.*  *.**

35. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NC_009339 (Mycolicibacterium gilvum PYR-GCK plasmid pMFLV01, complete sequence) position: , mismatch: 6, identity: 0.812

-cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
gcggctatc-ggccgccgcggcggccagcgcct	Protospacer
 ****...* ***********.******* ***

36. spacer 12.4|1645572|31|NC_014210|CRT matches to NZ_CP019316 (Tateyamaria omphalii strain DOK1-4 plasmid pDOK1-4-4, complete sequence) position: , mismatch: 6, identity: 0.806

acggcgtcaccgtgctcctggtcgatgccgc	CRISPR spacer
tgggcgtcaccgtgctgctggccgatgccaa	Protospacer
  ************** ****.*******.

37. spacer 12.4|1645572|31|NC_014210|CRT matches to NZ_CP017943 (Phyllobacterium zundukense strain Tri-48 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.806

acggcgtcaccgtgctcctggtcgatgccgc----	CRISPR spacer
tcggcgtcaccgtgctcctcgtcga----gcagaa	Protospacer
 ****************** *****    **

38. spacer 12.4|1645572|31|NC_014210|CRT matches to NZ_CP025505 (Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvC, complete sequence) position: , mismatch: 6, identity: 0.806

acggcgtcaccgtgctcctggtcgatgccgc----	CRISPR spacer
ccggagtcaccgtgctcctggtcga----gcaaaa	Protospacer
 *** ********************    **

39. spacer 12.4|1645572|31|NC_014210|CRT matches to NZ_LR594660 (Variovorax sp. PBL-H6 plasmid 2) position: , mismatch: 6, identity: 0.806

acggcgtcaccgtgctcctggtcgatgccgc	CRISPR spacer
ccgctctcaccgtcctcctggtcgctgccgc	Protospacer
 ** . ******* ********** ******

40. spacer 12.4|1645572|31|NC_014210|CRT matches to NZ_CP032324 (Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence) position: , mismatch: 6, identity: 0.806

acggcgtcaccgtgctcctggtcgatgccgc----	CRISPR spacer
acggcgtcaccgtcctgctggtcga----gcagaa	Protospacer
************* ** ********    **

41. spacer 12.4|1645572|31|NC_014210|CRT matches to NZ_LR594667 (Variovorax sp. SRS16 plasmid 2) position: , mismatch: 6, identity: 0.806

acggcgtcaccgtgctcctggtcgatgccgc	CRISPR spacer
ccgctctcaccgtcctcctggtcgctgccgc	Protospacer
 ** . ******* ********** ******

42. spacer 12.4|1645572|31|NC_014210|CRT matches to NZ_CP022366 (Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence) position: , mismatch: 6, identity: 0.806

acggcgtcaccgtgctcctggtcgatgccgc----	CRISPR spacer
acggcgtcaccgtcctgctggtcga----gcagaa	Protospacer
************* ** ********    **

43. spacer 12.4|1645572|31|NC_014210|CRT matches to NZ_CP015737 (Shinella sp. HZN7 plasmid pShin-01, complete sequence) position: , mismatch: 6, identity: 0.806

acggcgtcaccgtgctcctggtcgatgccgc----	CRISPR spacer
aaggcgtcaccgtcctcctggtcga----gcagaa	Protospacer
* *********** ***********    **

44. spacer 12.4|1645572|31|NC_014210|CRT matches to NZ_LR594672 (Variovorax sp. PBL-E5 plasmid 2) position: , mismatch: 6, identity: 0.806

acggcgtcaccgtgctcctggtcgatgccgc	CRISPR spacer
ccgctctcaccgtcctcctggtcgctgccgc	Protospacer
 ** . ******* ********** ******

45. spacer 12.4|1645572|31|NC_014210|CRT matches to NZ_CP032348 (Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence) position: , mismatch: 6, identity: 0.806

acggcgtcaccgtgctcctggtcgatgccgc----	CRISPR spacer
acggcgtcaccgtcctgctggtcga----gcagaa	Protospacer
************* ** ********    **

46. spacer 12.4|1645572|31|NC_014210|CRT matches to NZ_CP016083 (Streptomyces sp. SAT1 plasmid unnamed3, complete sequence) position: , mismatch: 6, identity: 0.806

acggcgtcaccgtgctcctggtcga-tgccgc	CRISPR spacer
tcggcgtcaccgtgctcatggccgagcaccg-	Protospacer
 **************** ***.*** ..***

47. spacer 13.2|1662532|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP015008 (Aminobacter aminovorans strain KCTC 2477 plasmid pAA03, complete sequence) position: , mismatch: 6, identity: 0.812

accagaacgtgatccgcggcggcggcatcgtc	CRISPR spacer
agcagatcgagatccgcggcggcggccttgcc	Protospacer
* **** ** **************** *.*.*

48. spacer 13.2|1662532|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP029831 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed7, complete sequence) position: , mismatch: 6, identity: 0.812

accagaacgtgatccgcggcggcggcatcgtc---	CRISPR spacer
accagaacgtgat---cgccggcggcatggccgaa	Protospacer
*************   ** ********* *.*

49. spacer 14.8|2013965|32|NC_014210|CRISPRCasFinder matches to NZ_CP023000 (Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-B, complete sequence) position: , mismatch: 6, identity: 0.812

--gccatgctcgcgtccgagacccgcaagatcca	CRISPR spacer
aagcaat--tcgcgtccgacatccgcaagatcga	Protospacer
  ** **  ********** *.********** *

50. spacer 14.17|2014514|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NZ_CP016820 (Rhodococcus sp. p52 plasmid pDF02, complete sequence) position: , mismatch: 6, identity: 0.812

gggcgacagaccacccggctaccaaccgtgtc-	CRISPR spacer
cggcgacagaccacccctctaccaa-ggtttca	Protospacer
 ***************  *******  ** **

51. spacer 14.17|2014514|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NZ_CP016820 (Rhodococcus sp. p52 plasmid pDF02, complete sequence) position: , mismatch: 6, identity: 0.812

gggcgacagaccacccggctaccaaccgtgtc-	CRISPR spacer
cggcgacagaccacccctctaccaa-ggtttca	Protospacer
 ***************  *******  ** **

52. spacer 14.18|2014575|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NZ_CP050105 (Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b6, complete sequence) position: , mismatch: 6, identity: 0.812

gaggagttcgcctacgccatcgctgggtcggg--	CRISPR spacer
gagcagttcgcctaccccatcgc--agtcggccg	Protospacer
*** *********** *******  .*****

53. spacer 14.18|2014575|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NZ_CP025508 (Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvB, complete sequence) position: , mismatch: 6, identity: 0.812

gaggagttcgcctacgccatcgctgggtcggg--	CRISPR spacer
gagcagttcgcctaccccatcgc--agtcggccg	Protospacer
*** *********** *******  .*****

54. spacer 14.18|2014575|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NZ_CP050110 (Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b4, complete sequence) position: , mismatch: 6, identity: 0.812

gaggagttcgcctacgccatcgctgggtcggg--	CRISPR spacer
gagcagttcgcctaccccatcgc--agtcggccg	Protospacer
*** *********** *******  .*****

55. spacer 14.18|2014575|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NZ_CP030764 (Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed4, complete sequence) position: , mismatch: 6, identity: 0.812

gaggagttcgcctacgccatcgctgggtcggg--	CRISPR spacer
gagcagttcgcctaccccatcgc--agtcggccg	Protospacer
*** *********** *******  .*****

56. spacer 14.18|2014575|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NZ_CP022667 (Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR2, complete sequence) position: , mismatch: 6, identity: 0.812

gaggagttcgcctacgccatcgctgggtcggg--	CRISPR spacer
gagcagttcgcctaccccatcgc--agtcggccg	Protospacer
*** *********** *******  .*****

57. spacer 14.18|2014575|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NZ_CP050087 (Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b5, complete sequence) position: , mismatch: 6, identity: 0.812

gaggagttcgcctacgccatcgctgggtcggg--	CRISPR spacer
gagcagttcgcctaccccatcgc--agtcggccg	Protospacer
*** *********** *******  .*****

58. spacer 14.24|2014941|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NC_022044 (Paracoccus aminophilus JCM 7686 plasmid pAMI6, complete sequence) position: , mismatch: 6, identity: 0.812

gcgacccccgctgacgctcccatcgtcgtctc	CRISPR spacer
gcagcccccgcagccgctcccatcgtcgccgc	Protospacer
**..******* * **************.* *

59. spacer 14.26|2015063|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NZ_CP017242 (Rhizobium etli 8C-3 plasmid pRsp8C3a, complete sequence) position: , mismatch: 6, identity: 0.812

atgatggtggtggcgttggacgccggggcggg	CRISPR spacer
aggtttgcggtggcgttgatcgccggggcggg	Protospacer
* * * *.**********. ************

60. spacer 14.27|2015124|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MK814752 (Gordonia phage Lutum, complete genome) position: , mismatch: 6, identity: 0.812

acatcgacctcctcaccgcagaatccccccac	CRISPR spacer
tcatcgacctcctcaccgcggcatccgcatac	Protospacer
 ******************.* **** * .**

61. spacer 14.27|2015124|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MH779504 (Gordonia phage Getalong, complete genome) position: , mismatch: 6, identity: 0.812

acatcgacctcctcaccgcagaatccccccac	CRISPR spacer
tcatcgacctcctcaccgcggcatccgcatac	Protospacer
 ******************.* **** * .**

62. spacer 14.27|2015124|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NC_048141 (Gordonia phage Kenna, complete genome) position: , mismatch: 6, identity: 0.812

acatcgacctcctcaccgcagaatccccccac	CRISPR spacer
tcatcgacctcctcaccgcggcatccgcatac	Protospacer
 ******************.* **** * .**

63. spacer 14.27|2015124|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NC_031267 (Gordonia phage Lucky10, complete genome) position: , mismatch: 6, identity: 0.812

acatcgacctcctcaccgcagaatccccccac	CRISPR spacer
tcatcgacctcctcaccgcggcatccgcatac	Protospacer
 ******************.* **** * .**

64. spacer 14.27|2015124|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NC_047891 (Gordonia phage BENtherdunthat, complete genome) position: , mismatch: 6, identity: 0.812

acatcgacctcctcaccgcagaatccccccac	CRISPR spacer
tcatcgacctcctcaccgcggcatccgcatac	Protospacer
 ******************.* **** * .**

65. spacer 14.29|2015246|32|NC_014210|CRISPRCasFinder matches to NZ_LT900339 (Gluconobacter oxydans 621H isolate WT-DSMZ plasmid 2) position: , mismatch: 6, identity: 0.812

cgggccatctgcatggcggcctcttcggcgac-	CRISPR spacer
agccccatctgcacggcggcctcgtc-gcgaca	Protospacer
 *  *********.********* ** *****

66. spacer 14.29|2015246|32|NC_014210|CRISPRCasFinder matches to NC_006672 (Gluconobacter oxydans 621H plasmid pGOX1, complete sequence) position: , mismatch: 6, identity: 0.812

cgggccatctgcatggcggcctcttcggcgac-	CRISPR spacer
agccccatctgcacggcggcctcgtc-gcgaca	Protospacer
 *  *********.********* ** *****

67. spacer 14.61|2013965|31|NC_014210|PILER-CR matches to NZ_CP023000 (Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-B, complete sequence) position: , mismatch: 6, identity: 0.806

--gccatgctcgcgtccgagacccgcaagatcc	CRISPR spacer
aagcaat--tcgcgtccgacatccgcaagatcg	Protospacer
  ** **  ********** *.**********

68. spacer 19.1|3414160|27|NC_014210|CRISPRCasFinder matches to NZ_CP022366 (Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence) position: , mismatch: 6, identity: 0.778

cgggagtagggcggcggggtggggggg	CRISPR spacer
ggggagtagggcggcggggcggtcagc	Protospacer
 ******************.**  .*

69. spacer 19.1|3414160|27|NC_014210|CRISPRCasFinder matches to NZ_CP032348 (Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence) position: , mismatch: 6, identity: 0.778

cgggagtagggcggcggggtggggggg	CRISPR spacer
ggggagtagggcggcggggcggtcagc	Protospacer
 ******************.**  .*

70. spacer 23.2|5555650|32|NC_014210|CRISPRCasFinder matches to NZ_CP022417 (Sulfitobacter pseudonitzschiae strain SMR1 plasmid pSMR1-2, complete sequence) position: , mismatch: 6, identity: 0.812

gccgt-caccaggttgcccacggtcgcgccgag	CRISPR spacer
-cagcgcaccagcttgcccacggtcgcgccgta	Protospacer
 * *. ****** ****************** .

71. spacer 23.3|5555711|32|NC_014210|CRISPRCasFinder matches to NZ_CP045390 (Roseivivax sp. THAF30 plasmid pTHAF30_a, complete sequence) position: , mismatch: 6, identity: 0.812

cagctggccgccctccaggcgcagacgcaggc	CRISPR spacer
cagctcgccgccctccaggcccagatcgagga	Protospacer
***** ************** ****.  ***

72. spacer 23.3|5555711|32|NC_014210|CRISPRCasFinder matches to NZ_CP045362 (Roseivivax sp. THAF40 plasmid pTHAF40_b, complete sequence) position: , mismatch: 6, identity: 0.812

cagctggccgccctccaggcgcagacgcaggc	CRISPR spacer
cagctcgccgccctccaggcccagatcgagga	Protospacer
***** ************** ****.  ***

73. spacer 23.3|5555711|32|NC_014210|CRISPRCasFinder matches to NZ_CP040820 (Paraoceanicella profunda strain D4M1 plasmid pD4M1B, complete sequence) position: , mismatch: 6, identity: 0.812

---cagctggccgccctccaggcgcagacgcaggc	CRISPR spacer
gtccacct---cgccctgcaggcgcaggcgcaggc	Protospacer
   ** **   ****** *********.*******

74. spacer 23.3|5555711|32|NC_014210|CRISPRCasFinder matches to NC_013855 (Azospirillum sp. B510 plasmid pAB510a, complete sequence) position: , mismatch: 6, identity: 0.812

cagctggc--cgccctccaggcgcagacgcaggc	CRISPR spacer
--ggtggccgcgccctccagccgcagacgccgga	Protospacer
  * ****  ********** ********* **

75. spacer 23.4|5555772|32|NC_014210|CRISPRCasFinder matches to MH744420 (Streptomyces phage Kromp, complete genome) position: , mismatch: 6, identity: 0.812

-ctgcccacccagctcaccgcgccggacgcgga	CRISPR spacer
accggaca-ccagctcaccgccccggacacgga	Protospacer
 *.*  ** ************ ******.****

76. spacer 7.9|1581936|32|NC_014210|CRISPRCasFinder,CRT matches to MN369761 (Mycobacterium phage Malthus, complete genome) position: , mismatch: 7, identity: 0.781

gacgacggggtcgctgctgctggccagggtgg	CRISPR spacer
cacgacggcgacgctgctgctggccgccgggg	Protospacer
 ******* * **************.  * **

77. spacer 7.9|1581936|32|NC_014210|CRISPRCasFinder,CRT matches to MK224497 (Mycobacterium phage Henu3, complete genome) position: , mismatch: 7, identity: 0.781

gacgacggggtcgctgctgctggccagggtgg	CRISPR spacer
cacgacggcgacgctgctgctggccgccgggg	Protospacer
 ******* * **************.  * **

78. spacer 7.9|1581936|32|NC_014210|CRISPRCasFinder,CRT matches to KJ944841 (Mycobacterium phage Cheetobro, complete genome) position: , mismatch: 7, identity: 0.781

gacgacggggtcgctgctgctggccagggtgg	CRISPR spacer
cacgacggcgacgctgctgctggccgccgggg	Protospacer
 ******* * **************.  * **

79. spacer 7.9|1581936|32|NC_014210|CRISPRCasFinder,CRT matches to MN945904 (Mycobacterium phage Eponine, complete genome) position: , mismatch: 7, identity: 0.781

gacgacggggtcgctgctgctggccagggtgg	CRISPR spacer
cacgacggcgacgctgctgctggccgccgggg	Protospacer
 ******* * **************.  * **

80. spacer 7.9|1581936|32|NC_014210|CRISPRCasFinder,CRT matches to KY087992 (Mycobacterium phage Mitti, complete genome) position: , mismatch: 7, identity: 0.781

gacgacggggtcgctgctgctggccagggtgg	CRISPR spacer
cacgacggcgacgctgctgctggccgccgggg	Protospacer
 ******* * **************.  * **

81. spacer 7.9|1581936|32|NC_014210|CRISPRCasFinder,CRT matches to MF140402 (Mycobacterium phage Chancellor, complete genome) position: , mismatch: 7, identity: 0.781

gacgacggggtcgctgctgctggccagggtgg	CRISPR spacer
cacgacggcgacgctgctgctggccgccgggg	Protospacer
 ******* * **************.  * **

82. spacer 7.9|1581936|32|NC_014210|CRISPRCasFinder,CRT matches to MK524485 (Mycobacterium phage MissDaisy, complete genome) position: , mismatch: 7, identity: 0.781

gacgacggggtcgctgctgctggccagggtgg	CRISPR spacer
cacgacggcgacgctgctgctggccgccgggg	Protospacer
 ******* * **************.  * **

83. spacer 7.9|1581936|32|NC_014210|CRISPRCasFinder,CRT matches to KT361920 (Mycobacterium phage Slarp, complete genome) position: , mismatch: 7, identity: 0.781

gacgacggggtcgctgctgctggccagggtgg	CRISPR spacer
cacgacggcgacgctgctgctggccgccgggg	Protospacer
 ******* * **************.  * **

84. spacer 7.9|1581936|32|NC_014210|CRISPRCasFinder,CRT matches to MH926058 (Mycobacterium phage Reptar3000, complete genome) position: , mismatch: 7, identity: 0.781

gacgacggggtcgctgctgctggccagggtgg	CRISPR spacer
cacgacggcgacgctgctgctggccgccgggg	Protospacer
 ******* * **************.  * **

85. spacer 7.9|1581936|32|NC_014210|CRISPRCasFinder,CRT matches to KX621007 (Mycobacterium phage Taquito, complete genome) position: , mismatch: 7, identity: 0.781

gacgacggggtcgctgctgctggccagggtgg	CRISPR spacer
cacgacggcgacgctgctgctggccgccgggg	Protospacer
 ******* * **************.  * **

86. spacer 7.9|1581936|32|NC_014210|CRISPRCasFinder,CRT matches to MH051258 (Mycobacterium phage SamScheppers, complete genome) position: , mismatch: 7, identity: 0.781

gacgacggggtcgctgctgctggccagggtgg	CRISPR spacer
cacgacggcgacgctgctgctggccgccgggg	Protospacer
 ******* * **************.  * **

87. spacer 7.9|1581936|32|NC_014210|CRISPRCasFinder,CRT matches to MK524488 (Mycobacterium phage Patt, complete genome) position: , mismatch: 7, identity: 0.781

gacgacggggtcgctgctgctggccagggtgg	CRISPR spacer
cacgacggcgacgctgctgctggccgccgggg	Protospacer
 ******* * **************.  * **

88. spacer 7.9|1581936|32|NC_014210|CRISPRCasFinder,CRT matches to MF140435 (Mycobacterium phage Wintermute, complete genome) position: , mismatch: 7, identity: 0.781

gacgacggggtcgctgctgctggccagggtgg	CRISPR spacer
cacgacggcgacgctgctgctggccgccgggg	Protospacer
 ******* * **************.  * **

89. spacer 7.9|1581936|32|NC_014210|CRISPRCasFinder,CRT matches to NC_013857 (Azospirillum sp. B510 plasmid pAB510c, complete sequence) position: , mismatch: 7, identity: 0.781

gacgacggggtcgctgctgctggccagggtgg	CRISPR spacer
ggtggcgctgtcgctgctgctgtcctgggtgg	Protospacer
*..*.**  ************* ** ******

90. spacer 7.9|1581936|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP054621 (Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence) position: , mismatch: 7, identity: 0.781

gacgacggggtcgctgctgctggccagggtgg	CRISPR spacer
ggtggcgctgtcgctgctgctgtcctgggtgg	Protospacer
*..*.**  ************* ** ******

91. spacer 8.5|1587733|33|NC_014210|PILER-CR matches to NZ_CP044989 (Deinococcus sp. AJ005 plasmid p380k, complete sequence) position: , mismatch: 7, identity: 0.788

ccggtgcgtgaccggtgcgcccagatggtcgac	CRISPR spacer
ccggtgcgtgaccagtgcgtccagatcgattgc	Protospacer
*************.*****.****** * . .*

92. spacer 8.7|1587855|33|NC_014210|PILER-CR matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 7, identity: 0.788

cccaggccgccgaccctcgcgcggcccgccacg	CRISPR spacer
ccacgtccgccgaccctcgggcggcccgccgaa	Protospacer
**  * ************* **********. .

93. spacer 8.14|1587612|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP032325 (Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence) position: , mismatch: 7, identity: 0.781

gccatcaacgccgccgcccgctccggtggtat	CRISPR spacer
tccagcaccgccgccgcccgctccggtgccgg	Protospacer
 *** ** ******************** ..

94. spacer 8.14|1587612|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP046906 (Streptomyces sp. QHH-9511 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

gccatcaacgccgccgcccgctccggtggtat	CRISPR spacer
gccatcaaggccgccacccgctccgggcgcgc	Protospacer
******** ******.**********  *...

95. spacer 8.14|1587612|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP007794 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence) position: , mismatch: 7, identity: 0.781

gccatcaacgccgccgcccgctccggtggtat	CRISPR spacer
gacgggatcgccgccgcccgcgccggtgggat	Protospacer
* *.  * ************* ******* **

96. spacer 8.14|1587612|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP050104 (Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b2, complete sequence) position: , mismatch: 7, identity: 0.781

gccatcaacgccgccgcccgctccggtggtat	CRISPR spacer
gccatgaacgccgccgcctgctcgtgtcgggt	Protospacer
***** ************.****  ** * .*

97. spacer 8.14|1587612|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP018229 (Rhizobium leguminosarum strain Vaf-108 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

gccatcaacgccgccgcccgctccggtggtat	CRISPR spacer
gccatgaacgccgccgcctgctcgtgtcgggt	Protospacer
***** ************.****  ** * .*

98. spacer 8.14|1587612|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP025507 (Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvA, complete sequence) position: , mismatch: 7, identity: 0.781

gccatcaacgccgccgcccgctccggtggtat	CRISPR spacer
gccatgaacgccgccgcctgctcgtgtcgggt	Protospacer
***** ************.****  ** * .*

99. spacer 8.14|1587612|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP016287 (Rhizobium leguminosarum strain Vaf10 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

gccatcaacgccgccgcccgctccggtggtat	CRISPR spacer
gccatgaacgccgccgcctgctcgtgtcgggt	Protospacer
***** ************.****  ** * .*

100. spacer 8.14|1587612|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP022191 (Yangia pacifica strain YSBP01 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

gccatcaacgccgccgcccgctccggtggtat	CRISPR spacer
gacatcatcgccgccgcccgcgccgaggggct	Protospacer
* ***** ************* ***. **  *

101. spacer 8.14|1587612|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP050109 (Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b2, complete sequence) position: , mismatch: 7, identity: 0.781

gccatcaacgccgccgcccgctccggtggtat	CRISPR spacer
gccatgaacgccgccgcctgctcgtgtcgggt	Protospacer
***** ************.****  ** * .*

102. spacer 8.14|1587612|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP022666 (Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR1, complete sequence) position: , mismatch: 7, identity: 0.781

gccatcaacgccgccgcccgctccggtggtat	CRISPR spacer
gccatgaacgccgccgcctgctcgtgtcgggt	Protospacer
***** ************.****  ** * .*

103. spacer 8.14|1587612|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP022565 (Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK01, complete sequence) position: , mismatch: 7, identity: 0.781

gccatcaacgccgccgcccgctccggtggtat	CRISPR spacer
gccatgaacgccgccgcctgctcgtgtcgggt	Protospacer
***** ************.****  ** * .*

104. spacer 8.14|1587612|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP050086 (Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b7, complete sequence) position: , mismatch: 7, identity: 0.781

gccatcaacgccgccgcccgctccggtggtat	CRISPR spacer
gccatgaacgccgccgcctgctcgtgtcgggt	Protospacer
***** ************.****  ** * .*

105. spacer 8.14|1587612|32|NC_014210|CRISPRCasFinder,CRT matches to MN908687 (Gordonia phage Skog, complete genome) position: , mismatch: 7, identity: 0.781

gccatcaacgccgccgcccgctccggtggtat-	CRISPR spacer
gccatcagcgccgccgccagct-cgtcgagatc	Protospacer
*******.********** *** ** .*. **

106. spacer 8.16|1587734|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP044989 (Deinococcus sp. AJ005 plasmid p380k, complete sequence) position: , mismatch: 7, identity: 0.781

cggtgcgtgaccggtgcgcccagatggtcgac	CRISPR spacer
cggtgcgtgaccagtgcgtccagatcgattgc	Protospacer
************.*****.****** * . .*

107. spacer 8.18|1587856|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 7, identity: 0.781

ccaggccgccgaccctcgcgcggcccgccacg	CRISPR spacer
cacgtccgccgaccctcgggcggcccgccgaa	Protospacer
*  * ************* **********. .

108. spacer 8.18|1587856|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_LR134460 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 18, complete sequence) position: , mismatch: 7, identity: 0.781

ccaggccgccgaccctcgcgcggcccgccacg	CRISPR spacer
caccggcgccgaccctcgcgcagcccgccgtg	Protospacer
*   * ***************.*******..*

109. spacer 8.20|1587978|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP022567 (Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK03, complete sequence) position: , mismatch: 7, identity: 0.781

cgggtccgaggtcggcgggcgggcggtcctcg	CRISPR spacer
cgtgatcgagggcggcgggcgggcgctccgcc	Protospacer
** * .***** ************* *** *

110. spacer 8.22|1588100|32|NC_014210|CRISPRCasFinder,CRT matches to NC_011892 (Methylobacterium nodulans ORS 2060 plasmid pMNOD01, complete sequence) position: , mismatch: 7, identity: 0.781

gggaagcccaccggcaccgtccgcaaggtcgc	CRISPR spacer
ggcaagcccgccggcaccgtccgcatcacggc	Protospacer
** ******.***************  .. **

111. spacer 8.22|1588100|32|NC_014210|CRISPRCasFinder,CRT matches to MF417927 (Uncultured Caudovirales phage clone 9F_2, partial genome) position: , mismatch: 7, identity: 0.781

gggaagcccaccggcaccgtccgcaaggtcgc	CRISPR spacer
gagcagaagaccgacaccgtccgcaagatcgc	Protospacer
*.* **   ****.*************.****

112. spacer 9.3|1595182|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP050093 (Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b5, complete sequence) position: , mismatch: 7, identity: 0.781

cagcgtcgtcgaccccaggctga-----cggaggtct	CRISPR spacer
cagcgttgtcgaccccaggctgaggctccggg-----	Protospacer
******.****************     ***.

113. spacer 9.3|1595182|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP050099 (Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b5, complete sequence) position: , mismatch: 7, identity: 0.781

cagcgtcgtcgaccccaggctga-----cggaggtct	CRISPR spacer
cagcgtcgtcgatcccaggctgagattccggg-----	Protospacer
************.**********     ***.

114. spacer 9.3|1595182|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP050105 (Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b6, complete sequence) position: , mismatch: 7, identity: 0.781

cagcgtcgtcgaccccaggctga-----cggaggtct	CRISPR spacer
cagcgtcgtcgatcccaggctgagattccggg-----	Protospacer
************.**********     ***.

115. spacer 9.3|1595182|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP053441 (Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eE, complete sequence) position: , mismatch: 7, identity: 0.781

cagcgtcgtcgaccccaggctga-----cggaggtct	CRISPR spacer
cagcgtcgtcgatcccaggctgagattccggg-----	Protospacer
************.**********     ***.

116. spacer 9.3|1595182|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP025508 (Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvB, complete sequence) position: , mismatch: 7, identity: 0.781

cagcgtcgtcgaccccaggctga-----cggaggtct	CRISPR spacer
cagcgtcgtcgatcccaggctgagattccggg-----	Protospacer
************.**********     ***.

117. spacer 9.3|1595182|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP016289 (Rhizobium leguminosarum strain Vaf10 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.781

cagcgtcgtcgaccccaggctgacggaggtct----	CRISPR spacer
cagcgtcgtcgatcccaggct----gaggcttcggg	Protospacer
************.********    ****..*

118. spacer 9.3|1595182|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP050110 (Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b4, complete sequence) position: , mismatch: 7, identity: 0.781

cagcgtcgtcgaccccaggctga-----cggaggtct	CRISPR spacer
cagcgtcgtcgatcccaggctgagattccggg-----	Protospacer
************.**********     ***.

119. spacer 9.3|1595182|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP048282 (Rhizobium leguminosarum bv. viciae 248 plasmid pRle248d, complete sequence) position: , mismatch: 7, identity: 0.781

cagcgtcgtcgaccccaggctgacggaggtct---	CRISPR spacer
cagcgtcgtcgatcccaggctga---ggctccgcg	Protospacer
************.**********   .* **.

120. spacer 9.3|1595182|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP054023 (Rhizobium sp. JKLM12A2 plasmid pPR12A202, complete sequence) position: , mismatch: 7, identity: 0.781

cagcgtcgtcgaccccaggctga-----cggaggtct	CRISPR spacer
cagcgtcgtcgaccccagactgagactccggg-----	Protospacer
******************.****     ***.

121. spacer 9.3|1595182|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022667 (Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR2, complete sequence) position: , mismatch: 7, identity: 0.781

cagcgtcgtcgaccccaggctga-----cggaggtct	CRISPR spacer
cagcgtcgtcgatcccaggctgagattccggg-----	Protospacer
************.**********     ***.

122. spacer 9.3|1595182|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP050087 (Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b5, complete sequence) position: , mismatch: 7, identity: 0.781

cagcgtcgtcgaccccaggctga-----cggaggtct	CRISPR spacer
cagcgtcgtcgatcccaggctgagattccggg-----	Protospacer
************.**********     ***.

123. spacer 9.7|1595426|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032327 (Azospirillum brasilense strain MTCC4035 plasmid p6, complete sequence) position: , mismatch: 7, identity: 0.781

gcggaccggcccacccggctggcgaccgtcgc	CRISPR spacer
tctgaccggcccatccggcgggcgacggctgc	Protospacer
 * **********.***** ****** *..**

124. spacer 9.8|1595487|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to MK524490 (Mycobacterium phage Donny, complete genome) position: , mismatch: 7, identity: 0.781

gccgtcgccgcctacgcgaccgccctcgggct	CRISPR spacer
gccatcgccgcctacgagaccgccgtggccgt	Protospacer
***.************ ******* * *   *

125. spacer 9.8|1595487|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NC_022063 (Mycobacterium phage Phelemich, complete genome) position: , mismatch: 7, identity: 0.781

gccgtcgccgcctacgcgaccgccctcgggct	CRISPR spacer
gccatcgccgcctacgagaccgccgtggccgt	Protospacer
***.************ ******* * *   *

126. spacer 9.8|1595487|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to JN699007 (Mycobacterium phage Acadian, complete genome) position: , mismatch: 7, identity: 0.781

gccgtcgccgcctacgcgaccgccctcgggct	CRISPR spacer
gccatcgccgcctacgagaccgccgtggccgt	Protospacer
***.************ ******* * *   *

127. spacer 9.8|1595487|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to KF024727 (Mycobacterium phage Reprobate, complete genome) position: , mismatch: 7, identity: 0.781

gccgtcgccgcctacgcgaccgccctcgggct	CRISPR spacer
gccatcgccgcctacgagaccgccgtggccgt	Protospacer
***.************ ******* * *   *

128. spacer 9.8|1595487|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to MT889381 (Mycobacterium phage Suigeneris, complete genome) position: , mismatch: 7, identity: 0.781

gccgtcgccgcctacgcgaccgccctcgggct	CRISPR spacer
gccatcgccgcctacgagaccgccgtggccgt	Protospacer
***.************ ******* * *   *

129. spacer 9.8|1595487|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to KP966108 (Burkholderia phage vB_BceM_AP3, complete genome) position: , mismatch: 7, identity: 0.781

gccgtcgccgcctacgcgaccgccc-tcgggct	CRISPR spacer
ctcgtcgccgccgacgcggccgcccgtcgcgg-	Protospacer
 .********** *****.****** *** *

130. spacer 9.10|1595610|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013104 (Paraburkholderia caribensis strain MWAP64 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.781

tcgatgaccgaggtcgacggcaccgggtcgga	CRISPR spacer
acgatgcgcgaggtcgacggcaccgtcgagga	Protospacer
 *****  *****************    ***

131. spacer 9.10|1595610|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

tcgatgaccgaggtcgacggcaccgggtcgga	CRISPR spacer
acgatgcgcgaggtcgacggcaccgtcgagga	Protospacer
 *****  *****************    ***

132. spacer 10.2|1602835|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP006368 (Aureimonas sp. AU20 plasmid pAU20a, complete sequence) position: , mismatch: 7, identity: 0.781

cggggccg--tggtgttggacgccgcggatgtgg	CRISPR spacer
--gagctgcccggtgttggacgtcacggatgtgg	Protospacer
  *.**.*  .***********.*.*********

133. spacer 10.2|1602835|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP054621 (Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence) position: , mismatch: 7, identity: 0.781

cggggccgtggtgttggacgccgcggatgtgg	CRISPR spacer
cggggccgcggtgtgggacgccgatctggtgg	Protospacer
********.***** ********     ****

134. spacer 10.4|1602957|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NC_012586 (Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence) position: , mismatch: 7, identity: 0.781

tcgtcggccttgaccatcatctgcaccccgcg	CRISPR spacer
tggccggccttgaccatcatcggcaccagcag	Protospacer
* *.***************** *****    *

135. spacer 10.4|1602957|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP020331 (Martelella mediterranea DSM 17316 strain MACL11 plasmid pMM593, complete sequence) position: , mismatch: 7, identity: 0.781

tcgtcggccttgaccatcatctgcaccccgcg-	CRISPR spacer
ccgtcgggcttgcccatcatctgcg-cttgcgc	Protospacer
.****** **** ***********. *..***

136. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP029830 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
cggccgccgtgccgccgcggtcgccatcagtc	Protospacer
********* *********** **** *  ..

137. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 7, identity: 0.781

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
ctgcgcccgggccgccgcggaggccggctacc	Protospacer
* **  ************** ****.*** *.

138. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 7, identity: 0.781

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
ctgcgcccgggccgccgcggaggccggctacc	Protospacer
* **  ************** ****.*** *.

139. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_AP014705 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence) position: , mismatch: 7, identity: 0.781

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
ccgccgcccggccgccgcggtggcccccggcc	Protospacer
* ****** ****************  *  *.

140. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NC_013855 (Azospirillum sp. B510 plasmid pAB510a, complete sequence) position: , mismatch: 7, identity: 0.781

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
ccgccgccgcgccgccggggtggcccccttca	Protospacer
* ******* ******* *******  **.*

141. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032323 (Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence) position: , mismatch: 7, identity: 0.781

cggccgccggg-ccgccgcggtggccagctcct	CRISPR spacer
-ggcgacgaggcccgccgcggtggccagcgccg	Protospacer
 *** .* .** ***************** **

142. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to CP021131 (Meiothermus taiwanensis strain WR-220 plasmid pMtWR-220, complete sequence) position: , mismatch: 7, identity: 0.781

-cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
tcggac-ccgggccgtcgcgggggccagcttga	Protospacer
 *** * ********.***** ********.

143. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to LN997843 (Streptomyces reticuli genome assembly TUE45, plasmid : II) position: , mismatch: 7, identity: 0.781

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
ctgctggtcggccgcggcggcggccagctcct	Protospacer
* **.* . ****** ****.***********

144. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to MN284895 (Mycobacterium phage Marshawn, complete genome) position: , mismatch: 7, identity: 0.781

cggccgc-cgggccgccgcggtggccagctcct	CRISPR spacer
-gaccatgcgggccgccgcggtggccttctcgt	Protospacer
 *.**.. ******************  *** *

145. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to MT310859 (Mycobacterium phage MarkPhew, complete genome) position: , mismatch: 7, identity: 0.781

cggccgc-cgggccgccgcggtggccagctcct	CRISPR spacer
-gaccatgcgggccgccgcggtggccttctcgt	Protospacer
 *.**.. ******************  *** *

146. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to HM486077 (Tsukamurella phage TPA2, complete sequence) position: , mismatch: 7, identity: 0.781

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
cggccgcccggccgccgaggtggtcgccgcgt	Protospacer
******** ******** *****.*. * * *

147. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NC_015210 (Tsukamurella phage TPA2, complete genome) position: , mismatch: 7, identity: 0.781

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
cggccgcccggccgccgaggtggtcgccgcgt	Protospacer
******** ******** *****.*. * * *

148. spacer 10.6|1603079|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NC_015579 (Novosphingobium sp. PP1Y plasmid Lpl, complete sequence) position: , mismatch: 7, identity: 0.781

gaggcggcgcgcgcggacccgtcgtcgctgtc	CRISPR spacer
ctagtggcgcgcgcggactcgtcgtcgctatg	Protospacer
  .*.*************.**********.*

149. spacer 10.6|1603079|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NC_012811 (Methylorubrum extorquens AM1 megaplasmid, complete sequence) position: , mismatch: 7, identity: 0.781

gaggcggcgcgcgcggacccgtcgtcgctgtc	CRISPR spacer
agggccgcgagcgcggacccgtcgtcggcctc	Protospacer
..*** *** ***************** . **

150. spacer 10.6|1603079|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP024895 (Amycolatopsis sp. AA4 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

gaggcggcgcgcgcggacccgtcgtcgctgtc	CRISPR spacer
tcgccggcgcgcgcggagccgtcggcgccgac	Protospacer
  * ************* ****** ***.* *

151. spacer 10.8|1603201|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP021355 (Rhodococcus sp. S2-17 plasmid pRB98, complete sequence) position: , mismatch: 7, identity: 0.781

tactggcgaacctgctggaggacctgtccgac	CRISPR spacer
ccgtcgcgaacctgctcgaggaccggtccggc	Protospacer
.  * *********** ******* *****.*

152. spacer 10.8|1603201|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP016452 (Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence) position: , mismatch: 7, identity: 0.781

---tactggcgaacctgctggaggacctgtccgac	CRISPR spacer
gcatcctcg---acctgctggaggacctggtcgac	Protospacer
   * ** *   ***************** .****

153. spacer 11.1|1638373|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP017077 (Novosphingobium resinovorum strain SA1 plasmid pSA2, complete sequence) position: , mismatch: 7, identity: 0.781

tacgcatccacggcaagccgccgctgcgcgaa	CRISPR spacer
tgccgctgcacgccaagccgccgatgcgcgaa	Protospacer
*.*   * **** ********** ********

154. spacer 11.1|1638373|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP017078 (Novosphingobium resinovorum strain SA1 plasmid pSA3, complete sequence) position: , mismatch: 7, identity: 0.781

tacgcatccacggcaagccgccgctgcgcgaa	CRISPR spacer
tgccgctgcacgccaagccgccgatgcgcgaa	Protospacer
*.*   * **** ********** ********

155. spacer 11.1|1638373|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP049157 (Caballeronia sp. SBC1 plasmid pSBC1_1, complete sequence) position: , mismatch: 7, identity: 0.781

tacgcatccacggcaagccgccgctgcgcgaa---	CRISPR spacer
aacgcaaccacggcaaggcgcc---gcgcgaggca	Protospacer
 ***** ********** ****   ******.

156. spacer 11.1|1638373|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP049317 (Caballeronia sp. SBC2 plasmid pSBC2-1, complete sequence) position: , mismatch: 7, identity: 0.781

tacgcatccacggcaagccgccgctgcgcgaa---	CRISPR spacer
aacgcaaccacggcaaggcgcc---gcgcgaggca	Protospacer
 ***** ********** ****   ******.

157. spacer 11.5|1638616|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP034351 (Streptomyces sp. W1SF4 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.781

agggtgagcgggtccacggcgccggtgacgat	CRISPR spacer
agggggagcgggtccagggcgccggagcgcct	Protospacer
**** *********** ******** *    *

158. spacer 11.5|1638616|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP050953 (Rhodococcus sp. DMU1 plasmid unnamed) position: , mismatch: 7, identity: 0.781

agggtgagcgggtccacggcgccggtgacgat-	CRISPR spacer
ggggtgagcaggtccacgccgcc-gtcgtgatc	Protospacer
.********.******** **** ** ..***

159. spacer 12.1|1645389|31|NC_014210|PILER-CR,CRT matches to NZ_CP054618 (Azospirillum oryzae strain KACC 14407 plasmid unnamed4, complete sequence) position: , mismatch: 7, identity: 0.774

ggacggaacgggaccgcgacggtcaccctgg	CRISPR spacer
atccggaacgggatcgggacggtcacccccg	Protospacer
.  **********.** ***********. *

160. spacer 12.2|1645450|31|NC_014210|PILER-CR,CRT matches to NZ_CP054618 (Azospirillum oryzae strain KACC 14407 plasmid unnamed4, complete sequence) position: , mismatch: 7, identity: 0.774

ggacggaacgggaccgcgacggtcaccctgg	CRISPR spacer
atccggaacgggatcgggacggtcacccccg	Protospacer
.  **********.** ***********. *

161. spacer 12.4|1645572|31|NC_014210|CRT matches to NZ_CP032324 (Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence) position: , mismatch: 7, identity: 0.774

acggcgtcaccgtgctcctggtcgatgccgc	CRISPR spacer
gcggcgtcaccgttctgctggtcgagcacga	Protospacer
.************ ** ********   **

162. spacer 12.4|1645572|31|NC_014210|CRT matches to NZ_CP035092 (Paracoccus denitrificans strain ATCC 19367 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

acggcgtcaccgtgctcctggtcgatgccgc----	CRISPR spacer
ttggcgtcaccgtgctgctggtcga----gcagaa	Protospacer
 .************** ********    **

163. spacer 12.4|1645572|31|NC_014210|CRT matches to NZ_CP022366 (Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence) position: , mismatch: 7, identity: 0.774

acggcgtcaccgtgctcctggtcgatgccgc	CRISPR spacer
gcggcgtcaccgtcctgctggtcgagcacga	Protospacer
.************ ** ********   **

164. spacer 12.4|1645572|31|NC_014210|CRT matches to NC_008688 (Paracoccus denitrificans PD1222 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.774

acggcgtcaccgtgctcctggtcgatgccgc----	CRISPR spacer
ttggcgtcaccgtgctgctggtcga----gcagaa	Protospacer
 .************** ********    **

165. spacer 12.4|1645572|31|NC_014210|CRT matches to NC_017958 (Tistrella mobilis KA081020-065 plasmid pTM3, complete sequence) position: , mismatch: 7, identity: 0.774

acggcgtcaccgtgctcctggtcgatgccgc	CRISPR spacer
ggggcgtcaccgtgctcatggtcgaacacga	Protospacer
. *************** *******   **

166. spacer 12.4|1645572|31|NC_014210|CRT matches to NZ_CP032348 (Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence) position: , mismatch: 7, identity: 0.774

acggcgtcaccgtgctcctggtcgatgccgc	CRISPR spacer
gcggcgtcaccgtcctgctggtcgagcacga	Protospacer
.************ ** ********   **

167. spacer 12.4|1645572|31|NC_014210|CRT matches to NZ_CP018236 (Rhizobium leguminosarum strain Vaf-108 plasmid unnamed8) position: , mismatch: 7, identity: 0.774

acggcgtcaccgtgctcctggtcgatgccgc----	CRISPR spacer
ccggagtaaccgtgctcctggtcga----gcaaaa	Protospacer
 *** ** *****************    **

168. spacer 12.4|1645572|31|NC_014210|CRT matches to NZ_CP018236 (Rhizobium leguminosarum strain Vaf-108 plasmid unnamed8) position: , mismatch: 7, identity: 0.774

acggcgtcaccgtgctcctggtcgatgccgc----	CRISPR spacer
ccggagtaaccgtgctcctggtcga----gcaaaa	Protospacer
 *** ** *****************    **

169. spacer 12.4|1645572|31|NC_014210|CRT matches to NZ_AP022623 (Mycobacteroides abscessus strain JCM 30620 plasmid pJCM30620_2) position: , mismatch: 7, identity: 0.774

acggcgtcaccgtgctcctggtcgatgccgc	CRISPR spacer
acggcggcaccgtggtcctggtcggtttcaa	Protospacer
****** ******* *********.* .*.

170. spacer 12.4|1645572|31|NC_014210|CRT matches to NZ_CP029832 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.774

acggcgtcaccgtgctcctggtcga-tgccgc	CRISPR spacer
gcggcgtcaccgtgctgctggtggagcacca-	Protospacer
.*************** ***** ** ..**.

171. spacer 12.4|1645572|31|NC_014210|CRT matches to NC_021278 (Mycobacteroides abscessus subsp. bolletii 50594 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.774

acggcgtcaccgtgctcctggtcgatgccgc	CRISPR spacer
acggcggcaccgtggtcctggtcggtttcaa	Protospacer
****** ******* *********.* .*.

172. spacer 12.4|1645572|31|NC_014210|CRT matches to NZ_CP026518 (Deinococcus sp. NW-56 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.774

acggcgtcaccgtgctcctggtcgatgccgc----	CRISPR spacer
agggcgtcacggtgctgctggtcga----gcagaa	Protospacer
* ******** ***** ********    **

173. spacer 13.2|1662532|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to MN694449 (Marine virus AFVG_250M57, complete genome) position: , mismatch: 7, identity: 0.781

accagaacgtgatccgcggcggcggcatcgtc	CRISPR spacer
ggcagaacgtgatacacggcggcggcaatgac	Protospacer
. *********** *.*********** .* *

174. spacer 13.5|1662715|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP011665 (Streptomyces sp. Mg1 plasmid pSMg1-1, complete sequence) position: , mismatch: 7, identity: 0.781

ggcgccgacggcgacgactggtcgctctccaa	CRISPR spacer
tgcgccgacgccgccgactggtcggtggccga	Protospacer
 ********* ** ********** *  **.*

175. spacer 13.5|1662715|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP033582 (Streptomyces sp. ADI95-16 plasmid pADI95-16a, complete sequence) position: , mismatch: 7, identity: 0.781

ggcgccgacggcgacgactggtcgctctccaa	CRISPR spacer
tgcgccgacgccgccgactggtcggtggccga	Protospacer
 ********* ** ********** *  **.*

176. spacer 14.1|2013540|32|NC_014210|PILER-CR,CRISPRCasFinder matches to NC_047905 (Streptomyces phage Attoomi, complete genome) position: , mismatch: 7, identity: 0.781

ggcagcaggtcctccagggaaccgccgccccg	CRISPR spacer
gccgggcggtcctccagggcacggccgcccag	Protospacer
* *.*  ************ ** ******* *

177. spacer 14.6|2013843|32|NC_014210|CRISPRCasFinder matches to AP018698 (Arthrobacter sp. MN05-02 plasmid plasmid1 DNA, complete genome) position: , mismatch: 7, identity: 0.781

ccggggcgggtcacggacgtgtacctgctcca	CRISPR spacer
accgaggaggtcacggacgtggacctggtcca	Protospacer
 * *.* .************* ***** ****

178. spacer 14.7|2013904|32|NC_014210|CRISPRCasFinder matches to AP018698 (Arthrobacter sp. MN05-02 plasmid plasmid1 DNA, complete genome) position: , mismatch: 7, identity: 0.781

ccggggcgggtcacggacgtgtacctgctcca	CRISPR spacer
accgaggaggtcacggacgtggacctggtcca	Protospacer
 * *.* .************* ***** ****

179. spacer 14.18|2014575|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NZ_CP006993 (Methylobacterium sp. AMS5 plasmid pAMS5a, complete sequence) position: , mismatch: 7, identity: 0.781

gaggagttcgcctacgccatcgctgggtcggg	CRISPR spacer
gaggatttcgcctacgccctcgcggacaaggg	Protospacer
***** ************ **** *.   ***

180. spacer 14.18|2014575|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MH727543 (Mycobacterium phage CharlieB, complete genome) position: , mismatch: 7, identity: 0.781

gaggagttcgcctacgccatcgctgggtcggg	CRISPR spacer
gctgtgttcgccttcgccatcgctgtgttcgg	Protospacer
*  * ******** *********** **. **

181. spacer 14.23|2014880|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NZ_CP009405 (Mycobacterium avium subsp. hominissuis strain OCU464 plasmid p78K, complete sequence) position: , mismatch: 7, identity: 0.781

gccatcgcgatcgccgctgtcctgggcatgca-	CRISPR spacer
gagtccgcgaacgccgccgtcctgggca-gcac	Protospacer
*   .***** ******.********** ***

182. spacer 14.25|2015002|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NZ_LR594668 (Variovorax sp. SRS16 plasmid 3) position: , mismatch: 7, identity: 0.781

cccctccagcgcaagctgggcgtggacgctga	CRISPR spacer
gcgctgctgcgcaagctgggcgtggacgtgca	Protospacer
 * ** * ********************.  *

183. spacer 14.29|2015246|32|NC_014210|CRISPRCasFinder matches to NZ_CP015007 (Aminobacter aminovorans strain KCTC 2477 plasmid pAA02, complete sequence) position: , mismatch: 7, identity: 0.781

cgggccatctgcatggcggcctcttcggcgac	CRISPR spacer
aggggccagtgcatggcgacctcttccgcgac	Protospacer
 *** *   *********.******* *****

184. spacer 14.29|2015246|32|NC_014210|CRISPRCasFinder matches to NZ_CP016455 (Sphingobium sp. RAC03 plasmid pBSY17_3, complete sequence) position: , mismatch: 7, identity: 0.781

cgggccatctgcatggcggcctcttcggcgac	CRISPR spacer
cgggccgtctgcatggcggcatcgacgatgcc	Protospacer
******.************* **  **..* *

185. spacer 14.50|2014753|37|NC_014210|CRT matches to NZ_CP013265 (Sphingobium baderi strain DE-13 plasmid pDE1, complete sequence) position: , mismatch: 7, identity: 0.811

gaccgggatgacgcaagccgagatcgtccgggccacg	CRISPR spacer
gcctggattgacgcaagccgcgatcgtcctggccatg	Protospacer
* *.**. ************ ******** *****.*

186. spacer 14.59|2013843|31|NC_014210|PILER-CR matches to AP018698 (Arthrobacter sp. MN05-02 plasmid plasmid1 DNA, complete genome) position: , mismatch: 7, identity: 0.774

ccggggcgggtcacggacgtgtacctgctcc	CRISPR spacer
accgaggaggtcacggacgtggacctggtcc	Protospacer
 * *.* .************* ***** ***

187. spacer 14.60|2013904|31|NC_014210|PILER-CR matches to AP018698 (Arthrobacter sp. MN05-02 plasmid plasmid1 DNA, complete genome) position: , mismatch: 7, identity: 0.774

ccggggcgggtcacggacgtgtacctgctcc	CRISPR spacer
accgaggaggtcacggacgtggacctggtcc	Protospacer
 * *.* .************* ***** ***

188. spacer 14.61|2013965|31|NC_014210|PILER-CR matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.774

gccatgctcgcgtccgagacccgcaagatcc	CRISPR spacer
gatgtgctcgcgttcgatacccgcaagaccg	Protospacer
* ..*********.*** **********.*

189. spacer 14.62|2014026|31|NC_014210|PILER-CR matches to NC_017958 (Tistrella mobilis KA081020-065 plasmid pTM3, complete sequence) position: , mismatch: 7, identity: 0.774

gtgacgtcgtcgggcgtgtagagctcgcgct---	CRISPR spacer
atgccgtcttcgggcgtgtagagc---ggctcga	Protospacer
.** **** ***************    ***

190. spacer 23.2|5555650|32|NC_014210|CRISPRCasFinder matches to NC_012725 (Burkholderia glumae BGR1 plasmid bglu_4p, complete sequence) position: , mismatch: 7, identity: 0.781

gccgtcaccaggttgcccacggtcgcgccgag	CRISPR spacer
gcctcggcctggttgaccacggtcgcgccgat	Protospacer
*** . .** ***** ***************

191. spacer 23.2|5555650|32|NC_014210|CRISPRCasFinder matches to NC_012720 (Burkholderia glumae BGR1 plasmid bglu_3p, complete sequence) position: , mismatch: 7, identity: 0.781

gccgtcaccaggttgcccacggtcgcgccgag	CRISPR spacer
gcctcggcctggttgaccacggtcgcgccgat	Protospacer
*** . .** ***** ***************

192. spacer 23.2|5555650|32|NC_014210|CRISPRCasFinder matches to NZ_CP035902 (Burkholderia glumae strain 257sh-1 plasmid plas1, complete sequence) position: , mismatch: 7, identity: 0.781

gccgtcaccaggttgcccacggtcgcgccgag	CRISPR spacer
gcctcggcctggttgaccacggtcgcgccgat	Protospacer
*** . .** ***** ***************

193. spacer 23.3|5555711|32|NC_014210|CRISPRCasFinder matches to NZ_CP035511 (Haematobacter massiliensis strain OT1 plasmid pOT1-1, complete sequence) position: , mismatch: 7, identity: 0.781

cagctggccgccctccaggcgcagacgcaggc	CRISPR spacer
gatctggccgcccttcaggcgcagtcgctgaa	Protospacer
 * ***********.********* *** *.

194. spacer 23.3|5555711|32|NC_014210|CRISPRCasFinder matches to NZ_CP054621 (Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence) position: , mismatch: 7, identity: 0.781

cagctggccgccctccaggcgcagacgcaggc	CRISPR spacer
cagctggccgccccccaggcgcggaactcgtc	Protospacer
*************.********.**  . * *

195. spacer 23.3|5555711|32|NC_014210|CRISPRCasFinder matches to CP011998 (Ralstonia solanacearum strain YC45 plasmid, complete sequence) position: , mismatch: 7, identity: 0.781

cagctggccgccctccaggcgcagacgcaggc	CRISPR spacer
cagctggccgcccggcaggcgcagcgtcacgg	Protospacer
*************  *********   ** *

196. spacer 23.3|5555711|32|NC_014210|CRISPRCasFinder matches to NZ_CP032346 (Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.781

cagctggccgccctccaggcgcagacgcaggc---	CRISPR spacer
aagctgaccgccgtccaggcgca---gcagggtca	Protospacer
 *****.***** **********   *****

197. spacer 23.4|5555772|32|NC_014210|CRISPRCasFinder matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

ctgcccacccagctcaccgcgccggacgcgga	CRISPR spacer
ctatccacccagatcaccgcgccgtacgacgt	Protospacer
**..******** *********** ***  *

198. spacer 23.4|5555772|32|NC_014210|CRISPRCasFinder matches to NZ_CP022747 (Sphingobium hydrophobicum strain C1 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.781

-ctgcccacccagctcaccgcgccggacgcgga	CRISPR spacer
atcgcggaccc-gctcaccgcgccggaagcggc	Protospacer
 ..**  **** *************** ****

199. spacer 7.7|1581816|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_LR134463 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 21, complete sequence) position: , mismatch: 8, identity: 0.75

tccgcgaacgagatgctcatgggcggcgggat	CRISPR spacer
ggcatggccgagatgctcaagggcggcgtgat	Protospacer
  *..*. *********** ******** ***

200. spacer 7.9|1581936|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP032322 (Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.75

gacgacggggtcgctgctgctggccagggtgg	CRISPR spacer
ggcgacggggacgctgctgctgtccaccgccc	Protospacer
*.******** *********** ***  *.

201. spacer 7.9|1581936|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP007794 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence) position: , mismatch: 8, identity: 0.75

gacgacggggtcgctgctgctggccagggtgg	CRISPR spacer
ggcgacggggacgctgctgctgtccaccgccc	Protospacer
*.******** *********** ***  *.

202. spacer 7.9|1581936|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP032340 (Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.75

gacgacggggtcgctgctgctggccagggtgg	CRISPR spacer
ggcgacggggacgctgctgctgtccaccgccc	Protospacer
*.******** *********** ***  *.

203. spacer 7.9|1581936|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP032346 (Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.75

gacgacggggtcgctgctgctggccagggtgg	CRISPR spacer
ggcgacggggacgctgctgctgtccaccgccc	Protospacer
*.******** *********** ***  *.

204. spacer 7.9|1581936|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP012915 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence) position: , mismatch: 8, identity: 0.75

gacgacggggtcgctgctgctggccagggtgg	CRISPR spacer
ggcgacggggacgctgctgctgtccaccgccc	Protospacer
*.******** *********** ***  *.

205. spacer 7.9|1581936|32|NC_014210|CRISPRCasFinder,CRT matches to NC_027365 (Mycobacterium virus Fionnbarth, complete genome) position: , mismatch: 8, identity: 0.75

gacgacggggtcgctgctgctggccagggtgg	CRISPR spacer
cacgacggcgacgctgctgctggccgctggcg	Protospacer
 ******* * **************.  *  *

206. spacer 7.10|1581997|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP016619 (Microvirga ossetica strain V5/3m plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

atcctcctgccgccgccctgggacgcgatgag	CRISPR spacer
cccagggtgccgccgccctgggaggcgatgcg	Protospacer
 .*    **************** ****** *

207. spacer 7.10|1581997|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP016620 (Microvirga ossetica strain V5/3m plasmid unnamed4, complete sequence) position: , mismatch: 8, identity: 0.75

atcctcctgccgccgccctgggacgcgatgag	CRISPR spacer
cccagggtgccgccgccctgggaggcgatgcg	Protospacer
 .*    **************** ****** *

208. spacer 7.10|1581997|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP024583 (Roseomonas sp. FDAARGOS_362 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

atcctcctgccgccgccctgggacgcgatgag	CRISPR spacer
accctgctgtcgccgccctgggacgcctcgca	Protospacer
*.*** ***.****************  .* .

209. spacer 7.10|1581997|32|NC_014210|CRISPRCasFinder,CRT matches to MN103401 (Bordetella phage vB_BbrS_PHB09, complete genome) position: , mismatch: 8, identity: 0.75

atcctcctgccgccgccctgggacgcgatgag	CRISPR spacer
acgccgatgccgccgcccagggccgcgatgaa	Protospacer
*. *.  *********** *** ********.

210. spacer 7.10|1581997|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 8, identity: 0.75

atcctcctgccgccgccctgggacgcgatgag	CRISPR spacer
agcgccttgccgccgcgctgggtcgcgatgcc	Protospacer
* * .*.********* ***** *******

211. spacer 7.12|1582119|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 8, identity: 0.75

aggacggagcgcgggtgcgcctggtgtgcggg	CRISPR spacer
aggacggcgcgcgggtccgcctgcacaacggc	Protospacer
******* ******** ******    .***

212. spacer 7.12|1582119|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP022369 (Azospirillum sp. TSH58 plasmid TSH58_p05, complete sequence) position: , mismatch: 8, identity: 0.75

aggacggagcgcgggtgcgcctggtgtgcggg	CRISPR spacer
agcacggagcgcggctgcgcctgccgcgtgta	Protospacer
** *********** ******** .*.*.* .

213. spacer 8.3|1587611|33|NC_014210|PILER-CR matches to NZ_CP032325 (Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence) position: , mismatch: 8, identity: 0.758

cgccatcaacgccgccgcccgctccggtggtat	CRISPR spacer
ttccagcaccgccgccgcccgctccggtgccgg	Protospacer
. *** ** ******************** ..

214. spacer 8.3|1587611|33|NC_014210|PILER-CR matches to NZ_CP046906 (Streptomyces sp. QHH-9511 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.758

cgccatcaacgccgccgcccgctccggtggtat	CRISPR spacer
ggccatcaaggccgccacccgctccgggcgcgc	Protospacer
 ******** ******.**********  *...

215. spacer 8.3|1587611|33|NC_014210|PILER-CR matches to NZ_CP023408 (Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.758

cgccatcaacgccgccgcccgct------ccggtggtat	CRISPR spacer
cgccatctgcgccgccgcccgctcgaagcccgg------	Protospacer
******* .**************      ****

216. spacer 8.3|1587611|33|NC_014210|PILER-CR matches to NZ_CP007794 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence) position: , mismatch: 8, identity: 0.758

cgccatcaacgccgccgcccgctccggtggtat	CRISPR spacer
ggacgggatcgccgccgcccgcgccggtgggat	Protospacer
 * *.  * ************* ******* **

217. spacer 8.7|1587855|33|NC_014210|PILER-CR matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 8, identity: 0.758

cccaggccgccgaccctcgcgcggcccgccacg	CRISPR spacer
cccgggccgccgacccgcgcgcggtgatcgtcg	Protospacer
***.************ *******.   *  **

218. spacer 8.7|1587855|33|NC_014210|PILER-CR matches to NZ_CP020701 (Streptomyces tsukubensis strain NRRL 18488 plasmid pSTS1, complete sequence) position: , mismatch: 8, identity: 0.758

cccaggccgccgaccctcgcgc------ggcccgccacg	CRISPR spacer
cccaggccgccgacgcccgcgcggagaaggccc------	Protospacer
************** *.*****      *****

219. spacer 8.11|1588099|33|NC_014210|PILER-CR matches to NC_011892 (Methylobacterium nodulans ORS 2060 plasmid pMNOD01, complete sequence) position: , mismatch: 8, identity: 0.758

cgggaagcccaccggcaccgtccgcaaggtcgc	CRISPR spacer
gggcaagcccgccggcaccgtccgcatcacggc	Protospacer
 ** ******.***************  .. **

220. spacer 8.12|1587490|32|NC_014210|CRISPRCasFinder,CRT matches to MH834608 (Arthrobacter phage Cote, complete genome) position: , mismatch: 8, identity: 0.75

-----aaggccacccactgctggcaggacccgcgcac	CRISPR spacer
ctggaatgg-----cacggctggcaggaccagcgcac	Protospacer
     * **     *** ************ ******

221. spacer 8.14|1587612|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP016453 (Sphingobium sp. RAC03 plasmid pBSY17_1, complete sequence) position: , mismatch: 8, identity: 0.75

gccatcaacgccgccgcccgctccggtggtat	CRISPR spacer
gccagcaacgccgccgcccgcaccgccaagac	Protospacer
**** **************** *** ... *.

222. spacer 8.14|1587612|32|NC_014210|CRISPRCasFinder,CRT matches to NC_016586 (Azospirillum lipoferum 4B plasmid AZO_p2, complete sequence) position: , mismatch: 8, identity: 0.75

gccatcaacgccgccgcccgctccggtggtat	CRISPR spacer
accatcatcgccgccacccgctccggcgccgg	Protospacer
.****** *******.**********.* ..

223. spacer 8.14|1587612|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP032324 (Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence) position: , mismatch: 8, identity: 0.75

gccatcaacgccgccgcccgctccggtggtat	CRISPR spacer
aggatttgcgccgccgcccgctccggcgggat	Protospacer
.  **. .******************.** **

224. spacer 8.14|1587612|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP023408 (Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.75

gccatcaacgccgccgcccgct------ccggtggtat	CRISPR spacer
gccatctgcgccgccgcccgctcgaagcccgg------	Protospacer
****** .**************      ****

225. spacer 8.14|1587612|32|NC_014210|CRISPRCasFinder,CRT matches to NC_008381 (Rhizobium leguminosarum bv. viciae 3841 plasmid pRL10, complete sequence) position: , mismatch: 8, identity: 0.75

gccatcaacgccgccgcccgctccggtggtat	CRISPR spacer
gccatgaaggccgccgcccgctcagcttgatc	Protospacer
***** ** ************** * * *  .

226. spacer 8.14|1587612|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP025013 (Rhizobium leguminosarum strain Norway plasmid pRLN1, complete sequence) position: , mismatch: 8, identity: 0.75

gccatcaacgccgccgcccgctccggtggtat	CRISPR spacer
gccatgaacgccgccgcctgctcgtgccgggt	Protospacer
***** ************.****  *. * .*

227. spacer 8.14|1587612|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP022369 (Azospirillum sp. TSH58 plasmid TSH58_p05, complete sequence) position: , mismatch: 8, identity: 0.75

gccatcaacgccgccgcccgctccggtggtat	CRISPR spacer
tcgagcaccgccgccgcccgttccggtgccgt	Protospacer
 * * ** ************.******* ..*

228. spacer 8.14|1587612|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP048281 (Rhizobium leguminosarum bv. viciae 248 plasmid pRle248e, complete sequence) position: , mismatch: 8, identity: 0.75

gccatcaacgccgccgcccgctccggtggtat	CRISPR spacer
gccatgaacgccgccgcctgctcgtgccgggt	Protospacer
***** ************.****  *. * .*

229. spacer 8.14|1587612|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP032349 (Azospirillum brasilense strain MTCC4039 plasmid p3, complete sequence) position: , mismatch: 8, identity: 0.75

-gccatcaacgccgccgcccgctccggtggtat	CRISPR spacer
cgacgt-gacgccgccggcggctccggtggtca	Protospacer
 * *.* .********* * ***********

230. spacer 8.18|1587856|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 8, identity: 0.75

ccaggccgccgaccctcgcgcggcccgccacg	CRISPR spacer
ccgggccgccgacccgcgcgcggtgatcgtcg	Protospacer
**.************ *******.   *  **

231. spacer 8.18|1587856|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 8, identity: 0.75

ccaggccgccgaccctcgcgcggcccgccacg	CRISPR spacer
cctggccgccgacccccgcgcggtgctggtcg	Protospacer
** ************.*******. *    **

232. spacer 8.18|1587856|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP012940 (Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

ccaggccgccgaccctcgcgcggcccgccacg-	CRISPR spacer
acccgccgcccaccctcgcccggcccg-agcgc	Protospacer
 *  ****** ******** *******  .**

233. spacer 8.18|1587856|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP012944 (Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

ccaggccgccgaccctcgcgcggcccgccacg-	CRISPR spacer
acccgccgcccaccctcgcccggcccg-agcgc	Protospacer
 *  ****** ******** *******  .**

234. spacer 8.18|1587856|32|NC_014210|CRISPRCasFinder,CRT matches to NC_013858 (Azospirillum sp. B510 plasmid pAB510d, complete sequence) position: , mismatch: 8, identity: 0.75

ccaggccgccgaccctcgcgcggcccg-ccacg	CRISPR spacer
tcccgccgccgcccctcgcccggcccgatcgc-	Protospacer
.*  ******* ******* ******* .*.*

235. spacer 8.18|1587856|32|NC_014210|CRISPRCasFinder,CRT matches to NC_017575 (Ralstonia solanacearum Po82 megaplasmid, complete sequence) position: , mismatch: 8, identity: 0.75

ccaggccgccgaccctcgcgcggcccgccacg-	CRISPR spacer
acccgccgcccaccctcgcccggcccg-agcgc	Protospacer
 *  ****** ******** *******  .**

236. spacer 8.18|1587856|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP026308 (Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

ccaggccgccgaccctcgcgcggcccgccacg-	CRISPR spacer
acccgccgcccaccctcgcccggcccg-agcgc	Protospacer
 *  ****** ******** *******  .**

237. spacer 8.18|1587856|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP051295 (Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence) position: , mismatch: 8, identity: 0.75

ccaggccgccgaccctcgcgcggcccgccacg-	CRISPR spacer
acccgccgcccaccctcgcccggcccg-agcgc	Protospacer
 *  ****** ******** *******  .**

238. spacer 8.18|1587856|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP020701 (Streptomyces tsukubensis strain NRRL 18488 plasmid pSTS1, complete sequence) position: , mismatch: 8, identity: 0.75

ccaggccgccgaccctcgcgc------ggcccgccacg	CRISPR spacer
ccaggccgccgacgcccgcgcggagaaggccc------	Protospacer
************* *.*****      *****

239. spacer 8.18|1587856|32|NC_014210|CRISPRCasFinder,CRT matches to KY092483 (Streptomyces phage Bioscum, complete genome) position: , mismatch: 8, identity: 0.75

ccaggccgccgaccctcgcgcggcccgccacg	CRISPR spacer
cgcctccctcgacgctctcgcggcccgccacg	Protospacer
*    ** .**** *** **************

240. spacer 8.18|1587856|32|NC_014210|CRISPRCasFinder,CRT matches to MT701591 (Burkholderia phage Mana, complete genome) position: , mismatch: 8, identity: 0.75

ccaggccgccgaccctcgcgcggcccgccacg	CRISPR spacer
tcggcccgccgaccgccgcgcggcccgcgcca	Protospacer
.*.* ********* .************  *.

241. spacer 8.18|1587856|32|NC_014210|CRISPRCasFinder,CRT matches to MK305888 (Streptomyces phage Austintatious, complete genome) position: , mismatch: 8, identity: 0.75

ccaggccgccgaccctcgcgcggcccgccacg	CRISPR spacer
cgcctccctcgacgctctcgcggcccgccacg	Protospacer
*    ** .**** *** **************

242. spacer 8.18|1587856|32|NC_014210|CRISPRCasFinder,CRT matches to NC_047792 (Streptomyces phage Ididsumtinwong, complete genome) position: , mismatch: 8, identity: 0.75

ccaggccgccgaccctcgcgcggcccgccacg	CRISPR spacer
cgcctccctcgacgctctcgcggcccgccacg	Protospacer
*    ** .**** *** **************

243. spacer 8.18|1587856|32|NC_014210|CRISPRCasFinder,CRT matches to KY092481 (Streptomyces phage PapayaSalad, complete genome) position: , mismatch: 8, identity: 0.75

ccaggccgccgaccctcgcgcggcccgccacg	CRISPR spacer
cgcctccctcgacgctctcgcggcccgccacg	Protospacer
*    ** .**** *** **************

244. spacer 8.20|1587978|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP032325 (Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence) position: , mismatch: 8, identity: 0.75

cgggtccgaggtcggcgggcgggcggtcctcg	CRISPR spacer
gggcgtcgaggtcggcgggcaggcggtccagc	Protospacer
 **  .**************.********

245. spacer 8.20|1587978|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP022191 (Yangia pacifica strain YSBP01 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

cgggtccgaggtcggcgggcgggcggtcctcg	CRISPR spacer
agttgtagaggtcggcgcgcaggcggtcctcg	Protospacer
 *   . ********** **.***********

246. spacer 8.20|1587978|32|NC_014210|CRISPRCasFinder,CRT matches to LN997843 (Streptomyces reticuli genome assembly TUE45, plasmid : II) position: , mismatch: 8, identity: 0.75

cgggtccgaggtcggcgggcgggcggtcctcg	CRISPR spacer
cctgggtggggccggtgggcgggcggtcctcg	Protospacer
*  *  .*.**.***.****************

247. spacer 8.22|1588100|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP022748 (Sphingobium hydrophobicum strain C1 plasmid p2, complete sequence) position: , mismatch: 8, identity: 0.75

gggaagcccaccggcaccgtccg---caaggtcgc	CRISPR spacer
tggaagcccaccgacaccgtacgcttcgagct---	Protospacer
 ************.****** **   *.** *

248. spacer 8.22|1588100|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP034185 (Deinococcus sp. S14-83 strain S14-83T plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

gggaagcc----caccggcaccgtccgcaaggtcgc	CRISPR spacer
----acccctggcaccgtcaccgtcctcaaggtcga	Protospacer
    * **    ***** ******** ********

249. spacer 8.22|1588100|32|NC_014210|CRISPRCasFinder,CRT matches to NC_022087 (Mycobacterium phage AnnaL29, complete genome) position: , mismatch: 8, identity: 0.75

gggaagcccaccggcaccgtccgcaaggtcgc	CRISPR spacer
ctgatgttcaccgccaccgtccgcaagatcgg	Protospacer
  ** *..***** *************.***

250. spacer 9.3|1595182|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NC_008384 (Rhizobium leguminosarum bv. viciae 3841 plasmid pRL11, complete sequence) position: , mismatch: 8, identity: 0.75

cagcgtcgtcgaccccaggctga-----cggaggtct	CRISPR spacer
cagcgttgtcgacccccggctgaggctccggg-----	Protospacer
******.********* ******     ***.

251. spacer 9.3|1595182|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP025014 (Rhizobium leguminosarum strain Norway plasmid pRLN2, complete sequence) position: , mismatch: 8, identity: 0.75

cagcgtcgtcgaccccaggctga-----cggaggtct	CRISPR spacer
cagtgtcgtcgatcccaggctgagattccggg-----	Protospacer
***.********.**********     ***.

252. spacer 9.3|1595182|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP049732 (Rhizobium leguminosarum strain A1 plasmid pRL11, complete sequence) position: , mismatch: 8, identity: 0.75

cagcgtcgtcgaccccaggctga-----cggaggtct	CRISPR spacer
cagcgtcgtcgatccgaggctgagattccggg-----	Protospacer
************.** *******     ***.

253. spacer 9.3|1595182|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP018230 (Rhizobium leguminosarum strain Vaf-108 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

cagcgtcgtcgaccccaggctga-----cggaggtct	CRISPR spacer
cagcgtcgtcgatcccaggttgaggctccggg-----	Protospacer
************.******.***     ***.

254. spacer 9.3|1595182|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NC_011366 (Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG202, complete sequence) position: , mismatch: 8, identity: 0.75

cagcgtcgtcgaccccaggctga-----cggaggtct	CRISPR spacer
cagcgtcgtcgatccccggctgaaactgcggg-----	Protospacer
************.*** ******     ***.

255. spacer 9.3|1595182|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013503 (Rhizobium esperanzae strain N561 plasmid pRspN561c, complete sequence) position: , mismatch: 8, identity: 0.75

cagcgtcgtcgaccccaggctga-----cggaggtct	CRISPR spacer
cagcgtcgtcgatccccggctgaaactccggg-----	Protospacer
************.*** ******     ***.

256. spacer 9.3|1595182|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013509 (Rhizobium sp. N1341 plasmid pRspN1341d, complete sequence) position: , mismatch: 8, identity: 0.75

cagcgtcgtcgaccccaggctga-----cggaggtct	CRISPR spacer
cagcgtcgtcgatccccggctgaaactccggg-----	Protospacer
************.*** ******     ***.

257. spacer 9.3|1595182|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013520 (Rhizobium sp. N113 plasmid pRspN113c, complete sequence) position: , mismatch: 8, identity: 0.75

cagcgtcgtcgaccccaggctga-----cggaggtct	CRISPR spacer
cagcgtcgtcgatccccggctgaaactccggg-----	Protospacer
************.*** ******     ***.

258. spacer 9.3|1595182|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013493 (Rhizobium sp. N6212 plasmid pRspN6212c, complete sequence) position: , mismatch: 8, identity: 0.75

cagcgtcgtcgaccccaggctga-----cggaggtct	CRISPR spacer
cagcgtcgtcgatccccggctgaaactccggg-----	Protospacer
************.*** ******     ***.

259. spacer 9.3|1595182|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013516 (Rhizobium sp. N1314 plasmid pRspN1314e, complete sequence) position: , mismatch: 8, identity: 0.75

cagcgtcgtcgaccccaggctga-----cggaggtct	CRISPR spacer
cagcgtcgtcgatccccggctgaaactccggg-----	Protospacer
************.*** ******     ***.

260. spacer 9.3|1595182|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP054029 (Rhizobium sp. JKLM19E plasmid pPR19E02, complete sequence) position: , mismatch: 8, identity: 0.75

cagcgtcgtcgaccccaggctga-----cggaggtct	CRISPR spacer
cagcgtcgtcgatccccggctgaaactccggg-----	Protospacer
************.*** ******     ***.

261. spacer 9.3|1595182|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022566 (Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK02, complete sequence) position: , mismatch: 8, identity: 0.75

cagcgtcgtcgaccccaggctgacggaggtct----	CRISPR spacer
cagcgttgtcgatcccaggct----gaggcttcggg	Protospacer
******.*****.********    ****..*

262. spacer 9.3|1595182|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP035001 (Rhizobium acidisoli strain FH23 plasmid pRapFH23c, complete sequence) position: , mismatch: 8, identity: 0.75

cagcgtcgtcgaccccaggctga-----cggaggtct	CRISPR spacer
cagcgtcgtcgatccccggctgaaactgcggg-----	Protospacer
************.*** ******     ***.

263. spacer 9.7|1595426|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP035092 (Paracoccus denitrificans strain ATCC 19367 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

gcggaccggcccacccggctggcgaccgtcgc	CRISPR spacer
cgcgaccgggccgcccggctggcgaccgaggg	Protospacer
   ****** **.***************  *

264. spacer 9.7|1595426|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NC_008688 (Paracoccus denitrificans PD1222 plasmid 1, complete sequence) position: , mismatch: 8, identity: 0.75

gcggaccggcccacccggctggcgaccgtcgc	CRISPR spacer
cgcgaccgggccgcccggctggcgaccgaggg	Protospacer
   ****** **.***************  *

265. spacer 9.8|1595487|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to CP047137 (Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

gccgtcgccgcctacgcgaccgccctcgggct	CRISPR spacer
gccggccccgcctacgcgaccgccctgcaatc	Protospacer
**** * *******************  ....

266. spacer 9.8|1595487|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 8, identity: 0.75

gccgtcgccgcctacgcgaccgccctcgggct	CRISPR spacer
cccgtggccggctacgcgaccgcccaccgctc	Protospacer
 **** **** ************** * * ..

267. spacer 9.8|1595487|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 8, identity: 0.75

gccgtcgccgcctacgcgaccgccctcgggct	CRISPR spacer
ccctccgccgcccacgccaccgccctcgcggc	Protospacer
 ** .*******.**** ********** * .

268. spacer 9.8|1595487|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 8, identity: 0.75

gccgtcgccgcctacgcgaccgccctcgggct	CRISPR spacer
cccgtggccggctacgcgaccgcccaccgctc	Protospacer
 **** **** ************** * * ..

269. spacer 9.8|1595487|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 8, identity: 0.75

gccgtcgccgcctacgcgaccgccctcgggct	CRISPR spacer
ccctccgccgcccacgccaccgccctcgcggc	Protospacer
 ** .*******.**** ********** * .

270. spacer 9.8|1595487|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_AP014705 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence) position: , mismatch: 8, identity: 0.75

gccgtcgccgcctacgcgaccgccctcgggct	CRISPR spacer
gatttcgccgcctacgccaccgccttcggcgg	Protospacer
* . ************* ******.****

271. spacer 9.8|1595487|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP047174 (Rathayibacter sp. VKM Ac-2760 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

gccgtcgccgcctacgcgaccgccctcgggct---	CRISPR spacer
cgcgtcgacacctacgcgaccgccct---gttcgc	Protospacer
  ***** *.****************   *.*

272. spacer 9.8|1595487|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_LR134465 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 23, complete sequence) position: , mismatch: 8, identity: 0.75

gccgtcgccgcctacgcgaccgccctcgggct	CRISPR spacer
ctccgcgccgcctacgggaccggcctcgcgat	Protospacer
 .*  *********** ***** ***** * *

273. spacer 9.8|1595487|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NC_002699 (Frankia sp. CpI1 plasmid pFQ12, complete plasmid sequence) position: , mismatch: 8, identity: 0.75

gccgtcgccgcctacgcgaccgccctcgggct	CRISPR spacer
accgtcgccgccagcgcgaccgccgcccgccc	Protospacer
.*********** .********** .* * *.

274. spacer 9.8|1595487|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NC_013531 (Xylanimonas cellulosilytica DSM 15894 plasmid pXCEL01, complete sequence) position: , mismatch: 8, identity: 0.75

gccgtcgccgcctacgcgaccgccctcgggct	CRISPR spacer
gaccccaacgccttcgccaccgccctcgggcg	Protospacer
* * .*. ***** *** *************

275. spacer 9.8|1595487|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to CP022016 (Salmonella enterica subsp. enterica serovar India str. SA20085604 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

gccgtcgccgcctacgcgaccgccctcgggct----	CRISPR spacer
accctcgccgcctgcgcgaccgcc----ggttatag	Protospacer
.** *********.**********    **.*

276. spacer 9.8|1595487|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to MG757154 (Streptomyces phage Bing, complete genome) position: , mismatch: 8, identity: 0.75

gccgtcgccgcctacgcgaccgccctcgggct	CRISPR spacer
gccgtcgccgccgacgtgaccgctgcctgacc	Protospacer
************ ***.******. .* *.*.

277. spacer 9.10|1595610|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022195 (Yangia pacifica strain YSBP01 plasmid unnamed5, complete sequence) position: , mismatch: 8, identity: 0.75

tcgatgaccgaggtcgacggcaccgggtcgga	CRISPR spacer
ctgccggacgcggtcgacggcaccgggccgga	Protospacer
..* .*. ** ****************.****

278. spacer 9.10|1595610|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to CP062157 (Pseudomonas lundensis strain 2T.2.5.2 plasmid pPL-38ph, complete sequence) position: , mismatch: 8, identity: 0.75

tcgatgaccgaggtcgacggcaccgggtcgga	CRISPR spacer
ccgatgatcgaggtcgacggcagcgcaatggt	Protospacer
.******.************** ** . .**

279. spacer 10.1|1602774|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP034782 (Pseudomonas sp. MPC6 plasmid pMPC6-328K, complete sequence) position: , mismatch: 8, identity: 0.75

tgagaaaccgctcatgaactggagaaacacat	CRISPR spacer
gccgttaccgctaaggaactggagaaacactt	Protospacer
   *  ****** * *************** *

280. spacer 10.2|1602835|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NC_012811 (Methylorubrum extorquens AM1 megaplasmid, complete sequence) position: , mismatch: 8, identity: 0.75

cggggccgtggtgttggacgccgcggatgtgg	CRISPR spacer
gggggccgtggtgtcggccgccgctggcctcg	Protospacer
 *************.** ****** *.. * *

281. spacer 10.2|1602835|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP021405 (Celeribacter manganoxidans strain DY25 plasmid pDY25-A, complete sequence) position: , mismatch: 8, identity: 0.75

cggggccgtggtgttggacgccgcggatgtgg	CRISPR spacer
cgaggccgtggtgctggacgccggtggcgacg	Protospacer
**.**********.*********  *..*  *

282. spacer 10.3|1602896|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP049906 (Diaphorobacter sp. HDW4B plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

tcggacgcgggcgatgacttcttctgcgtctt	CRISPR spacer
gttcacgcgggcgatgacttcttcttcggtgt	Protospacer
 .  ********************* ** . *

283. spacer 10.4|1602957|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP023071 (Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence) position: , mismatch: 8, identity: 0.75

tcgtcggccttgaccatcatctgcaccccgcg	CRISPR spacer
tgaccggccttgaccatcatcggcaccagcag	Protospacer
* ..***************** *****    *

284. spacer 10.4|1602957|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP029232 (Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence) position: , mismatch: 8, identity: 0.75

tcgtcggccttgaccatcatctgcaccccgcg	CRISPR spacer
tgaccggccttgaccatcatcggcaccagcag	Protospacer
* ..***************** *****    *

285. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP025013 (Rhizobium leguminosarum strain Norway plasmid pRLN1, complete sequence) position: , mismatch: 8, identity: 0.75

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
cggccgccgggccgccggggtggctgacgata	Protospacer
***************** ******...*  .

286. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP054022 (Rhizobium sp. JKLM12A2 plasmid pPR12A201, complete sequence) position: , mismatch: 8, identity: 0.75

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
cggccgccgggccgccggggtggctgacgatg	Protospacer
***************** ******...*  .

287. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NC_012848 (Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132501, complete sequence) position: , mismatch: 8, identity: 0.75

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
cggccgccgggccgccggggtggctgacgatg	Protospacer
***************** ******...*  .

288. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP034351 (Streptomyces sp. W1SF4 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.75

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
tgcccgccgggccgccgcggcggccacgtggg	Protospacer
.* *****************.*****  *

289. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032343 (Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence) position: , mismatch: 8, identity: 0.75

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
cgaccgccgggccgccgcggtagccgtagtcg	Protospacer
**.******************.***.   .*

290. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP012917 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence) position: , mismatch: 8, identity: 0.75

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
cgaccgccgggccgccgcggtagccgtagtcg	Protospacer
**.******************.***.   .*

291. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP054616 (Azospirillum oryzae strain KACC 14407 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
cggccgccgggccgcggcggaggcggtcagcc	Protospacer
*************** **** *** . *  *.

292. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP054616 (Azospirillum oryzae strain KACC 14407 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
catcggccgcgccgccgcggtgcccagccggt	Protospacer
*. * **** ************ *****.  *

293. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP026091 (Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
aagccgccgggccgcggcggtgacctcgtcgt	Protospacer
 .************* ******.**   ** *

294. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP021653 (Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
gagccgccgggccgcggcggtgacctcgtcgt	Protospacer
 .************* ******.**   ** *

295. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP026093 (Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
aagccgccgggccgcggcggtgacctcgtcgt	Protospacer
 .************* ******.**   ** *

296. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP021767 (Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
aagccgccgggccgcggcggtgacctcgtcgt	Protospacer
 .************* ******.**   ** *

297. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP012940 (Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
gagccgccgggccgcggcggtgacctcatcgt	Protospacer
 .************* ******.**   ** *

298. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP012944 (Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
gagccgccgggccgcggcggtgacctcatcgt	Protospacer
 .************* ******.**   ** *

299. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP012688 (Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
gagccgccgggccgcggcggtgacctcgtcgt	Protospacer
 .************* ******.**   ** *

300. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NC_013857 (Azospirillum sp. B510 plasmid pAB510c, complete sequence) position: , mismatch: 8, identity: 0.75

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
catcggccgcgccgccgcggtgcccagccggt	Protospacer
*. * **** ************ *****.  *

301. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NC_017575 (Ralstonia solanacearum Po82 megaplasmid, complete sequence) position: , mismatch: 8, identity: 0.75

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
gagccgccgggccgcggcggtgacctcatcgt	Protospacer
 .************* ******.**   ** *

302. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP026308 (Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
gagccgccgggccgcggcggtgacctcatcgt	Protospacer
 .************* ******.**   ** *

303. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP021119 (Streptomyces sp. CLI2509 strain CLI2905 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

cggccg--ccgggccgccgcggtggccagctcct	CRISPR spacer
--gctggcccgggccgccgctgtggccggctggc	Protospacer
  **.*  ************ ******.***  .

304. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP021119 (Streptomyces sp. CLI2509 strain CLI2905 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

cggccg--ccgggccgccgcggtggccagctcct	CRISPR spacer
--gctggcccgggccgccgctgtggccggctggc	Protospacer
  **.*  ************ ******.***  .

305. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to CP047139 (Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
gagccgccgggccgcggcggtgacctcgtcgt	Protospacer
 .************* ******.**   ** *

306. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP051295 (Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence) position: , mismatch: 8, identity: 0.75

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
gagccgccgggccgcggcggtgacctcatcgt	Protospacer
 .************* ******.**   ** *

307. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to CP047137 (Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
gagccgccgggccgcggcggtgacctcgtcgt	Protospacer
 .************* ******.**   ** *

308. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to MN945901 (Mycobacterium phage Ximenita, complete genome) position: , mismatch: 8, identity: 0.75

-----cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
tgtgacgac-----ggccgccgcggcggccagcccct	Protospacer
     **.*     ***********.*******.***

309. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to MH910042 (Mycobacterium phage Scarlett, complete genome) position: , mismatch: 8, identity: 0.75

cggccgc-cgggccgccgcggtggccagctcct	CRISPR spacer
-gatcatgcgggccgccgcggtggcgcgctcgt	Protospacer
 *..*.. *****************  **** *

310. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to MH910038 (Mycobacterium phage LeMond, complete genome) position: , mismatch: 8, identity: 0.75

cggccgc-cgggccgccgcggtggccagctcct	CRISPR spacer
-gatcatgcgggccgccgcggtggcacgctcgt	Protospacer
 *..*.. *****************  **** *

311. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to MK460246 (Mycobacterium phage Nibb, complete genome) position: , mismatch: 8, identity: 0.75

cggccgc-cgggccgccgcggtggccagctcct	CRISPR spacer
-gatcatgcgggccgccgcggtggccttctcgt	Protospacer
 *..*.. ******************  *** *

312. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to MH910039 (Mycobacterium phage Oscar, complete genome) position: , mismatch: 8, identity: 0.75

cggccgc-cgggccgccgcggtggccagctcct	CRISPR spacer
-gatcatgcgggccgccgcggtggcacgctcgt	Protospacer
 *..*.. *****************  **** *

313. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to MK376955 (Mycobacterium phage KiSi, complete genome) position: , mismatch: 8, identity: 0.75

cggccgc-cgggccgccgcggtggccagctcct	CRISPR spacer
-gatcatgcgggccgccgcggtggcgcgctcgt	Protospacer
 *..*.. *****************  **** *

314. spacer 10.6|1603079|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP007129 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence) position: , mismatch: 8, identity: 0.75

gaggcggcgcgcgcggacccgtcgtcgctgtc	CRISPR spacer
gcgtgggcgagcgcgaacccgtcgtcgcgctg	Protospacer
* *  **** *****.************  *

315. spacer 10.7|1603140|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP010625 (Phaeobacter inhibens strain P51 plasmid pP51_b, complete sequence) position: , mismatch: 8, identity: 0.75

atcccgcgtggcgctgccctctacctgcgcgg	CRISPR spacer
gccaaccatggcgctgcccgcaacctgcgcgg	Protospacer
..*   *.*********** * **********

316. spacer 10.7|1603140|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP010670 (Phaeobacter inhibens strain P57 plasmid pP57_b, complete sequence) position: , mismatch: 8, identity: 0.75

atcccgcgtggcgctgccctctacctgcgcgg	CRISPR spacer
gccaaccatggcgctgcccgcaacctgcgcgg	Protospacer
..*   *.*********** * **********

317. spacer 10.7|1603140|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP031959 (Phaeobacter sp. LSS9 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.75

atcccgcgtggcgctgccctctacctgcgcgg	CRISPR spacer
gccaaccatggcgctgcccgcaacctgcgcgg	Protospacer
..*   *.*********** * **********

318. spacer 10.7|1603140|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP010719 (Phaeobacter piscinae strain P18 plasmid pP18_d, complete sequence) position: , mismatch: 8, identity: 0.75

atcccgcgtggcgctgccctctacctgcgcgg	CRISPR spacer
gccaaccatggcgctgcccgcaacctgcgcgg	Protospacer
..*   *.*********** * **********

319. spacer 10.7|1603140|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP010743 (Phaeobacter inhibens strain P59 plasmid pP59_b, complete sequence) position: , mismatch: 8, identity: 0.75

atcccgcgtggcgctgccctctacctgcgcgg	CRISPR spacer
gccaaccatggcgctgcccgcaacctgcgcgg	Protospacer
..*   *.*********** * **********

320. spacer 10.7|1603140|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP010620 (Phaeobacter inhibens strain P30 isolate M4-3.1A plasmid pP30_c, complete sequence) position: , mismatch: 8, identity: 0.75

atcccgcgtggcgctgccctctacctgcgcgg	CRISPR spacer
gccaaccatggcgctgcccgcaacctgcgcgg	Protospacer
..*   *.*********** * **********

321. spacer 10.7|1603140|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP010772 (Phaeobacter piscinae strain P13 plasmid pP13_e, complete sequence) position: , mismatch: 8, identity: 0.75

atcccgcgtggcgctgccctctacctgcgcgg	CRISPR spacer
gccaaccatggcgctgcccgcaacctgcgcgg	Protospacer
..*   *.*********** * **********

322. spacer 10.7|1603140|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP010701 (Phaeobacter inhibens strain P24 plasmid pP24_e, complete sequence) position: , mismatch: 8, identity: 0.75

atcccgcgtggcgctgccctctacctgcgcgg	CRISPR spacer
gccaaccatggcgctgcccgcaacctgcgcgg	Protospacer
..*   *.*********** * **********

323. spacer 10.7|1603140|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP010747 (Phaeobacter inhibens strain P48 isolate M21-2.3 plasmid pP48_b, complete sequence) position: , mismatch: 8, identity: 0.75

atcccgcgtggcgctgccctctacctgcgcgg	CRISPR spacer
gccaaccatggcgctgcccgcaacctgcgcgg	Protospacer
..*   *.*********** * **********

324. spacer 10.7|1603140|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013104 (Paraburkholderia caribensis strain MWAP64 plasmid 1, complete sequence) position: , mismatch: 8, identity: 0.75

-atcccgcgtggcgctgccctctacctgcgcgg	CRISPR spacer
cacttcg-acggcgctgcccgccacctgcgcgg	Protospacer
 *...** ..********** *.**********

325. spacer 10.7|1603140|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

-atcccgcgtggcgctgccctctacctgcgcgg	CRISPR spacer
cacttcg-acggcgctgcccgccacctgcgcgg	Protospacer
 *...** ..********** *.**********

326. spacer 10.9|1603262|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 8, identity: 0.75

tgcgcggccgccgccttgtttgcccacgtccc	CRISPR spacer
accgcggccgccgccctgcttgccctggaccg	Protospacer
  *************.**.******  * **

327. spacer 10.9|1603262|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP040760 (Paracoccus sp. 2251 plasmid unnamed6, complete sequence) position: , mismatch: 8, identity: 0.75

tgcgcggccgccgccttgtttgcccacgtccc	CRISPR spacer
gccgcggccgccgccgagtttgccctgttcca	Protospacer
  *************  ********   ***

328. spacer 10.10|1603323|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NC_014753 (Oceanithermus profundus DSM 14977 plasmid pOCEPR01, complete sequence) position: , mismatch: 8, identity: 0.75

ggcagtggtgaggggctcgcccttcaggccaa	CRISPR spacer
ggccgtggtcaggggctcgccctggtagtcga	Protospacer
*** ***** *************   .*.*.*

329. spacer 11.1|1638373|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_LR134449 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 7, complete sequence) position: , mismatch: 8, identity: 0.75

tacgcatccacggcaagccgccgctgcgcgaa	CRISPR spacer
acctgttccacggcacgccgccgcggcgcgag	Protospacer
  *   ********* ******** ******.

330. spacer 11.1|1638373|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to CP027479 (Pseudomonas koreensis strain P19E3 plasmid p2, complete sequence) position: , mismatch: 8, identity: 0.75

tacgcatccacggcaagccgccgctgcgcgaa	CRISPR spacer
tgcccatcaacggcatgccgccgctgcctgtt	Protospacer
*.* **** ****** *********** .*

331. spacer 11.4|1638555|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP033873 (Caulobacter sp. FWC26 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.75

ttcttggcgttcatcgcttcagctccggcagg	CRISPR spacer
tccttggcgctcatcgcttcggctccgttttc	Protospacer
*.*******.**********.****** .

332. spacer 11.4|1638555|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP039693 (Agrobacterium larrymoorei strain CFBP5473 plasmid pAlCFBP5473, complete sequence) position: , mismatch: 8, identity: 0.75

ttcttggcgttcatcgcttcagctccggcagg	CRISPR spacer
gtcggagcgttcatcgcatcagctgcggctgc	Protospacer
 **  .*********** ****** **** *

333. spacer 11.5|1638616|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP037902 (Cupriavidus metallidurans strain BS1 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.75

agggtgagcgggtccacggcgccggtgacgat	CRISPR spacer
gcggccaccgggcccagggcgccggtgacgac	Protospacer
. **. * ****.*** **************.

334. spacer 11.5|1638616|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP010410 (Xanthomonas sacchari strain R1 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

agggtgagcgggtccacggcgccggtgacgat	CRISPR spacer
atgctcggcaggtccatggcgccggtgacggc	Protospacer
* * * .**.******.*************..

335. spacer 11.5|1638616|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP020556 (Streptomyces sp. Sge12 plasmid pSGE, complete sequence) position: , mismatch: 8, identity: 0.75

agggtgagcgggtccacggcgccggtgacgat-	CRISPR spacer
agggggagcgggtccagggcgcc-ctagcgcct	Protospacer
**** *********** ******  *..** .

336. spacer 11.5|1638616|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to MF919510 (Gordonia phage Kabluna, complete genome) position: , mismatch: 8, identity: 0.75

agggtgagcgggtccacggcgccggtgacgat	CRISPR spacer
aggagcagcggtcccacggcgccggtgaccgg	Protospacer
***.  ***** .**************** .

337. spacer 11.5|1638616|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to MK376962 (Gordonia phage NosilaM, complete genome) position: , mismatch: 8, identity: 0.75

agggtgagcgggtccacggcgccggtgacgat	CRISPR spacer
aggagcagcggtcccacggcgccggtgaccgg	Protospacer
***.  ***** .**************** .

338. spacer 12.4|1645572|31|NC_014210|CRT matches to NZ_CP016452 (Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence) position: , mismatch: 8, identity: 0.742

acggcgtcaccgtgctcctggtcgatgccgc	CRISPR spacer
aaggcgtcaacgtgctcctcgtcgagaagga	Protospacer
* ******* ********* ***** .  *

339. spacer 12.4|1645572|31|NC_014210|CRT matches to NC_016586 (Azospirillum lipoferum 4B plasmid AZO_p2, complete sequence) position: , mismatch: 8, identity: 0.742

acggcgtcaccgtgctcctggtcg-atgccgc	CRISPR spacer
gcggcgtcaccgtgctgctggtggaacatca-	Protospacer
.*************** ***** * *...*.

340. spacer 12.4|1645572|31|NC_014210|CRT matches to NC_012529 (Deinococcus deserti VCD115 plasmid 2, complete sequence) position: , mismatch: 8, identity: 0.742

acggcgtcaccgtgctcctggtcgatgccgc----	CRISPR spacer
gtggcgtgaccgtgctgctggtcga----gcagaa	Protospacer
..***** ******** ********    **

341. spacer 12.4|1645572|31|NC_014210|CRT matches to NC_014718 (Paraburkholderia rhizoxinica HKI 454 plasmid pBRH01, complete sequence) position: , mismatch: 8, identity: 0.742

acggcgtcaccgtgctcctggtcgatgccgc	CRISPR spacer
ttggcgtcaccgcgttcctggtcgagacgac	Protospacer
 .**********.*.********** .* .*

342. spacer 12.4|1645572|31|NC_014210|CRT matches to NZ_CP044425 (Paracoccus pantotrophus strain DSM 2944 plasmid pPAN2, complete sequence) position: , mismatch: 8, identity: 0.742

acggcgtcaccgtgctcctggtcgatgccgc----	CRISPR spacer
ttggcgtcactgtgctgctggtcga----gcagaa	Protospacer
 .********.***** ********    **

343. spacer 12.4|1645572|31|NC_014210|CRT matches to NZ_CP019242 (Rhodoferax antarcticus strain DSMZ24876 plasmid unnamed2) position: , mismatch: 8, identity: 0.742

acggcgtcaccgtgctcctggtcgatgccgc	CRISPR spacer
aaggcgtcggcgtgctcctggtcgaactggt	Protospacer
* ******. ***************  . *.

344. spacer 12.4|1645572|31|NC_014210|CRT matches to NZ_CP019242 (Rhodoferax antarcticus strain DSMZ24876 plasmid unnamed2) position: , mismatch: 8, identity: 0.742

acggcgtcaccgtgctcctggtcgatgccgc	CRISPR spacer
aaggcgtcggcgtgctcctggtcgaactggt	Protospacer
* ******. ***************  . *.

345. spacer 12.4|1645572|31|NC_014210|CRT matches to NZ_CP045549 (Streptomyces sp. SYP-A7193 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

acggcgtcaccgtgctcctggtcgatgccgc	CRISPR spacer
ccgagctcaccgtgatcctggtcgacgcccg	Protospacer
 **.  ******** **********.***

346. spacer 12.4|1645572|31|NC_014210|CRT matches to NZ_CP029232 (Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence) position: , mismatch: 8, identity: 0.742

acggcgtcaccgtgctcctggtcgatgccgc	CRISPR spacer
cggtcgtcaccatgctcctggtcgttggctg	Protospacer
  * *******.************ ** *

347. spacer 13.2|1662532|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP021653 (Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

accagaa----cgtgatccgcggcggcggcatcgtc	CRISPR spacer
----ggatcgccgtgatccccggcgacggcatcggc	Protospacer
    *.*    ******** *****.******** *

348. spacer 13.2|1662532|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP015091 (Pelagibaca abyssi strain JLT2014 plasmid pPABY1, complete sequence) position: , mismatch: 8, identity: 0.75

accagaacgtgatccgcggcggcggcatcgtc	CRISPR spacer
ccaaagccgtgatcatcggcggcggcatcgtg	Protospacer
 * *.. *******  ***************

349. spacer 13.2|1662532|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP012688 (Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

accagaa----cgtgatccgcggcggcggcatcgtc	CRISPR spacer
----ggatcgccgtgatccccggcgacggcatcggc	Protospacer
    *.*    ******** *****.******** *

350. spacer 13.2|1662532|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to CP047139 (Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

accagaa----cgtgatccgcggcggcggcatcgtc	CRISPR spacer
----ggatcgccgtgatccccggcgacggcatcggc	Protospacer
    *.*    ******** *****.******** *

351. spacer 13.2|1662532|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to CP047137 (Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

accagaa----cgtgatccgcggcggcggcatcgtc	CRISPR spacer
----ggatcgccgtgatccccggcgacggcatcggc	Protospacer
    *.*    ******** *****.******** *

352. spacer 13.2|1662532|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022371 (Bosea sp. AS-1 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

accagaacgtgatccgcggcggcggcatcgtc	CRISPR spacer
cccctcacggggtccgcggcggcggcatcgcg	Protospacer
 **   *** *.******************.

353. spacer 13.2|1662532|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

accag--aacgtgatccgcggcggcggcatcgtc	CRISPR spacer
--cggttgccgtgatcggctgcggcggcatcggc	Protospacer
  *.*  . ******* ** ************ *

354. spacer 13.2|1662532|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 8, identity: 0.75

accagaacgtgatccgcggcggcggcatcgtc	CRISPR spacer
ccgagagcgtgatccgcgacggcggcggaatc	Protospacer
 * ***.***********.*******.  .**

355. spacer 13.2|1662532|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP030829 (Neorhizobium sp. NCHU2750 plasmid pNCHU2750b, complete sequence) position: , mismatch: 8, identity: 0.75

accagaacgtgatccgcggcggcggcatcgtc	CRISPR spacer
tgcatgccttgatcctcggcggcggcgtcgtc	Protospacer
  ** . * ****** **********.*****

356. spacer 13.2|1662532|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NC_007950 (Polaromonas sp. JS666 plasmid 2, complete sequence) position: , mismatch: 8, identity: 0.75

accagaacgtgatccgcggcggcggcatcgtc	CRISPR spacer
aggtggccgtgatcggcgccggcggcatcggc	Protospacer
*   *. ******* *** *********** *

357. spacer 13.4|1662654|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NC_008713 (Paenarthrobacter aurescens TC1 plasmid pTC2, complete sequence) position: , mismatch: 8, identity: 0.75

tcaccggtggccgacccttcctgcacgccatc	CRISPR spacer
acaccggtggccgcaccttcctgctccataac	Protospacer
 ************  ********* *  .* *

358. spacer 13.5|1662715|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 8, identity: 0.75

ggcgccgacggcgacgactggtcgctctccaa	CRISPR spacer
gtagatgacggcgacgacgggtcgctcgccgc	Protospacer
*  * .************ ******** **.

359. spacer 13.5|1662715|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP050104 (Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b2, complete sequence) position: , mismatch: 8, identity: 0.75

ggcgccgacggcgacgactggtcgctctccaa	CRISPR spacer
taggaagacggcaacgactggtcgcgctccac	Protospacer
 . *  ******.************ *****

360. spacer 13.5|1662715|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NC_014818 (Asticcacaulis excentricus CB 48 plasmid pASTEX01, complete sequence) position: , mismatch: 8, identity: 0.75

ggcgccgacggcgacgactggtcgctctccaa	CRISPR spacer
ggcgcggacggcgtcgactggtcgcaggcgtg	Protospacer
***** ******* ***********   *  .

361. spacer 13.5|1662715|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP025507 (Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvA, complete sequence) position: , mismatch: 8, identity: 0.75

ggcgccgacggcgacgactggtcgctctccaa	CRISPR spacer
taggaagacggcaacgactggtcgcgctccac	Protospacer
 . *  ******.************ *****

362. spacer 13.5|1662715|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP050109 (Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b2, complete sequence) position: , mismatch: 8, identity: 0.75

ggcgccgacggcgacgactggtcgctctccaa	CRISPR spacer
taggaagacggcaacgactggtcgcgctccac	Protospacer
 . *  ******.************ *****

363. spacer 13.5|1662715|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP030761 (Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ggcgccgacggcgacgactggtcgctctccaa	CRISPR spacer
taggaagacggcaacgactggtcgcgctccac	Protospacer
 . *  ******.************ *****

364. spacer 13.5|1662715|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022666 (Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR1, complete sequence) position: , mismatch: 8, identity: 0.75

ggcgccgacggcgacgactggtcgctctccaa	CRISPR spacer
taggaagacggcaacgactggtcgcgctccac	Protospacer
 . *  ******.************ *****

365. spacer 13.5|1662715|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP050086 (Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b7, complete sequence) position: , mismatch: 8, identity: 0.75

ggcgccgacggcgacgactggtcgctctccaa	CRISPR spacer
taggaagacggcaacgactggtcgcgctccac	Protospacer
 . *  ******.************ *****

366. spacer 13.6|1662776|32|NC_014210|CRISPRCasFinder,CRT matches to CP023013 (Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

gtgggtggggccgggcgggggaagtggaagcg	CRISPR spacer
cagcttgccgccgggccggggaagcggaagcg	Protospacer
  *  **  ******* *******.*******

367. spacer 13.6|1662776|32|NC_014210|CRISPRCasFinder,CRT matches to CP000662 (Rhodobacter sphaeroides ATCC 17025 plasmid pRSPA01, complete sequence) position: , mismatch: 8, identity: 0.75

gtgggtggggccgggcgggggaagtggaagcg	CRISPR spacer
tcggacgcggccgggcggaggaagcggaagct	Protospacer
 .**..* **********.*****.******

368. spacer 14.1|2013540|32|NC_014210|PILER-CR,CRISPRCasFinder matches to NC_008010 (Deinococcus geothermalis DSM 11300 plasmid pDGEO01, complete sequence) position: , mismatch: 8, identity: 0.75

ggcagcaggtcctccagggaaccgccgccccg	CRISPR spacer
tcctggaggccctccagggcaccgccgccctt	Protospacer
  * * ***.********* **********.

369. spacer 14.1|2013540|32|NC_014210|PILER-CR,CRISPRCasFinder matches to KY555145 (Caulobacter phage Ccr29, complete genome) position: , mismatch: 8, identity: 0.75

ggcagcaggtcctccagggaaccgccgccccg	CRISPR spacer
tgcagcaggtcttccagggaatcgtagcgcga	Protospacer
 **********.*********.**. ** * .

370. spacer 14.1|2013540|32|NC_014210|PILER-CR,CRISPRCasFinder matches to KY555143 (Caulobacter phage Ccr2, complete genome) position: , mismatch: 8, identity: 0.75

ggcagcaggtcctccagggaaccgccgccccg	CRISPR spacer
tgcagcaggtcttccagggaatcgtagcgcga	Protospacer
 **********.*********.**. ** * .

371. spacer 14.1|2013540|32|NC_014210|PILER-CR,CRISPRCasFinder matches to KY555142 (Caulobacter phage Ccr10, complete genome) position: , mismatch: 8, identity: 0.75

ggcagcaggtcctccagggaaccgccgccccg	CRISPR spacer
tgcagcaggtcttccagggaatcgtagcgcga	Protospacer
 **********.*********.**. ** * .

372. spacer 14.5|2013782|32|NC_014210|CRISPRCasFinder matches to NC_011961 (Thermomicrobium roseum DSM 5159 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

cgcacgtcgatgctccccgagacgcggcggga	CRISPR spacer
ctggaggcgatgctctccgagacgcggcggac	Protospacer
*  . * ********.**************.

373. spacer 14.5|2013782|32|NC_014210|CRISPRCasFinder matches to NZ_CP026745 (Nocardia cyriacigeorgica strain MDA3349 isolate MDA3349 ancestor plasmid p_unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

cgcacgtcgatgctccccgagacgcggcggga	CRISPR spacer
cggtcgtcgatgctgaccgagacgcggatcgt	Protospacer
**  **********  ***********   *

374. spacer 14.8|2013965|32|NC_014210|CRISPRCasFinder matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

gccatgctcgcgtccgagacccgcaagatcca	CRISPR spacer
gatgtgctcgcgttcgatacccgcaagaccgt	Protospacer
* ..*********.*** **********.*

375. spacer 14.8|2013965|32|NC_014210|CRISPRCasFinder matches to NZ_CP043499 (Rhizobium grahamii strain BG7 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

gccatgctcgcgtccgagacccgcaagatcca	CRISPR spacer
gccatactcgcgtccgatacccgattgcttga	Protospacer
*****.*********** *****   * *. *

376. spacer 14.9|2014026|32|NC_014210|CRISPRCasFinder matches to NC_017958 (Tistrella mobilis KA081020-065 plasmid pTM3, complete sequence) position: , mismatch: 8, identity: 0.75

gtgacgtcgtcgggcgtgtagagctcgcgctt---	CRISPR spacer
atgccgtcttcgggcgtgtagagc---ggctcgac	Protospacer
.** **** ***************    ***.

377. spacer 14.11|2014148|32|NC_014210|CRISPRCasFinder matches to NZ_CP016891 (Pantoea agglomerans strain C410P1 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

gcgttcatcagctgaggctcaccggcggcggg	CRISPR spacer
cagcttatcagctgcggcgcaccggcggccgt	Protospacer
  *.*.******** *** ********** *

378. spacer 14.18|2014575|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NZ_LR134456 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 14, complete sequence) position: , mismatch: 8, identity: 0.75

gaggagttcgcctacgccatcgctgggtcggg	CRISPR spacer
gggctgctcgcctacgacatcgctggctcgtc	Protospacer
*.*  *.********* ********* ***

379. spacer 14.18|2014575|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MH590593 (Mycobacterium phage Rabinovish, complete genome) position: , mismatch: 8, identity: 0.75

gaggagttcgcctacgccatcgctgggtcggg	CRISPR spacer
gctgtgttcgccttcgccatcgctgtgttcgc	Protospacer
*  * ******** *********** **. *

380. spacer 14.18|2014575|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MH590593 (Mycobacterium phage Rabinovish, complete genome) position: , mismatch: 8, identity: 0.75

gaggagttcgcctacgccatcgctgggtcggg	CRISPR spacer
gctgtgttcgccttcgccatcgctgtgttcgc	Protospacer
*  * ******** *********** **. *

381. spacer 14.18|2014575|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MK450432 (Mycobacterium phage ValleyTerrace, complete genome) position: , mismatch: 8, identity: 0.75

gaggagttcgcctacgccatcgctgggtcggg	CRISPR spacer
gctgtgttcgccttcgccatcgctgtgttcgc	Protospacer
*  * ******** *********** **. *

382. spacer 14.18|2014575|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MH697586 (Mycobacterium phage InigoMontoya, complete genome) position: , mismatch: 8, identity: 0.75

gaggagttcgcctacgccatcgctgggtcggg	CRISPR spacer
gctgtgttcgccttcgccatcgctgtgttcgc	Protospacer
*  * ******** *********** **. *

383. spacer 14.18|2014575|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NC_023714 (Mycobacterium phage LinStu, complete genome) position: , mismatch: 8, identity: 0.75

gaggagttcgcctacgccatcgctgggtcggg	CRISPR spacer
gctgtgttcgccttcgccatcgctgtgttcgc	Protospacer
*  * ******** *********** **. *

384. spacer 14.18|2014575|32|NC_014210|CRISPRCasFinder,PILER-CR matches to KJ595575 (Mycobacterium phage Willis, complete genome) position: , mismatch: 8, identity: 0.75

gaggagttcgcctacgccatcgctgggtcggg	CRISPR spacer
gctgtgttcgccttcgccatcgctgtgttcgc	Protospacer
*  * ******** *********** **. *

385. spacer 14.18|2014575|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MK359339 (Mycobacterium phage Naija, complete genome) position: , mismatch: 8, identity: 0.75

gaggagttcgcctacgccatcgctgggtcggg	CRISPR spacer
gctgtgttcgccttcgccatcgctgtgttcgc	Protospacer
*  * ******** *********** **. *

386. spacer 14.18|2014575|32|NC_014210|CRISPRCasFinder,PILER-CR matches to JN699625 (Mycobacterium phage Wally, complete genome) position: , mismatch: 8, identity: 0.75

gaggagttcgcctacgccatcgctgggtcggg	CRISPR spacer
gctgtgttcgccttcgccatcgctgtgttcgc	Protospacer
*  * ******** *********** **. *

387. spacer 14.18|2014575|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MK359335 (Mycobacterium phage Patter, complete genome) position: , mismatch: 8, identity: 0.75

gaggagttcgcctacgccatcgctgggtcggg	CRISPR spacer
gctgtgttcgccttcgccatcgctgtgttcgc	Protospacer
*  * ******** *********** **. *

388. spacer 14.18|2014575|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MT889395 (Mycobacterium phage Shifa, complete genome) position: , mismatch: 8, identity: 0.75

gaggagttcgcctacgccatcgctgggtcggg	CRISPR spacer
gctgtgttcgccttcgccatcgctgtgttcgc	Protospacer
*  * ******** *********** **. *

389. spacer 14.18|2014575|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MT723944 (Mycobacterium phage ChaylaJr, complete genome) position: , mismatch: 8, identity: 0.75

gaggagttcgcctacgccatcgctgggtcggg	CRISPR spacer
gctgtgttcgccttcgccatcgctgtgttcgc	Protospacer
*  * ******** *********** **. *

390. spacer 14.18|2014575|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MT723944 (Mycobacterium phage ChaylaJr, complete genome) position: , mismatch: 8, identity: 0.75

gaggagttcgcctacgccatcgctgggtcggg	CRISPR spacer
gctgtgttcgccttcgccatcgctgtgttcgc	Protospacer
*  * ******** *********** **. *

391. spacer 14.18|2014575|32|NC_014210|CRISPRCasFinder,PILER-CR matches to KR080196 (Mycobacterium phage Momo, complete genome) position: , mismatch: 8, identity: 0.75

gaggagttcgcctacgccatcgctgggtcggg	CRISPR spacer
gctgtgttcgccttcgccatcgctgtgttcgc	Protospacer
*  * ******** *********** **. *

392. spacer 14.18|2014575|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MH910040 (Mycobacterium phage Sauce, complete genome) position: , mismatch: 8, identity: 0.75

gaggagttcgcctacgccatcgctgggtcggg	CRISPR spacer
gctgtgttcgccttcgccatcgctgtgttcgc	Protospacer
*  * ******** *********** **. *

393. spacer 14.18|2014575|32|NC_014210|CRISPRCasFinder,PILER-CR matches to KF024734 (Mycobacterium phage Shrimp, complete genome) position: , mismatch: 8, identity: 0.75

gaggagttcgcctacgccatcgctgggtcggg	CRISPR spacer
gctgtgttcgccttcgccatcgctgtgttcgc	Protospacer
*  * ******** *********** **. *

394. spacer 14.18|2014575|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MK359338 (Mycobacterium phage Amataga, complete genome) position: , mismatch: 8, identity: 0.75

gaggagttcgcctacgccatcgctgggtcggg	CRISPR spacer
gctgtgttcgccttcgccatcgctgtgttcgc	Protospacer
*  * ******** *********** **. *

395. spacer 14.18|2014575|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MT723945 (Mycobacterium phage Quasimodo, complete genome) position: , mismatch: 8, identity: 0.75

gaggagttcgcctacgccatcgctgggtcggg	CRISPR spacer
gctgtgttcgccttcgccatcgctgtgttcgc	Protospacer
*  * ******** *********** **. *

396. spacer 14.18|2014575|32|NC_014210|CRISPRCasFinder,PILER-CR matches to JF704096 (Mycobacterium phage Ghost, complete sequence) position: , mismatch: 8, identity: 0.75

gaggagttcgcctacgccatcgctgggtcggg	CRISPR spacer
gctgtgttcgccttcgccatcgctgtgttcgc	Protospacer
*  * ******** *********** **. *

397. spacer 14.18|2014575|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MN062707 (Mycobacterium phage Grungle, complete genome) position: , mismatch: 8, identity: 0.75

gaggagttcgcctacgccatcgctgggtcggg	CRISPR spacer
gctgtgttcgccttcgccatcgctgtgttcgc	Protospacer
*  * ******** *********** **. *

398. spacer 14.18|2014575|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MK359345 (Mycobacterium phage QBert, complete genome) position: , mismatch: 8, identity: 0.75

gaggagttcgcctacgccatcgctgggtcggg	CRISPR spacer
gctgtgttcgccttcgccatcgctgtgttcgc	Protospacer
*  * ******** *********** **. *

399. spacer 14.18|2014575|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MK359362 (Mycobacterium phage Atlantean, complete genome) position: , mismatch: 8, identity: 0.75

gaggagttcgcctacgccatcgctgggtcggg	CRISPR spacer
gctgtgttcgccttcgccatcgctgtgttcgc	Protospacer
*  * ******** *********** **. *

400. spacer 14.18|2014575|32|NC_014210|CRISPRCasFinder,PILER-CR matches to KX369583 (Mycobacterium phage Littleton, complete genome) position: , mismatch: 8, identity: 0.75

gaggagttcgcctacgccatcgctgggtcggg	CRISPR spacer
gctgtgttcgccttcgccatcgctgtgttcgc	Protospacer
*  * ******** *********** **. *

401. spacer 14.18|2014575|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MK359353 (Mycobacterium phage BadAgartude, complete genome) position: , mismatch: 8, identity: 0.75

gaggagttcgcctacgccatcgctgggtcggg	CRISPR spacer
gctgtgttcgccttcgccatcgctgtgttcgc	Protospacer
*  * ******** *********** **. *

402. spacer 14.18|2014575|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MH697590 (Mycobacterium phage Phlegm, complete genome) position: , mismatch: 8, identity: 0.75

gaggagttcgcctacgccatcgctgggtcggg	CRISPR spacer
gctgtgttcgccttcgccatcgctgtgttcgc	Protospacer
*  * ******** *********** **. *

403. spacer 14.18|2014575|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MN428066 (Mycobacterium phage JPickles, complete genome) position: , mismatch: 8, identity: 0.75

gaggagttcgcctacgccatcgctgggtcggg	CRISPR spacer
gctgtgttcgccttcgccatcgctgtgttcgc	Protospacer
*  * ******** *********** **. *

404. spacer 14.18|2014575|32|NC_014210|CRISPRCasFinder,PILER-CR matches to DQ398053 (Mycobacteriophage Catera, complete genome) position: , mismatch: 8, identity: 0.75

gaggagttcgcctacgccatcgctgggtcggg	CRISPR spacer
gctgtgttcgccttcgccatcgctgtgttcgc	Protospacer
*  * ******** *********** **. *

405. spacer 14.18|2014575|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NC_028986 (Mycobacterium phage Alice, complete sequence) position: , mismatch: 8, identity: 0.75

gaggagttcgcctacgccatcgctgggtcggg	CRISPR spacer
gctgtgttcgccttcgccatcgctgtgttcgc	Protospacer
*  * ******** *********** **. *

406. spacer 14.18|2014575|32|NC_014210|CRISPRCasFinder,PILER-CR matches to JN204348 (Mycobacterium phage Sebata, complete genome) position: , mismatch: 8, identity: 0.75

gaggagttcgcctacgccatcgctgggtcggg	CRISPR spacer
gctgtgttcgccttcgccatcgctgtgttcgc	Protospacer
*  * ******** *********** **. *

407. spacer 14.18|2014575|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NC_008207 (Mycobacterium phage Catera, complete genome) position: , mismatch: 8, identity: 0.75

gaggagttcgcctacgccatcgctgggtcggg	CRISPR spacer
gctgtgttcgccttcgccatcgctgtgttcgc	Protospacer
*  * ******** *********** **. *

408. spacer 14.18|2014575|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MK359326 (Mycobacterium phage Pivoine, complete genome) position: , mismatch: 8, identity: 0.75

gaggagttcgcctacgccatcgctgggtcggg	CRISPR spacer
gctgtgttcgccttcgccatcgctgtgttcgc	Protospacer
*  * ******** *********** **. *

409. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NZ_CP050093 (Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b5, complete sequence) position: , mismatch: 8, identity: 0.75

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
catagccagccggacggttcctaccgcaacct	Protospacer
.*..********* ****.********* * .

410. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NZ_CP050105 (Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b6, complete sequence) position: , mismatch: 8, identity: 0.75

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
catcgccagccggacggttcctaccgcaacct	Protospacer
.*. ********* ****.********* * .

411. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NC_008384 (Rhizobium leguminosarum bv. viciae 3841 plasmid pRL11, complete sequence) position: , mismatch: 8, identity: 0.75

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
catagccagccggacggttcctaccgcaacct	Protospacer
.*..********* ****.********* * .

412. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NZ_CP025014 (Rhizobium leguminosarum strain Norway plasmid pRLN2, complete sequence) position: , mismatch: 8, identity: 0.75

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
catcgccagccggacggttcctaccgcaacct	Protospacer
.*. ********* ****.********* * .

413. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NZ_CP050110 (Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b4, complete sequence) position: , mismatch: 8, identity: 0.75

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
catcgccagccggacggttcctaccgcaacct	Protospacer
.*. ********* ****.********* * .

414. spacer 14.20|2014697|32|NC_014210|CRISPRCasFinder,PILER-CR matches to KY092483 (Streptomyces phage Bioscum, complete genome) position: , mismatch: 8, identity: 0.75

tgcgcggccacgtacccggcgaggtcgatcac	CRISPR spacer
tggccggcctcgtacccggcggggtcggggtc	Protospacer
**  ***** ***********.*****.   *

415. spacer 14.20|2014697|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MK305888 (Streptomyces phage Austintatious, complete genome) position: , mismatch: 8, identity: 0.75

tgcgcggccacgtacccggcgaggtcgatcac	CRISPR spacer
tggccggcctcgtacccggcggggtcggggtc	Protospacer
**  ***** ***********.*****.   *

416. spacer 14.20|2014697|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NC_047958 (Burkholderia phage vB_BmuP_KL4, complete genome) position: , mismatch: 8, identity: 0.75

tgcgcggccacgtacccggcgaggtcgatcac	CRISPR spacer
gaggccccaacgtacccgtcgacgtcgatcac	Protospacer
 . **  * ********* *** *********

417. spacer 14.20|2014697|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NC_047792 (Streptomyces phage Ididsumtinwong, complete genome) position: , mismatch: 8, identity: 0.75

tgcgcggccacgtacccggcgaggtcgatcac	CRISPR spacer
tggccggcctcgtacccggcggggtcggggtc	Protospacer
**  ***** ***********.*****.   *

418. spacer 14.20|2014697|32|NC_014210|CRISPRCasFinder,PILER-CR matches to KY092481 (Streptomyces phage PapayaSalad, complete genome) position: , mismatch: 8, identity: 0.75

tgcgcggccacgtacccggcgaggtcgatcac	CRISPR spacer
tggccggcctcgtacccggcggggtcggggtc	Protospacer
**  ***** ***********.*****.   *

419. spacer 14.21|2014758|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NZ_CP032695 (Rhizobium jaguaris strain CCGE525 plasmid pRCCGE525c, complete sequence) position: , mismatch: 8, identity: 0.75

ggatgacgcaagccgagatcgtccgggccacg	CRISPR spacer
ggatgacgcaagccgaattcgtcaacgccttc	Protospacer
****************. ***** . *** .

420. spacer 14.22|2014819|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NC_015583 (Novosphingobium sp. PP1Y plasmid Mpl, complete sequence) position: , mismatch: 8, identity: 0.75

ccatcgacaggggcacacgccccgccgaccta	CRISPR spacer
gcttcgacaggggctcacgcccctcctgccag	Protospacer
 * *********** ******** ** .** .

421. spacer 14.23|2014880|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NC_011962 (Rhodobacter sphaeroides KD131 plasmid pRSKD131A, complete sequence) position: , mismatch: 8, identity: 0.75

gccatcgcgatcgccgctgtcctgggcatgca	CRISPR spacer
gccatggcgatcgccgcggtcctgccgcgcca	Protospacer
***** *********** ******      **

422. spacer 14.23|2014880|32|NC_014210|CRISPRCasFinder,PILER-CR matches to KU252585 (Gordonia phage Howe, complete genome) position: , mismatch: 8, identity: 0.75

gccatcgcgatcgccgctgtcctgggcatgca	CRISPR spacer
ggcatcgcgatcgccgctcgcctggatgttcc	Protospacer
* ****************  *****...* *

423. spacer 14.23|2014880|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MK878902 (Gordonia phage Twinkle, complete genome) position: , mismatch: 8, identity: 0.75

gccatcgcgatcgccgctgtcctgggcatgca	CRISPR spacer
ggcatcgcgatcgccgctcgcctggatgttcc	Protospacer
* ****************  *****...* *

424. spacer 14.23|2014880|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MK061406 (Gordonia phage Adora, complete genome) position: , mismatch: 8, identity: 0.75

gccatcgcgatcgccgctgtcctgggcatgca	CRISPR spacer
ggcatcgcgatcgccgctcgcctggatgttcc	Protospacer
* ****************  *****...* *

425. spacer 14.23|2014880|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MN428055 (Gordonia phage Mcklovin, complete genome) position: , mismatch: 8, identity: 0.75

gccatcgcgatcgccgctgtcctgggcatgca	CRISPR spacer
ggcatcgcgatcgccgctcgcctggatgttcc	Protospacer
* ****************  *****...* *

426. spacer 14.26|2015063|32|NC_014210|CRISPRCasFinder,PILER-CR matches to KT281796 (Mycobacterium phage Zakhe101, complete genome) position: , mismatch: 8, identity: 0.75

atgatggtggtggcgttggacgccggggcggg	CRISPR spacer
ttcatggtggtgtcgttcgacgccgggcagat	Protospacer
 * ********* **** *********  *.

427. spacer 14.26|2015063|32|NC_014210|CRISPRCasFinder,PILER-CR matches to AY129335 (Mycobacterium virus Corndog, complete genome) position: , mismatch: 8, identity: 0.75

atgatggtggtggcgttggacgccggggcggg	CRISPR spacer
ttcatggtggtgtcgttcgacgccgggcagat	Protospacer
 * ********* **** *********  *.

428. spacer 14.26|2015063|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MN428058 (Mycobacterium phage Krili, complete genome) position: , mismatch: 8, identity: 0.75

atgatggtggtggcgttggacgccggggcggg	CRISPR spacer
ttcatggtggtgtcgttcgacgccgggcagat	Protospacer
 * ********* **** *********  *.

429. spacer 14.26|2015063|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MH020246 (Mycobacterium phage SchoolBus, complete genome) position: , mismatch: 8, identity: 0.75

atgatggtggtggcgttggacgccggggcggg	CRISPR spacer
ttcatggtggtgtcgttcgacgccgggcagat	Protospacer
 * ********* **** *********  *.

430. spacer 14.26|2015063|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MT818418 (Mycobacterium phage Shida, complete genome) position: , mismatch: 8, identity: 0.75

atgatggtggtggcgttggacgccggggcggg	CRISPR spacer
ttcatggtggtgtcgttcgacgccgggcagat	Protospacer
 * ********* **** *********  *.

431. spacer 14.26|2015063|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NC_004685 (Mycobacterium phage Corndog, complete genome) position: , mismatch: 8, identity: 0.75

atgatggtggtggcgttggacgccggggcggg	CRISPR spacer
ttcatggtggtgtcgttcgacgccgggcagat	Protospacer
 * ********* **** *********  *.

432. spacer 14.26|2015063|32|NC_014210|CRISPRCasFinder,PILER-CR matches to JN698993 (Mycobacterium phage Firecracker, complete genome) position: , mismatch: 8, identity: 0.75

atgatggtggtggcgttggacgccggggcggg	CRISPR spacer
ttcatggtggtgtcgttcgacgccgggcagat	Protospacer
 * ********* **** *********  *.

433. spacer 14.26|2015063|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MH926062 (Mycobacterium phage Vorrps, complete genome) position: , mismatch: 8, identity: 0.75

atgatggtggtggcgttggacgccggggcggg	CRISPR spacer
ttcatggtggtgtcgttcgacgccgggcagat	Protospacer
 * ********* **** *********  *.

434. spacer 14.26|2015063|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MG099943 (Mycobacterium phage Familton, complete genome) position: , mismatch: 8, identity: 0.75

atgatggtggtggcgttggacgccggggcggg	CRISPR spacer
ttcatggtggtgtcgttcgacgccgggcagat	Protospacer
 * ********* **** *********  *.

435. spacer 14.26|2015063|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MG872838 (Mycobacterium phage JangDynasty, complete genome) position: , mismatch: 8, identity: 0.75

atgatggtggtggcgttggacgccggggcggg	CRISPR spacer
ttcatggtggtgtcgttcgacgccgggcagat	Protospacer
 * ********* **** *********  *.

436. spacer 14.26|2015063|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MH590592 (Mycobacterium phage Ryadel, complete genome) position: , mismatch: 8, identity: 0.75

atgatggtggtggcgttggacgccggggcggg	CRISPR spacer
ttcatggtggtgtcgttcgacgccgggcagat	Protospacer
 * ********* **** *********  *.

437. spacer 14.26|2015063|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MN585964 (Mycobacterium phage Blessica, complete genome) position: , mismatch: 8, identity: 0.75

atgatggtggtggcgttggacgccggggcggg	CRISPR spacer
ttcatggtggtgtcgttcgacgccgggcagat	Protospacer
 * ********* **** *********  *.

438. spacer 14.26|2015063|32|NC_014210|CRISPRCasFinder,PILER-CR matches to KJ829260 (Mycobacterium phage YungJamal, complete genome) position: , mismatch: 8, identity: 0.75

atgatggtggtggcgttggacgccggggcggg	CRISPR spacer
ttcatggtggtgtcgttcgacgccgggcagat	Protospacer
 * ********* **** *********  *.

439. spacer 14.26|2015063|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NC_022057 (Mycobacterium phage Catdawg, complete genome) position: , mismatch: 8, identity: 0.75

atgatggtggtggcgttggacgccggggcggg	CRISPR spacer
ttcatggtggtgtcgttcgacgccgggcagat	Protospacer
 * ********* **** *********  *.

440. spacer 14.26|2015063|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MT818425 (Mycobacterium phage NiebruSaylor, complete genome) position: , mismatch: 8, identity: 0.75

atgatggtggtggcgttggacgccggggcggg	CRISPR spacer
ttcatggtggtgtcgttcgacgccgggcagat	Protospacer
 * ********* **** *********  *.

441. spacer 14.26|2015063|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NC_022325 (Mycobacterium phage Dylan, complete genome) position: , mismatch: 8, identity: 0.75

atgatggtggtggcgttggacgccggggcggg	CRISPR spacer
ttcatggtggtgtcgttcgacgccgggcagat	Protospacer
 * ********* **** *********  *.

442. spacer 14.26|2015063|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MN428052 (Mycobacterium phage Smooch, complete genome) position: , mismatch: 8, identity: 0.75

atgatggtggtggcgttggacgccggggcggg	CRISPR spacer
ttcatggtggtgtcgttcgacgccgggcagat	Protospacer
 * ********* **** *********  *.

443. spacer 14.29|2015246|32|NC_014210|CRISPRCasFinder matches to NZ_CP009293 (Novosphingobium pentaromativorans US6-1 plasmid pLA4, complete sequence) position: , mismatch: 8, identity: 0.75

cgggccatctgcatggcggcctcttcggcgac	CRISPR spacer
tggttgatctgcatggcggcctcctgggcgtg	Protospacer
.** . *****************.* ****

444. spacer 14.29|2015246|32|NC_014210|CRISPRCasFinder matches to NZ_CP029832 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

cgggccatctgcatggcggcctcttcggcgac	CRISPR spacer
ccgatgcgctgcatggcggcggcttcggcgac	Protospacer
* *..   ************  **********

445. spacer 14.29|2015246|32|NC_014210|CRISPRCasFinder matches to MF477236 (Nocardia phage NTR1, complete genome) position: , mismatch: 8, identity: 0.75

cgggccatctgcatggcggcctcttcggcgac	CRISPR spacer
tgctcgatctgcatggcggcctcgtccgcctc	Protospacer
.*  * ***************** ** **  *

446. spacer 14.29|2015246|32|NC_014210|CRISPRCasFinder matches to NC_023498 (Mycobacterium phage Validus, complete genome) position: , mismatch: 8, identity: 0.75

cgggccatctgcatggcggcctcttcggcgac	CRISPR spacer
cgggccatctgctcggcggcctccgcgcgggt	Protospacer
************ .*********. **  *..

447. spacer 14.61|2013965|31|NC_014210|PILER-CR matches to NZ_CP043499 (Rhizobium grahamii strain BG7 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.742

gccatgctcgcgtccgagacccgcaagatcc	CRISPR spacer
gccatactcgcgtccgatacccgattgcttg	Protospacer
*****.*********** *****   * *.

448. spacer 23.3|5555711|32|NC_014210|CRISPRCasFinder matches to NZ_CP011627 (Klebsiella oxytoca strain CAV1374 plasmid pCAV1374-14, complete sequence) position: , mismatch: 8, identity: 0.75

cagctggccgccctccaggcgcagacgcaggc	CRISPR spacer
gagctggccgccctgcaggcgcagacctgccg	Protospacer
 ************* *********** ..

449. spacer 23.3|5555711|32|NC_014210|CRISPRCasFinder matches to NZ_CP025945 (Escherichia coli strain SCEC020023 plasmid p1_020023, complete sequence) position: , mismatch: 8, identity: 0.75

cagctggccgccctccaggcgcagacgcaggc	CRISPR spacer
gaactggccgccctgcaggcgcagacccgccg	Protospacer
 *.*********** *********** *.

450. spacer 23.3|5555711|32|NC_014210|CRISPRCasFinder matches to NZ_CP036322 (Klebsiella pneumoniae strain VBA2172 plasmid pCol440I) position: , mismatch: 8, identity: 0.75

cagctggccgccctccaggcgcagacgcaggc	CRISPR spacer
gaactggccgccctgcaggcgcagacccgccg	Protospacer
 *.*********** *********** *.

451. spacer 23.3|5555711|32|NC_014210|CRISPRCasFinder matches to NZ_CP033949 (Klebsiella pneumoniae subsp. pneumoniae strain ARLG-3135 plasmid p3, complete sequence) position: , mismatch: 8, identity: 0.75

cagctggccgccctccaggcgcagacgcaggc	CRISPR spacer
gaactggccgccctgcaggcgcagacccgccg	Protospacer
 *.*********** *********** *.

452. spacer 23.3|5555711|32|NC_014210|CRISPRCasFinder matches to NZ_CP024491 (Klebsiella pneumoniae strain INF249 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

cagctggccgccctccaggcgcagacgcaggc	CRISPR spacer
gaactggccgccctgcaggcgcagacccgccg	Protospacer
 *.*********** *********** *.

453. spacer 23.3|5555711|32|NC_014210|CRISPRCasFinder matches to NZ_CP034676 (Klebsiella quasipneumoniae strain D120-1 plasmid pD120-1_6kb, complete sequence) position: , mismatch: 8, identity: 0.75

cagctggccgccctccaggcgcagacgcaggc	CRISPR spacer
gaactggccgccctgcaggcgcagacccgccg	Protospacer
 *.*********** *********** *.

454. spacer 23.3|5555711|32|NC_014210|CRISPRCasFinder matches to NZ_CP040599 (Klebsiella pneumoniae subsp. pneumoniae strain KpvST15_NDM plasmid unnamed4, complete sequence) position: , mismatch: 8, identity: 0.75

cagctggccgccctccaggcgcagacgcaggc	CRISPR spacer
gaactggccgccctgcaggcgcagacccgccg	Protospacer
 *.*********** *********** *.

455. spacer 23.3|5555711|32|NC_014210|CRISPRCasFinder matches to NZ_CP050828 (Klebsiella pneumoniae strain Bckp212 plasmid pBckp212-2, complete sequence) position: , mismatch: 8, identity: 0.75

cagctggccgccctccaggcgcagacgcaggc	CRISPR spacer
gaactggccgccctgcaggcgcagacccgccg	Protospacer
 *.*********** *********** *.

456. spacer 23.3|5555711|32|NC_014210|CRISPRCasFinder matches to NZ_CP038459 (Escherichia coli strain EC-129 plasmid pEC129_6, complete sequence) position: , mismatch: 8, identity: 0.75

cagctggccgccctccaggcgcagacgcaggc	CRISPR spacer
gaactggccgccctgcaggcgcagacccgccg	Protospacer
 *.*********** *********** *.

457. spacer 23.3|5555711|32|NC_014210|CRISPRCasFinder matches to NZ_CP050824 (Klebsiella pneumoniae strain Bckp091 plasmid pBckp091-2, complete sequence) position: , mismatch: 8, identity: 0.75

cagctggccgccctccaggcgcagacgcaggc	CRISPR spacer
gaactggccgccctgcaggcgcagacccgccg	Protospacer
 *.*********** *********** *.

458. spacer 23.3|5555711|32|NC_014210|CRISPRCasFinder matches to NZ_CP034050 (Klebsiella pneumoniae strain KP_NORM_BLD_2014_104014 plasmid unnamed5, complete sequence) position: , mismatch: 8, identity: 0.75

cagctggccgccctccaggcgcagacgcaggc	CRISPR spacer
gaactggccgccctgcaggcgcagacccgccg	Protospacer
 *.*********** *********** *.

459. spacer 23.3|5555711|32|NC_014210|CRISPRCasFinder matches to CP052340 (Klebsiella pneumoniae strain D17KP0018 plasmid pD17KP0018-3, complete sequence) position: , mismatch: 8, identity: 0.75

cagctggccgccctccaggcgcagacgcaggc	CRISPR spacer
gaactggccgccctgcaggcgcagacccgccg	Protospacer
 *.*********** *********** *.

460. spacer 23.3|5555711|32|NC_014210|CRISPRCasFinder matches to NZ_CP044044 (Klebsiella pneumoniae strain FDAARGOS_629 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

cagctggccgccctccaggcgcagacgcaggc	CRISPR spacer
gaactggccgccctgcaggcgcagacccgccg	Protospacer
 *.*********** *********** *.

461. spacer 23.3|5555711|32|NC_014210|CRISPRCasFinder matches to NZ_CP045296 (Paenibacillus cellulositrophicus strain KACC 16577 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

cagctggccgccctccaggcgcagacgcaggc	CRISPR spacer
gagctgaccgcccttcaggcgcagattcgtcc	Protospacer
 *****.*******.**********. *.  *

462. spacer 23.3|5555711|32|NC_014210|CRISPRCasFinder matches to NZ_CP013541 (Rhizobium phaseoli strain R630 plasmid pRphaR630d, complete sequence) position: , mismatch: 8, identity: 0.75

cagctggccgccctccaggcgcagacgcaggc	CRISPR spacer
gaactggccgccttcaaggcgcagaccaagaa	Protospacer
 *.*********.** **********  **.

463. spacer 23.3|5555711|32|NC_014210|CRISPRCasFinder matches to NC_013449 (Streptomyces sp. W9 plasmid pCQ3, complete sequence) position: , mismatch: 8, identity: 0.75

cagctggccgccctccaggcgcagacgcaggc	CRISPR spacer
aagctggccgcccgccaggagcaggccgacac	Protospacer
 ************ ***** ****.*  * .*

464. spacer 23.3|5555711|32|NC_014210|CRISPRCasFinder matches to NZ_CP024314 (Rhizobium sp. NXC24 plasmid pRspNXC24c, complete sequence) position: , mismatch: 8, identity: 0.75

cagctggccgccctccaggcgcagacgcaggc	CRISPR spacer
gaactggccgccttcaaggcgcagaccaagaa	Protospacer
 *.*********.** **********  **.

465. spacer 23.3|5555711|32|NC_014210|CRISPRCasFinder matches to NZ_CP053567 (Pseudonocardia sp. Gen01 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.75

cagctggccgccctccaggcgcagacgcaggc	CRISPR spacer
gggctggacgcccgccaggcgcagatcgacgc	Protospacer
 .***** ***** ***********.  * **

466. spacer 23.4|5555772|32|NC_014210|CRISPRCasFinder matches to NC_019847 (Sinorhizobium meliloti GR4 plasmid pRmeGR4b, complete sequence) position: , mismatch: 8, identity: 0.75

--ctgcccacccagctcaccgcgccggacgcgga	CRISPR spacer
agcgatc--cccagctcgccgcggcggacgcggc	Protospacer
  * ..*  ********.***** *********

467. spacer 23.4|5555772|32|NC_014210|CRISPRCasFinder matches to NC_017327 (Sinorhizobium meliloti SM11 plasmid pSmeSM11c, complete sequence) position: , mismatch: 8, identity: 0.75

--ctgcccacccagctcaccgcgccggacgcgga	CRISPR spacer
agcgatc--cccagctcgccgcggcggacgcggc	Protospacer
  * ..*  ********.***** *********

468. spacer 23.4|5555772|32|NC_014210|CRISPRCasFinder matches to NZ_CP029453 (Sinorhizobium fredii CCBAU 25509 plasmid pSF25509a, complete sequence) position: , mismatch: 8, identity: 0.75

--ctgcccacccagctcaccgcgccggacgcgga	CRISPR spacer
agcgatc--cccagctcgccgcggcggacgcggc	Protospacer
  * ..*  ********.***** *********

469. spacer 23.4|5555772|32|NC_014210|CRISPRCasFinder matches to NC_017324 (Sinorhizobium meliloti BL225C plasmid pSINMEB01, complete sequence) position: , mismatch: 8, identity: 0.75

--ctgcccacccagctcaccgcgccggacgcgga	CRISPR spacer
agcgatc--cccagctcgccgcggcggacgcggc	Protospacer
  * ..*  ********.***** *********

470. spacer 23.4|5555772|32|NC_014210|CRISPRCasFinder matches to NZ_AP013104 (Bradyrhizobium elkanii USDA 61 plasmid pBel61, complete sequence) position: , mismatch: 8, identity: 0.75

--ctgcccacccagctcaccgcgccggacgcgga	CRISPR spacer
agcgatc--cccagctcgccgcggcggacgcggc	Protospacer
  * ..*  ********.***** *********

471. spacer 23.4|5555772|32|NC_014210|CRISPRCasFinder matches to NZ_CP024309 (Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3b, complete sequence) position: , mismatch: 8, identity: 0.75

--ctgcccacccagctcaccgcgccggacgcgga	CRISPR spacer
agcgatc--cccagctcgccgcggcggacgcggc	Protospacer
  * ..*  ********.***** *********

472. spacer 23.4|5555772|32|NC_014210|CRISPRCasFinder matches to NZ_CP021803 (Sinorhizobium meliloti strain USDA1021 plasmid accessoryA, complete sequence) position: , mismatch: 8, identity: 0.75

--ctgcccacccagctcaccgcgccggacgcgga	CRISPR spacer
agcgatc--cccagctcgccgcggcggacgcggc	Protospacer
  * ..*  ********.***** *********

473. spacer 23.4|5555772|32|NC_014210|CRISPRCasFinder matches to NZ_CP011000 (Sinorhizobium meliloti strain USDA1963 plasmid pHRB800, complete sequence) position: , mismatch: 8, identity: 0.75

--ctgcccacccagctcaccgcgccggacgcgga	CRISPR spacer
agcgatc--cccagctcgccgcggcggacgcggc	Protospacer
  * ..*  ********.***** *********

474. spacer 23.4|5555772|32|NC_014210|CRISPRCasFinder matches to NZ_CP023069 (Ensifer sojae CCBAU 05684 plasmid pSJ05684a, complete sequence) position: , mismatch: 8, identity: 0.75

--ctgcccacccagctcaccgcgccggacgcgga	CRISPR spacer
agcgatc--cccagctcgccgcggcggacgcggc	Protospacer
  * ..*  ********.***** *********

475. spacer 23.4|5555772|32|NC_014210|CRISPRCasFinder matches to NZ_CP021821 (Sinorhizobium meliloti strain M162 plasmid accessoryA, complete sequence) position: , mismatch: 8, identity: 0.75

--ctgcccacccagctcaccgcgccggacgcgga	CRISPR spacer
agcgatc--cccagctcgccgcggcggacgcggc	Protospacer
  * ..*  ********.***** *********

476. spacer 23.4|5555772|32|NC_014210|CRISPRCasFinder matches to NZ_CP013053 (Sinorhizobium americanum CCGM7 plasmid B, complete sequence) position: , mismatch: 8, identity: 0.75

--ctgcccacccagctcaccgcgccggacgcgga	CRISPR spacer
agcgatc--cccagctcgccgcggcggacgcggc	Protospacer
  * ..*  ********.***** *********

477. spacer 23.4|5555772|32|NC_014210|CRISPRCasFinder matches to NZ_CP023072 (Sinorhizobium fredii CCBAU 83666 plasmid pSF83666a, complete sequence) position: , mismatch: 8, identity: 0.75

--ctgcccacccagctcaccgcgccggacgcgga	CRISPR spacer
agcgatc--cccagctcgccgcggcggacgcggc	Protospacer
  * ..*  ********.***** *********

478. spacer 23.4|5555772|32|NC_014210|CRISPRCasFinder matches to NZ_CP023072 (Sinorhizobium fredii CCBAU 83666 plasmid pSF83666a, complete sequence) position: , mismatch: 8, identity: 0.75

--ctgcccacccagctcaccgcgccggacgcgga	CRISPR spacer
agcgatc--cccagctcgccgcggcggacgcggc	Protospacer
  * ..*  ********.***** *********

479. spacer 23.4|5555772|32|NC_014210|CRISPRCasFinder matches to NZ_CP021817 (Sinorhizobium meliloti strain M270 plasmid accessoryC, complete sequence) position: , mismatch: 8, identity: 0.75

--ctgcccacccagctcaccgcgccggacgcgga	CRISPR spacer
agcgatc--cccagctcgccgcggcggacgcggc	Protospacer
  * ..*  ********.***** *********

480. spacer 23.4|5555772|32|NC_014210|CRISPRCasFinder matches to NZ_CP021794 (Sinorhizobium meliloti strain USDA1157 plasmid psymA, complete sequence) position: , mismatch: 8, identity: 0.75

--ctgcccacccagctcaccgcgccggacgcgga	CRISPR spacer
agcgatc--cccagctcgccgcggcggacgcggc	Protospacer
  * ..*  ********.***** *********

481. spacer 23.4|5555772|32|NC_014210|CRISPRCasFinder matches to NZ_CP021217 (Sinorhizobium meliloti RU11/001 plasmid pSymA, complete sequence) position: , mismatch: 8, identity: 0.75

--ctgcccacccagctcaccgcgccggacgcgga	CRISPR spacer
agcgatc--cccagctcgccgcggcggacgcggc	Protospacer
  * ..*  ********.***** *********

482. spacer 23.4|5555772|32|NC_014210|CRISPRCasFinder matches to NZ_CP024313 (Rhizobium sp. NXC24 plasmid pRspNXC24b, complete sequence) position: , mismatch: 8, identity: 0.75

--ctgcccacccagctcaccgcgccggacgcgga	CRISPR spacer
agcgatc--cccagctcgccgcggcggacgcggc	Protospacer
  * ..*  ********.***** *********

483. spacer 23.4|5555772|32|NC_014210|CRISPRCasFinder matches to NZ_CP026526 (Sinorhizobium meliloti strain AK21 plasmid pSymA, complete sequence) position: , mismatch: 8, identity: 0.75

--ctgcccacccagctcaccgcgccggacgcgga	CRISPR spacer
agcgatc--cccagctcgccgcggcggacgcggc	Protospacer
  * ..*  ********.***** *********

484. spacer 23.4|5555772|32|NC_014210|CRISPRCasFinder matches to NZ_CP023065 (Sinorhizobium sp. CCBAU 05631 plasmid pSS05631a, complete sequence) position: , mismatch: 8, identity: 0.75

--ctgcccacccagctcaccgcgccggacgcgga	CRISPR spacer
agcgatc--cccagctcgccgcggcggacgcggc	Protospacer
  * ..*  ********.***** *********

485. spacer 23.4|5555772|32|NC_014210|CRISPRCasFinder matches to NC_019313 (Sinorhizobium meliloti plasmid pHRC017, complete sequence) position: , mismatch: 8, identity: 0.75

--ctgcccacccagctcaccgcgccggacgcgga	CRISPR spacer
agcgatc--cccagctcgccgcggcggacgcggc	Protospacer
  * ..*  ********.***** *********

486. spacer 23.4|5555772|32|NC_014210|CRISPRCasFinder matches to NZ_CP029233 (Sinorhizobium fredii CCBAU 45436 plasmid pSF45436a, complete sequence) position: , mismatch: 8, identity: 0.75

--ctgcccacccagctcaccgcgccggacgcgga	CRISPR spacer
agcgatc--cccagctcgccgcggcggacgcggc	Protospacer
  * ..*  ********.***** *********

487. spacer 23.4|5555772|32|NC_014210|CRISPRCasFinder matches to NZ_CP030864 (Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

ctgcccacccagctcaccgcgccggacgcgga	CRISPR spacer
ctcgccgcccagttcaccgcgccggacctgac	Protospacer
**  **.*****.************** .*.

488. spacer 23.9|5555708|35|NC_014210|CRT matches to NZ_CP045390 (Roseivivax sp. THAF30 plasmid pTHAF30_a, complete sequence) position: , mismatch: 8, identity: 0.771

caccagctggccgccctccaggcgcagacgcaggc	CRISPR spacer
gcccagctcgccgccctccaggcccagatcgagga	Protospacer
  ****** ************** ****.  ***

489. spacer 23.9|5555708|35|NC_014210|CRT matches to NZ_CP045362 (Roseivivax sp. THAF40 plasmid pTHAF40_b, complete sequence) position: , mismatch: 8, identity: 0.771

caccagctggccgccctccaggcgcagacgcaggc	CRISPR spacer
gcccagctcgccgccctccaggcccagatcgagga	Protospacer
  ****** ************** ****.  ***

490. spacer 23.9|5555708|35|NC_014210|CRT matches to CP011998 (Ralstonia solanacearum strain YC45 plasmid, complete sequence) position: , mismatch: 8, identity: 0.771

caccagctggccgccctccaggcgcagacgcaggc	CRISPR spacer
gaccagctggccgcccggcaggcgcagcgtcacgg	Protospacer
 ***************  *********   ** *

491. spacer 23.15|5555709|35|NC_014210|PILER-CR matches to NZ_CP045390 (Roseivivax sp. THAF30 plasmid pTHAF30_a, complete sequence) position: , mismatch: 8, identity: 0.771

caccagctggccgccctccaggcgcagacgcaggc	CRISPR spacer
gcccagctcgccgccctccaggcccagatcgagga	Protospacer
  ****** ************** ****.  ***

492. spacer 23.15|5555709|35|NC_014210|PILER-CR matches to NZ_CP045362 (Roseivivax sp. THAF40 plasmid pTHAF40_b, complete sequence) position: , mismatch: 8, identity: 0.771

caccagctggccgccctccaggcgcagacgcaggc	CRISPR spacer
gcccagctcgccgccctccaggcccagatcgagga	Protospacer
  ****** ************** ****.  ***

493. spacer 23.15|5555709|35|NC_014210|PILER-CR matches to CP011998 (Ralstonia solanacearum strain YC45 plasmid, complete sequence) position: , mismatch: 8, identity: 0.771

caccagctggccgccctccaggcgcagacgcaggc	CRISPR spacer
gaccagctggccgcccggcaggcgcagcgtcacgg	Protospacer
 ***************  *********   ** *

494. spacer 7.9|1581936|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 9, identity: 0.719

gacgacggggtcgctgctgctggccagggtgg	CRISPR spacer
ggtcgggctgtcgctgctgctgtcctgggtgg	Protospacer
*.. . *  ************* ** ******

495. spacer 7.9|1581936|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP031159 (Deinococcus wulumuqiensis strain NEB 479 plasmid pDrdA, complete sequence) position: , mismatch: 9, identity: 0.719

gacgacggggtcgctgctgctggccagggtgg	CRISPR spacer
gcttacggcgtcgctgctgcttgccagcaccg	Protospacer
* . **** ************ ***** .. *

496. spacer 7.9|1581936|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

gacgacggggtcgctgctgctggccagggtgg	CRISPR spacer
gttcagcccgtcgctgctgctggccgggctgg	Protospacer
* . *    ****************.** ***

497. spacer 7.10|1581997|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP006368 (Aureimonas sp. AU20 plasmid pAU20a, complete sequence) position: , mismatch: 9, identity: 0.719

atcctcctgccgccgccctgggacgcgatgag	CRISPR spacer
atcctcctgccgacgccctggtacttcaacca	Protospacer
************ ******** ** . *   .

498. spacer 7.10|1581997|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP013110 (Sinorhizobium americanum strain CFNEI 73 plasmid C, complete sequence) position: , mismatch: 9, identity: 0.719

atcctcctgccgccgccctgggacgcgatgag	CRISPR spacer
ggccaactgccgccgcccggggccgcgatctc	Protospacer
. **  ************ *** ******

499. spacer 7.10|1581997|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP013054 (Sinorhizobium americanum CCGM7 plasmid C, complete sequence) position: , mismatch: 9, identity: 0.719

atcctcctgccgccgccctgggacgcgatgag	CRISPR spacer
ggccaactgccgccgcccggggccgcgatctc	Protospacer
. **  ************ *** ******

500. spacer 7.10|1581997|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcctcctgccgccgccctgggacgcgatgag	CRISPR spacer
acggcgatgccgccgcccagggccgcgatgcg	Protospacer
*.  .  *********** *** ******* *

501. spacer 7.12|1582119|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_KY865323 (Escherichia coli strain SY286M plasmid pECM13, complete sequence) position: , mismatch: 9, identity: 0.719

aggacggagcgcgggtgcgcctggtgtgcggg	CRISPR spacer
tgtgcggagcgcgggtgcgtctggcgttgtcg	Protospacer
 * .***************.****.**    *

502. spacer 8.3|1587611|33|NC_014210|PILER-CR matches to NC_016586 (Azospirillum lipoferum 4B plasmid AZO_p2, complete sequence) position: , mismatch: 9, identity: 0.727

cgccatcaacgccgccgcccgctccggtggtat	CRISPR spacer
gaccatcatcgccgccacccgctccggcgccgg	Protospacer
 .****** *******.**********.* ..

503. spacer 8.3|1587611|33|NC_014210|PILER-CR matches to NZ_CP016453 (Sphingobium sp. RAC03 plasmid pBSY17_1, complete sequence) position: , mismatch: 9, identity: 0.727

cgccatcaacgccgccgcccgctccggtggtat	CRISPR spacer
agccagcaacgccgccgcccgcaccgccaagac	Protospacer
 **** **************** *** ... *.

504. spacer 8.3|1587611|33|NC_014210|PILER-CR matches to NZ_CP032324 (Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence) position: , mismatch: 9, identity: 0.727

cgccatcaacgccgccgcccgctccggtggtat	CRISPR spacer
gaggatttgcgccgccgcccgctccggcgggat	Protospacer
 .  **. .******************.** **

505. spacer 8.9|1587977|33|NC_014210|PILER-CR matches to NZ_CP022191 (Yangia pacifica strain YSBP01 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.727

gcgggtccgaggtcggcgggcgggcggtcctcg	CRISPR spacer
aagttgtagaggtcggcgcgcaggcggtcctcg	Protospacer
. *   . ********** **.***********

506. spacer 8.11|1588099|33|NC_014210|PILER-CR matches to CP052389 (Klebsiella pneumoniae strain C17KP0052 plasmid pC17KP0052-1) position: , mismatch: 9, identity: 0.727

cgggaagcccaccggcaccgtccgcaaggtcgc	CRISPR spacer
cgtctcgcccaccggcatcgtccgcacggtttt	Protospacer
**    ***********.******** ***. .

507. spacer 8.14|1587612|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP051471 (Rhodobacter sphaeroides strain CH10 plasmid pRspCH10B, complete sequence) position: , mismatch: 9, identity: 0.719

gccatcaacgccgccgcccgctccggtggtat	CRISPR spacer
gccttcagcgccgccgcccgctcgagccgcgc	Protospacer
*** ***.*************** .*. *...

508. spacer 8.14|1587612|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_AP020327 (Mycobacterium avium subsp. hominissuis strain JP-H-1 plasmid p1-JPH1) position: , mismatch: 9, identity: 0.719

gccatcaacgccgccgcccgctccggtggtat	CRISPR spacer
ctcctcaacgccatcgcccgctccggtcgctc	Protospacer
 .* ********..************* *. .

509. spacer 8.14|1587612|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP030274 (Rhodobacter sphaeroides 2.4.1 plasmid pB, complete sequence) position: , mismatch: 9, identity: 0.719

gccatcaacgccgccgcccgctccggtggtat	CRISPR spacer
gccttcagcgccgccgcccgctcgagccgcgc	Protospacer
*** ***.*************** .*. *...

510. spacer 8.14|1587612|32|NC_014210|CRISPRCasFinder,CRT matches to CP047034 (Rhodobacter sphaeroides strain DSM 158 plasmid pB, complete sequence) position: , mismatch: 9, identity: 0.719

gccatcaacgccgccgcccgctccggtggtat	CRISPR spacer
gccttcagcgccgccgcccgctcgagccgcgc	Protospacer
*** ***.*************** .*. *...

511. spacer 8.14|1587612|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP015291 (Rhodobacter sphaeroides strain MBTLJ-20 plasmid c, complete sequence) position: , mismatch: 9, identity: 0.719

gccatcaacgccgccgcccgctccggtggtat	CRISPR spacer
gccttcagcgccgccgcccgctcgagccgcgc	Protospacer
*** ***.*************** .*. *...

512. spacer 8.14|1587612|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP047040 (Rhodobacter sphaeroides strain 2.4.1 substr. H2 plasmid pB, complete sequence) position: , mismatch: 9, identity: 0.719

gccatcaacgccgccgcccgctccggtggtat	CRISPR spacer
gccttcagcgccgccgcccgctcgagccgcgc	Protospacer
*** ***.*************** .*. *...

513. spacer 8.14|1587612|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP007795 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence) position: , mismatch: 9, identity: 0.719

gccatcaacgccgccgcccgctccggtggtat	CRISPR spacer
cgcatctacgccgccgccccctccgccaccat	Protospacer
  **** ************ ***** .. .**

514. spacer 8.14|1587612|32|NC_014210|CRISPRCasFinder,CRT matches to NC_011962 (Rhodobacter sphaeroides KD131 plasmid pRSKD131A, complete sequence) position: , mismatch: 9, identity: 0.719

gccatcaacgccgccgcccgctccggtggtat	CRISPR spacer
gccttcagcgccgccgcccgctcgagccgcgc	Protospacer
*** ***.*************** .*. *...

515. spacer 8.14|1587612|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_AP014579 (Burkholderia sp. RPE67 plasmid p1, complete sequence) position: , mismatch: 9, identity: 0.719

gccatcaacgccgccgcccgctccggtggtat	CRISPR spacer
gcggccaatgccgctgcccgctccggtgacga	Protospacer
** ..***.*****.*************...

516. spacer 8.14|1587612|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP015215 (Rhodobacter sphaeroides strain MBTLJ-13 plasmid d, complete sequence) position: , mismatch: 9, identity: 0.719

gccatcaacgccgccgcccgctccggtggtat	CRISPR spacer
gccttcagcgccgccgcccgctcgagccgcgc	Protospacer
*** ***.*************** .*. *...

517. spacer 8.14|1587612|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP034185 (Deinococcus sp. S14-83 strain S14-83T plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

gccatcaacgccgccgcccgctccggtggtat	CRISPR spacer
agcggctacgccgccgcccgctgcggtcgtgc	Protospacer
. *. * *************** **** **..

518. spacer 8.14|1587612|32|NC_014210|CRISPRCasFinder,CRT matches to MN694708 (Marine virus AFVG_250M243, complete genome) position: , mismatch: 9, identity: 0.719

gccatcaacgccgccgcccgctccggtggtat	CRISPR spacer
ctgaagaacgccgccgccctctccggaggcac	Protospacer
 . *  ************* ****** **.*.

519. spacer 8.18|1587856|32|NC_014210|CRISPRCasFinder,CRT matches to NC_012811 (Methylorubrum extorquens AM1 megaplasmid, complete sequence) position: , mismatch: 9, identity: 0.719

ccaggccgccgaccctcgcgcggcccgccacg	CRISPR spacer
tgcggccgccgagactcgcgcggcccgggcgg	Protospacer
.  *********  *************    *

520. spacer 8.18|1587856|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 9, identity: 0.719

ccaggccgccgaccctcgcgcggcccgccacg	CRISPR spacer
ccgagccgccgacccacgcgcggaccgtgctc	Protospacer
**..*********** ******* ***.  .

521. spacer 8.18|1587856|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP026305 (Streptomyces lunaelactis strain MM109 plasmid pSLUN1, complete sequence) position: , mismatch: 9, identity: 0.719

ccaggccgccgaccctcgcgcggcccgccacg	CRISPR spacer
agggcgcaccggcgctcgcgcggcccgccacc	Protospacer
  .*  *.***.* *****************

522. spacer 8.18|1587856|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP032054 (Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence) position: , mismatch: 9, identity: 0.719

ccaggccgccgaccctcgcgcggcccgccacg	CRISPR spacer
ccgagccgccgacccacgcgcggaccgtgctc	Protospacer
**..*********** ******* ***.  .

523. spacer 8.18|1587856|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP016560 (Streptomyces clavuligerus strain F613-1 plasmid pSCL4, complete sequence) position: , mismatch: 9, identity: 0.719

ccaggccgccgaccctcgcgcggcccgccacg	CRISPR spacer
ccgagccgccgacccacgcgcggaccgtgctc	Protospacer
**..*********** ******* ***.  .

524. spacer 8.20|1587978|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP014519 (Sinomonas atrocyanea strain KCTC 3377 plasmid pSA01, complete sequence) position: , mismatch: 9, identity: 0.719

cgggtccgaggtcggcgggcgggcggtcctcg	CRISPR spacer
tctcgccgaggtcggcgggcacgcggtccggg	Protospacer
.    ***************. *******  *

525. spacer 8.20|1587978|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP007796 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p3, complete sequence) position: , mismatch: 9, identity: 0.719

cgggtccgaggtcggcgggcgggcggtcctcg	CRISPR spacer
gggcgtcgaggtcggcgggcagccggtccagc	Protospacer
 **  .**************.* ******

526. spacer 8.20|1587978|32|NC_014210|CRISPRCasFinder,CRT matches to NC_013857 (Azospirillum sp. B510 plasmid pAB510c, complete sequence) position: , mismatch: 9, identity: 0.719

cgggtccgaggtcggcgggcgggcggtcctcg	CRISPR spacer
ggtggtgatggtcggcgggcgggcgggcttcg	Protospacer
 * * . . ***************** *.***

527. spacer 8.21|1588039|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP022991 (Paraburkholderia aromaticivorans strain BN5 plasmid pBN1, complete sequence) position: , mismatch: 9, identity: 0.719

ggcacggcaccctggaccgccgctgcgtcatc	CRISPR spacer
atatcggcacccaggcccgccgctgcgccgtt	Protospacer
.   ******** ** ***********.*.*.

528. spacer 8.22|1588100|32|NC_014210|CRISPRCasFinder,CRT matches to CP052389 (Klebsiella pneumoniae strain C17KP0052 plasmid pC17KP0052-1) position: , mismatch: 9, identity: 0.719

gggaagcccaccggcaccgtccgcaaggtcgc	CRISPR spacer
gtctcgcccaccggcatcgtccgcacggtttt	Protospacer
*    ***********.******** ***. .

529. spacer 8.22|1588100|32|NC_014210|CRISPRCasFinder,CRT matches to NC_017791 (Deinococcus gobiensis I-0 plasmid P2, complete sequence) position: , mismatch: 9, identity: 0.719

gggaagcccaccggcaccgtccgcaaggtcgc	CRISPR spacer
accaacggcaccgtcaccctccgcaaggtcga	Protospacer
.  **   ***** **** ************

530. spacer 8.22|1588100|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP020811 (Mycobacterium dioxanotrophicus strain PH-06 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

gggaagcccaccggcaccgtccgcaaggtcgc	CRISPR spacer
atgaccatcaccggcaaggtccgcaaggtcga	Protospacer
. **   .********  *************

531. spacer 8.22|1588100|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP054615 (Azospirillum oryzae strain KACC 14407 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

gggaagcccaccggcaccgtccgcaaggtcgc	CRISPR spacer
tcgccggccagcggcaccgtccgcacggtcat	Protospacer
  *  * *** ************** ****..

532. spacer 8.22|1588100|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP032346 (Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence) position: , mismatch: 9, identity: 0.719

gggaagcccaccggcaccgtccgcaaggtcgc	CRISPR spacer
gcggcgccccccggctccgtccgcaaggcgaa	Protospacer
* *. **** ***** ************. .

533. spacer 9.3|1595182|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to MN096379 (Streptomyces phage Yasdnil, complete genome) position: , mismatch: 9, identity: 0.719

cagcgtcgtcgaccccaggctgacggaggtct	CRISPR spacer
tgatgtcgtcgtcgccaggctgacggaggatg	Protospacer
....******* * *************** .

534. spacer 9.3|1595182|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP020951 (Rhizobium sp. CIAT894 plasmid pRheCIAT894d, complete sequence) position: , mismatch: 9, identity: 0.719

cagcgtcgtcgaccccaggctgacggaggtct	CRISPR spacer
cagcgtcgtcgatccccggctgaaactgcgcg	Protospacer
************.*** ****** .  *  *

535. spacer 9.8|1595487|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to CP042595 (Streptomyces albogriseolus strain LBX-2 plasmid pSALBX2, complete sequence) position: , mismatch: 9, identity: 0.719

gccgtcgccgcctacgcgaccgccctcgggct	CRISPR spacer
atcgtcgccggcgacgcgaccgcccctgacca	Protospacer
..******** * ************..*. *

536. spacer 9.8|1595487|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NC_024145 (Mycobacterium phage Hosp, complete genome) position: , mismatch: 9, identity: 0.719

gccgtcgccgcctacgcgaccgccctcgggct	CRISPR spacer
ccagaacccgcctccccgaccgccctcgggtg	Protospacer
 * *   ****** * **************.

537. spacer 9.9|1595548|33|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP024791 (Nostoc flagelliforme CCNUN1 plasmid pNFSY06, complete sequence) position: , mismatch: 9, identity: 0.727

catgcggcaatccaccccacagagaagcccgtg	CRISPR spacer
tgttacacaattcaccccacagagaagaccgag	Protospacer
..*   .****.*************** *** *

538. spacer 9.9|1595548|33|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP024793 (Nostoc flagelliforme CCNUN1 plasmid pNFSY08, complete sequence) position: , mismatch: 9, identity: 0.727

catgcggcaatccaccccacagagaagcccgtg	CRISPR spacer
tgttacacaattcaccccacagagaagaccgag	Protospacer
..*   .****.*************** *** *

539. spacer 9.10|1595610|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP015419 (Rhodovulum sulfidophilum DSM 1374 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

tcgatgaccgaggtcgacggcaccgggtcgga	CRISPR spacer
gcgatgaccgaggtcggcggcgccgcccggcg	Protospacer
 ***************.****.***  . * .

540. spacer 9.10|1595610|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NC_008269 (Rhodococcus jostii RHA1 plasmid pRHL1, complete sequence) position: , mismatch: 9, identity: 0.719

tcgatgaccgaggtcgacggcaccgggtcgga	CRISPR spacer
gtgatgaccgaggtcgacgtccccggcggtgt	Protospacer
 .***************** * ****    *

541. spacer 9.10|1595610|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP015422 (Rhodovulum sulfidophilum strain SNK001 plasmid, complete sequence) position: , mismatch: 9, identity: 0.719

tcgatgaccgaggtcgacggcaccgggtcgga	CRISPR spacer
gcgatgaccgaggtcggcggcgccgcccggcg	Protospacer
 ***************.****.***  . * .

542. spacer 9.10|1595610|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP007129 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence) position: , mismatch: 9, identity: 0.719

tcgatgaccgaggtcgacggcaccgggtcgga	CRISPR spacer
accgtgaccgacgtcgagggcaccgggctcgg	Protospacer
 * .******* ***** *********.. *.

543. spacer 9.10|1595610|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to KT001914 (Caulobacter phage Seuss, complete genome) position: , mismatch: 9, identity: 0.719

tcgatgaccgaggtcgacggcaccgggtcgga	CRISPR spacer
atcctgttcgaggtcgacggcaccgaggcggc	Protospacer
 .  ** .*****************.* ***

544. spacer 10.2|1602835|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to MF766046 (Streptomyces phage Diane, complete genome) position: , mismatch: 9, identity: 0.719

cggggccgtggtgttggacgccgcggatgtgg	CRISPR spacer
gcgggacgaggtgttggacgccgcgatggtca	Protospacer
  *** ** ****************.  ** .

545. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP050092 (Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b6, complete sequence) position: , mismatch: 9, identity: 0.719

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
cggccgccgggccgccgggatggctgacgatg	Protospacer
***************** *.****...*  .

546. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to CP023013 (Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
cggccgcctgaccgccgcggtggtgcaccacg	Protospacer
******** *.************.  .*. *

547. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP050098 (Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b4, complete sequence) position: , mismatch: 9, identity: 0.719

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
cggccgccgggccgccgggatggctgacgatg	Protospacer
***************** *.****...*  .

548. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP050104 (Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b2, complete sequence) position: , mismatch: 9, identity: 0.719

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
cggccgccgggccaccggggtggctgacgatg	Protospacer
*************.*** ******...*  .

549. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP053440 (Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eF, complete sequence) position: , mismatch: 9, identity: 0.719

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
cggctgccgggccgccggggtggctgacgatg	Protospacer
****.************ ******...*  .

550. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP018229 (Rhizobium leguminosarum strain Vaf-108 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
cggccgccgggccgccgggatggctgacgatg	Protospacer
***************** *.****...*  .

551. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP025507 (Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvA, complete sequence) position: , mismatch: 9, identity: 0.719

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
cggccgccgggccaccggggtggctgacgatg	Protospacer
*************.*** ******...*  .

552. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP050109 (Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b2, complete sequence) position: , mismatch: 9, identity: 0.719

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
cggccgccgggccaccggggtggctgacgatg	Protospacer
*************.*** ******...*  .

553. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP030761 (Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
cggccgccgggccaccggggtggctgacgatg	Protospacer
*************.*** ******...*  .

554. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022783 (Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
cggccgcctgaccgccgcggtggtgcaccacg	Protospacer
******** *.************.  .*. *

555. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022795 (Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
cggccgcctgaccgccgcggtggtgcaccacg	Protospacer
******** *.************.  .*. *

556. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022666 (Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR1, complete sequence) position: , mismatch: 9, identity: 0.719

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
cggccgccgggccaccggggtggctgacgatg	Protospacer
*************.*** ******...*  .

557. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to CP023015 (Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
cggccgcctgaccgccgcggtggtgcaccacg	Protospacer
******** *.************.  .*. *

558. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP054032 (Rhizobium sp. JKLM13E plasmid pPR13E01, complete sequence) position: , mismatch: 9, identity: 0.719

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
cggccgccgggccgccgggatggctgacgata	Protospacer
***************** *.****...*  .

559. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP050086 (Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b7, complete sequence) position: , mismatch: 9, identity: 0.719

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
cggccgccgggccaccggggtggctgacgatg	Protospacer
*************.*** ******...*  .

560. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to MN175603 (Microbacterium phage Tyrumbra, complete genome) position: , mismatch: 9, identity: 0.719

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
cccccgccgggccgcggcggtcgccagggtgg	Protospacer
*  ************ ***** *****  .

561. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to MH271312 (Microbacterium phage RobsFeet, complete genome) position: , mismatch: 9, identity: 0.719

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
cccccgccgggccgcggcggtcgccagggtgg	Protospacer
*  ************ ***** *****  .

562. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to MK524510 (Microbacterium phage Fireman, complete genome) position: , mismatch: 9, identity: 0.719

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
cccccgccgggccgcggcggtcgccagggtgg	Protospacer
*  ************ ***** *****  .

563. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NC_047988 (Microbacterium phage Metamorphoo, complete genome) position: , mismatch: 9, identity: 0.719

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
cccccgccgggccgcggcggtcgccagggtgg	Protospacer
*  ************ ***** *****  .

564. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP016613 (Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
cggccgcctgaccgccgcggtggtgcaccacg	Protospacer
******** *.************.  .*. *

565. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022766 (Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
cggccgcctgaccgccgcggtggtgcaccacg	Protospacer
******** *.************.  .*. *

566. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP050953 (Rhodococcus sp. DMU1 plasmid unnamed) position: , mismatch: 9, identity: 0.719

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
gggccgccgggccgcttcggtggcggatagct	Protospacer
 **************. ******* ...  **

567. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052069 (Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
cggccgcctgaccgccgcggtggtgcaccacg	Protospacer
******** *.************.  .*. *

568. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP016313 (Thermus brockianus strain GE-1 plasmid pTB1, complete sequence) position: , mismatch: 9, identity: 0.719

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
ccggacccgggccgtcgcgggggccagcttga	Protospacer
* *   ********.***** ********.

569. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022769 (Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
cggccgcctgaccgccgcggtggtgcaccacg	Protospacer
******** *.************.  .*. *

570. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP029358 (Azospirillum sp. CFH 70021 plasmid unnamed3) position: , mismatch: 9, identity: 0.719

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
gagcagccgggccgccgcggtgtcccgggtcc	Protospacer
 .** ***************** ** *  .*.

571. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022773 (Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
cggccgcctgaccgccgcggtggtgcaccacg	Protospacer
******** *.************.  .*. *

572. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP023549 (Rhodobacter sp. CZR27 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
cggccgccgggccgccggcgtggtcgaagacg	Protospacer
*****************  ****.*..   *

573. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022482 (Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence) position: , mismatch: 9, identity: 0.719

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
cggccgcctgaccgccgcggtggtgcaccacg	Protospacer
******** *.************.  .*. *

574. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP046573 (Rhodococcus sp. WAY2 plasmid pRWAY01, complete sequence) position: , mismatch: 9, identity: 0.719

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
ggtgtgccgggcctccgcggcggccagcagcg	Protospacer
 *  .******** ******.*******  *

575. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022779 (Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
cggccgcctgaccgccgcggtggtgcaccacg	Protospacer
******** *.************.  .*. *

576. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022781 (Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
cggccgcctgaccgccgcggtggtgcaccacg	Protospacer
******** *.************.  .*. *

577. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to CP003957 (Rhodococcus opacus PD630 plasmid 8, complete sequence) position: , mismatch: 9, identity: 0.719

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
tgttcgccgggacgcggcggtggccagttgac	Protospacer
.* .******* *** ***********.*  .

578. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022793 (Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
cggccgcctgaccgccgcggtggtgcaccacg	Protospacer
******** *.************.  .*. *

579. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022785 (Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
cggccgcctgaccgccgcggtggtgcaccacg	Protospacer
******** *.************.  .*. *

580. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022787 (Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
cggccgcctgaccgccgcggtggtgcaccacg	Protospacer
******** *.************.  .*. *

581. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022756 (Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
cggccgcctgaccgccgcggtggtgcaccacg	Protospacer
******** *.************.  .*. *

582. spacer 10.6|1603079|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP025188 (Roseomonas mucosa strain AD2 plasmid p1-AD2, complete sequence) position: , mismatch: 9, identity: 0.719

gaggcggcgcgcgcggacccgtcgtcgctgtc	CRISPR spacer
gaggcggcgcgcgcggcccggtcgcgcagggt	Protospacer
**************** ** ****.    * .

583. spacer 10.6|1603079|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP015881 (Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence) position: , mismatch: 9, identity: 0.719

gaggcggcgcgcgcggacccgtcgtcgctgtc	CRISPR spacer
ttgagggcgcgggcggactcgtcgtcgcgcgc	Protospacer
  *. ****** ******.*********   *

584. spacer 10.6|1603079|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP030263 (Ensifer adhaerens strain Corn53 plasmid AA, complete sequence) position: , mismatch: 9, identity: 0.719

gaggcggcgcgcgcggacccgtcgtcgctgtc	CRISPR spacer
ttgagggcgcgggcggactcgtcgtcgcgcgc	Protospacer
  *. ****** ******.*********   *

585. spacer 10.6|1603079|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP023549 (Rhodobacter sp. CZR27 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

gaggcggcgcgcgcggacccgtcgtcgctgtc	CRISPR spacer
tcgtcggcgcgcgcggacccgtgatcgtcgag	Protospacer
  * ****************** .***..*

586. spacer 10.7|1603140|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP010613 (Phaeobacter inhibens strain P92 plasmid pP92_c, complete sequence) position: , mismatch: 9, identity: 0.719

atcccgcgtggcgctgccctctacctgcgcgg	CRISPR spacer
gccaaccacggcgctgcccgcaacctgcgcgg	Protospacer
..*   *..********** * **********

587. spacer 10.7|1603140|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP010597 (Phaeobacter inhibens strain P10 plasmid pP10_b, complete sequence) position: , mismatch: 9, identity: 0.719

atcccgcgtggcgctgccctctacctgcgcgg	CRISPR spacer
gccaaccacggcgctgcccgcaacctgcgcgg	Protospacer
..*   *..********** * **********

588. spacer 10.7|1603140|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NC_018287 (Phaeobacter inhibens DSM 17395 plasmid pPGA1_78, complete sequence) position: , mismatch: 9, identity: 0.719

atcccgcgtggcgctgccctctacctgcgcgg	CRISPR spacer
gccaaccacggcgctgcccgcaacctgcgcgg	Protospacer
..*   *..********** * **********

589. spacer 10.7|1603140|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP010632 (Phaeobacter inhibens strain P78 plasmid pP78_c, complete sequence) position: , mismatch: 9, identity: 0.719

atcccgcgtggcgctgccctctacctgcgcgg	CRISPR spacer
gccaaccacggcgctgcccgcaacctgcgcgg	Protospacer
..*   *..********** * **********

590. spacer 10.7|1603140|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP031954 (Phaeobacter inhibens strain 2.10 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

atcccgcgtggcgctgccctctacctgcgcgg	CRISPR spacer
gccaaccacggcgctgcccgcaacctgcgcgg	Protospacer
..*   *..********** * **********

591. spacer 10.7|1603140|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NC_018423 (Phaeobacter inhibens 2.10 plasmid pPGA2_95, complete sequence) position: , mismatch: 9, identity: 0.719

atcccgcgtggcgctgccctctacctgcgcgg	CRISPR spacer
gccaaccacggcgctgcccgcaacctgcgcgg	Protospacer
..*   *..********** * **********

592. spacer 10.7|1603140|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP010761 (Phaeobacter inhibens strain P80 plasmid pP80_e, complete sequence) position: , mismatch: 9, identity: 0.719

atcccgcgtggcgctgccctctacctgcgcgg	CRISPR spacer
gccaaccacggcgctgcccgcaacctgcgcgg	Protospacer
..*   *..********** * **********

593. spacer 10.7|1603140|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP010604 (Phaeobacter inhibens strain P83 plasmid pP83_e, complete sequence) position: , mismatch: 9, identity: 0.719

atcccgcgtggcgctgccctctacctgcgcgg	CRISPR spacer
gccaaccacggcgctgcccgcaacctgcgcgg	Protospacer
..*   *..********** * **********

594. spacer 10.7|1603140|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP031950 (Phaeobacter inhibens strain BS107 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

atcccgcgtggcgctgccctctacctgcgcgg	CRISPR spacer
gccaaccacggcgctgcccgcaacctgcgcgg	Protospacer
..*   *..********** * **********

595. spacer 10.7|1603140|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP010731 (Phaeobacter inhibens strain P88 plasmid pP88_f, complete sequence) position: , mismatch: 9, identity: 0.719

atcccgcgtggcgctgccctctacctgcgcgg	CRISPR spacer
gccaaccacggcgctgcccgcaacctgcgcgg	Protospacer
..*   *..********** * **********

596. spacer 10.7|1603140|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP010653 (Phaeobacter inhibens strain P54 plasmid pP54_c, complete sequence) position: , mismatch: 9, identity: 0.719

atcccgcgtggcgctgccctctacctgcgcgg	CRISPR spacer
gccaaccacggcgctgcccgcaacctgcgcgg	Protospacer
..*   *..********** * **********

597. spacer 10.7|1603140|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP010710 (Phaeobacter inhibens strain P66 plasmid pP66_e, complete sequence) position: , mismatch: 9, identity: 0.719

atcccgcgtggcgctgccctctacctgcgcgg	CRISPR spacer
gccaaccacggcgctgcccgcaacctgcgcgg	Protospacer
..*   *..********** * **********

598. spacer 10.7|1603140|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP019310 (Phaeobacter inhibens strain DOK1-1 plasmid pDOK1-1-3, complete sequence) position: , mismatch: 9, identity: 0.719

atcccgcgtggcgctgccctctacctgcgcgg	CRISPR spacer
gccaaccacggcgctgcccgcaacctgcgcgg	Protospacer
..*   *..********** * **********

599. spacer 10.7|1603140|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP010738 (Phaeobacter inhibens strain P72 plasmid pP72_c, complete sequence) position: , mismatch: 9, identity: 0.719

atcccgcgtggcgctgccctctacctgcgcgg	CRISPR spacer
gccaaccacggcgctgcccgcaacctgcgcgg	Protospacer
..*   *..********** * **********

600. spacer 10.8|1603201|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NC_022590 (Brevibacterium sp. Ap13 plasmid pAP13, complete sequence) position: , mismatch: 9, identity: 0.719

tactggcgaacctgctggaggacctgtccgac	CRISPR spacer
tgttcccgaacctgctggaggaccagaccctt	Protospacer
*..*  ****************** * **  .

601. spacer 10.9|1603262|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP012477 (Arthrobacter sp. ERGS1:01 isolate water plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

tgcgcggccgccgccttgtttgcccacgtccc	CRISPR spacer
cacgcggccggcgccttgttcgccctggccta	Protospacer
..******** *********.****  *.*.

602. spacer 10.9|1603262|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_AP014705 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence) position: , mismatch: 9, identity: 0.719

tgcgcggccgccgccttgtttgcccacgtccc	CRISPR spacer
cgcgccgccgccgccttgttggccgagagagc	Protospacer
.**** ************** *** * .   *

603. spacer 11.1|1638373|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 9, identity: 0.719

tacgcatccacggcaagccgccgctgcgcgaa	CRISPR spacer
cgatgttcaacggcaagccgcagctgcgcgta	Protospacer
..    ** ************ ******** *

604. spacer 11.1|1638373|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NC_022995 (Burkholderia sp. M701 plasmid pM7012 DNA, complete sequence) position: , mismatch: 9, identity: 0.719

tacgcatccacggcaagccgccgctgcgcgaa	CRISPR spacer
tcggcatccacggcacgccgacgctgatctcc	Protospacer
*  ************ **** *****  *

605. spacer 11.1|1638373|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP024582 (Roseomonas sp. FDAARGOS_362 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

tacgcatccacggcaagccgccgctgcgcgaa	CRISPR spacer
ggaccatccacggccagccgccgccgcaggag	Protospacer
 .  ********** *********.**. **.

606. spacer 11.4|1638555|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to KX119197 (Helicobacter phage PtB92G, complete genome) position: , mismatch: 9, identity: 0.719

ttcttggcgttcatcgcttcagctccggcagg	CRISPR spacer
atcttggcgttgatcgcttccgctagcgcgta	Protospacer
 ********** ******** ***   **. .

607. spacer 11.4|1638555|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to KX119205 (Helicobacter phage DeM53M, complete genome) position: , mismatch: 9, identity: 0.719

ttcttggcgttcatcgcttcagctccggcagg	CRISPR spacer
atcttggcgtttatcgcttccgctaaagcgta	Protospacer
 **********.******** ***  .**. .

608. spacer 11.4|1638555|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to KX119189 (Helicobacter phage Pt21299RU, complete genome) position: , mismatch: 9, identity: 0.719

ttcttggcgttcatcgcttcagctccggcagg	CRISPR spacer
atcttggcgttcaacgcttccgctaaagaata	Protospacer
 ************ ****** ***  .* * .

609. spacer 11.5|1638616|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP030864 (Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

agggtgagcgggtccacggcgccggtgacgat	CRISPR spacer
cacgcctgcgggtccacggcgccggcgacggc	Protospacer
 . *.  ******************.****..

610. spacer 11.5|1638616|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP017759 (Cupriavidus necator strain NH9 plasmid pENH92, complete sequence) position: , mismatch: 9, identity: 0.719

agggtgagcgggtccacggcgccggtgacgat	CRISPR spacer
gcgccgagcaggttcacggcgccggtgaacag	Protospacer
. * .****.***.**************  *

611. spacer 11.5|1638616|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to JX182371 (Streptomyces phage SV1, complete genome) position: , mismatch: 9, identity: 0.719

agggtgagcgggtccacggcgccggtgacgat	CRISPR spacer
gtgagggtcgcgttcacggcgccggtgacgac	Protospacer
. *. *. ** **.*****************.

612. spacer 12.4|1645572|31|NC_014210|CRT matches to NZ_CP054616 (Azospirillum oryzae strain KACC 14407 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.71

acggcgtcaccgtgctcctggtcgatgccgc	CRISPR spacer
gcggcatcaccgtgctgctggtcgaacagaa	Protospacer
.****.********** ********    .

613. spacer 12.4|1645572|31|NC_014210|CRT matches to NC_013857 (Azospirillum sp. B510 plasmid pAB510c, complete sequence) position: , mismatch: 9, identity: 0.71

acggcgtcaccgtgctcctggtcgatgccgc	CRISPR spacer
tcggcggcaccgtgctgctggtcggcgggct	Protospacer
 ***** ********* *******..*   .

614. spacer 13.1|1662471|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032343 (Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence) position: , mismatch: 9, identity: 0.719

tccacgtcctgccccggcagcaagaactactc	CRISPR spacer
gacacgtcccgccccggcagcaggaaggtcaa	Protospacer
  *******.************.***   *

615. spacer 13.1|1662471|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP012917 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence) position: , mismatch: 9, identity: 0.719

tccacgtcctgccccggcagcaagaactactc	CRISPR spacer
gacacgtcccgccccggcagcaggaaggtcaa	Protospacer
  *******.************.***   *

616. spacer 13.3|1662593|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NC_006569 (Ruegeria pomeroyi DSS-3 megaplasmid, complete sequence) position: , mismatch: 9, identity: 0.719

cgctccagcccgaaaccctggctcgcgccgac	CRISPR spacer
gcgaccagcccgaaaccctggcgcgcggccta	Protospacer
    ****************** **** *

617. spacer 13.5|1662715|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP011515 (Mitsuaria sp. 7 plasmid, complete sequence) position: , mismatch: 9, identity: 0.719

ggcgccgacggcgacgactggtcgctctccaa	CRISPR spacer
cacgccgacggcgacgaccgggcgctgaaccg	Protospacer
 .****************.** ****   * .

618. spacer 13.5|1662715|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP031166 (Euzebya sp. DY32-46 plasmid pEDY32-46I, complete sequence) position: , mismatch: 9, identity: 0.719

ggcgccgacggcgacgactggtcgctctccaa	CRISPR spacer
cacaccgacggcgacgtctggtcgatcgacct	Protospacer
 .*.************ ******* **  *

619. spacer 13.6|1662776|32|NC_014210|CRISPRCasFinder,CRT matches to KT351734 (Pectobacterium carotovorum plasmid Drgb3, complete sequence) position: , mismatch: 9, identity: 0.719

gtgggtggggccgggcgggggaagtggaagcg	CRISPR spacer
tgtcttggggccgggcgggcggagtggaagaa	Protospacer
     ************** *.******** .

620. spacer 14.4|2013721|32|NC_014210|CRISPRCasFinder matches to MK864266 (Gordonia phage Arri, complete genome) position: , mismatch: 9, identity: 0.719

ttcaccccccggcgtccggtgacccgtgctcc	CRISPR spacer
cgcacccctcggcctccggtgacccgacgaac	Protospacer
. ******.**** ************     *

621. spacer 14.4|2013721|32|NC_014210|CRISPRCasFinder matches to MN284907 (Gordonia phage Fireball, complete genome) position: , mismatch: 9, identity: 0.719

ttcaccccccggcgtccggtgacccgtgctcc	CRISPR spacer
cgcacccctcggcctccggtgacccgacgaac	Protospacer
. ******.**** ************     *

622. spacer 14.4|2013721|32|NC_014210|CRISPRCasFinder matches to MK864264 (Gordonia phage VanDeWege, complete genome) position: , mismatch: 9, identity: 0.719

ttcaccccccggcgtccggtgacccgtgctcc	CRISPR spacer
cgcacccctcggcctccggtgacccgacgaac	Protospacer
. ******.**** ************     *

623. spacer 14.4|2013721|32|NC_014210|CRISPRCasFinder matches to MT639651 (Gordonia phage Portcullis, complete genome) position: , mismatch: 9, identity: 0.719

ttcaccccccggcgtccggtgacccgtgctcc	CRISPR spacer
cgcacccctcggcctccggtgacccgacgaac	Protospacer
. ******.**** ************     *

624. spacer 14.4|2013721|32|NC_014210|CRISPRCasFinder matches to MH479917 (Gordonia phage KimmyK, complete genome) position: , mismatch: 9, identity: 0.719

ttcaccccccggcgtccggtgacccgtgctcc	CRISPR spacer
cgcacccctcggcctccggtgacccgacgaac	Protospacer
. ******.**** ************     *

625. spacer 14.4|2013721|32|NC_014210|CRISPRCasFinder matches to MH669015 (Gordonia phage TillyBobJoe, complete genome) position: , mismatch: 9, identity: 0.719

ttcaccccccggcgtccggtgacccgtgctcc	CRISPR spacer
cgcacccctcggcctccggtgacccgacgaac	Protospacer
. ******.**** ************     *

626. spacer 14.4|2013721|32|NC_014210|CRISPRCasFinder matches to MK814761 (Gordonia phage SmokingBunny, complete genome) position: , mismatch: 9, identity: 0.719

ttcaccccccggcgtccggtgacccgtgctcc	CRISPR spacer
cgcacccctcggcctccggtgacccgacgaac	Protospacer
. ******.**** ************     *

627. spacer 14.4|2013721|32|NC_014210|CRISPRCasFinder matches to KX557286 (Gordonia phage Twister6, complete genome) position: , mismatch: 9, identity: 0.719

ttcaccccccggcgtccggtgacccgtgctcc	CRISPR spacer
cgcacccctcggcctccggtgacccgacgaac	Protospacer
. ******.**** ************     *

628. spacer 14.4|2013721|32|NC_014210|CRISPRCasFinder matches to MK864267 (Gordonia phage Valary, complete genome) position: , mismatch: 9, identity: 0.719

ttcaccccccggcgtccggtgacccgtgctcc	CRISPR spacer
cgcacccctcggcctccggtgacccgacgaac	Protospacer
. ******.**** ************     *

629. spacer 14.4|2013721|32|NC_014210|CRISPRCasFinder matches to MK967381 (Gordonia phage RogerDodger, complete genome) position: , mismatch: 9, identity: 0.719

ttcaccccccggcgtccggtgacccgtgctcc	CRISPR spacer
cgcacccctcggcctccggtgacccgacgaac	Protospacer
. ******.**** ************     *

630. spacer 14.4|2013721|32|NC_014210|CRISPRCasFinder matches to MT310872 (Gordonia phage Evamon, complete genome) position: , mismatch: 9, identity: 0.719

ttcaccccccggcgtccggtgacccgtgctcc	CRISPR spacer
cgcacccctcggcctccggtgacccgacgaac	Protospacer
. ******.**** ************     *

631. spacer 14.4|2013721|32|NC_014210|CRISPRCasFinder matches to NC_030913 (Gordonia phage Wizard, complete genome) position: , mismatch: 9, identity: 0.719

ttcaccccccggcgtccggtgacccgtgctcc	CRISPR spacer
cgcacccctcggcctccggtgacccgacgaac	Protospacer
. ******.**** ************     *

632. spacer 14.5|2013782|32|NC_014210|CRISPRCasFinder matches to NZ_LR594669 (Variovorax sp. SRS16 plasmid 4) position: , mismatch: 9, identity: 0.719

cgcacgtcgatgctccccgagacgcggcggga	CRISPR spacer
cttgggtcgatgctcgccaagacgcggccgag	Protospacer
* .. ********** **.********* *..

633. spacer 14.5|2013782|32|NC_014210|CRISPRCasFinder matches to NC_008308 (Sphingomonas sp. KA1 plasmid pCAR3 DNA, complete sequence) position: , mismatch: 9, identity: 0.719

cgcacgtcgatgctccccgagacgcggcggga	CRISPR spacer
agggggcggatgctccccgagaagcgtcgggc	Protospacer
 * . *. ************** *** ****

634. spacer 14.8|2013965|32|NC_014210|CRISPRCasFinder matches to CP023013 (Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gccatgctcgcgtccgagacccgcaagatcca	CRISPR spacer
aagccggtcgcggccgagatccgcaagatcga	Protospacer
.   .* ***** ******.********** *

635. spacer 14.8|2013965|32|NC_014210|CRISPRCasFinder matches to NZ_CP021763 (Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gccatgctcgcgtccgagacccgcaagatcca	CRISPR spacer
aagccggtcgcggccgagatccgcaagatcga	Protospacer
.   .* ***** ******.********** *

636. spacer 14.8|2013965|32|NC_014210|CRISPRCasFinder matches to NZ_CP015116 (Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gccatgctcgcgtccgagacccgcaagatcca	CRISPR spacer
aagccggtcgcggccgagatccgcaagatcga	Protospacer
.   .* ***** ******.********** *

637. spacer 14.8|2013965|32|NC_014210|CRISPRCasFinder matches to NZ_CP022783 (Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gccatgctcgcgtccgagacccgcaagatcca	CRISPR spacer
aagccggtcgcggccgagatccgcaagatcga	Protospacer
.   .* ***** ******.********** *

638. spacer 14.8|2013965|32|NC_014210|CRISPRCasFinder matches to NZ_CP022795 (Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gccatgctcgcgtccgagacccgcaagatcca	CRISPR spacer
aagccggtcgcggccgagatccgcaagatcga	Protospacer
.   .* ***** ******.********** *

639. spacer 14.8|2013965|32|NC_014210|CRISPRCasFinder matches to NZ_CP022482 (Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence) position: , mismatch: 9, identity: 0.719

gccatgctcgcgtccgagacccgcaagatcca	CRISPR spacer
aagccggtcgcggccgagatccgcaagatcga	Protospacer
.   .* ***** ******.********** *

640. spacer 14.8|2013965|32|NC_014210|CRISPRCasFinder matches to NZ_CP009763 (Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gccatgctcgcgtccgagacccgcaagatcca	CRISPR spacer
aagccggtcgcggccgagatccgcaagatcga	Protospacer
.   .* ***** ******.********** *

641. spacer 14.8|2013965|32|NC_014210|CRISPRCasFinder matches to CP023015 (Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gccatgctcgcgtccgagacccgcaagatcca	CRISPR spacer
aagccggtcgcggccgagatccgcaagatcga	Protospacer
.   .* ***** ******.********** *

642. spacer 14.8|2013965|32|NC_014210|CRISPRCasFinder matches to NZ_CP052111 (Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

gccatgctcgcgtccgagacccgcaagatcca	CRISPR spacer
aagccggtcgcggccgagatccgcaagatcga	Protospacer
.   .* ***** ******.********** *

643. spacer 14.8|2013965|32|NC_014210|CRISPRCasFinder matches to NZ_CP052113 (Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

gccatgctcgcgtccgagacccgcaagatcca	CRISPR spacer
aagccggtcgcggccgagatccgcaagatcga	Protospacer
.   .* ***** ******.********** *

644. spacer 14.9|2014026|32|NC_014210|CRISPRCasFinder matches to NZ_CP029452 (Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence) position: , mismatch: 9, identity: 0.719

gtgacgtcgtcgggcgtgtagagctcgcgctt	CRISPR spacer
atgacgtcgtcgggcgtgttgcgcaggtaggt	Protospacer
.****************** * **  *..  *

645. spacer 14.9|2014026|32|NC_014210|CRISPRCasFinder matches to NZ_CP023071 (Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence) position: , mismatch: 9, identity: 0.719

gtgacgtcgtcgggcgtgtagagctcgcgctt	CRISPR spacer
atgacgtcgtcgggcgtgttgcgcaggtaggt	Protospacer
.****************** * **  *..  *

646. spacer 14.18|2014575|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NC_016907 (Gordonia polyisoprenivorans VH2 plasmid p174, complete sequence) position: , mismatch: 9, identity: 0.719

gaggagttcgcctacgccatcgctgggtcggg	CRISPR spacer
gaggagttcgccgaagccatcgcaaatgaggc	Protospacer
************ * ******** ..   **

647. spacer 14.18|2014575|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MH590593 (Mycobacterium phage Rabinovish, complete genome) position: , mismatch: 9, identity: 0.719

gaggagttcgcctacgccatcgctgggtcggg	CRISPR spacer
gtccggttcgccttcgccatcgctgtgttcgc	Protospacer
*   .******** *********** **. *

648. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NZ_CP050082 (Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b4, complete sequence) position: , mismatch: 9, identity: 0.719

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
catcgccagccggacggttcctaccgcaatct	Protospacer
.*. ********* ****.********* . .

649. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NZ_CP049732 (Rhizobium leguminosarum strain A1 plasmid pRL11, complete sequence) position: , mismatch: 9, identity: 0.719

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
catcgccagccggacggttcctaccgcaatct	Protospacer
.*. ********* ****.********* . .

650. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NZ_CP054023 (Rhizobium sp. JKLM12A2 plasmid pPR12A202, complete sequence) position: , mismatch: 9, identity: 0.719

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
catcgccagccggacggttcctaccgcaatct	Protospacer
.*. ********* ****.********* . .

651. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NZ_CP053208 (Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1B, complete sequence) position: , mismatch: 9, identity: 0.719

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
catcgccagccggacggttcctaccgcaatct	Protospacer
.*. ********* ****.********* . .

652. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NZ_CP032324 (Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence) position: , mismatch: 9, identity: 0.719

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
gccggccagtcggtcggtcccttcccggtgga	Protospacer
  *******.************ **  .* *

653. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NZ_CP022366 (Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence) position: , mismatch: 9, identity: 0.719

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
gccggccagtcggtcggtcccttcccggtgga	Protospacer
  *******.************ **  .* *

654. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NZ_CP018230 (Rhizobium leguminosarum strain Vaf-108 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
catcgccagccggacggttcctaccgcgacct	Protospacer
.*. ********* ****.********. * .

655. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NZ_CP007797 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p4, complete sequence) position: , mismatch: 9, identity: 0.719

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
gccggccagtcggtcggtcccttcccggtgga	Protospacer
  *******.************ **  .* *

656. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NC_016624 (Azospirillum lipoferum 4B plasmid AZO_p5, complete sequence) position: , mismatch: 9, identity: 0.719

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
gccggccagtcggtcggtcccttcccggtgga	Protospacer
  *******.************ **  .* *

657. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NC_013859 (Azospirillum sp. B510 plasmid pAB510e, complete sequence) position: , mismatch: 9, identity: 0.719

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
gccggccagtcggtcggtcccttcccggtgga	Protospacer
  *******.************ **  .* *

658. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NZ_CP022566 (Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK02, complete sequence) position: , mismatch: 9, identity: 0.719

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
catcgccagccggacggttcctaccgcgacct	Protospacer
.*. ********* ****.********. * .

659. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NZ_CP032348 (Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence) position: , mismatch: 9, identity: 0.719

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
gccggccagtcggtcggtcccttcccggtgga	Protospacer
  *******.************ **  .* *

660. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MH051250 (Mycobacterium phage Coog, complete genome) position: , mismatch: 9, identity: 0.719

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
agaggccagccggtcggtcctgaccgaactgg	Protospacer
 . *****************. **** *..*

661. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MK494087 (Mycobacterium phage DBQu4n, complete genome) position: , mismatch: 9, identity: 0.719

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgaactgg	Protospacer
.. *****************. **** *..*

662. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to AP018480 (Mycobacterium virus D29 DNA, complete sequence) position: , mismatch: 9, identity: 0.719

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgaactgg	Protospacer
.. *****************. **** *..*

663. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MN617844 (Mycobacterium phage Bluefalcon, complete genome) position: , mismatch: 9, identity: 0.719

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgaactgg	Protospacer
.. *****************. **** *..*

664. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to KC787102 (Mycobacterium phage Chy1, partial genome) position: , mismatch: 9, identity: 0.719

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgaactgg	Protospacer
.. *****************. **** *..*

665. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MN586062 (Mycobacterium phage Lev2, complete genome) position: , mismatch: 9, identity: 0.719

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
agaggccagccggtcggtcctgaccgaactgg	Protospacer
 . *****************. **** *..*

666. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NC_001900 (Mycobacterium phage D29, complete genome) position: , mismatch: 9, identity: 0.719

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgaactgg	Protospacer
.. *****************. **** *..*

667. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NC_022973 (Mycobacterium phage Conspiracy, complete genome) position: , mismatch: 9, identity: 0.719

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
agaggccagccggtcggtcctgaccgaactgg	Protospacer
 . *****************. **** *..*

668. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MN586016 (Mycobacterium phage MarysWell, complete genome) position: , mismatch: 9, identity: 0.719

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgaactgg	Protospacer
.. *****************. **** *..*

669. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MH051256 (Mycobacterium phage Midas2, complete genome) position: , mismatch: 9, identity: 0.719

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
agaggccagccggtcggtcctgaccgaactgg	Protospacer
 . *****************. **** *..*

670. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to KF493882 (Mycobacterium phage Jovo, complete genome) position: , mismatch: 9, identity: 0.719

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
agaggccagccggtcggtcctgaccgaactgg	Protospacer
 . *****************. **** *..*

671. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to AF022214 (Mycobacterium virus D29, complete genome) position: , mismatch: 9, identity: 0.719

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgaactgg	Protospacer
.. *****************. **** *..*

672. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MN096372 (Mycobacterium phage Zolita, complete genome) position: , mismatch: 9, identity: 0.719

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgaactgg	Protospacer
.. *****************. **** *..*

673. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to KX897981 (Mycobacterium phage StarStuff, complete genome) position: , mismatch: 9, identity: 0.719

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgaactgg	Protospacer
.. *****************. **** *..*

674. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MN234169 (Mycobacterium phage Naji, complete genome) position: , mismatch: 9, identity: 0.719

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgaactgg	Protospacer
.. *****************. **** *..*

675. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MT310883 (Mycobacterium phage D32, complete genome) position: , mismatch: 9, identity: 0.719

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgaactgg	Protospacer
.. *****************. **** *..*

676. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NC_021318 (Mycobacterium phage Chy5, complete genome) position: , mismatch: 9, identity: 0.719

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgaactgg	Protospacer
.. *****************. **** *..*

677. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NC_041984 (Mycobacterium phage Tiger, complete genome) position: , mismatch: 9, identity: 0.719

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
agaggccagccggtcggtcctgaccgaactgg	Protospacer
 . *****************. **** *..*

678. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NC_021338 (Mycobacterium phage Chy4, complete genome) position: , mismatch: 9, identity: 0.719

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgaactgg	Protospacer
.. *****************. **** *..*

679. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NC_028960 (Mycobacterium phage Theia, complete genome) position: , mismatch: 9, identity: 0.719

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
agaggccagccggtcggtcctgaccgaactgg	Protospacer
 . *****************. **** *..*

680. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MG099944 (Mycobacterium phage ForGetIt, complete genome) position: , mismatch: 9, identity: 0.719

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
agaggccagccggtcggtcctgaccgaactgg	Protospacer
 . *****************. **** *..*

681. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MG099934 (Mycobacterium phage AgentM, complete genome) position: , mismatch: 9, identity: 0.719

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
agaggccagccggtcggtcctgaccgaactgg	Protospacer
 . *****************. **** *..*

682. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MN586039 (Mycobacterium phage Blinn1, complete genome) position: , mismatch: 9, identity: 0.719

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgaactgg	Protospacer
.. *****************. **** *..*

683. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to KX574455 (Mycobacterium phage Pomar16, complete genome) position: , mismatch: 9, identity: 0.719

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgaactgg	Protospacer
.. *****************. **** *..*

684. spacer 14.20|2014697|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NZ_CP033583 (Streptomyces sp. ADI95-16 plasmid pADI95-16b, complete sequence) position: , mismatch: 9, identity: 0.719

tgcgcggccacgtacccggcgaggtcgatcac	CRISPR spacer
acggcggcaacgtgcccggcgaggtcgggggc	Protospacer
   ***** ****.*************.  .*

685. spacer 14.20|2014697|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NC_012811 (Methylorubrum extorquens AM1 megaplasmid, complete sequence) position: , mismatch: 9, identity: 0.719

tgcgcggccacgtacccggcgaggtcgatcac	CRISPR spacer
gcctcggccacgtagccgccgaggtcgcgtcc	Protospacer
  * ********** *** ********  . *

686. spacer 14.20|2014697|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NZ_CP042998 (Aquisphaera giovannonii strain OJF2 plasmid pOJF2_1, complete sequence) position: , mismatch: 9, identity: 0.719

tgcgcggccacgtacccggcgaggtcgatcac	CRISPR spacer
tcgtcggcaacgtccccggcgaggtcgcggcc	Protospacer
*   **** **** *************    *

687. spacer 14.22|2014819|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MG872842 (Mycobacterium phage Scherzo, complete genome) position: , mismatch: 9, identity: 0.719

ccatcgacaggggcacacgccccgccgaccta---	CRISPR spacer
gcatcgacagcggcacacgct---ccggtctgtgg	Protospacer
 ********* *********.   ***..**.

688. spacer 14.22|2014819|32|NC_014210|CRISPRCasFinder,PILER-CR matches to KT285706 (Mycobacterium phage Pioneer, complete genome) position: , mismatch: 9, identity: 0.719

ccatcgacaggggcacacgccccgccgaccta---	CRISPR spacer
gcatcgacagcggcacacgct---ccggtctgtgg	Protospacer
 ********* *********.   ***..**.

689. spacer 14.22|2014819|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MN585978 (Mycobacterium phage Beemo, complete genome) position: , mismatch: 9, identity: 0.719

ccatcgacaggggcacacgccccgccgaccta---	CRISPR spacer
gcatcgacagcggcacacgct---ccggtctgtgg	Protospacer
 ********* *********.   ***..**.

690. spacer 14.22|2014819|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MG872840 (Mycobacterium phage Phonnegut, complete genome) position: , mismatch: 9, identity: 0.719

ccatcgacaggggcacacgccccgccgaccta---	CRISPR spacer
gcatcgacagcggcacacgct---ccggtctgtgg	Protospacer
 ********* *********.   ***..**.

691. spacer 14.23|2014880|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NZ_CP027239 (Dietzia sp. oral taxon 368 strain W5195 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

gccatcgcgatcgccgctgtcctgggcatgca	CRISPR spacer
gacatcgcgaccgccactgtcctggaccactg	Protospacer
* ********.****.*********.*   ..

692. spacer 14.23|2014880|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NC_005205 (Pseudomonas syringae pv. syringae A2 plasmid pPSR1, complete sequence) position: , mismatch: 9, identity: 0.719

gccatcgcgatcgccgctgtcctgggcatgca	CRISPR spacer
tttatgtcgatcgccgctgtgctgggcctgac	Protospacer
 ..**  ************* ****** **

693. spacer 14.24|2014941|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NZ_CP014514 (Frondihabitans sp. PAMC 28766 strain SR6 plasmid 1, complete sequence) position: , mismatch: 9, identity: 0.719

gcgacccccgctgacgctcccatcgtcgtctc	CRISPR spacer
atcggcggcgcggacgctcccgtcgtcgtctc	Protospacer
.. . *  *** *********.**********

694. spacer 14.24|2014941|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NZ_CP031166 (Euzebya sp. DY32-46 plasmid pEDY32-46I, complete sequence) position: , mismatch: 9, identity: 0.719

gcgacccccgctgacgctcccatcgtcgtctc	CRISPR spacer
ctgtgcaccgccgacgctctcatcgtcgtcga	Protospacer
 .*  * ****.*******.**********

695. spacer 14.25|2015002|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NZ_AP017656 (Sphingobium cloacae strain JCM 10874 plasmid pSCLO_2, complete sequence) position: , mismatch: 9, identity: 0.719

cccctccagcgcaagctgggcgtggacgctga	CRISPR spacer
aagccgcagcgcaagcggggcgaggacgcagc	Protospacer
   *. ********** ***** ****** *

696. spacer 14.25|2015002|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NZ_CP032326 (Azospirillum brasilense strain MTCC4035 plasmid p5, complete sequence) position: , mismatch: 9, identity: 0.719

cccctccagcgcaagctgggcgtggacgctga	CRISPR spacer
aagctccagggcaagctcggcgtggaatggga	Protospacer
   ****** ******* ********    **

697. spacer 14.26|2015063|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 9, identity: 0.719

atgatggtggtggcgttggacgccggggcggg	CRISPR spacer
gtgatggtggtggcgttcgccgccgccgtacc	Protospacer
.**************** * *****  *..

698. spacer 14.26|2015063|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NZ_CP029831 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed7, complete sequence) position: , mismatch: 9, identity: 0.719

atgatggtggtggcgttggacgccggggcggg	CRISPR spacer
gggctggtggcggcgctggacgccgggctcgc	Protospacer
. * ******.****.*********** . *

699. spacer 14.26|2015063|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NZ_CP054621 (Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence) position: , mismatch: 9, identity: 0.719

atgatggtggtggcgttggacgccggggcggg	CRISPR spacer
gccctgtcggtggcgctgggcgccggggcggc	Protospacer
..  ** .*******.***.***********

700. spacer 14.26|2015063|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NZ_CP045548 (Streptomyces sp. SYP-A7193 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atgatggtggtggcgttggacgccggggcggg	CRISPR spacer
gacaccggggtggcgctggacgccgggccggc	Protospacer
.  *. * *******.*********** ***

701. spacer 14.28|2015185|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NZ_CP021355 (Rhodococcus sp. S2-17 plasmid pRB98, complete sequence) position: , mismatch: 9, identity: 0.719

gccgtcagcgtggaactcagaggcgtatggga	CRISPR spacer
tcggtcagcgaggaactcagcggcgtgaccgc	Protospacer
 * ******* ********* *****.   *

702. spacer 14.29|2015246|32|NC_014210|CRISPRCasFinder matches to NZ_AP013104 (Bradyrhizobium elkanii USDA 61 plasmid pBel61, complete sequence) position: , mismatch: 9, identity: 0.719

cgggccatctgcatggcggcctcttcggcgac	CRISPR spacer
tgctccttctgcctggcggcctcttcgctcgc	Protospacer
.*  ** ***** ************** . .*

703. spacer 14.61|2013965|31|NC_014210|PILER-CR matches to CP023013 (Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

gccatgctcgcgtccgagacccgcaagatcc	CRISPR spacer
aagccggtcgcggccgagatccgcaagatcg	Protospacer
.   .* ***** ******.**********

704. spacer 14.61|2013965|31|NC_014210|PILER-CR matches to NZ_CP021763 (Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

gccatgctcgcgtccgagacccgcaagatcc	CRISPR spacer
aagccggtcgcggccgagatccgcaagatcg	Protospacer
.   .* ***** ******.**********

705. spacer 14.61|2013965|31|NC_014210|PILER-CR matches to NZ_CP015116 (Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

gccatgctcgcgtccgagacccgcaagatcc	CRISPR spacer
aagccggtcgcggccgagatccgcaagatcg	Protospacer
.   .* ***** ******.**********

706. spacer 14.61|2013965|31|NC_014210|PILER-CR matches to NZ_CP022783 (Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

gccatgctcgcgtccgagacccgcaagatcc	CRISPR spacer
aagccggtcgcggccgagatccgcaagatcg	Protospacer
.   .* ***** ******.**********

707. spacer 14.61|2013965|31|NC_014210|PILER-CR matches to NZ_CP022795 (Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

gccatgctcgcgtccgagacccgcaagatcc	CRISPR spacer
aagccggtcgcggccgagatccgcaagatcg	Protospacer
.   .* ***** ******.**********

708. spacer 14.61|2013965|31|NC_014210|PILER-CR matches to NZ_CP022482 (Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence) position: , mismatch: 9, identity: 0.71

gccatgctcgcgtccgagacccgcaagatcc	CRISPR spacer
aagccggtcgcggccgagatccgcaagatcg	Protospacer
.   .* ***** ******.**********

709. spacer 14.61|2013965|31|NC_014210|PILER-CR matches to NZ_CP009763 (Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

gccatgctcgcgtccgagacccgcaagatcc	CRISPR spacer
aagccggtcgcggccgagatccgcaagatcg	Protospacer
.   .* ***** ******.**********

710. spacer 14.61|2013965|31|NC_014210|PILER-CR matches to CP023015 (Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

gccatgctcgcgtccgagacccgcaagatcc	CRISPR spacer
aagccggtcgcggccgagatccgcaagatcg	Protospacer
.   .* ***** ******.**********

711. spacer 14.61|2013965|31|NC_014210|PILER-CR matches to NZ_CP052111 (Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.71

gccatgctcgcgtccgagacccgcaagatcc	CRISPR spacer
aagccggtcgcggccgagatccgcaagatcg	Protospacer
.   .* ***** ******.**********

712. spacer 14.61|2013965|31|NC_014210|PILER-CR matches to NZ_CP052113 (Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.71

gccatgctcgcgtccgagacccgcaagatcc	CRISPR spacer
aagccggtcgcggccgagatccgcaagatcg	Protospacer
.   .* ***** ******.**********

713. spacer 14.62|2014026|31|NC_014210|PILER-CR matches to NZ_CP007129 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence) position: , mismatch: 9, identity: 0.71

gtgacgtcgtcgggcgtgtagagctcgcgct	CRISPR spacer
cgcgcgtcgtcgggcgcgtagagctggccga	Protospacer
   .************.******** **

714. spacer 14.62|2014026|31|NC_014210|PILER-CR matches to NZ_CP032341 (Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence) position: , mismatch: 9, identity: 0.71

gtgacgtcgtcgggcgtgtagagctcgcgct	CRISPR spacer
cagcattcgtcgggcgtgtagaggtcgcaga	Protospacer
  *   ***************** ****.

715. spacer 14.62|2014026|31|NC_014210|PILER-CR matches to NZ_CP012916 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence) position: , mismatch: 9, identity: 0.71

gtgacgtcgtcgggcgtgtagagctcgcgct	CRISPR spacer
cagcattcgtcgggcgtgtagaggtcgcaga	Protospacer
  *   ***************** ****.

716. spacer 14.62|2014026|31|NC_014210|PILER-CR matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 9, identity: 0.71

gtgacgtcgtcgggcgtgtagagctcgcgct	CRISPR spacer
atgacgttgtcgggcgtgtcgagcgtggtgg	Protospacer
.******.*********** **** .*

717. spacer 14.62|2014026|31|NC_014210|PILER-CR matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 9, identity: 0.71

gtgacgtcgtcgggcgtgtagagctcgcgct	CRISPR spacer
atgacgttgtcgggcgtgtcgagcgtggtgg	Protospacer
.******.*********** **** .*

718. spacer 14.62|2014026|31|NC_014210|PILER-CR matches to NZ_CP029452 (Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence) position: , mismatch: 9, identity: 0.71

gtgacgtcgtcgggcgtgtagagctcgcgct	CRISPR spacer
atgacgtcgtcgggcgtgttgcgcaggtagg	Protospacer
.****************** * **  *..

719. spacer 14.62|2014026|31|NC_014210|PILER-CR matches to NZ_CP023071 (Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence) position: , mismatch: 9, identity: 0.71

gtgacgtcgtcgggcgtgtagagctcgcgct	CRISPR spacer
atgacgtcgtcgggcgtgttgcgcaggtagg	Protospacer
.****************** * **  *..

720. spacer 14.62|2014026|31|NC_014210|PILER-CR matches to NZ_CP029542 (Streptomyces sp. NEAU-S7GS2 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.71

gtgacgtcgtcgggcgtgtagagctcgcgct	CRISPR spacer
ccgggcaggtcgggcgtgtagtggtcgcgct	Protospacer
 .*.    ************* * *******

721. spacer 15.2|2020811|35|NC_014210|CRISPRCasFinder matches to MF417941 (Uncultured Caudovirales phage clone 7F_14, partial genome) position: , mismatch: 9, identity: 0.743

accgctgccggtggcggcggactgggtggcggtga	CRISPR spacer
gcaactgacggtggcggcgaactgggtggcgtcac	Protospacer
.* .*** ***********.*********** ..

722. spacer 15.2|2020811|35|NC_014210|CRISPRCasFinder matches to MF417869 (Uncultured Caudovirales phage clone 3S_4, partial genome) position: , mismatch: 9, identity: 0.743

accgctgccggtggcggcggactgggtggcggtga	CRISPR spacer
gcaactgacggtggcggcgaactgggtggcgtcac	Protospacer
.* .*** ***********.*********** ..

723. spacer 15.2|2020811|35|NC_014210|CRISPRCasFinder matches to MF417878 (Uncultured Caudovirales phage clone 8S_7, partial genome) position: , mismatch: 9, identity: 0.743

accgctgccggtggcggcggactgggtggcggtga	CRISPR spacer
gcaactgacggtggcggcgaactgggtggcgtcac	Protospacer
.* .*** ***********.*********** ..

724. spacer 15.2|2020811|35|NC_014210|CRISPRCasFinder matches to MF417876 (Uncultured Caudovirales phage clone 3F_6, partial genome) position: , mismatch: 9, identity: 0.743

accgctgccggtggcggcggactgggtggcggtga	CRISPR spacer
gcaactgacggtggcggcgaactgggtggcgtcac	Protospacer
.* .*** ***********.*********** ..

725. spacer 15.2|2020811|35|NC_014210|CRISPRCasFinder matches to MF417877 (Uncultured Caudovirales phage clone 9F_7, partial genome) position: , mismatch: 9, identity: 0.743

accgctgccggtggcggcggactgggtggcggtga	CRISPR spacer
gcaactgacggtggcggcgaactgggtggcgtcac	Protospacer
.* .*** ***********.*********** ..

726. spacer 15.2|2020811|35|NC_014210|CRISPRCasFinder matches to NZ_CP033582 (Streptomyces sp. ADI95-16 plasmid pADI95-16a, complete sequence) position: , mismatch: 9, identity: 0.743

accgctgccggtggcggcggactgggtggcggtga	CRISPR spacer
tacggcaccggtggcggcggagggggtggcggcgg	Protospacer
  ** ..**************  *********.*.

727. spacer 23.2|5555650|32|NC_014210|CRISPRCasFinder matches to NZ_CP039699 (Novosphingobium sp. ABRDHK2 plasmid pABRDHK234, complete sequence) position: , mismatch: 9, identity: 0.719

gccgtcaccaggttgcccacggtcgcgccgag	CRISPR spacer
cccgtcagcaggttgcccacgttccgctcggc	Protospacer
 ****** ************* **   .**.

728. spacer 23.2|5555650|32|NC_014210|CRISPRCasFinder matches to MN270889 (Ralstonia phage P-PSG-11, complete genome) position: , mismatch: 9, identity: 0.719

gccgtcaccaggttgcccacggtcgcgccgag	CRISPR spacer
ctccaaaggaggttgcccccggtcgtgccgag	Protospacer
 .*   *  ********* ******.******

729. spacer 23.2|5555650|32|NC_014210|CRISPRCasFinder matches to MN270890 (Ralstonia phage P-PSG-11-1, complete genome) position: , mismatch: 9, identity: 0.719

gccgtcaccaggttgcccacggtcgcgccgag	CRISPR spacer
ctccaaaggaggttgcccccggtcgtgccgag	Protospacer
 .*   *  ********* ******.******

730. spacer 23.2|5555650|32|NC_014210|CRISPRCasFinder matches to MN685189 (UNVERIFIED: Ralstonia phage vRsoP-WF2 genomic sequence) position: , mismatch: 9, identity: 0.719

gccgtcaccaggttgcccacggtcgcgccgag	CRISPR spacer
ctccaaaagaggttgcccccggtcgtgccgag	Protospacer
 .*   *  ********* ******.******

731. spacer 23.2|5555650|32|NC_014210|CRISPRCasFinder matches to MF979559 (Ralstonia phage DU_RP_I, complete genome) position: , mismatch: 9, identity: 0.719

gccgtcaccaggttgcccacggtcgcgccgag	CRISPR spacer
ctccaaaagaggttgcccccggtcgtgccgag	Protospacer
 .*   *  ********* ******.******

732. spacer 23.2|5555650|32|NC_014210|CRISPRCasFinder matches to MN685191 (UNVERIFIED: Ralstonia phage vRsoP-WR2 genomic sequence) position: , mismatch: 9, identity: 0.719

gccgtcaccaggttgcccacggtcgcgccgag	CRISPR spacer
ctccaaaagaggttgcccccggtcgtgccgag	Protospacer
 .*   *  ********* ******.******

733. spacer 23.2|5555650|32|NC_014210|CRISPRCasFinder matches to MN685190 (UNVERIFIED: Ralstonia phage vRsoP-WM2 genomic sequence) position: , mismatch: 9, identity: 0.719

gccgtcaccaggttgcccacggtcgcgccgag	CRISPR spacer
ctccaaaagaggttgcccccggtcgtgccgag	Protospacer
 .*   *  ********* ******.******

734. spacer 23.2|5555650|32|NC_014210|CRISPRCasFinder matches to NC_047946 (Ralstonia phage RsoP1EGY, complete genome) position: , mismatch: 9, identity: 0.719

gccgtcaccaggttgcccacggtcgcgccgag	CRISPR spacer
ctccaaaagaggttgcccccggtcgtgccgag	Protospacer
 .*   *  ********* ******.******

735. spacer 23.3|5555711|32|NC_014210|CRISPRCasFinder matches to NZ_CP032323 (Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence) position: , mismatch: 9, identity: 0.719

cagctggccgccctccaggcgcagacgcaggc	CRISPR spacer
ctgctggccgacctccaggcggagaccggcat	Protospacer
* ******** ********** ****  . ..

736. spacer 23.3|5555711|32|NC_014210|CRISPRCasFinder matches to NZ_CP019902 (Raoultella planticola strain GODA plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.719

cagctggccgccctccaggcgcagacgcaggc	CRISPR spacer
gaactggccgccctgcaggcgcaaacccgccg	Protospacer
 *.*********** ********.** *.

737. spacer 23.3|5555711|32|NC_014210|CRISPRCasFinder matches to NC_004929 (Ruegeria sp. PR1b plasmid pSD20, complete sequence) position: , mismatch: 9, identity: 0.719

cagctggccgccctccaggcgcagacgcaggc	CRISPR spacer
gagctggccgccgtcgaggcgcagctggggca	Protospacer
 *********** ** ******** .* .*

738. spacer 23.3|5555711|32|NC_014210|CRISPRCasFinder matches to NC_013855 (Azospirillum sp. B510 plasmid pAB510a, complete sequence) position: , mismatch: 9, identity: 0.719

cagctggccgccctccaggcgcagacgcaggc	CRISPR spacer
cgtttcctcgccctccaggcgcagcggcaggt	Protospacer
*. .*  .****************  *****.

739. spacer 23.3|5555711|32|NC_014210|CRISPRCasFinder matches to NZ_CP024314 (Rhizobium sp. NXC24 plasmid pRspNXC24c, complete sequence) position: , mismatch: 9, identity: 0.719

cagctggccgccctccaggcgcagacgcaggc	CRISPR spacer
gaactggccgccttcaaggcgcagaccaggaa	Protospacer
 *.*********.** **********  .*.

740. spacer 23.3|5555711|32|NC_014210|CRISPRCasFinder matches to NZ_CP022304 (Thalassococcus sp. S3 plasmid pS3A, complete sequence) position: , mismatch: 9, identity: 0.719

cagctggccgccctccaggcgcagacgcaggc	CRISPR spacer
atgctggccgccctcaacgcgcagatagacga	Protospacer
  ************* * *******.. * *

741. spacer 23.3|5555711|32|NC_014210|CRISPRCasFinder matches to NC_019307 (Streptomyces sp. W75 plasmid pCQ4, complete sequence) position: , mismatch: 9, identity: 0.719

cagctggccgccctccaggcgcagacgcaggc	CRISPR spacer
aagctggccgcccgccaggagcaggccgctac	Protospacer
 ************ ***** ****.*    .*

742. spacer 23.3|5555711|32|NC_014210|CRISPRCasFinder matches to JX100810 (Caulobacter phage CcrColossus, complete genome) position: , mismatch: 9, identity: 0.719

cagctggccgccctccaggcgcagacgcaggc	CRISPR spacer
atcgaggccgccctgcaagcgcagacgcgcgc	Protospacer
     ********* **.**********. **

743. spacer 23.4|5555772|32|NC_014210|CRISPRCasFinder matches to NZ_LR134451 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 9, complete sequence) position: , mismatch: 9, identity: 0.719

ctgcccacccagctcaccgcgccggacgcgga	CRISPR spacer
ggatcgtcccagcgcagcgcgccggacgcggc	Protospacer
  ..*  ****** ** **************

744. spacer 23.4|5555772|32|NC_014210|CRISPRCasFinder matches to NZ_CP049043 (Pseudohalocynthiibacter aestuariivivens strain RR4-35 plasmid pRR4-35_6, complete sequence) position: , mismatch: 9, identity: 0.719

ctgcccacccagctcaccgcgccggacgcgga	CRISPR spacer
agcgcggcccagctcagcgcgccggtcgcggt	Protospacer
    * .********* ******** *****

745. spacer 23.8|5555647|35|NC_014210|CRT matches to NZ_CP022417 (Sulfitobacter pseudonitzschiae strain SMR1 plasmid pSMR1-2, complete sequence) position: , mismatch: 9, identity: 0.743

cacgccgtcaccaggttgcccacggtcgcgccgag	CRISPR spacer
cgccagcgcaccagcttgcccacggtcgcgccgta	Protospacer
*.*     ****** ****************** .

746. spacer 23.9|5555708|35|NC_014210|CRT matches to NZ_CP035511 (Haematobacter massiliensis strain OT1 plasmid pOT1-1, complete sequence) position: , mismatch: 9, identity: 0.743

caccagctggccgccctccaggcgcagacgcaggc	CRISPR spacer
gaggatctggccgcccttcaggcgcagtcgctgaa	Protospacer
 *  * ***********.********* *** *.

747. spacer 23.9|5555708|35|NC_014210|CRT matches to NZ_CP054621 (Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence) position: , mismatch: 9, identity: 0.743

caccagctggccgccctccaggcgcagacgcaggc	CRISPR spacer
gagcagctggccgccccccaggcgcggaactcgtc	Protospacer
 * *************.********.**  . * *

748. spacer 23.11|5555830|35|NC_014210|CRT matches to MG592671 (Vibrio phage 2.275.O._10N.286.54.E11, partial genome) position: , mismatch: 9, identity: 0.743

aaccagcgcgccaagctcatcagtaacccgtcggc	CRISPR spacer
aactagcgcgccaagatcatcagtatagcctacac	Protospacer
***.*********** *********   * *  .*

749. spacer 23.14|5555648|35|NC_014210|PILER-CR matches to NZ_CP022417 (Sulfitobacter pseudonitzschiae strain SMR1 plasmid pSMR1-2, complete sequence) position: , mismatch: 9, identity: 0.743

cacgccgtcaccaggttgcccacggtcgcgccgag	CRISPR spacer
cgccagcgcaccagcttgcccacggtcgcgccgta	Protospacer
*.*     ****** ****************** .

750. spacer 23.15|5555709|35|NC_014210|PILER-CR matches to NZ_CP035511 (Haematobacter massiliensis strain OT1 plasmid pOT1-1, complete sequence) position: , mismatch: 9, identity: 0.743

caccagctggccgccctccaggcgcagacgcaggc	CRISPR spacer
gaggatctggccgcccttcaggcgcagtcgctgaa	Protospacer
 *  * ***********.********* *** *.

751. spacer 23.15|5555709|35|NC_014210|PILER-CR matches to NZ_CP054621 (Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence) position: , mismatch: 9, identity: 0.743

caccagctggccgccctccaggcgcagacgcaggc	CRISPR spacer
gagcagctggccgccccccaggcgcggaactcgtc	Protospacer
 * *************.********.**  . * *

752. spacer 23.17|5555831|35|NC_014210|PILER-CR matches to MG592671 (Vibrio phage 2.275.O._10N.286.54.E11, partial genome) position: , mismatch: 9, identity: 0.743

aaccagcgcgccaagctcatcagtaacccgtcggc	CRISPR spacer
aactagcgcgccaagatcatcagtatagcctacac	Protospacer
***.*********** *********   * *  .*

753. spacer 7.9|1581936|32|NC_014210|CRISPRCasFinder,CRT matches to NC_017958 (Tistrella mobilis KA081020-065 plasmid pTM3, complete sequence) position: , mismatch: 10, identity: 0.688

gacgacggggtcgctgctgctggccagggtgg	CRISPR spacer
aagcttggggtcgctgcggctggcccggggat	Protospacer
.*   .*********** ******* *** .

754. spacer 8.3|1587611|33|NC_014210|PILER-CR matches to NZ_LR134456 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 14, complete sequence) position: , mismatch: 10, identity: 0.697

cgccatcaacgccgccgcccgctccggtggtat	CRISPR spacer
catcatcagcgccgccgcccgcgccggcatgcg	Protospacer
*..*****.************* ****..

755. spacer 8.3|1587611|33|NC_014210|PILER-CR matches to NC_009717 (Xanthobacter autotrophicus Py2 plasmid pXAUT01, complete sequence) position: , mismatch: 10, identity: 0.697

cgccatcaacgccgccgcccgctccggtggtat	CRISPR spacer
caagctcaacgccgccgccggcttcggtgaccc	Protospacer
*.   ************** ***.*****.. .

756. spacer 8.7|1587855|33|NC_014210|PILER-CR matches to NC_012811 (Methylorubrum extorquens AM1 megaplasmid, complete sequence) position: , mismatch: 10, identity: 0.697

cccaggccgccgaccctcgcgcggcccgccacg	CRISPR spacer
gtgcggccgccgagactcgcgcggcccgggcgg	Protospacer
 .  *********  *************    *

757. spacer 8.9|1587977|33|NC_014210|PILER-CR matches to NZ_CP014519 (Sinomonas atrocyanea strain KCTC 3377 plasmid pSA01, complete sequence) position: , mismatch: 10, identity: 0.697

gcgggtccgaggtcggcgggcgggcggtcctcg	CRISPR spacer
ttctcgccgaggtcggcgggcacgcggtccggg	Protospacer
 .    ***************. *******  *

758. spacer 8.11|1588099|33|NC_014210|PILER-CR matches to NZ_CP018784 (Curtobacterium pusillum strain AA3 plasmid pCPAA3, complete sequence) position: , mismatch: 10, identity: 0.697

cgggaagcccaccggcaccgtccgcaaggtcgc	CRISPR spacer
caacgccaccgccggcaccgtccgcaaggccga	Protospacer
*.. .   **.******************.**

759. spacer 8.14|1587612|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP032324 (Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence) position: , mismatch: 10, identity: 0.688

gccatcaacgccgccgcccgctccggtggtat	CRISPR spacer
tgcagcagcgccgccgcccgctccgccaatcc	Protospacer
  ** **.***************** ...* .

760. spacer 8.14|1587612|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_LR134456 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 14, complete sequence) position: , mismatch: 10, identity: 0.688

gccatcaacgccgccgcccgctccggtggtat	CRISPR spacer
atcatcagcgccgccgcccgcgccggcatgcg	Protospacer
..*****.************* ****..

761. spacer 8.14|1587612|32|NC_014210|CRISPRCasFinder,CRT matches to NC_009717 (Xanthobacter autotrophicus Py2 plasmid pXAUT01, complete sequence) position: , mismatch: 10, identity: 0.688

gccatcaacgccgccgcccgctccggtggtat	CRISPR spacer
aagctcaacgccgccgccggcttcggtgaccc	Protospacer
.   ************** ***.*****.. .

762. spacer 8.16|1587734|32|NC_014210|CRISPRCasFinder,CRT matches to JN638751 (Bacillus phage G, complete genome) position: , mismatch: 10, identity: 0.688

cggtgcgtgaccggtgcgcccagatggtcgac	CRISPR spacer
atgaaaaggaccgttgcgccgagatggtcgaa	Protospacer
  * . . ***** ****** **********

763. spacer 8.22|1588100|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP018784 (Curtobacterium pusillum strain AA3 plasmid pCPAA3, complete sequence) position: , mismatch: 10, identity: 0.688

gggaagcccaccggcaccgtccgcaaggtcgc	CRISPR spacer
aacgccaccgccggcaccgtccgcaaggccga	Protospacer
.. .   **.******************.**

764. spacer 8.22|1588100|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_CP016620 (Microvirga ossetica strain V5/3m plasmid unnamed4, complete sequence) position: , mismatch: 10, identity: 0.688

gggaagcccaccggcaccgtccgcaaggtcgc	CRISPR spacer
accgacggcaccgacaccgtacgcaaggtcga	Protospacer
.  .*   *****.****** **********

765. spacer 9.7|1595426|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NC_017958 (Tistrella mobilis KA081020-065 plasmid pTM3, complete sequence) position: , mismatch: 10, identity: 0.688

gcggaccggcccacccggctggcgaccgtcgc	CRISPR spacer
aacagccggcgcacccagctggcgaccgttca	Protospacer
.  ..***** *****.************.

766. spacer 9.8|1595487|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to MT114166 (Microbacterium phage Nike, complete genome) position: , mismatch: 10, identity: 0.688

gccgtcgccgcctacgcgaccgccctcgggct	CRISPR spacer
cccctcgccgccaacgcgaccgcctacaacgc	Protospacer
 ** ******** ***********. *..  .

767. spacer 9.8|1595487|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NC_047975 (Microbacterium phage Squash, complete genome) position: , mismatch: 10, identity: 0.688

gccgtcgccgcctacgcgaccgccctcgggct	CRISPR spacer
cccctcgccgccaacgcgaccgcctacaacgc	Protospacer
 ** ******** ***********. *..  .

768. spacer 9.10|1595610|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP020385 (Rhodovulum sp. MB263 plasmid pRSMBA, complete sequence) position: , mismatch: 10, identity: 0.688

tcgatgaccgaggtcgacggcaccgggtcgga	CRISPR spacer
gcgatgaccgaggtcggcggcgccacccggcg	Protospacer
 ***************.****.**.  . * .

769. spacer 10.3|1602896|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to MN694036 (Marine virus AFVG_250M883, complete genome) position: , mismatch: 10, identity: 0.688

tcggacgcgggcgatgacttcttctgcgtctt	CRISPR spacer
gttcacgcgggcgatgactacctctgccgatg	Protospacer
 .  *************** *.*****   *

770. spacer 10.3|1602896|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to MN694324 (Marine virus AFVG_250M884, complete genome) position: , mismatch: 10, identity: 0.688

tcggacgcgggcgatgacttcttctgcgtctt	CRISPR spacer
gttcacgcgggcgatgactacctctgccgatg	Protospacer
 .  *************** *.*****   *

771. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NC_016623 (Azospirillum lipoferum 4B plasmid AZO_p3, complete sequence) position: , mismatch: 10, identity: 0.688

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
tggccgccggggcgtcgcggtggccgagatgg	Protospacer
.********** **.**********..  .

772. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NC_023286 (Streptomyces sp. F12 plasmid pFRL6, complete sequence) position: , mismatch: 10, identity: 0.688

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
gggccgccgggccgccggggaggcgacgatgc	Protospacer
 **************** ** *** *   . .

773. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 10, identity: 0.688

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
ggggcgcagggccgccgcggtggcggcgggca	Protospacer
 ** *** **************** .    *

774. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NC_013856 (Azospirillum sp. B510 plasmid pAB510b, complete sequence) position: , mismatch: 10, identity: 0.688

cggccgccgggccgccgcggtggccagctcct	CRISPR spacer
ctcgagccgggccgccgtggtcgccagcaaag	Protospacer
*    ************.*** ******

775. spacer 10.8|1603201|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032325 (Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence) position: , mismatch: 10, identity: 0.688

tactggcgaacctgctggaggacctgtccgac	CRISPR spacer
agatccttcacctgctggaggacctgcgcgac	Protospacer
 . *  .  *****************. ****

776. spacer 10.8|1603201|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP007796 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p3, complete sequence) position: , mismatch: 10, identity: 0.688

tactggcgaacctgctggaggacctgtccgac	CRISPR spacer
agatccttcacctgctggaggacctgcgcgac	Protospacer
 . *  .  *****************. ****

777. spacer 10.8|1603201|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032342 (Azospirillum brasilense strain MTCC4038 plasmid p3, complete sequence) position: , mismatch: 10, identity: 0.688

tactggcgaacctgctggaggacctgtccgac	CRISPR spacer
agatccttcacctgctggaggacctgcgcgac	Protospacer
 . *  .  *****************. ****

778. spacer 10.8|1603201|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP033321 (Azospirillum brasilense strain Cd plasmid p3, complete sequence) position: , mismatch: 10, identity: 0.688

tactggcgaacctgctggaggacctgtccgac	CRISPR spacer
agatccttcacctgctggaggacctgcgcgac	Protospacer
 . *  .  *****************. ****

779. spacer 10.8|1603201|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP033315 (Azospirillum brasilense strain Sp 7 plasmid p3, complete sequence) position: , mismatch: 10, identity: 0.688

tactggcgaacctgctggaggacctgtccgac	CRISPR spacer
agatccttcacctgctggaggacctgcgcgac	Protospacer
 . *  .  *****************. ****

780. spacer 10.10|1603323|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_LR594673 (Variovorax sp. PBL-E5 plasmid 3) position: , mismatch: 10, identity: 0.688

ggcagtggtgaggggctcgcccttcaggccaa	CRISPR spacer
atcgcaggtgaggggctcgtcctgcaggcatt	Protospacer
. *.  *************.*** *****

781. spacer 10.10|1603323|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP039640 (Azospirillum sp. TSH100 plasmid p1, complete sequence) position: , mismatch: 10, identity: 0.688

ggcagtggtgaggggctcgcccttcaggccaa	CRISPR spacer
atagatggtgatcggctcgcccttcagggcct	Protospacer
.  ..******  *************** *

782. spacer 11.1|1638373|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032688 (Rhizobium sp. CCGE531 plasmid pRCCGE531a, complete sequence) position: , mismatch: 10, identity: 0.688

tacgcatccacggcaagccgccgctgcgcgaa	CRISPR spacer
ggttcgtccacggcaactcgccgctgcgcacc	Protospacer
 .. *.********** .***********.

783. spacer 11.1|1638373|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032693 (Rhizobium sp. CCGE532 plasmid pRCCGE532a, complete sequence) position: , mismatch: 10, identity: 0.688

tacgcatccacggcaagccgccgctgcgcgaa	CRISPR spacer
ggttcgtccacggcaactcgccgctgcgcacc	Protospacer
 .. *.********** .***********.

784. spacer 11.1|1638373|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP006987 (Rhizobium sp. IE4771 plasmid pRetIE4771a, complete sequence) position: , mismatch: 10, identity: 0.688

tacgcatccacggcaagccgccgctgcgcgaa	CRISPR spacer
ggttcgtccacggcaactcgccgctgcgcacc	Protospacer
 .. *.********** .***********.

785. spacer 11.1|1638373|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013523 (Rhizobium phaseoli strain R744 plasmid pRphaR744a, complete sequence) position: , mismatch: 10, identity: 0.688

tacgcatccacggcaagccgccgctgcgcgaa	CRISPR spacer
ggttcgtccacggcaactcgccgctgcgcacc	Protospacer
 .. *.********** .***********.

786. spacer 11.1|1638373|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP017103 (Rhizobium gallicum strain IE4872 plasmid pRgalIE4872a, complete sequence) position: , mismatch: 10, identity: 0.688

tacgcatccacggcaagccgccgctgcgcgaa	CRISPR spacer
ggttcgtccacggcaactcgccgctgcgcacg	Protospacer
 .. *.********** .***********. .

787. spacer 11.1|1638373|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to CP006878 (Rhizobium gallicum bv. gallicum R602 plasmid pRgalR602a, complete sequence) position: , mismatch: 10, identity: 0.688

tacgcatccacggcaagccgccgctgcgcgaa	CRISPR spacer
ggttcgtccacggcaactcgccgctgcgcacg	Protospacer
 .. *.********** .***********. .

788. spacer 11.1|1638373|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP034999 (Rhizobium acidisoli strain FH23 plasmid pRapFH23a, complete sequence) position: , mismatch: 10, identity: 0.688

tacgcatccacggcaagccgccgctgcgcgaa	CRISPR spacer
ggttcgtccacggcaactcgccgctgcgcacc	Protospacer
 .. *.********** .***********.

789. spacer 11.1|1638373|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NC_022235 (Sphingomonas sp. ERG5 plasmid pCADAB1, complete sequence) position: , mismatch: 10, identity: 0.688

tacgcatccacggcaagccgccgctgcgcgaa	CRISPR spacer
ttgccatcaacggcgagccgccgctgccgctc	Protospacer
*   **** *****.************

790. spacer 11.5|1638616|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP025506 (Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvE, complete sequence) position: , mismatch: 10, identity: 0.688

agggtgagcgggtccacggcgccggtgacgat	CRISPR spacer
ttcaccctcggatccacggcgacggtgacgat	Protospacer
   ..   ***.********* **********

791. spacer 11.5|1638616|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022668 (Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR3, complete sequence) position: , mismatch: 10, identity: 0.688

agggtgagcgggtccacggcgccggtgacgat	CRISPR spacer
ttcaccctcggatccacggcgacggtgacgat	Protospacer
   ..   ***.********* **********

792. spacer 12.4|1645572|31|NC_014210|CRT matches to NZ_CP025431 (Paracoccus zhejiangensis strain J6 plasmid pPZ01, complete sequence) position: , mismatch: 10, identity: 0.677

acggcgtcaccgtgctcctggtcgatgccgc	CRISPR spacer
ttggggtcaccgtgctcttggtcgaacagaa	Protospacer
 .** ************.*******    .

793. spacer 13.1|1662471|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NC_017958 (Tistrella mobilis KA081020-065 plasmid pTM3, complete sequence) position: , mismatch: 10, identity: 0.688

tccacgtcctgccccggcagcaagaactactc	CRISPR spacer
agaccgtcctgcgccggcagcacgaacatcga	Protospacer
    ******** ********* ****  *

794. spacer 13.2|1662532|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP039340 (Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence) position: , mismatch: 10, identity: 0.688

accagaacgtgatccgcggcggcggcatcgtc	CRISPR spacer
tggacggcgtgatcgccggcggcggcatcggt	Protospacer
   * ..*******  ************** .

795. spacer 13.2|1662532|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_HG938356 (Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141 plasmid pHAMBI1141a, complete sequence) position: , mismatch: 10, identity: 0.688

accagaacgtgatccgcggcggcggcatcgtc	CRISPR spacer
gtttctacgagatcggcggcggcggcatcacc	Protospacer
...   *** **** **************..*

796. spacer 13.2|1662532|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP017563 (Paraburkholderia sprentiae WSM5005 plasmid pl1WSM5005, complete sequence) position: , mismatch: 10, identity: 0.688

accagaacgtgatccgcggcggcggcatcgtc	CRISPR spacer
tcatcgccgcgatccgcggcgccggcatcgcg	Protospacer
 *   . **.*********** ********.

797. spacer 13.4|1662654|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_AP022319 (Burkholderia sp. THE68 plasmid BTHE68_p1, complete sequence) position: , mismatch: 10, identity: 0.688

tcaccggtggccgacccttcctgcacgccatc	CRISPR spacer
ggctccgtgcccgaccattcctgcacgccgaa	Protospacer
   .* *** ****** ************.

798. spacer 13.5|1662715|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NC_008271 (Rhodococcus jostii RHA1 plasmid pRHL3, complete sequence) position: , mismatch: 10, identity: 0.688

ggcgccgacggcgacgactggtcgctctccaa	CRISPR spacer
ggcgccgacgtcgacgacttgtccgatgagga	Protospacer
********** ******** ***   .   .*

799. spacer 14.1|2013540|32|NC_014210|PILER-CR,CRISPRCasFinder matches to MN961671 (Pseudomonas aeruginosa strain 201330 plasmid p201330-IMP, complete sequence) position: , mismatch: 10, identity: 0.688

ggcagcaggtcctccagggaaccgccgccccg	CRISPR spacer
acggtcaggtcctccagggagacgccgcgctc	Protospacer
.  . ***************. ****** *.

800. spacer 14.1|2013540|32|NC_014210|PILER-CR,CRISPRCasFinder matches to MN961672 (Pseudomonas aeruginosa strain PA15W plasmid pPA15W-NR, complete sequence) position: , mismatch: 10, identity: 0.688

ggcagcaggtcctccagggaaccgccgccccg	CRISPR spacer
acggtcaggtcctccagggagacgccgcgctc	Protospacer
.  . ***************. ****** *.

801. spacer 14.4|2013721|32|NC_014210|CRISPRCasFinder matches to NC_011273 (Mycobacterium phage Myrna, complete genome) position: , mismatch: 10, identity: 0.688

ttcaccccccggcgtccggtgacccgtgctcc	CRISPR spacer
gtggtgccccggctgccggtgacccgtgccat	Protospacer
 * .. *******  **************. .

802. spacer 14.5|2013782|32|NC_014210|CRISPRCasFinder matches to NZ_CP013268 (Sphingobium baderi strain DE-13 plasmid pDE4, complete sequence) position: , mismatch: 10, identity: 0.688

cgcacgtcgatgctccccgagacgcggcggga	CRISPR spacer
ctcacgtcgatgccgcccgagacgccattctg	Protospacer
* ***********. ********** ..   .

803. spacer 14.8|2013965|32|NC_014210|CRISPRCasFinder matches to NZ_CP016613 (Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.688

gccatgctcgcgtccgagacccgcaagatcca	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcga	Protospacer
.   .  ***** ******.********** *

804. spacer 14.8|2013965|32|NC_014210|CRISPRCasFinder matches to NZ_CP049790 (Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

gccatgctcgcgtccgagacccgcaagatcca	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcga	Protospacer
.   .  ***** ******.********** *

805. spacer 14.8|2013965|32|NC_014210|CRISPRCasFinder matches to NZ_CP049794 (Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

gccatgctcgcgtccgagacccgcaagatcca	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcga	Protospacer
.   .  ***** ******.********** *

806. spacer 14.8|2013965|32|NC_014210|CRISPRCasFinder matches to NZ_CP049788 (Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

gccatgctcgcgtccgagacccgcaagatcca	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcga	Protospacer
.   .  ***** ******.********** *

807. spacer 14.8|2013965|32|NC_014210|CRISPRCasFinder matches to NZ_CP022766 (Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

gccatgctcgcgtccgagacccgcaagatcca	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcga	Protospacer
.   .  ***** ******.********** *

808. spacer 14.8|2013965|32|NC_014210|CRISPRCasFinder matches to NZ_CP016555 (Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence) position: , mismatch: 10, identity: 0.688

gccatgctcgcgtccgagacccgcaagatcca	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcga	Protospacer
.   .  ***** ******.********** *

809. spacer 14.8|2013965|32|NC_014210|CRISPRCasFinder matches to NZ_CP049792 (Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

gccatgctcgcgtccgagacccgcaagatcca	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcga	Protospacer
.   .  ***** ******.********** *

810. spacer 14.8|2013965|32|NC_014210|CRISPRCasFinder matches to NZ_CP052069 (Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.688

gccatgctcgcgtccgagacccgcaagatcca	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcga	Protospacer
.   .  ***** ******.********** *

811. spacer 14.8|2013965|32|NC_014210|CRISPRCasFinder matches to NZ_CP016915 (Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

gccatgctcgcgtccgagacccgcaagatcca	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcga	Protospacer
.   .  ***** ******.********** *

812. spacer 14.8|2013965|32|NC_014210|CRISPRCasFinder matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 10, identity: 0.688

gccatgctcgcgtccgagacccgcaagatcca	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcga	Protospacer
.   .  ***** ******.********** *

813. spacer 14.8|2013965|32|NC_014210|CRISPRCasFinder matches to NZ_CP022769 (Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

gccatgctcgcgtccgagacccgcaagatcca	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcga	Protospacer
.   .  ***** ******.********** *

814. spacer 14.8|2013965|32|NC_014210|CRISPRCasFinder matches to NZ_CP015851 (Ralstonia solanacearum strain YC40-M plasmid, complete sequence) position: , mismatch: 10, identity: 0.688

gccatgctcgcgtccgagacccgcaagatcca	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcga	Protospacer
.   .  ***** ******.********** *

815. spacer 14.8|2013965|32|NC_014210|CRISPRCasFinder matches to NZ_CP022773 (Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

gccatgctcgcgtccgagacccgcaagatcca	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcga	Protospacer
.   .  ***** ******.********** *

816. spacer 14.8|2013965|32|NC_014210|CRISPRCasFinder matches to NZ_CP052071 (Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.688

gccatgctcgcgtccgagacccgcaagatcca	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcga	Protospacer
.   .  ***** ******.********** *

817. spacer 14.8|2013965|32|NC_014210|CRISPRCasFinder matches to NZ_CP022779 (Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

gccatgctcgcgtccgagacccgcaagatcca	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcga	Protospacer
.   .  ***** ******.********** *

818. spacer 14.8|2013965|32|NC_014210|CRISPRCasFinder matches to NZ_CP052075 (Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.688

gccatgctcgcgtccgagacccgcaagatcca	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcga	Protospacer
.   .  ***** ******.********** *

819. spacer 14.8|2013965|32|NC_014210|CRISPRCasFinder matches to NZ_CP052085 (Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.688

gccatgctcgcgtccgagacccgcaagatcca	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcga	Protospacer
.   .  ***** ******.********** *

820. spacer 14.8|2013965|32|NC_014210|CRISPRCasFinder matches to NZ_CP052095 (Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.688

gccatgctcgcgtccgagacccgcaagatcca	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcga	Protospacer
.   .  ***** ******.********** *

821. spacer 14.8|2013965|32|NC_014210|CRISPRCasFinder matches to NZ_CP052105 (Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.688

gccatgctcgcgtccgagacccgcaagatcca	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcga	Protospacer
.   .  ***** ******.********** *

822. spacer 14.8|2013965|32|NC_014210|CRISPRCasFinder matches to NZ_CP052077 (Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.688

gccatgctcgcgtccgagacccgcaagatcca	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcga	Protospacer
.   .  ***** ******.********** *

823. spacer 14.8|2013965|32|NC_014210|CRISPRCasFinder matches to NZ_CP052087 (Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.688

gccatgctcgcgtccgagacccgcaagatcca	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcga	Protospacer
.   .  ***** ******.********** *

824. spacer 14.8|2013965|32|NC_014210|CRISPRCasFinder matches to NZ_CP052097 (Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.688

gccatgctcgcgtccgagacccgcaagatcca	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcga	Protospacer
.   .  ***** ******.********** *

825. spacer 14.8|2013965|32|NC_014210|CRISPRCasFinder matches to NZ_CP052115 (Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.688

gccatgctcgcgtccgagacccgcaagatcca	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcga	Protospacer
.   .  ***** ******.********** *

826. spacer 14.8|2013965|32|NC_014210|CRISPRCasFinder matches to NZ_CP052127 (Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.688

gccatgctcgcgtccgagacccgcaagatcca	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcga	Protospacer
.   .  ***** ******.********** *

827. spacer 14.8|2013965|32|NC_014210|CRISPRCasFinder matches to NZ_CP052079 (Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.688

gccatgctcgcgtccgagacccgcaagatcca	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcga	Protospacer
.   .  ***** ******.********** *

828. spacer 14.8|2013965|32|NC_014210|CRISPRCasFinder matches to NZ_CP052089 (Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.688

gccatgctcgcgtccgagacccgcaagatcca	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcga	Protospacer
.   .  ***** ******.********** *

829. spacer 14.8|2013965|32|NC_014210|CRISPRCasFinder matches to NZ_CP052093 (Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.688

gccatgctcgcgtccgagacccgcaagatcca	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcga	Protospacer
.   .  ***** ******.********** *

830. spacer 14.8|2013965|32|NC_014210|CRISPRCasFinder matches to NZ_CP052101 (Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.688

gccatgctcgcgtccgagacccgcaagatcca	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcga	Protospacer
.   .  ***** ******.********** *

831. spacer 14.8|2013965|32|NC_014210|CRISPRCasFinder matches to NZ_CP052099 (Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.688

gccatgctcgcgtccgagacccgcaagatcca	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcga	Protospacer
.   .  ***** ******.********** *

832. spacer 14.8|2013965|32|NC_014210|CRISPRCasFinder matches to NZ_CP052107 (Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.688

gccatgctcgcgtccgagacccgcaagatcca	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcga	Protospacer
.   .  ***** ******.********** *

833. spacer 14.8|2013965|32|NC_014210|CRISPRCasFinder matches to NZ_CP022781 (Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

gccatgctcgcgtccgagacccgcaagatcca	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcga	Protospacer
.   .  ***** ******.********** *

834. spacer 14.8|2013965|32|NC_014210|CRISPRCasFinder matches to NZ_CP052117 (Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.688

gccatgctcgcgtccgagacccgcaagatcca	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcga	Protospacer
.   .  ***** ******.********** *

835. spacer 14.8|2013965|32|NC_014210|CRISPRCasFinder matches to NZ_CP052125 (Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.688

gccatgctcgcgtccgagacccgcaagatcca	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcga	Protospacer
.   .  ***** ******.********** *

836. spacer 14.8|2013965|32|NC_014210|CRISPRCasFinder matches to NZ_CP022793 (Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

gccatgctcgcgtccgagacccgcaagatcca	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcga	Protospacer
.   .  ***** ******.********** *

837. spacer 14.8|2013965|32|NC_014210|CRISPRCasFinder matches to NZ_CP022785 (Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

gccatgctcgcgtccgagacccgcaagatcca	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcga	Protospacer
.   .  ***** ******.********** *

838. spacer 14.8|2013965|32|NC_014210|CRISPRCasFinder matches to NZ_CP022787 (Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

gccatgctcgcgtccgagacccgcaagatcca	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcga	Protospacer
.   .  ***** ******.********** *

839. spacer 14.8|2013965|32|NC_014210|CRISPRCasFinder matches to NZ_CP022756 (Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

gccatgctcgcgtccgagacccgcaagatcca	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcga	Protospacer
.   .  ***** ******.********** *

840. spacer 14.8|2013965|32|NC_014210|CRISPRCasFinder matches to NZ_CP052129 (Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.688

gccatgctcgcgtccgagacccgcaagatcca	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcga	Protospacer
.   .  ***** ******.********** *

841. spacer 14.8|2013965|32|NC_014210|CRISPRCasFinder matches to NZ_CP052121 (Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.688

gccatgctcgcgtccgagacccgcaagatcca	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcga	Protospacer
.   .  ***** ******.********** *

842. spacer 14.8|2013965|32|NC_014210|CRISPRCasFinder matches to NZ_CP052123 (Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.688

gccatgctcgcgtccgagacccgcaagatcca	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcga	Protospacer
.   .  ***** ******.********** *

843. spacer 14.8|2013965|32|NC_014210|CRISPRCasFinder matches to NZ_CP052131 (Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.688

gccatgctcgcgtccgagacccgcaagatcca	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcga	Protospacer
.   .  ***** ******.********** *

844. spacer 14.8|2013965|32|NC_014210|CRISPRCasFinder matches to NZ_CP052073 (Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.688

gccatgctcgcgtccgagacccgcaagatcca	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcga	Protospacer
.   .  ***** ******.********** *

845. spacer 14.8|2013965|32|NC_014210|CRISPRCasFinder matches to NZ_CP052081 (Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.688

gccatgctcgcgtccgagacccgcaagatcca	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcga	Protospacer
.   .  ***** ******.********** *

846. spacer 14.8|2013965|32|NC_014210|CRISPRCasFinder matches to NZ_CP052083 (Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.688

gccatgctcgcgtccgagacccgcaagatcca	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcga	Protospacer
.   .  ***** ******.********** *

847. spacer 14.8|2013965|32|NC_014210|CRISPRCasFinder matches to NZ_CP052109 (Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.688

gccatgctcgcgtccgagacccgcaagatcca	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcga	Protospacer
.   .  ***** ******.********** *

848. spacer 14.8|2013965|32|NC_014210|CRISPRCasFinder matches to NZ_CP052091 (Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.688

gccatgctcgcgtccgagacccgcaagatcca	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcga	Protospacer
.   .  ***** ******.********** *

849. spacer 14.8|2013965|32|NC_014210|CRISPRCasFinder matches to NZ_CP052103 (Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.688

gccatgctcgcgtccgagacccgcaagatcca	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcga	Protospacer
.   .  ***** ******.********** *

850. spacer 14.8|2013965|32|NC_014210|CRISPRCasFinder matches to NZ_CP052119 (Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.688

gccatgctcgcgtccgagacccgcaagatcca	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcga	Protospacer
.   .  ***** ******.********** *

851. spacer 14.9|2014026|32|NC_014210|CRISPRCasFinder matches to NZ_CP007129 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence) position: , mismatch: 10, identity: 0.688

gtgacgtcgtcgggcgtgtagagctcgcgctt	CRISPR spacer
cgcgcgtcgtcgggcgcgtagagctggccgac	Protospacer
   .************.******** **   .

852. spacer 14.9|2014026|32|NC_014210|CRISPRCasFinder matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 10, identity: 0.688

gtgacgtcgtcgggcgtgtagagctcgcgctt	CRISPR spacer
atgacgttgtcgggcgtgtcgagcgtggtgga	Protospacer
.******.*********** **** .*

853. spacer 14.9|2014026|32|NC_014210|CRISPRCasFinder matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 10, identity: 0.688

gtgacgtcgtcgggcgtgtagagctcgcgctt	CRISPR spacer
atgacgttgtcgggcgtgtcgagcgtggtgga	Protospacer
.******.*********** **** .*

854. spacer 14.9|2014026|32|NC_014210|CRISPRCasFinder matches to NZ_CP029542 (Streptomyces sp. NEAU-S7GS2 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.688

gtgacgtcgtcgggcgtgtagagctcgcgctt	CRISPR spacer
ccgggcaggtcgggcgtgtagtggtcgcgctg	Protospacer
 .*.    ************* * *******

855. spacer 14.12|2014209|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NZ_CP030829 (Neorhizobium sp. NCHU2750 plasmid pNCHU2750b, complete sequence) position: , mismatch: 10, identity: 0.688

atcccggccagccccctgctcaggttgccgct	CRISPR spacer
ttcccgaccagccgcctgctcaggggcatggg	Protospacer
 *****.****** **********    .*

856. spacer 14.14|2014331|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NZ_CP009619 (Vibrio coralliilyticus strain RE98 plasmid p380, complete sequence) position: , mismatch: 10, identity: 0.688

gctcagcccactgagggctgagaggtcaccgc	CRISPR spacer
caactacctactgagggctgagagctcactca	Protospacer
   * .**.*************** ****.

857. spacer 14.17|2014514|32|NC_014210|CRISPRCasFinder,PILER-CR matches to CP031285 (Escherichia fergusonii strain 40A plasmid p46_40A, complete sequence) position: , mismatch: 10, identity: 0.688

gggcgacagaccacccggctaccaaccgtgtc	CRISPR spacer
atcagtcagaccatacggctaccaaccgtaga	Protospacer
.   * *******. **************.

858. spacer 14.17|2014514|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NZ_CP022502 (Salmonella enterica subsp. enterica serovar Kentucky str. SA20030505 plasmid unnamed2, complete sequence) position: , mismatch: 10, identity: 0.688

gggcgacagaccacccggctaccaaccgtgtc	CRISPR spacer
atcagtcagaccatacggctaccaaccgtaga	Protospacer
.   * *******. **************.

859. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MG925355 (Mycobacterium phage OlanP, complete genome) position: , mismatch: 10, identity: 0.688

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagctgg	Protospacer
.. *****************. **** ...*

860. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to AP018479 (Mycobacterium phage GS4E DNA, complete sequence) position: , mismatch: 10, identity: 0.688

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagctgg	Protospacer
.. *****************. **** ...*

861. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NC_023606 (Mycobacterium phage CRB1, complete genome) position: , mismatch: 10, identity: 0.688

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagctgg	Protospacer
.. *****************. **** ...*

862. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to KX523125 (Mycobacterium phage BuzzBuzz, complete genome) position: , mismatch: 10, identity: 0.688

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagctgg	Protospacer
.. *****************. **** ...*

863. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MH047632 (Mycobacterium phage Puppy, complete genome) position: , mismatch: 10, identity: 0.688

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagctgg	Protospacer
.. *****************. **** ...*

864. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MK494094 (Mycobacterium phage DirtyDunning, complete genome) position: , mismatch: 10, identity: 0.688

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagctgg	Protospacer
.. *****************. **** ...*

865. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MT310878 (Mycobacterium phage MK4, complete genome) position: , mismatch: 10, identity: 0.688

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagctgg	Protospacer
.. *****************. **** ...*

866. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MH047633 (Mycobacterium phage Pistachio, complete genome) position: , mismatch: 10, identity: 0.688

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagctgg	Protospacer
.. *****************. **** ...*

867. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NC_028914 (Mycobacterium phage Sheen, complete genome) position: , mismatch: 10, identity: 0.688

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagctgg	Protospacer
.. *****************. **** ...*

868. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MF185729 (Mycobacterium phage KADY, complete genome) position: , mismatch: 10, identity: 0.688

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagctgg	Protospacer
.. *****************. **** ...*

869. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MH051259 (Mycobacterium phage TNguyen7, complete genome) position: , mismatch: 10, identity: 0.688

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagctgg	Protospacer
.. *****************. **** ...*

870. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MN096368 (Mycobacterium phage Soshari, complete genome) position: , mismatch: 10, identity: 0.688

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagctgg	Protospacer
.. *****************. **** ...*

871. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to KY204250 (Mycobacterium phage Kratark, complete genome) position: , mismatch: 10, identity: 0.688

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagctgg	Protospacer
.. *****************. **** ...*

872. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MN062706 (Mycobacterium phage Heathen, complete genome) position: , mismatch: 10, identity: 0.688

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagctgg	Protospacer
.. *****************. **** ...*

873. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NC_004682 (Mycobacterium virus Bxz2, complete genome) position: , mismatch: 10, identity: 0.688

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagctgg	Protospacer
.. *****************. **** ...*

874. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to KY464936 (Mycobacterium phage Idleandcovert, complete genome) position: , mismatch: 10, identity: 0.688

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagctgg	Protospacer
.. *****************. **** ...*

875. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MK433273 (Mycobacterium phage Daishi, complete genome) position: , mismatch: 10, identity: 0.688

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagctgg	Protospacer
.. *****************. **** ...*

876. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MH513984 (Mycobacterium phage Steamy, complete genome) position: , mismatch: 10, identity: 0.688

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagctgg	Protospacer
.. *****************. **** ...*

877. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to KM233455 (Mycobacterium phage Farber, complete genome) position: , mismatch: 10, identity: 0.688

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagctgg	Protospacer
.. *****************. **** ...*

878. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to KX670788 (Mycobacterium phage Louie6, complete genome) position: , mismatch: 10, identity: 0.688

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagctgg	Protospacer
.. *****************. **** ...*

879. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NC_042036 (Mycobacterium phage Rockstar, complete genome) position: , mismatch: 10, identity: 0.688

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagctgg	Protospacer
.. *****************. **** ...*

880. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MT658804 (Mycobacterium phage BengiVuitton, complete genome) position: , mismatch: 10, identity: 0.688

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagctgg	Protospacer
.. *****************. **** ...*

881. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MN586063 (Mycobacterium phage Isca, complete genome) position: , mismatch: 10, identity: 0.688

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagctgg	Protospacer
.. *****************. **** ...*

882. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MN585984 (Mycobacterium phage AgronaGT15, complete genome) position: , mismatch: 10, identity: 0.688

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagctgg	Protospacer
.. *****************. **** ...*

883. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NC_023597 (Mycobacterium phage 20ES, complete genome) position: , mismatch: 10, identity: 0.688

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagctgg	Protospacer
.. *****************. **** ...*

884. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MF140403 (Mycobacterium phage Changeling, complete genome) position: , mismatch: 10, identity: 0.688

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagctgg	Protospacer
.. *****************. **** ...*

885. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MK494093 (Mycobacterium phage Phighter1804, complete genome) position: , mismatch: 10, identity: 0.688

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagctgg	Protospacer
.. *****************. **** ...*

886. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NC_042328 (Mycobacterium virus HelDan, complete genome) position: , mismatch: 10, identity: 0.688

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagctgg	Protospacer
.. *****************. **** ...*

887. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MH513975 (Mycobacterium phage Misomonster, complete genome) position: , mismatch: 10, identity: 0.688

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagctgg	Protospacer
.. *****************. **** ...*

888. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MF373840 (Mycobacterium phage Fred313, complete genome) position: , mismatch: 10, identity: 0.688

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagctgg	Protospacer
.. *****************. **** ...*

889. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to KC172839 (Mycobacterium phage BTCU-1, complete genome) position: , mismatch: 10, identity: 0.688

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagctgg	Protospacer
.. *****************. **** ...*

890. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to KP017310 (Mycobacterium phage Phoxy, complete genome) position: , mismatch: 10, identity: 0.688

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagctgg	Protospacer
.. *****************. **** ...*

891. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to KT588442 (Mycobacterium phage LadyBird, complete genome) position: , mismatch: 10, identity: 0.688

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagctgg	Protospacer
.. *****************. **** ...*

892. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MT310886 (Mycobacterium phage AN3, complete genome) position: , mismatch: 10, identity: 0.688

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagctgg	Protospacer
.. *****************. **** ...*

893. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to JX899358 (Mycobacterium phage First, complete genome) position: , mismatch: 10, identity: 0.688

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagctgg	Protospacer
.. *****************. **** ...*

894. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to KJ510415 (Mycobacterium phage Phantastic, complete genome) position: , mismatch: 10, identity: 0.688

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagctgg	Protospacer
.. *****************. **** ...*

895. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NC_042339 (Mycobacterium virus Arturo, complete genome) position: , mismatch: 10, identity: 0.688

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagctgg	Protospacer
.. *****************. **** ...*

896. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MF472895 (Mycobacterium phage Kimona, complete genome) position: , mismatch: 10, identity: 0.688

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagctgg	Protospacer
.. *****************. **** ...*

897. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to KP017311 (Mycobacterium phage Spike509, complete genome) position: , mismatch: 10, identity: 0.688

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagctgg	Protospacer
.. *****************. **** ...*

898. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to KU761559 (Mycobacterium phage ArcherNM, complete genome) position: , mismatch: 10, identity: 0.688

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagctgg	Protospacer
.. *****************. **** ...*

899. spacer 14.23|2014880|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NZ_CP030263 (Ensifer adhaerens strain Corn53 plasmid AA, complete sequence) position: , mismatch: 10, identity: 0.688

gccatcgcgatcgccgctgtcctgggcatgca	CRISPR spacer
gtgatcgcgatcgtcgctgtgctggggcctgg	Protospacer
*. **********.****** *****  .  .

900. spacer 14.28|2015185|32|NC_014210|CRISPRCasFinder,PILER-CR matches to JF974300 (Synechococcus phage S-CBP42, *** SEQUENCING IN PROGRESS ***, 8 unordered pieces) position: , mismatch: 10, identity: 0.688

gccgtcagcgtggaactcagaggcgtatggga	CRISPR spacer
gaagtcaccgaggaactcagaggcgtggaact	Protospacer
*  **** ** ***************. ..

901. spacer 14.28|2015185|32|NC_014210|CRISPRCasFinder,PILER-CR matches to KC310805 (Synechococcus phage S-CBP42, complete genome) position: , mismatch: 10, identity: 0.688

gccgtcagcgtggaactcagaggcgtatggga	CRISPR spacer
gaagtcaccgaggaactcagaggcgtggaact	Protospacer
*  **** ** ***************. ..

902. spacer 14.29|2015246|32|NC_014210|CRISPRCasFinder matches to MN175386 (Klebsiella pneumoniae strain KP-13-14 plasmid pKP-13-14-NDM-9, complete sequence) position: , mismatch: 10, identity: 0.688

cgggccatctgcatggcggcctcttcggcgac	CRISPR spacer
atggccatctccacggcggcctctttatggct	Protospacer
  ******** **.***********..  * .

903. spacer 14.29|2015246|32|NC_014210|CRISPRCasFinder matches to NZ_CP035002 (Rhizobium acidisoli strain FH23 plasmid pRapFH23d, complete sequence) position: , mismatch: 10, identity: 0.688

cgggccatctgcatggcggcctcttcggcgac	CRISPR spacer
tcctccatctgcttggcagcctcttcgacatg	Protospacer
.   ******** ****.*********.*.

904. spacer 14.29|2015246|32|NC_014210|CRISPRCasFinder matches to MH697582 (Mycobacterium phage Ejimix, complete genome) position: , mismatch: 10, identity: 0.688

cgggccatctgcatggcggcctcttcggcgac	CRISPR spacer
tcgtagatctccatggcggcatcttcggccga	Protospacer
. *   **** ********* ******** .

905. spacer 14.29|2015246|32|NC_014210|CRISPRCasFinder matches to MF919504 (Mycobacterium phage DmpstrDiver, complete genome) position: , mismatch: 10, identity: 0.688

cgggccatctgcatggcggcctcttcggcgac	CRISPR spacer
tcgtagatctccatggcggcatcttcggccga	Protospacer
. *   **** ********* ******** .

906. spacer 14.29|2015246|32|NC_014210|CRISPRCasFinder matches to MH077579 (Mycobacterium phage Halley, complete genome) position: , mismatch: 10, identity: 0.688

cgggccatctgcatggcggcctcttcggcgac	CRISPR spacer
tcgtagatctccatggcggcatcttcggccga	Protospacer
. *   **** ********* ******** .

907. spacer 14.29|2015246|32|NC_014210|CRISPRCasFinder matches to MK524521 (Mycobacterium phage Schatzie, complete genome) position: , mismatch: 10, identity: 0.688

cgggccatctgcatggcggcctcttcggcgac	CRISPR spacer
tcgtagatctccatggcggcatcttcggccga	Protospacer
. *   **** ********* ******** .

908. spacer 14.29|2015246|32|NC_014210|CRISPRCasFinder matches to MN062701 (Mycobacterium phage Dallas, complete genome) position: , mismatch: 10, identity: 0.688

cgggccatctgcatggcggcctcttcggcgac	CRISPR spacer
tcgtagatctccatggcggcatcttcggccga	Protospacer
. *   **** ********* ******** .

909. spacer 14.61|2013965|31|NC_014210|PILER-CR matches to NZ_CP016613 (Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.677

gccatgctcgcgtccgagacccgcaagatcc	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcg	Protospacer
.   .  ***** ******.**********

910. spacer 14.61|2013965|31|NC_014210|PILER-CR matches to NZ_CP049790 (Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.677

gccatgctcgcgtccgagacccgcaagatcc	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcg	Protospacer
.   .  ***** ******.**********

911. spacer 14.61|2013965|31|NC_014210|PILER-CR matches to NZ_CP049794 (Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.677

gccatgctcgcgtccgagacccgcaagatcc	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcg	Protospacer
.   .  ***** ******.**********

912. spacer 14.61|2013965|31|NC_014210|PILER-CR matches to NZ_CP049788 (Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.677

gccatgctcgcgtccgagacccgcaagatcc	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcg	Protospacer
.   .  ***** ******.**********

913. spacer 14.61|2013965|31|NC_014210|PILER-CR matches to NZ_CP022766 (Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.677

gccatgctcgcgtccgagacccgcaagatcc	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcg	Protospacer
.   .  ***** ******.**********

914. spacer 14.61|2013965|31|NC_014210|PILER-CR matches to NZ_CP016555 (Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence) position: , mismatch: 10, identity: 0.677

gccatgctcgcgtccgagacccgcaagatcc	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcg	Protospacer
.   .  ***** ******.**********

915. spacer 14.61|2013965|31|NC_014210|PILER-CR matches to NZ_CP049792 (Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.677

gccatgctcgcgtccgagacccgcaagatcc	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcg	Protospacer
.   .  ***** ******.**********

916. spacer 14.61|2013965|31|NC_014210|PILER-CR matches to NZ_CP052069 (Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.677

gccatgctcgcgtccgagacccgcaagatcc	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcg	Protospacer
.   .  ***** ******.**********

917. spacer 14.61|2013965|31|NC_014210|PILER-CR matches to NZ_CP016915 (Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.677

gccatgctcgcgtccgagacccgcaagatcc	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcg	Protospacer
.   .  ***** ******.**********

918. spacer 14.61|2013965|31|NC_014210|PILER-CR matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 10, identity: 0.677

gccatgctcgcgtccgagacccgcaagatcc	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcg	Protospacer
.   .  ***** ******.**********

919. spacer 14.61|2013965|31|NC_014210|PILER-CR matches to NZ_CP022769 (Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.677

gccatgctcgcgtccgagacccgcaagatcc	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcg	Protospacer
.   .  ***** ******.**********

920. spacer 14.61|2013965|31|NC_014210|PILER-CR matches to NZ_CP015851 (Ralstonia solanacearum strain YC40-M plasmid, complete sequence) position: , mismatch: 10, identity: 0.677

gccatgctcgcgtccgagacccgcaagatcc	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcg	Protospacer
.   .  ***** ******.**********

921. spacer 14.61|2013965|31|NC_014210|PILER-CR matches to NZ_CP022773 (Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.677

gccatgctcgcgtccgagacccgcaagatcc	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcg	Protospacer
.   .  ***** ******.**********

922. spacer 14.61|2013965|31|NC_014210|PILER-CR matches to NZ_CP052071 (Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.677

gccatgctcgcgtccgagacccgcaagatcc	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcg	Protospacer
.   .  ***** ******.**********

923. spacer 14.61|2013965|31|NC_014210|PILER-CR matches to NZ_CP022779 (Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.677

gccatgctcgcgtccgagacccgcaagatcc	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcg	Protospacer
.   .  ***** ******.**********

924. spacer 14.61|2013965|31|NC_014210|PILER-CR matches to NZ_CP052075 (Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.677

gccatgctcgcgtccgagacccgcaagatcc	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcg	Protospacer
.   .  ***** ******.**********

925. spacer 14.61|2013965|31|NC_014210|PILER-CR matches to NZ_CP052085 (Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.677

gccatgctcgcgtccgagacccgcaagatcc	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcg	Protospacer
.   .  ***** ******.**********

926. spacer 14.61|2013965|31|NC_014210|PILER-CR matches to NZ_CP052095 (Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.677

gccatgctcgcgtccgagacccgcaagatcc	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcg	Protospacer
.   .  ***** ******.**********

927. spacer 14.61|2013965|31|NC_014210|PILER-CR matches to NZ_CP052105 (Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.677

gccatgctcgcgtccgagacccgcaagatcc	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcg	Protospacer
.   .  ***** ******.**********

928. spacer 14.61|2013965|31|NC_014210|PILER-CR matches to NZ_CP052077 (Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.677

gccatgctcgcgtccgagacccgcaagatcc	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcg	Protospacer
.   .  ***** ******.**********

929. spacer 14.61|2013965|31|NC_014210|PILER-CR matches to NZ_CP052087 (Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.677

gccatgctcgcgtccgagacccgcaagatcc	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcg	Protospacer
.   .  ***** ******.**********

930. spacer 14.61|2013965|31|NC_014210|PILER-CR matches to NZ_CP052097 (Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.677

gccatgctcgcgtccgagacccgcaagatcc	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcg	Protospacer
.   .  ***** ******.**********

931. spacer 14.61|2013965|31|NC_014210|PILER-CR matches to NZ_CP052115 (Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.677

gccatgctcgcgtccgagacccgcaagatcc	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcg	Protospacer
.   .  ***** ******.**********

932. spacer 14.61|2013965|31|NC_014210|PILER-CR matches to NZ_CP052127 (Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.677

gccatgctcgcgtccgagacccgcaagatcc	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcg	Protospacer
.   .  ***** ******.**********

933. spacer 14.61|2013965|31|NC_014210|PILER-CR matches to NZ_CP052079 (Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.677

gccatgctcgcgtccgagacccgcaagatcc	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcg	Protospacer
.   .  ***** ******.**********

934. spacer 14.61|2013965|31|NC_014210|PILER-CR matches to NZ_CP052089 (Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.677

gccatgctcgcgtccgagacccgcaagatcc	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcg	Protospacer
.   .  ***** ******.**********

935. spacer 14.61|2013965|31|NC_014210|PILER-CR matches to NZ_CP052093 (Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.677

gccatgctcgcgtccgagacccgcaagatcc	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcg	Protospacer
.   .  ***** ******.**********

936. spacer 14.61|2013965|31|NC_014210|PILER-CR matches to NZ_CP052101 (Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.677

gccatgctcgcgtccgagacccgcaagatcc	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcg	Protospacer
.   .  ***** ******.**********

937. spacer 14.61|2013965|31|NC_014210|PILER-CR matches to NZ_CP052099 (Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.677

gccatgctcgcgtccgagacccgcaagatcc	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcg	Protospacer
.   .  ***** ******.**********

938. spacer 14.61|2013965|31|NC_014210|PILER-CR matches to NZ_CP052107 (Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.677

gccatgctcgcgtccgagacccgcaagatcc	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcg	Protospacer
.   .  ***** ******.**********

939. spacer 14.61|2013965|31|NC_014210|PILER-CR matches to NZ_CP022781 (Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.677

gccatgctcgcgtccgagacccgcaagatcc	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcg	Protospacer
.   .  ***** ******.**********

940. spacer 14.61|2013965|31|NC_014210|PILER-CR matches to NZ_CP052117 (Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.677

gccatgctcgcgtccgagacccgcaagatcc	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcg	Protospacer
.   .  ***** ******.**********

941. spacer 14.61|2013965|31|NC_014210|PILER-CR matches to NZ_CP052125 (Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.677

gccatgctcgcgtccgagacccgcaagatcc	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcg	Protospacer
.   .  ***** ******.**********

942. spacer 14.61|2013965|31|NC_014210|PILER-CR matches to NZ_CP022793 (Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.677

gccatgctcgcgtccgagacccgcaagatcc	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcg	Protospacer
.   .  ***** ******.**********

943. spacer 14.61|2013965|31|NC_014210|PILER-CR matches to NZ_CP022785 (Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.677

gccatgctcgcgtccgagacccgcaagatcc	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcg	Protospacer
.   .  ***** ******.**********

944. spacer 14.61|2013965|31|NC_014210|PILER-CR matches to NZ_CP022787 (Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.677

gccatgctcgcgtccgagacccgcaagatcc	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcg	Protospacer
.   .  ***** ******.**********

945. spacer 14.61|2013965|31|NC_014210|PILER-CR matches to NZ_CP022756 (Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.677

gccatgctcgcgtccgagacccgcaagatcc	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcg	Protospacer
.   .  ***** ******.**********

946. spacer 14.61|2013965|31|NC_014210|PILER-CR matches to NZ_CP052129 (Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.677

gccatgctcgcgtccgagacccgcaagatcc	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcg	Protospacer
.   .  ***** ******.**********

947. spacer 14.61|2013965|31|NC_014210|PILER-CR matches to NZ_CP052121 (Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.677

gccatgctcgcgtccgagacccgcaagatcc	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcg	Protospacer
.   .  ***** ******.**********

948. spacer 14.61|2013965|31|NC_014210|PILER-CR matches to NZ_CP052123 (Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.677

gccatgctcgcgtccgagacccgcaagatcc	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcg	Protospacer
.   .  ***** ******.**********

949. spacer 14.61|2013965|31|NC_014210|PILER-CR matches to NZ_CP052131 (Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.677

gccatgctcgcgtccgagacccgcaagatcc	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcg	Protospacer
.   .  ***** ******.**********

950. spacer 14.61|2013965|31|NC_014210|PILER-CR matches to NZ_CP052073 (Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.677

gccatgctcgcgtccgagacccgcaagatcc	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcg	Protospacer
.   .  ***** ******.**********

951. spacer 14.61|2013965|31|NC_014210|PILER-CR matches to NZ_CP052081 (Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.677

gccatgctcgcgtccgagacccgcaagatcc	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcg	Protospacer
.   .  ***** ******.**********

952. spacer 14.61|2013965|31|NC_014210|PILER-CR matches to NZ_CP052083 (Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.677

gccatgctcgcgtccgagacccgcaagatcc	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcg	Protospacer
.   .  ***** ******.**********

953. spacer 14.61|2013965|31|NC_014210|PILER-CR matches to NZ_CP052109 (Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.677

gccatgctcgcgtccgagacccgcaagatcc	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcg	Protospacer
.   .  ***** ******.**********

954. spacer 14.61|2013965|31|NC_014210|PILER-CR matches to NZ_CP052091 (Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.677

gccatgctcgcgtccgagacccgcaagatcc	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcg	Protospacer
.   .  ***** ******.**********

955. spacer 14.61|2013965|31|NC_014210|PILER-CR matches to NZ_CP052103 (Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.677

gccatgctcgcgtccgagacccgcaagatcc	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcg	Protospacer
.   .  ***** ******.**********

956. spacer 14.61|2013965|31|NC_014210|PILER-CR matches to NZ_CP052119 (Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence) position: , mismatch: 10, identity: 0.677

gccatgctcgcgtccgagacccgcaagatcc	CRISPR spacer
aaacccgtcgcggccgagatccgcaagatcg	Protospacer
.   .  ***** ******.**********

957. spacer 23.3|5555711|32|NC_014210|CRISPRCasFinder matches to NZ_CP032326 (Azospirillum brasilense strain MTCC4035 plasmid p5, complete sequence) position: , mismatch: 10, identity: 0.688

cagctggccgccctccaggcgcagacgcaggc	CRISPR spacer
gagctggccgccctccaggaggaggcatccct	Protospacer
 ****************** * **.*..   .

958. spacer 23.3|5555711|32|NC_014210|CRISPRCasFinder matches to LN997843 (Streptomyces reticuli genome assembly TUE45, plasmid : II) position: , mismatch: 10, identity: 0.688

cagctggccgccctccaggcgcagacgcaggc	CRISPR spacer
gccccggccggcctcctggcgcagacgcccct	Protospacer
   *.***** ***** ***********   .

959. spacer 23.4|5555772|32|NC_014210|CRISPRCasFinder matches to NZ_CP034812 (Paracoccus sp. Arc7-R13 plasmid unnamed3, complete sequence) position: , mismatch: 10, identity: 0.688

ctgcccacccagctcaccgcgccggacgcgga	CRISPR spacer
gatcttgatcagatcaccgcgccggccgcgga	Protospacer
   *... .*** ************ ******

960. spacer 23.4|5555772|32|NC_014210|CRISPRCasFinder matches to NZ_CP034812 (Paracoccus sp. Arc7-R13 plasmid unnamed3, complete sequence) position: , mismatch: 10, identity: 0.688

ctgcccacccagctcaccgcgccggacgcgga	CRISPR spacer
gatcttgatcagatcaccgcgccggccgcgga	Protospacer
   *... .*** ************ ******

961. spacer 23.9|5555708|35|NC_014210|CRT matches to NZ_CP011627 (Klebsiella oxytoca strain CAV1374 plasmid pCAV1374-14, complete sequence) position: , mismatch: 10, identity: 0.714

caccagctggccgccctccaggcgcagacgcaggc	CRISPR spacer
gccgagctggccgccctgcaggcgcagacctgccg	Protospacer
  * ************* *********** ..

962. spacer 23.15|5555709|35|NC_014210|PILER-CR matches to NZ_CP011627 (Klebsiella oxytoca strain CAV1374 plasmid pCAV1374-14, complete sequence) position: , mismatch: 10, identity: 0.714

caccagctggccgccctccaggcgcagacgcaggc	CRISPR spacer
gccgagctggccgccctgcaggcgcagacctgccg	Protospacer
  * ************* *********** ..

963. spacer 7.4|1581993|36|NC_014210|PILER-CR matches to NZ_CP006368 (Aureimonas sp. AU20 plasmid pAU20a, complete sequence) position: , mismatch: 11, identity: 0.694

tccgatcctcctgccgccgccctgggacgcgatgag	CRISPR spacer
ctcgatcctcctgccgacgccctggtacttcaacca	Protospacer
..************** ******** ** . *   .

964. spacer 8.12|1587490|32|NC_014210|CRISPRCasFinder,CRT matches to MK095207 (Pectobacterium phage Nobby_B3, complete genome) position: , mismatch: 11, identity: 0.656

aaggccacccactgctggcaggacccgcgcac	CRISPR spacer
cttatcacccacttctggcaggaccagcaacg	Protospacer
   ..******** *********** **.

965. spacer 8.12|1587490|32|NC_014210|CRISPRCasFinder,CRT matches to MK095208 (Pectobacterium phage Nobby_B4, complete genome) position: , mismatch: 11, identity: 0.656

aaggccacccactgctggcaggacccgcgcac	CRISPR spacer
cttatcacccacttctggcaggaccagcaacg	Protospacer
   ..******** *********** **.

966. spacer 8.12|1587490|32|NC_014210|CRISPRCasFinder,CRT matches to MK095192 (Pectobacterium phage Astalicious, complete genome) position: , mismatch: 11, identity: 0.656

aaggccacccactgctggcaggacccgcgcac	CRISPR spacer
cttatcacccacttctggcaggaccagcaacg	Protospacer
   ..******** *********** **.

967. spacer 8.12|1587490|32|NC_014210|CRISPRCasFinder,CRT matches to MK095205 (Pectobacterium phage Nobby_B1, complete genome) position: , mismatch: 11, identity: 0.656

aaggccacccactgctggcaggacccgcgcac	CRISPR spacer
cttatcacccacttctggcaggaccagcaacg	Protospacer
   ..******** *********** **.

968. spacer 8.12|1587490|32|NC_014210|CRISPRCasFinder,CRT matches to MH807819 (Pectobacterium phage Slant, complete genome) position: , mismatch: 11, identity: 0.656

aaggccacccactgctggcaggacccgcgcac	CRISPR spacer
cttatcacccacttctggcaggaccagcaacg	Protospacer
   ..******** *********** **.

969. spacer 8.12|1587490|32|NC_014210|CRISPRCasFinder,CRT matches to MK095206 (Pectobacterium phage Nobby_B2, complete genome) position: , mismatch: 11, identity: 0.656

aaggccacccactgctggcaggacccgcgcac	CRISPR spacer
cttatcacccacttctggcaggaccagcaacg	Protospacer
   ..******** *********** **.

970. spacer 8.12|1587490|32|NC_014210|CRISPRCasFinder,CRT matches to MH807818 (Pectobacterium phage Nobby, complete genome) position: , mismatch: 11, identity: 0.656

aaggccacccactgctggcaggacccgcgcac	CRISPR spacer
cttatcacccacttctggcaggaccagcaacg	Protospacer
   ..******** *********** **.

971. spacer 8.14|1587612|32|NC_014210|CRISPRCasFinder,CRT matches to NZ_HG938354 (Neorhizobium galegae bv. orientalis str. HAMBI 540 plasmid pHAMBI540a, complete sequence) position: , mismatch: 11, identity: 0.656

gccatcaacgccgccgcccgctccggtggtat	CRISPR spacer
aacatcaacgccgccttccgctccgtccaggc	Protospacer
. ************* .******** . . ..

972. spacer 8.22|1588100|32|NC_014210|CRISPRCasFinder,CRT matches to NC_018022 (Mycolicibacterium chubuense NBB4 plasmid pMYCCH.01, complete sequence) position: , mismatch: 11, identity: 0.656

gggaagcccaccggcaccgtccgcaaggtcgc	CRISPR spacer
aacggcgacaccggcaccgcctgcaaggtcga	Protospacer
.. ..   ***********.*.*********

973. spacer 9.8|1595487|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP031116 (Rubrobacter indicoceani strain SCSIO 08198 plasmid unnamed1, complete sequence) position: , mismatch: 11, identity: 0.656

gccgtcgccgcctacgcgaccgccctcgggct	CRISPR spacer
ttgctcgccgccaacgcgaccgcgctctacga	Protospacer
 .  ******** ********** *** .

974. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MK112543 (Mycobacterium Phage Kalb97, complete genome) position: , mismatch: 11, identity: 0.656

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagcttg	Protospacer
.. *****************. **** ...

975. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MN497953 (Mycobacterium phage GtownJaz, complete genome) position: , mismatch: 11, identity: 0.656

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagcttg	Protospacer
.. *****************. **** ...

976. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MK967399 (Mycobacterium phage Groupthink, complete genome) position: , mismatch: 11, identity: 0.656

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagcttg	Protospacer
.. *****************. **** ...

977. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MG925341 (Mycobacteriophage EpicPhail, complete genome) position: , mismatch: 11, identity: 0.656

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagcttg	Protospacer
.. *****************. **** ...

978. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to KX808129 (Mycobacterium phage Sabinator, complete genome) position: , mismatch: 11, identity: 0.656

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagcttg	Protospacer
.. *****************. **** ...

979. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MK359341 (Mycobacterium phage GingkoMaracino, complete genome) position: , mismatch: 11, identity: 0.656

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagcttg	Protospacer
.. *****************. **** ...

980. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to JF704114 (Mycobacterium phage Vix, complete genome) position: , mismatch: 11, identity: 0.656

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagcttg	Protospacer
.. *****************. **** ...

981. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MK279913 (Mycobacterium phage PotatoSplit, complete genome) position: , mismatch: 11, identity: 0.656

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagcttg	Protospacer
.. *****************. **** ...

982. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MG757161 (Mycobacterium phage LugYA, complete genome) position: , mismatch: 11, identity: 0.656

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagcttg	Protospacer
.. *****************. **** ...

983. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MH536825 (Mycobacterium phage Ollie, complete genome) position: , mismatch: 11, identity: 0.656

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagcttg	Protospacer
.. *****************. **** ...

984. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MH020238 (Mycobacterium phage Lilith, complete genome) position: , mismatch: 11, identity: 0.656

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagcttg	Protospacer
.. *****************. **** ...

985. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MH077583 (Mycobacterium phage PGHhamlin, complete genome) position: , mismatch: 11, identity: 0.656

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagcttg	Protospacer
.. *****************. **** ...

986. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MT897907 (Mycobacterium phage Grif, complete genome) position: , mismatch: 11, identity: 0.656

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagcttg	Protospacer
.. *****************. **** ...

987. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MK310140 (Mycobacterium phage Gemma, complete genome) position: , mismatch: 11, identity: 0.656

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagcttg	Protospacer
.. *****************. **** ...

988. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MH155864 (Mycobacterium phage Beauxregard13, complete genome) position: , mismatch: 11, identity: 0.656

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagcttg	Protospacer
.. *****************. **** ...

989. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MH727554 (Mycobacterium phage MuchMore, complete genome) position: , mismatch: 11, identity: 0.656

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagcttg	Protospacer
.. *****************. **** ...

990. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MH338240 (Mycobacterium phage Sabia, complete genome) position: , mismatch: 11, identity: 0.656

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagcttg	Protospacer
.. *****************. **** ...

991. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to KY965063 (Mycobacterium phage PurpleHaze, complete genome) position: , mismatch: 11, identity: 0.656

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagcttg	Protospacer
.. *****************. **** ...

992. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MN813699 (Mycobacterium phage P28Green, complete genome) position: , mismatch: 11, identity: 0.656

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagcttg	Protospacer
.. *****************. **** ...

993. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MT657331 (Mycobacterium phage Manu, complete genome) position: , mismatch: 11, identity: 0.656

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagcttg	Protospacer
.. *****************. **** ...

994. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MK494128 (Mycobacterium phage Heliosoles, complete genome) position: , mismatch: 11, identity: 0.656

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagcttg	Protospacer
.. *****************. **** ...

995. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MK279903 (Mycobacterium phage Zetzy, complete genome) position: , mismatch: 11, identity: 0.656

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagcttg	Protospacer
.. *****************. **** ...

996. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MN284900 (Mycobacterium phage JeppNRM, complete genome) position: , mismatch: 11, identity: 0.656

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagcttg	Protospacer
.. *****************. **** ...

997. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to HM755814 (Mycobacterium phage Wonder, complete genome) position: , mismatch: 11, identity: 0.656

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagcttg	Protospacer
.. *****************. **** ...

998. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to KU578077 (Mycobacterium phage Marie, complete genome) position: , mismatch: 11, identity: 0.656

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagcttg	Protospacer
.. *****************. **** ...

999. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MH450128 (Mycobacterium phage Reba, complete genome) position: , mismatch: 11, identity: 0.656

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagcttg	Protospacer
.. *****************. **** ...

1000. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to KT381277 (Mycobacterium phage Wooldri, complete genome) position: , mismatch: 11, identity: 0.656

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagcttg	Protospacer
.. *****************. **** ...

1001. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MK875800 (Mycobacterium phage MoneyMay, complete genome) position: , mismatch: 11, identity: 0.656

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagcttg	Protospacer
.. *****************. **** ...

1002. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to KX664448 (Mycobacterium phage Watson, complete genome) position: , mismatch: 11, identity: 0.656

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagcttg	Protospacer
.. *****************. **** ...

1003. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to KX507362 (Mycobacterium phage Aglet, complete genome) position: , mismatch: 11, identity: 0.656

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagcttg	Protospacer
.. *****************. **** ...

1004. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MN586048 (Mycobacterium phage Fernando, complete genome) position: , mismatch: 11, identity: 0.656

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagcttg	Protospacer
.. *****************. **** ...

1005. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to KU985091 (Mycobacterium phage Hercules11, complete genome) position: , mismatch: 11, identity: 0.656

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagcttg	Protospacer
.. *****************. **** ...

1006. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NC_042310 (Mycobacterium virus JHC117, complete genome) position: , mismatch: 11, identity: 0.656

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagcttg	Protospacer
.. *****************. **** ...

1007. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MH576949 (Mycobacterium phage BreSam8, complete genome) position: , mismatch: 11, identity: 0.656

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagcttg	Protospacer
.. *****************. **** ...

1008. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MH450124 (Mycobacterium phage Marius, complete genome) position: , mismatch: 11, identity: 0.656

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagcttg	Protospacer
.. *****************. **** ...

1009. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to KP027202 (Mycobacterium phage Taurus, complete genome) position: , mismatch: 11, identity: 0.656

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagcttg	Protospacer
.. *****************. **** ...

1010. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MH399776 (Mycobacterium phage Grum1, complete genome) position: , mismatch: 11, identity: 0.656

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagcttg	Protospacer
.. *****************. **** ...

1011. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MN585969 (Mycobacterium phage Dieselweasel, complete genome) position: , mismatch: 11, identity: 0.656

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagcttg	Protospacer
.. *****************. **** ...

1012. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to KU255188 (Mycobacterium phage JenCasNa, complete genome) position: , mismatch: 11, identity: 0.656

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagcttg	Protospacer
.. *****************. **** ...

1013. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to KX458237 (Mycobacterium phage Penny1, complete genome) position: , mismatch: 11, identity: 0.656

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagcttg	Protospacer
.. *****************. **** ...

1014. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NC_021535 (Mycobacterium phage Jobu08, complete genome) position: , mismatch: 11, identity: 0.656

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagcttg	Protospacer
.. *****************. **** ...

1015. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MH536813 (Mycobacterium phage AugsMagnumOpus, complete genome) position: , mismatch: 11, identity: 0.656

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagcttg	Protospacer
.. *****************. **** ...

1016. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MH450126 (Mycobacterium phage PhishRPhriends, complete genome) position: , mismatch: 11, identity: 0.656

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagcttg	Protospacer
.. *****************. **** ...

1017. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MF185733 (Mycobacterium phage StepMih, complete genome) position: , mismatch: 11, identity: 0.656

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagcttg	Protospacer
.. *****************. **** ...

1018. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MH450119 (Mycobacterium phage Kalnoky, complete genome) position: , mismatch: 11, identity: 0.656

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagcttg	Protospacer
.. *****************. **** ...

1019. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MF185732 (Mycobacterium phage Stagni, complete genome) position: , mismatch: 11, identity: 0.656

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagcttg	Protospacer
.. *****************. **** ...

1020. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MK494096 (Mycobacterium phage Mainiac, complete genome) position: , mismatch: 11, identity: 0.656

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagcttg	Protospacer
.. *****************. **** ...

1021. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to KU984914 (Mycobacterium phage Malinsilva, complete genome) position: , mismatch: 11, identity: 0.656

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagcttg	Protospacer
.. *****************. **** ...

1022. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to JF704101 (Mycobacterium virus Microwolf, complete genome) position: , mismatch: 11, identity: 0.656

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagcttg	Protospacer
.. *****************. **** ...

1023. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NC_028757 (Mycobacterium phage Tiffany, complete genome) position: , mismatch: 11, identity: 0.656

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagcttg	Protospacer
.. *****************. **** ...

1024. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MN062718 (Mycobacterium phage SoilDragon, complete genome) position: , mismatch: 11, identity: 0.656

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagcttg	Protospacer
.. *****************. **** ...

1025. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to KT359365 (Mycobacterium phage DaHudson, complete genome) position: , mismatch: 11, identity: 0.656

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagcttg	Protospacer
.. *****************. **** ...

1026. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MH651179 (Mycobacterium phage MadMarie, complete genome) position: , mismatch: 11, identity: 0.656

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagcttg	Protospacer
.. *****************. **** ...

1027. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to MH371121 (Mycobacterium phage Phranny, complete genome) position: , mismatch: 11, identity: 0.656

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagcttg	Protospacer
.. *****************. **** ...

1028. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to KF279418 (Mycobacterium phage Anubis, complete genome) position: , mismatch: 11, identity: 0.656

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagcttg	Protospacer
.. *****************. **** ...

1029. spacer 14.19|2014636|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NC_028798 (Mycobacterium phage MarQuardt, complete genome) position: , mismatch: 11, identity: 0.656

tacggccagccggtcggtccctaccgcatcgc	CRISPR spacer
cgaggccagccggtcggtcctgaccgagcttg	Protospacer
.. *****************. **** ...

1030. spacer 14.23|2014880|32|NC_014210|CRISPRCasFinder,PILER-CR matches to NZ_CP015232 (Epibacterium mobile F1926 plasmid unnamed2, complete sequence) position: , mismatch: 11, identity: 0.656

gccatcgcgatcgccgctgtcctgggcatgca	CRISPR spacer
ctggacgccatcgccgctgtgctgggcaccgg	Protospacer
 . . *** *********** *******.  .

1031. spacer 23.3|5555711|32|NC_014210|CRISPRCasFinder matches to NC_017958 (Tistrella mobilis KA081020-065 plasmid pTM3, complete sequence) position: , mismatch: 11, identity: 0.656

cagctggccgccctccaggcgcagacgcaggc	CRISPR spacer
atgctggccgccgtccaggcgccgatcatcat	Protospacer
  ********** ********* **.    ..

1032. spacer 23.4|5555772|32|NC_014210|CRISPRCasFinder matches to NC_011892 (Methylobacterium nodulans ORS 2060 plasmid pMNOD01, complete sequence) position: , mismatch: 11, identity: 0.656

ctgcccacccagctcaccgcgccggacgcgga	CRISPR spacer
acatttgatcagatcaccgcgccggccgcgga	Protospacer
 ...... .*** ************ ******

1033. spacer 14.47|2014570|37|NC_014210|CRT matches to NZ_CP009112 (Rhodococcus opacus strain 1CP plasmid pR1CP1, complete sequence) position: , mismatch: 12, identity: 0.676

aaccggaggagttcgcctacgccatcgctgggtcggg	CRISPR spacer
gaccggaggagatcgcctacgccgtcgtcttcctgct	Protospacer
.********** ***********.***..   ..*

1034. spacer 10.5|1603018|32|NC_014210|PILER-CR,CRISPRCasFinder,CRT matches to CP000662 (Rhodobacter sphaeroides ATCC 17025 plasmid pRSPA01, complete sequence) position: , mismatch: 15, identity: 0.531

cggccgccgggccgccgcggtggccagctcct--	CRISPR spacer
--aggagctggccgccgcgccggccgcgcccgaa	Protospacer
  .  . * ********** .****.  .**

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

2177270 : 2226290

Virus_Rctr71(12.5%)

coat,transposase,protease

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_145973076.1\|2177270_2178446_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A1P8DJA0	Virus_Rctr71	4.1e-51	36.1
WP_013152815.1\|2178624_2180091_-	PepSY domain-containing protein	NA	NA	NA	NA
WP_013152816.1\|2180394_2181606_-	MFS transporter	NA	NA	NA	NA
WP_041553116.1\|2181999_2183061_-	mannose-6-phosphate isomerase	NA	NA	NA	NA
WP_013152819.1\|2183072_2183915_-	SDR family oxidoreductase	A0A2N9QUX2	Trichoplusia_ni_ascovirus	1.3e-54	46.4
WP_013152820.1\|2184314_2184620_+	hypothetical protein	NA	NA	NA	NA
WP_013152821.1\|2184781_2185342_+	PadR family transcriptional regulator	NA	NA	NA	NA
WP_013152822.1\|2185307_2185964_+	hypothetical protein	NA	NA	NA	NA
WP_013152823.1\|2186086_2186686_+	hypothetical protein	NA	NA	NA	NA
WP_013152824.1\|2186930_2188469_-	MFS transporter	NA	NA	NA	NA
WP_041552606.1\|2188731_2189397_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_013152826.1\|2189681_2190047_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_013152827.1\|2190050_2192219_+	cation-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	3.9e-100	38.7
WP_013152828.1\|2192618_2193995_+	UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D- alanine ligase	NA	NA	NA	NA
WP_071623189.1\|2194160_2194721_+	transferase	NA	NA	NA	NA
WP_013152830.1\|2194732_2195119_-	TIGR03618 family F420-dependent PPOX class oxidoreductase	NA	NA	NA	NA
WP_013152831.1\|2195398_2197942_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_013152832.1\|2197985_2199068_-	tartrate dehydrogenase	NA	NA	NA	NA
WP_013152833.1\|2199159_2200116_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_013152835.1\|2200617_2201778_+\|transposase	transposase	I4AZI9	Saccharomonospora_phage	4.1e-120	59.2
WP_013152836.1\|2201995_2202589_-	hypothetical protein	NA	NA	NA	NA
WP_013152837.1\|2202612_2203632_-	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	2.2e-29	31.2
WP_013152838.1\|2204160_2205396_+	hypothetical protein	NA	NA	NA	NA
WP_126625067.1\|2205578_2206094_+	hypothetical protein	NA	NA	NA	NA
WP_013152840.1\|2206099_2208226_-	regulator protein	NA	NA	NA	NA
WP_013152841.1\|2208816_2211999_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_013152842.1\|2212736_2213912_+	UDP-N-acetylglucosamine--N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase	NA	NA	NA	NA
WP_013152843.1\|2214022_2214628_-	response regulator transcription factor	NA	NA	NA	NA
WP_013152844.1\|2214624_2215794_-	two-component sensor histidine kinase	NA	NA	NA	NA
WP_013152845.1\|2215825_2216869_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_041552611.1\|2217034_2217571_+	hypothetical protein	NA	NA	NA	NA
WP_013152847.1\|2217795_2218341_-	G/U mismatch-specific DNA glycosylase	NA	NA	NA	NA
WP_013152848.1\|2218689_2219688_+\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_013152849.1\|2219684_2220638_-	hypothetical protein	A0A2R4A1Q4	Microbacterium_phage	6.9e-25	43.6
WP_013152850.1\|2220914_2221874_+	polyphosphate polymerase domain-containing protein	NA	NA	NA	NA
WP_013152851.1\|2221914_2222601_+	DUF4956 domain-containing protein	NA	NA	NA	NA
WP_013152852.1\|2222602_2224249_+\|coat	spore coat protein CotH	NA	NA	NA	NA
WP_013152853.1\|2224427_2224937_-	N-acetyltransferase	A0A1P8CWJ6	Bacillus_phage	6.7e-19	41.3
WP_041553117.1\|2225072_2226290_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A0R8V9X2	Thermobifida_phage	2.0e-141	71.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_014210

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection