CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP046035	Pseudomonas coronafaciens pv. oryzae str. 1_6 chromosome, complete genome	1 crisprs	DEDDh,csa3,DinG,cas3,PD-DExK	0	1	5	0
NZ_CP046036	Pseudomonas coronafaciens pv. oryzae str. 1_6 plasmid pPor1_6, complete sequence	0 crisprs	NA	0	0	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP046035_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP046035_1

4357385-4357467

Orphan

Consensus_repeat	Method
CGCCTGGCGTTGAATGAGCTGGAAGCTGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP046035_1

>merge|NZ_CP046035|1|4357385-4357467|CRISPRCasFinder
CGCCTGGCGTTGAATGAGCTGGAAGCTGCCAATGCAGCGCTTCAGGAAAGCCACCGCCTGGCGTTGAGTGAGCTGGAAGCTGC

>NZ_CP046035|1|1|4357385-4357467|CRISPRCasFinder
CGCCTGGCGTTGAATGAGCTGGAAGCTGC	CAATGCAGCGCTTCAGGAAAGCCAC
CGCCTGGCGTTGAGTGAGCTGGAAGCTGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP046035.1\|WP_005891130.1\|4347873_4348947_+\|dTDP-glucose-4,6-dehydratase	unknown	unknown	gnl\|CDD\|236649
NZ_CP046035.1\|WP_005891109.1\|4353741_4355109_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213187
NZ_CP046035.1\|WP_005891114.1\|4352379_4352925_+\|dTDP-4-dehydrorhamnose-3,5-epimerase	unknown	unknown	gnl\|CDD\|273510
NZ_CP046035.1\|WP_005891120.1\|4350780_4351710_+\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|133039
NZ_CP046035.1\|WP_005891123.1\|4349848_4350739_+\|glucose-1-phosphate-thymidylyltransferase-RfbA	unknown	unknown	gnl\|CDD\|130274
NZ_CP046035.1\|WP_005891139.1\|4345103_4345718_+\|50S-ribosomal-protein-L25/general-stress-protein-Ctc	unknown	unknown	gnl\|CDD\|235534
NZ_CP046035.1\|WP_024670109.1\|4352924_4353752_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224596
NZ_CP046035.1\|WP_005891101.1\|4362977_4363928_+\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|133030
NZ_CP046035.1\|WP_055002209.1\|4363914_4364865_+\|isomerase	unknown	unknown	gnl\|CDD\|377522
NZ_CP046035.1\|WP_005891136.1\|4345882_4346467_+\|aminoacyl-tRNA-hydrolase	unknown	unknown	gnl\|CDD\|235457
NZ_CP046035.1\|WP_005891079.1\|4371268_4373326_-\|methyl-accepting-chemotaxis-protein	unknown	unknown	gnl\|CDD\|223910
NZ_CP046035.1\|WP_162010107.1\|4370077_4371109_-\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|133039
NZ_CP046035.1\|WP_005891077.1\|4373666_4374788_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|99751
NZ_CP046035.1\|WP_042932349.1\|4365369_4367454_-\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|133027
NZ_CP046035.1\|WP_051126724.1\|4359985_4361863_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|370749
NZ_CP046035.1\|WP_024690456.1\|4348946_4349852_+\|dTDP-4-dehydrorhamnose-reductase	unknown	unknown	gnl\|CDD\|182184
NZ_CP046035.1\|WP_005891103.1\|4361877_4362981_+\|DegT/DnrJ/EryC1/StrS-family-aminotransferase	unknown	unknown	gnl\|CDD\|99740
NZ_CP046035.1\|WP_024670112.1\|4346488_4347589_+\|redox-regulated-ATPase-YchF	unknown	unknown	gnl\|CDD\|236583
NZ_CP046035.1\|WP_005891094.1\|4364872_4365274_+\|GtrA-family-protein	unknown	unknown	gnl\|CDD\|377229
NZ_CP046035.1\|WP_005891085.1\|4368390_4369812_+\|glycosyl-transferase	unknown	unknown	gnl\|CDD\|377447

Protein	Function_ID	Function_description	E-value
NZ_CP046035.1\|WP_005891130.1\|4347873_4348947_+\|dTDP-glucose-4,6-dehydratase	gnl\|CDD\|236649	PRK10084, PRK10084, dTDP-glucose 4,6 dehydratase; Provisional.	0
NZ_CP046035.1\|WP_005891109.1\|4353741_4355109_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|213187	cd03220, ABC_KpsT_Wzt, ATP-binding cassette component of polysaccharide transport system. The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export. Among the variety of membrane-linked or extracellular polysaccharides excreted by bacteria, only capsular polysaccharides, lipopolysaccharides, and teichoic acids have been shown to be exported by ABC transporters. A typical system is made of a conserved integral membrane and an ABC. In addition to these proteins, capsular polysaccharide exporter systems require two 'accessory' proteins to perform their function: a periplasmic (E.coli) or a lipid-anchored outer membrane protein called OMA (Neisseria meningitidis and Haemophilus influenza) and a cytoplasmic membrane protein MPA2.	9.64758e-110
NZ_CP046035.1\|WP_005891114.1\|4352379_4352925_+\|dTDP-4-dehydrorhamnose-3,5-epimerase	gnl\|CDD\|273510	TIGR01221, dTDP-4-dehydrorhamnose_35-epimerase, dTDP-4-dehydrorhamnose 3,5-epimerase. This enzyme participates in the biosynthesis of dTDP-L-rhamnose, often as a precursor to LPS O-antigen [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides].	2.3194e-105
NZ_CP046035.1\|WP_005891120.1\|4350780_4351710_+\|glycosyltransferase-family-2-protein	gnl\|CDD\|133039	cd04196, GT_2_like_d, Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.	4.31529e-72
NZ_CP046035.1\|WP_005891123.1\|4349848_4350739_+\|glucose-1-phosphate-thymidylyltransferase-RfbA	gnl\|CDD\|130274	TIGR01207, Glucose-1-phosphate_thymidylyltransferase_1, glucose-1-phosphate thymidylyltransferase, short form. Alternate name: dTDP-D-glucose synthase homotetramer This model describes a tightly conserved but broadly distributed subfamily (here designated as short form) of known and putative bacterial glucose-1-phosphate thymidylyltransferases. It is well characterized in several species as the first of four enzymes involved in the biosynthesis of dTDP-L-rhamnose, a cell wall constituent and a feedback inhibitor of the enzyme. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides].	0
NZ_CP046035.1\|WP_005891139.1\|4345103_4345718_+\|50S-ribosomal-protein-L25/general-stress-protein-Ctc	gnl\|CDD\|235534	PRK05618, PRK05618, 50S ribosomal protein L25/general stress protein Ctc; Reviewed.	2.06199e-81
NZ_CP046035.1\|WP_024670109.1\|4352924_4353752_+\|ABC-transporter-permease	gnl\|CDD\|224596	COG1682, TagG, ABC-type polysaccharide/polyol phosphate export systems, permease component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane].	9.23927e-52
NZ_CP046035.1\|WP_005891101.1\|4362977_4363928_+\|glycosyltransferase-family-2-protein	gnl\|CDD\|133030	cd04187, DPM1_like_bac, Bacterial DPM1_like enzymes are related to eukaryotic DPM1. A family of bacterial enzymes related to eukaryotic DPM1; Although the mechanism of eukaryotic enzyme is well studied, the mechanism of the bacterial enzymes is not well understood. The eukaryotic DPM1 is the catalytic subunit of eukaryotic Dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. The enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. This protein family belongs to Glycosyltransferase 2 superfamily.	1.35142e-63
NZ_CP046035.1\|WP_055002209.1\|4363914_4364865_+\|isomerase	gnl\|CDD\|377522	pfam05523, FdtA, WxcM-like, C-terminal. This family includes FdtA from Aneurinibacillus thermoaerophilus, which has been characterized as a dtdp-6-deoxy-3,4-keto-hexulose isomerase. It also includes WxcM from Xanthomonas campestris (pv. campestris).	2.97337e-67
NZ_CP046035.1\|WP_005891136.1\|4345882_4346467_+\|aminoacyl-tRNA-hydrolase	gnl\|CDD\|235457	PRK05426, PRK05426, peptidyl-tRNA hydrolase; Provisional.	1.72885e-100
NZ_CP046035.1\|WP_005891079.1\|4371268_4373326_-\|methyl-accepting-chemotaxis-protein	gnl\|CDD\|223910	COG0840, Tar, Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms].	1.56459e-59
NZ_CP046035.1\|WP_162010107.1\|4370077_4371109_-\|glycosyltransferase-family-2-protein	gnl\|CDD\|133039	cd04196, GT_2_like_d, Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.	3.02445e-84
NZ_CP046035.1\|WP_005891077.1\|4373666_4374788_+\|hypothetical-protein	gnl\|CDD\|99751	cd06257, DnaJ, DnaJ domain or J-domain. DnaJ/Hsp40 (heat shock protein 40) proteins are highly conserved and play crucial roles in protein translation, folding, unfolding, translocation, and degradation. They act primarily by stimulating the ATPase activity of Hsp70s, an important chaperonine family. Hsp40 proteins are characterized by the presence of a J domain, which mediates the interaction with Hsp70. They may contain other domains as well, and the architectures provide a means of classification.	3.77501e-05
NZ_CP046035.1\|WP_042932349.1\|4365369_4367454_-\|glycosyltransferase-family-2-protein	gnl\|CDD\|133027	cd04184, GT2_RfbC_Mx_like, Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.	1.71147e-116
NZ_CP046035.1\|WP_051126724.1\|4359985_4361863_+\|hypothetical-protein	gnl\|CDD\|370749	pfam09913, DUF2142, Predicted membrane protein (DUF2142). This domain, found in various hypothetical prokaryotic proteins, has no known function.	9.86803e-05
NZ_CP046035.1\|WP_024690456.1\|4348946_4349852_+\|dTDP-4-dehydrorhamnose-reductase	gnl\|CDD\|182184	PRK09987, PRK09987, dTDP-4-dehydrorhamnose reductase; Provisional.	2.89163e-137
NZ_CP046035.1\|WP_005891103.1\|4361877_4362981_+\|DegT/DnrJ/EryC1/StrS-family-aminotransferase	gnl\|CDD\|99740	cd00616, AHBA_syn, 3-amino-5-hydroxybenzoic acid synthase family (AHBA_syn). AHBA_syn family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The members of this CD are involved in various biosynthetic pathways for secondary metabolites. Some well studied proteins in this CD are AHBA_synthase, protein product of pleiotropic regulatory gene degT, Arnb aminotransferase and pilin glycosylation protein. The prototype of this family, the AHBA_synthase, is a dimeric PLP dependent enzyme. AHBA_syn is the terminal enzyme of 3-amino-5-hydroxybenzoic acid (AHBA) formation which is involved in the biosynthesis of ansamycin antibiotics, including rifamycin B. Some members of this CD are involved in 4-amino-6-deoxy-monosaccharide D-perosamine synthesis. Perosamine is an important element in the glycosylation of several cell products, such as antibiotics and lipopolysaccharides of gram-positive and gram-negative bacteria. The pilin glycosylation protein encoded by gene pglA, is a galactosyltransferase involved in pilin glycosylation. Additionally, this CD consists of ArnB (PmrH) aminotransferase, a 4-amino-4-deoxy-L-arabinose lipopolysaccharide-modifying enzyme. This CD also consists of several predicted pyridoxal phosphate-dependent enzymes apparently involved in regulation of cell wall biogenesis. The catalytic lysine which is present in all characterized PLP dependent enzymes is replaced by histidine in some members of this CD.	3.80943e-125
NZ_CP046035.1\|WP_024670112.1\|4346488_4347589_+\|redox-regulated-ATPase-YchF	gnl\|CDD\|236583	PRK09601, PRK09601, redox-regulated ATPase YchF.	0
NZ_CP046035.1\|WP_005891094.1\|4364872_4365274_+\|GtrA-family-protein	gnl\|CDD\|377229	pfam04138, GtrA, GtrA-like protein. Members of this family are predicted to be integral membrane proteins with three or four transmembrane spans. They are involved in the synthesis of cell surface polysaccharides. The GtrA family are a subset of this family. GtrA is predicted to be an integral membrane protein with 4 transmembrane spans. It is involved is in O antigen modification by Shigella flexneri bacteriophage X (SfX), but does not determine the specificity of glucosylation. Its function remains unknown, but it may play a role in translocation of undecaprenyl phosphate linked glucose (UndP-Glc) across the cytoplasmic membrane. Another member of this family is a DTDP-glucose-4-keto-6-deoxy-D-glucose reductase, which catalyzes the conversion of dTDP-4-keto-6-deoxy-D-glucose to dTDP-D-fucose, which is involved in the biosynthesis of the serotype-specific polysaccharide antigen of Actinobacillus actinomycetemcomitans Y4 (serotype b). This family also includes the teichoic acid glycosylation protein, GtcA, which is a serotype-specific protein in some Listeria innocua and monocytogenes strains. Its exact function is not known, but it is essential for decoration of cell wall teichoic acids with glucose and galactose.	1.24553e-15
NZ_CP046035.1\|WP_005891085.1\|4368390_4369812_+\|glycosyl-transferase	gnl\|CDD\|377447	pfam05045, RgpF, Rhamnan synthesis protein F. This family consists of a group of proteins which are related to the Streptococcus rhamnose-glucose polysaccharide assembly protein (RgpF). Rhamnan backbones are found in several O polysaccharides of phytopathogenic bacteria and are regarded as pathogenic factors.	3.35375e-23

>NZ_CP046035.1|WP_005891109.1|4353741_4355109_+|ABC-transporter-ATP-binding-protein
MSSDQPVISVQNVSKCFYTYDKPHDRLKQALVPRLQRWSGQAATTTYGKEFWALRDVSFNVGKGETVGIVGRNGSGKSTLLQIICGTLSPTIGEIQTRGRVAALLELGSGFNPEFTGRENVYLNAAVLGLTRDEVDERFDAIAGFADIGEFLDQPVKSYSSGMAVRLAFAVQAQVDPEILVVDEALSVGDARFQAKCFERLRQLKENGTSILLVTHSSEQVVTHCNRAILLEKSRIEMIGESRPVINRYTDLLFGRDKSPITDKSLDLAEAERVEAAPVEADKIALRFDEDVYASRPGYNPHEYRWGDGAATLLDFHMSASGREFPNSVESGEDIVLDLALRFNSTVVNPIIGFTIKTKEGVTVYGTNSYMQDCEGTALIGNAGKQAKARVKFKNALATGDYFISIGIASRQSEDIVPHDRRYDSIHFVVEPTPKLLGLIDLGASMDIEPVIADV
>NZ_CP046035.1|WP_024670109.1|4352924_4353752_+|ABC-transporter-permease
MNPHQTPSAGPLRLVSSLWTNRSLISQMTKREVIGRYRGSVMGLAWSFFNPVLMLAVYTFVFSEIFSARWVGVDTGKGGFAILLFVGMIVHGLFAECANRAPSLVMSNSNYVKKVVFPLEILPVITLGSALFHSCISLIVLVIAQLLISHTLYWTALLFPLILVPLILGTLGISWFLASLGVYLRDVGHVITVLTTVLLFLSPVLYPVAALPEVYRPWLQMNPLTYIIEESRSVLLFGNLPHWDSLGIAIAVGAVIAVIGFWFFQKTRKGFADVI
>NZ_CP046035.1|WP_005891114.1|4352379_4352925_+|dTDP-4-dehydrorhamnose-3,5-epimerase
MNATRLAIPDVIVFEPKTFGDERGFFFESFNQKAFEEVVGRPVKFVQDNHSRSVKGVLRGLHYQIQQPQGKLVRVTVGEVFDVAVDLRKSSPTFGKWVGLHLTAENKKQLWIPEGFAHGFVVLSESAEFLYKTTDYWAPEHERSLVWNDASVGIEWPFSEAPSLSAKDQKAVAFEDAEVFA
>NZ_CP046035.1|WP_005891120.1|4350780_4351710_+|glycosyltransferase-family-2-protein
MSSVTPKVAVLLAAYNGRSWIEAQLESILMQTHVCVSVFISVDTSTDGTEAWCAGYAQRHANITLLPLAARFGGASRNFFRLIRDVNFSSFDYVAFSDQDDIWYPDKLERAVSALKPGNHHAYSSNVIAFWPNGQRLLLDKAQPQVRWDHLFEAAGPGCTYVLSRPLADAFKASLIAQWDAAQAVSLHDWYCYAFARSQGYHWLIDPVPGMDYRQHANNQVGANTGLASLLTRLKKIADGWWAGQVLLISQLTGGNEALPTGKTAGTRWLFLRLAFKARECRRRPRDKLFFIIACLAATLNKPEQPDNR
>NZ_CP046035.1|WP_005891123.1|4349848_4350739_+|glucose-1-phosphate-thymidylyltransferase-RfbA
MTTINRKGIILAGGSGTRLHPLTLGVSKQMLPIYDKPMIFYPLSVLMLAGMREVLIISTPEDLPSFRKLLGDGSQYGIQLTYAEQPTPDGLAQAFIIGEEFIGEDPCCLILGDNIFYGQHFSDNLRSASQQTSGATVFGYHVSDPERFGVVEFDDTGRALSIEEKPSEPKSSYAVTGLYFYDNQVVEIAKSIKPSERGELEITDVNRAYLEQKSLTVEILGRGFAWLDTGTHESLLEASHFVHTIEQRQGWKVACLEEIAYTNGWITAAQLGEQAQKLKKTGYGQYLQKLLDLGSF
>NZ_CP046035.1|WP_024690456.1|4348946_4349852_+|dTDP-4-dehydrorhamnose-reductase
MKILLLGKNGQVGWELQRSLAVLGEVVALDRHTVSTDYGDLSGDLSNLEGLRDTIRRVQPQVIVNAAAYTAVDKAETEQELAHTVNALASQVLAEEAHTLDALLVHYSTDYVFDGTGTTAWKESDAVSAVNYYGATKLEGERLIVASGCKHLIFRTSWVYAARGNNFAKTMLRLAKDRPTLNVIADQIGAPTGAELLADIATAALQQALARPELCGIYHLAPAGEVSWHAYAQYVIDYARANGEPLAVETINPIGTAEYPTPAQRPLNSRLNTEKLRHNFSLHLPDWQSGVARMLMETLNK
>NZ_CP046035.1|WP_005891130.1|4347873_4348947_+|dTDP-glucose-4,6-dehydratase
MKILVTGGAGFIGSAVIRHIIANTTDSVVNVDKLTYAGNLESLQSADQSERYAFEHVDICNREDLDRVFKEHQPDAVMHLAAESHVDRSITGPSEFIQTNIIGTYVLLEAARGYWSQLDEARKANFRFHHISTDEVYGDLEGPEDLFTETTPYQPSSPYSASKASSDHLVRAWSRTYGLPTLVTNCSNNYGPCHFPEKLIPLIILNALEGKPLPIYGKGDQVRDWLYVEDHARALYKVVTEGEIGETYNIGGHNEKQNIEVVNTVCALLDQMRPDSAHRPHASLITYVQDRPGHDLRYAIDASKIQRELGWVPEESFESGIRKTVQWYLDNPEWVAHVKSGSYQQWIDKNYTARADK
>NZ_CP046035.1|WP_024670112.1|4346488_4347589_+|redox-regulated-ATPase-YchF
MGFNCGIVGLPNVGKSTLFNALTKSGIAAENFPFCTIEPNSGIVPMPDPRLAALAAIVNPKRILPTTMEFVDIAGLVAGASKGEGLGNKFLANIRETDAIAHVVRCFEDENVIHVSNSVDPKRDIEIIDLELIFADLDSCEKQLQKVTRNAKGGDKDAVVQKGLLEQLIAHFSEGKPARSLMKSMNNDEKAVIRSFHLLTTKPVMYIANVAEDGFENNPLLDVVRAIAEEEGAMLVPVCNKIEAEIAELDDGEEKDMFLEALGLEEPGLNRVIRAGYEMLHLQTYFTAGVEEVRAWTVRVGATAPQAAGVIHTDFEKGFIRAEVVAYNDFIQFKGEAGAKEAGKWRLEGKEYIVKDGDVMHFRFNV
>NZ_CP046035.1|WP_005891136.1|4345882_4346467_+|aminoacyl-tRNA-hydrolase
MTAIQLIVGLGNPGAEYEQTRHNAGAFFVERIAAAQRVNLVPERKFFGLTGRFTHQGQDVRLLIPTTYMNRSGQAVAALAGFYRIAVESILVAHDELDLPPGVAKLKTGGGHGGHNGLRDIIAQLGNQNTFHRLRLGIGHPGDASKVSGFVLGRAPRAEQEKLDASIDFALGVLPDILASEWNRAMKNLHSQKA
>NZ_CP046035.1|WP_005891139.1|4345103_4345718_+|50S-ribosomal-protein-L25/general-stress-protein-Ctc
MNEFTLNAEQRSDLGKGASRRLRRLASLVPAVVYGGDKAPESISMLAKEVAKLLENDAAYSHIIELNVGGKKQNVIIKALQRHPAKGHVLHADFVRVIAGQKLTAIVPIHFLNEEAPVKKGGEISHTTTELEVTCLPKDLPEFIEVDLGALEVGDNVHLSELKAPKGVEFVALAHGTDLAIANVHAPRIVKDEEEGEGEEGAAE
>NZ_CP046035.1|WP_051126724.1|4359985_4361863_+|hypothetical-protein
MPENTIHNSITKTSKPRYQLLLAAVYIIVLILWSVGISFHGGPDESTHFFLLEYLKTFHELPNAAEPLQPFTGSLSGYTWHPGEFWYHGLPFPHVIGAMISSYGLSWLLPDDLAYLSARSFNWILGAVFICALYRIACRAGMTEKSAAFSALIISLIPQVSFVFSYFNSDAYGLASIALLLSSLLGYIKSPTKYTAICFGAALGLMFLAKLYFLPALVFAGSMLIAYRYAGERKVTQLFPLALVVGLLISAPMLIITYLKYGEITGITGQLDFVAMHKSNPAQGFGTCYIKCPGHLIDMTTVLPWLSLATKSYFSVTGWMNVYIPDSYYMGAALLLILITLTAIVQTARACALPDKKKLILENLLPLIMILGLFPSIIILSLVASQNSLPQPQGRYLFVTIPFLALIISIATTTHANHQTSASLARIAKSRHFHMKWLFMVTIWMAWTNMVAWSANTLSQPNLQKSAIGRPLSEAVQETSGPINAAGAFPTAAQLSKRLSIESGEFSLKAPVSQDLPRGNIDVMRQTSDGLYIRGWSYIEPGDGVPLYVIAVEEGKIVGALNIDGKRQDVAAAIGDKSALRTGYEGTFLSVSPADKCNLKLYTVSSSFQIFAMPDVCEFISRSSH
>NZ_CP046035.1|WP_005891103.1|4361877_4362981_+|DegT/DnrJ/EryC1/StrS-family-aminotransferase
MENIPLFSAIKANAGLDFATPLKAVLDSHWYVLGNEVKLFEEEFAAYVGVQHCISVANGSDALELALKGLGVVVGNRVVAVANAGFYGSTAIHAVGATPVYADVDPATLTLCKKSLEAVIAKEKPAAIIVTHLYGQLANVEEIVQIASAAGIPVLEDCAQSHGARRNGKQAGSFGTIACFSFYPTKNLGALGDGGAVVTDDDALAARIRQLRQYGWDQKYRIAIPGGRNSRLDEMQAAILRIKLPHLDTWNEQRRSIAKRYNEAFAGLDIELPSSVSEDYVAHLYVIRAKDRAALAAALKEKSVSTDIHYPIADHKQPAYAAATSVALDVTERTCDTVISLPCFPGLTDEEVDRVIKAVTAHFSKEI
>NZ_CP046035.1|WP_005891101.1|4362977_4363928_+|glycosyltransferase-family-2-protein
MILLTLVIPVYRNESNLPDLLVAVTALDKQLGHELEVVFVVDGSPDRCYEILREQLPSQSFKSKLILLSRNFGSFMAIRTGLQHGTGDRFAVMAADLQEPPELVLEMNTVLMRGDIDVVVGVREGRQDPWATRTASKIFWGFYRRYVIPEIPPGGVDMFACNRAFRDTLLTLEERHSSLIAQIFWMGYRREVVTYTRQERVHGTSAWTLRKKVNYLMDSVFSFTDMPIRILTRVGAFGSTFAALFGVFTLIAKLEGRIEVPGYAMIMLAITFLGCLNLLGLGIVGSYAWRTYENTKNRPLAIPMRIEGFGETNEQR
>NZ_CP046035.1|WP_055002209.1|4363914_4364865_+|isomerase
MSSGKDFFVHSHALCESENIGKDSRVWAFAHILPGARLGTECNVCDNVFIENDVVIGDRVTLKCGVQVWDGITIEDDVFIGPNATFTNDLFPRSKVYPQSFSRTIIRKGASLGANCTILPGITIGINAMVGAGAVVTRSVPPNAIVVGNPAKIIGYVDAKPVNASSEARPEKAAPGVTATSVKNVTLHTMNEVADIRGSLSAGEFERSVPFKSERYFLVYDVPTAETRGEHAHRICHQFLVAVKGSVHVVADDGVNREEFILDKPNQGIHLPPMTWGIQYRYSQDAVLLVFASHYYDAGDYIRNYEEFKSLIANAE
>NZ_CP046035.1|WP_005891094.1|4364872_4365274_+|GtrA-family-protein
MMNQAVSKFLKQDFARFLMSGGFNTALTYGLYLILLMFLSYKISYTISYVTGILLAYVLNRFFVFKSHQGIRSVVLLPLIYAIQYGLSLVILWCWVEKLAFDERLAPLAAIALTLPVTFFLSKVAFTAKAPPQ
>NZ_CP046035.1|WP_042932349.1|4365369_4367454_-|glycosyltransferase-family-2-protein
MLKRLRQENSLQRKQSSAVIERLQRELALEQQQLARKEAVFAAALIERDTHIHNLNLTIMELQGSTSWKITSPLRKLVAAIRRASSGEQAPVAFPAHDALSHTVEPETPAVAHAENAPEQLDTYARWVEEFDTIDDIDRLCMYEEIGAWKTKPLLSIIMPVYNPPIEMLRDAIESIKTQVYFNWELCIADDASTDHRVRLFLEQSAKSDHRIKVVYREQNGHISKASNSALDIASGEFIVLMDNDDTLPEHALFWMAKTINNHPDAAVIYSDEDKIDEQGVRSAPYFKTDWNPYLFRSHNMICHLGAYRKDLVERIGRFRVGMEGAQDYDLALRCVEQVEAAQIIHIPRVLYHWRIHAGSTAMSTDEKPYAQNAGQKALEEHLKRSGIAGRVELLDFGMYRVHYDLPAVKPLVSLIIPTRNAYALVKQCIESIRHKTLYPNYEIILVDNGSDDPQSLQYFEMLSRLTGVTVIRDDGEFNYSALNNNAVEHAKGELIGLVNNDIEVINPEWLDEMVSLALQPNSGAIGARLWYPDERLQHGGVIMGPLTLAGHAHKMLPRGHHGYFGRASLIQGMSAVTAACLIVKKSIFQEVGGLNAKDLKIAFNDVDLCLKIMQAGYQNIWTPNADLYHHESATRGFEDTPEKIKRFISEVEYMQNKWRAIIKHDPYYNPNLTLAAEDFSVAFPPRVNDFAGV
>NZ_CP046035.1|WP_005891085.1|4368390_4369812_+|glycosyl-transferase
MSRLPFDFSAVEYLRLNPDVASADMHPAQHYLDFGRAEGRRYQDISIDKQQLRSLGIFDSEFYMSENPDVASAGLDPAEHFLTGGCAEGRWASLFFRSNWYMDCHPDSKLHPKNCLFHYSEIGSRLGYEPNPFFEPEYYSAKYKQHIGLEEPLAHFIKHGKEGFNPSPRFDSAAYIKTTGCSENPLKHYLQTGMQAGIPLLRAEPVQAHEEVESAFVITLKKSGPFKRVVLLITHSPDGKIKPHVGNYAAELARGDLSVFLIVASDVNDVTIPEGLRETCSNIVVRQNTGFDFAAWAHIIKTHSWLEDCEELILTNDSIIGPVGVSGPALMNKVRSSDADVIGLVENIEHASHLQSFFLVFREKAIQSDSFKKFWLSVVNHNDKSKVIRDYEITFTSILRASGLKTDCIFQKASENNATVFNWEKLLNEGFPFLKFEVVKNSNIDTLQHIKTLLNAAHYDTSLIPQLANLSAN
>NZ_CP046035.1|WP_162010107.1|4370077_4371109_-|glycosyltransferase-family-2-protein
MQAKGFLKTQLPEEQRSDSLSPLQGRGSSEAGDRFSGHPRVAILMCTYNGAAYLREQLESFASQTLRDWTLYVSDDASTDDTLRVLSEYQTRWGSERLVVFNGPCKGFAENFISLVKRPEIDADYFAFSDQDDVWFSDKLKRSVDCLELIKRGTPALYCSRTRLVDAGLKVIGVSPQFKKTPSFKNALVQSLAGANTMLINQPARDLLVQLPEHAPLIAHDWLTYLLVTGCGGQVFYDPEPCLYYRQHCGNLIGANASTRDRLIRFRKMLSGRFIEWNDANVATLKGMEAMLTEENRNVLAHFDNGRRQSFFKRVTTLRKSGVYRQTVQGNLSLMLAVCLGRV
>NZ_CP046035.1|WP_005891079.1|4371268_4373326_-|methyl-accepting-chemotaxis-protein
MNSLLSPGMRLMGRFGFARKFQVLFLLFILPLAGSAWFITKDYRNKLDVISGEQSGVRQLLALDDLNVELSAQRDHAARWKAADILREPTPAAKEAMISVDAGIARITKALEGVSAALARENAPADTMARYKELQAAVTGLDTASLRTVGWWPDGYDRFSTVLNLVQALREQIAMDSGLILDPWLETYMLMQLSTQQVPDLIERIGRLSSVGQTSVAAGQFSLQSRLQMRDLRGRIDDSKEQMNKAAGLLLSKLPEQLKPWADKYAGVKQVLESELKVIDDGVFGGSIKLKPQEFEKSIDNLTASTSDLRKHSLEALNSRLDYYHESSNMEFIPLAVVFGILVAMAVYLFACLQSSIRNSASGITTLAESLRDGNLCVEVPVQGRDELASISRALNVAVVQLRTSLLGVNQETVRVGDAVLILTAQSSGTLNEVEDQQQQISQIAAAATELAATSQGVARSCEQASESARHTRRIAEQSSEDSQRTTDSIQQLNQRLTETAAALGRVSEQGQQIQSVVDAIRGIAEQTNLLALNAAIEAARAGEQGRGFAVVADEVRSLSQRTQASTAQIAGTVDSLRSTVTQAVNLMEAACGQAVNDAQSVTGLGVRLGEIATAVQSVADTLAQISTAVEEQASTADEVSSNIQQVDQAAGRLLEGARAVNHAADTLSQGSRALNDNTARFRLS
>NZ_CP046035.1|WP_005891077.1|4373666_4374788_+|hypothetical-protein
MITPPTSPRIVAPPSRPQLSAGQKKFNTLMEKLETRRKLLEQWLSVSTTCDQLWVNELLPMINEQSENEINKLRLLDNAFDQVRLSKKDRATLLEIICVMTVSLLGGDHDDELKRLYFKYTGIDFDENERLENQRFKASLEAELGVELGDDVDLSSVEDVTRHVAEKMKEHAEQEQGAQKPKKPTANEIRREQEAAEGTQSLREIYRKLASALHPDREQDSEERERKTALMQRVNEAYENENLLALLQMQMEIEQIDQTHIDSISEKRLKHFNRILSEQLRELEDEIHDRKMMIRERFLMDPYEDIRPKTVNGKCAKQLKAIREHLDESQDELQELADPKNLKAWLRAQRDMAELLERAEEFDDLELLDTLFR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP046035_1	1.1\|4357414\|25\|NZ_CP046035\|CRISPRCasFinder	4357414-4357438	25	MG592546	Vibrio phage 1.179.O._10N.286.45.F12, partial genome	2883-2907	4	0.84
NZ_CP046035_1	1.1\|4357414\|25\|NZ_CP046035\|CRISPRCasFinder	4357414-4357438	25	MG592620	Vibrio phage 1.254.O._10N.286.45.C8, partial genome	2858-2882	4	0.84
NZ_CP046035_1	1.1\|4357414\|25\|NZ_CP046035\|CRISPRCasFinder	4357414-4357438	25	MG592623	Vibrio phage 1.257.O._10N.286.46.A4, partial genome	2874-2898	4	0.84
NZ_CP046035_1	1.1\|4357414\|25\|NZ_CP046035\|CRISPRCasFinder	4357414-4357438	25	NZ_CP013600	Rhizobium sp. N741 plasmid pRspN741e, complete sequence	12010-12034	4	0.84
NZ_CP046035_1	1.1\|4357414\|25\|NZ_CP046035\|CRISPRCasFinder	4357414-4357438	25	NZ_CP013504	Rhizobium esperanzae strain N561 plasmid pRspN561d, complete sequence	12010-12034	4	0.84
NZ_CP046035_1	1.1\|4357414\|25\|NZ_CP046035\|CRISPRCasFinder	4357414-4357438	25	NZ_CP013510	Rhizobium sp. N1341 plasmid pRspN1341e, complete sequence	12010-12034	4	0.84
NZ_CP046035_1	1.1\|4357414\|25\|NZ_CP046035\|CRISPRCasFinder	4357414-4357438	25	NZ_CP013521	Rhizobium sp. N113 plasmid pRspN113d, complete sequence	12010-12034	4	0.84
NZ_CP046035_1	1.1\|4357414\|25\|NZ_CP046035\|CRISPRCasFinder	4357414-4357438	25	NZ_CP013494	Rhizobium sp. N6212 plasmid pRspN6212d, complete sequence	12010-12034	4	0.84
NZ_CP046035_1	1.1\|4357414\|25\|NZ_CP046035\|CRISPRCasFinder	4357414-4357438	25	NZ_CP013594	Rhizobium sp. N871 plasmid pRspN871d, complete sequence	12010-12034	4	0.84

1. spacer 1.1|4357414|25|NZ_CP046035|CRISPRCasFinder matches to MG592546 (Vibrio phage 1.179.O._10N.286.45.F12, partial genome) position: , mismatch: 4, identity: 0.84

caatgcagcgcttcaggaaagccac	CRISPR spacer
ttatgcagcgcttcaagaaagccaa	Protospacer
. *************.********

2. spacer 1.1|4357414|25|NZ_CP046035|CRISPRCasFinder matches to MG592620 (Vibrio phage 1.254.O._10N.286.45.C8, partial genome) position: , mismatch: 4, identity: 0.84

caatgcagcgcttcaggaaagccac	CRISPR spacer
ttatgcagcgcttcaagaaagccaa	Protospacer
. *************.********

3. spacer 1.1|4357414|25|NZ_CP046035|CRISPRCasFinder matches to MG592623 (Vibrio phage 1.257.O._10N.286.46.A4, partial genome) position: , mismatch: 4, identity: 0.84

caatgcagcgcttcaggaaagccac	CRISPR spacer
ttatgcagcgcttcaagaaagccaa	Protospacer
. *************.********

4. spacer 1.1|4357414|25|NZ_CP046035|CRISPRCasFinder matches to NZ_CP013600 (Rhizobium sp. N741 plasmid pRspN741e, complete sequence) position: , mismatch: 4, identity: 0.84

caatgcagcgcttcaggaaagccac	CRISPR spacer
tcatgcggcgcttcaggaaagcgac	Protospacer
. ****.*************** **

5. spacer 1.1|4357414|25|NZ_CP046035|CRISPRCasFinder matches to NZ_CP013504 (Rhizobium esperanzae strain N561 plasmid pRspN561d, complete sequence) position: , mismatch: 4, identity: 0.84

caatgcagcgcttcaggaaagccac	CRISPR spacer
tcatgcggcgcttcaggaaagcgac	Protospacer
. ****.*************** **

6. spacer 1.1|4357414|25|NZ_CP046035|CRISPRCasFinder matches to NZ_CP013510 (Rhizobium sp. N1341 plasmid pRspN1341e, complete sequence) position: , mismatch: 4, identity: 0.84

caatgcagcgcttcaggaaagccac	CRISPR spacer
tcatgcggcgcttcaggaaagcgac	Protospacer
. ****.*************** **

7. spacer 1.1|4357414|25|NZ_CP046035|CRISPRCasFinder matches to NZ_CP013521 (Rhizobium sp. N113 plasmid pRspN113d, complete sequence) position: , mismatch: 4, identity: 0.84

caatgcagcgcttcaggaaagccac	CRISPR spacer
tcatgcggcgcttcaggaaagcgac	Protospacer
. ****.*************** **

8. spacer 1.1|4357414|25|NZ_CP046035|CRISPRCasFinder matches to NZ_CP013494 (Rhizobium sp. N6212 plasmid pRspN6212d, complete sequence) position: , mismatch: 4, identity: 0.84

caatgcagcgcttcaggaaagccac	CRISPR spacer
tcatgcggcgcttcaggaaagcgac	Protospacer
. ****.*************** **

9. spacer 1.1|4357414|25|NZ_CP046035|CRISPRCasFinder matches to NZ_CP013594 (Rhizobium sp. N871 plasmid pRspN871d, complete sequence) position: , mismatch: 4, identity: 0.84

caatgcagcgcttcaggaaagccac	CRISPR spacer
tcatgcggcgcttcaggaaagcgac	Protospacer
. ****.*************** **

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

2177619 : 2228538

Pseudomonas_phage(70.21%)

capsid,portal,head,protease,terminase,tail,integrase

attL 2166957:2166972|attR 2229633:2229648

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2166957:2166972	attL	NA	NA	NA	NA
WP_005897524.1\|2177619_2178723_-\|integrase	tyrosine-type recombinase/integrase	A0A0U4JIT5	Pseudomonas_phage	2.3e-128	61.0
WP_002553062.1\|2178703_2178946_-	excisionase	A0A2H4J5E1	uncultured_Caudovirales_phage	3.0e-09	45.6
WP_005897528.1\|2178982_2179312_-	hypothetical protein	NA	NA	NA	NA
WP_005897532.1\|2179436_2179649_+	hypothetical protein	NA	NA	NA	NA
WP_122381107.1\|2179818_2180580_-	hypothetical protein	A0A2H4IY33	uncultured_phage	1.4e-73	54.1
WP_042932682.1\|2180576_2180912_-	hypothetical protein	A0A1B0VM42	Pseudomonas_phage	2.9e-39	66.4
WP_005897537.1\|2181391_2181790_-	hypothetical protein	NA	NA	NA	NA
WP_042933093.1\|2182588_2183116_-	hypothetical protein	I6NP82	Burkholderia_phage	3.5e-18	37.1
WP_005897543.1\|2183161_2183581_+	hypothetical protein	NA	NA	NA	NA
WP_005897545.1\|2183577_2184435_-	phosphoadenosine phosphosulfate reductase family protein	A0A2K9VK66	Klebsiella_phage	3.5e-28	36.6
WP_147460270.1\|2184500_2185283_+	hypothetical protein	NA	NA	NA	NA
WP_005897549.1\|2185415_2185823_-	hypothetical protein	A0A0U4JNY7	Pseudomonas_phage	5.0e-41	64.3
WP_005897552.1\|2185928_2186249_+	hypothetical protein	NA	NA	NA	NA
WP_005897555.1\|2186351_2187164_-	DUF2303 family protein	K7ZMK3	Xanthomonas_citri_phage	5.7e-44	38.9
WP_005897557.1\|2187190_2187538_-	hypothetical protein	NA	NA	NA	NA
WP_005897559.1\|2187626_2188214_-	hypothetical protein	NA	NA	NA	NA
WP_005897562.1\|2188213_2188552_-	hypothetical protein	NA	NA	NA	NA
WP_005897565.1\|2188689_2188935_-	helix-turn-helix transcriptional regulator	A0A1W6JTA9	Pseudomonas_phage	1.8e-09	46.2
WP_005897566.1\|2189342_2189651_+	DUF1654 domain-containing protein	A0A2D1GND3	Pseudomonas_phage	7.9e-23	65.8
WP_005897568.1\|2189803_2190220_-	hypothetical protein	NA	NA	NA	NA
WP_005897570.1\|2190213_2190933_-	type II toxin-antitoxin system MqsA family antitoxin	NA	NA	NA	NA
WP_005897572.1\|2190929_2191319_-	hypothetical protein	NA	NA	NA	NA
WP_005897574.1\|2191543_2192377_-	helix-turn-helix domain-containing protein	H2BD63	Pseudomonas_phage	1.4e-50	42.3
WP_122381106.1\|2192466_2192676_+	hypothetical protein	A0A1B0Z2M2	Pseudomonas_phage	2.7e-14	63.3
WP_122381109.1\|2192804_2193227_+	Rha family transcriptional regulator	A0A2D1GNM7	Pseudomonas_phage	1.8e-30	52.8
WP_005897580.1\|2193355_2194117_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_005897582.1\|2194113_2194860_+	hypothetical protein	A0A2D1GNB3	Pseudomonas_phage	2.7e-93	67.8
WP_005897584.1\|2194856_2195162_+	DUF1364 domain-containing protein	A0A2D1GNQ4	Pseudomonas_phage	1.1e-40	82.3
WP_005897586.1\|2195158_2195590_+	VRR-NUC domain-containing protein	A0A2D1GNH3	Pseudomonas_phage	7.1e-54	73.4
WP_005897588.1\|2195586_2195898_+	hypothetical protein	A0A2H4J249	uncultured_Caudovirales_phage	1.0e-14	45.9
WP_005897590.1\|2195894_2197172_+\|integrase	site-specific integrase	A0A2D1GND4	Pseudomonas_phage	1.9e-115	51.0
WP_005897592.1\|2197174_2197546_+	hypothetical protein	NA	NA	NA	NA
WP_042933094.1\|2197542_2197863_+	hypothetical protein	A0A2D1GNG3	Pseudomonas_phage	7.4e-40	78.3
WP_005897596.1\|2197865_2198249_+	hypothetical protein	A0A1W6JTD2	Pseudomonas_phage	2.3e-32	51.6
WP_122381105.1\|2198789_2199161_+	chemotaxis protein	A0A059VK40	Pseudomonas_phage	6.3e-43	74.8
WP_024691600.1\|2199160_2199499_+	hypothetical protein	A0A059VJW1	Pseudomonas_phage	3.4e-27	72.2
WP_005897604.1\|2199554_2199785_+	hypothetical protein	A0A1S6UB66	Serratia_phage	6.3e-17	62.0
WP_005897608.1\|2199948_2200314_+	hypothetical protein	NA	NA	NA	NA
WP_005897610.1\|2200364_2200544_+	hypothetical protein	NA	NA	NA	NA
WP_005897612.1\|2200534_2200930_+	HNH endonuclease	A0A2D1GNP5	Pseudomonas_phage	1.7e-57	76.0
WP_005897614.1\|2201097_2201583_+\|terminase	phage terminase small subunit P27 family	A0A2D1GNP3	Pseudomonas_phage	4.2e-79	90.7
WP_005897617.1\|2201583_2203317_+\|terminase	terminase large subunit	A0A2D1GNU5	Pseudomonas_phage	0.0e+00	93.3
WP_154897054.1\|2203325_2203637_-	hypothetical protein	NA	NA	NA	NA
WP_005747050.1\|2203635_2204781_+\|portal	phage portal protein	A0A1V0E8B9	Vibrio_phage	7.1e-125	57.8
WP_005897623.1\|2204784_2205627_+\|protease	Clp protease ClpP	A0A1V0E8B8	Vibrio_phage	2.3e-88	62.3
WP_005897625.1\|2205638_2207024_+\|capsid	phage major capsid protein	H2BDB0	Pseudomonas_virus	3.6e-131	63.6
WP_005897627.1\|2207074_2207491_+	hypothetical protein	NA	NA	NA	NA
WP_005897628.1\|2207494_2207971_+\|head,tail	phage gp6-like head-tail connector protein	Q6JIM5	Burkholderia_virus	5.9e-09	31.2
WP_005897630.1\|2207970_2208309_+\|head	phage head closure protein	A0A1J0GUY4	Halomonas_phage	2.4e-28	60.0
WP_122355165.1\|2208301_2208787_+	HK97 gp10 family phage protein	A0A0U3TGT7	Pseudomonas_phage	6.6e-56	67.1
WP_003407814.1\|2208786_2209155_+	DUF3168 domain-containing protein	Q9MCA6	Pseudomonas_phage	1.9e-39	65.0
WP_005893573.1\|2209218_2209719_+	hypothetical protein	H2BDC0	Pseudomonas_virus	1.5e-58	67.6
WP_122358036.1\|2209728_2210166_+\|tail	phage tail protein	Q9MCA4	Pseudomonas_phage	9.5e-38	68.4
WP_005897639.1\|2210416_2212993_+\|tail	phage tail tape measure protein	A0A2H4PI09	Pseudomonas_phage	3.9e-171	48.5
WP_005897641.1\|2212992_2213337_+\|tail	tail protein	A0A2D1GNJ1	Pseudomonas_phage	6.7e-31	53.5
WP_005897643.1\|2213373_2214072_+\|tail	phage minor tail protein L	A0A2D1GNF3	Pseudomonas_phage	5.8e-106	79.2
WP_054998220.1\|2214074_2214857_+\|tail	phage tail protein	A0A2D1GNP8	Pseudomonas_phage	8.0e-120	73.5
WP_005893813.1\|2214853_2215441_+\|tail	tail assembly protein	A0A2D1GNM2	Pseudomonas_phage	2.5e-78	76.7
WP_042933095.1\|2215495_2219332_+\|tail	phage tail protein	A0A2D1GNE3	Pseudomonas_phage	0.0e+00	54.9
WP_005897651.1\|2219758_2220484_+	hypothetical protein	NA	NA	NA	NA
WP_042933096.1\|2220505_2221936_+\|tail	tail fiber domain-containing protein	NA	NA	NA	NA
WP_005897656.1\|2222001_2222535_+	glycoside hydrolase family 19 protein	A0A059VA40	Pseudomonas_phage	6.0e-87	89.3
WP_005897658.1\|2222531_2223062_+	DUF2514 domain-containing protein	A0A059VF51	Pseudomonas_phage	1.1e-48	75.3
WP_054989983.1\|2223237_2224032_+	DNA adenine methylase	C7BGE1	Burkholderia_phage	1.3e-101	66.9
WP_042932466.1\|2224066_2224285_+	hypothetical protein	A0A059VK06	Pseudomonas_phage	2.1e-09	51.5
WP_154897055.1\|2224281_2225526_+	SGNH/GDSL hydrolase family protein	A0A059VA35	Pseudomonas_phage	3.1e-211	89.1
WP_042931938.1\|2226579_2227566_+	type III effector	NA	NA	NA	NA
WP_005897385.1\|2228301_2228538_+	hypothetical protein	A0A059VA35	Pseudomonas_phage	4.3e-29	83.3
2229633:2229648	attR	NA	NA	NA	NA

DBSCAN-SWA_2

3204543 : 3215978

uncultured_Caudovirales_phage(62.5%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005892758.1\|3204543_3205911_-	putative transcriptional regulator	Q8W6N3	Burkholderia_virus	1.6e-86	40.6
WP_005892755.1\|3206512_3207421_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_005892752.1\|3207406_3208186_-	substrate-binding domain-containing protein	NA	NA	NA	NA
WP_024689656.1\|3208201_3209503_-	MFS transporter	Q6JIH2	Burkholderia_virus	9.6e-62	36.7
WP_005892746.1\|3209752_3210145_+	sulfurtransferase complex subunit TusD	A0A2H4JA39	uncultured_Caudovirales_phage	2.0e-55	80.8
WP_005892744.1\|3210146_3210509_+	sulfurtransferase complex subunit TusC	A0A2H4J8C0	uncultured_Caudovirales_phage	5.1e-37	65.3
WP_005892742.1\|3210508_3210808_+	sulfurtransferase complex subunit TusB	A0A2H4JG28	uncultured_Caudovirales_phage	1.7e-30	63.6
WP_005892740.1\|3210804_3211140_+	TusE/DsrC/DsvC family sulfur relay protein	A0A2H4J8B6	uncultured_Caudovirales_phage	6.8e-44	77.5
WP_005892738.1\|3211136_3212138_+	glycosyl transferase family protein	A0A2H4JBY5	uncultured_Caudovirales_phage	8.0e-165	84.4
WP_005892735.1\|3212246_3213245_+	glutathione S-transferase family protein	NA	NA	NA	NA
WP_024689660.1\|3213302_3214697_-	uroporphyrinogen-III C-methyltransferase	NA	NA	NA	NA
WP_005892733.1\|3214697_3215978_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	2.6e-96	45.6

DBSCAN-SWA_3

4882412 : 4956320

uncultured_Caudovirales_phage(47.27%)

capsid,holin,portal,lysis,head,bacteriocin,protease,terminase,tail,plate,tRNA,integrase

attL 4897126:4897142|attR 4937963:4937979

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005896877.1\|4882412_4883612_-\|tRNA	tyrosine--tRNA ligase	NA	NA	NA	NA
WP_005896875.1\|4883813_4885235_+	peptidoglycan DD-metalloendopeptidase family protein	G9BW84	Planktothrix_phage	2.5e-18	43.2
WP_005896872.1\|4885238_4886333_+	anhydro-N-acetylmuramic acid kinase	NA	NA	NA	NA
WP_002551953.1\|4886396_4886747_-	iron-sulfur cluster insertion protein ErpA	A0A2H4N7M3	Lake_Baikal_phage	7.4e-25	50.5
WP_005896868.1\|4886853_4887888_-	N-acetyl-gamma-glutamyl-phosphate reductase	NA	NA	NA	NA
WP_005896864.1\|4888021_4888450_+	protoporphyrinogen oxidase HemJ	NA	NA	NA	NA
WP_122381155.1\|4888547_4889477_+	DUF805 domain-containing protein	NA	NA	NA	NA
WP_005896860.1\|4889533_4890310_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_005896857.1\|4890411_4890750_+	histidine triad nucleotide-binding protein	NA	NA	NA	NA
WP_005896855.1\|4890870_4891518_+	2-polyprenyl-3-methyl-6-methoxy-1,4-benzoquinone monooxygenase	NA	NA	NA	NA
WP_005896853.1\|4891578_4892373_-	adenosylmethionine decarboxylase	NA	NA	NA	NA
WP_005896851.1\|4892616_4893039_-	OsmC family protein	NA	NA	NA	NA
WP_024670550.1\|4893262_4893907_+	cAMP-activated global transcriptional regulator CRP	NA	NA	NA	NA
WP_005896847.1\|4893918_4894614_-	lipoate--protein ligase family protein	NA	NA	NA	NA
WP_005896845.1\|4894644_4895481_-	indole-3-glycerol phosphate synthase TrpC	A0A0P0IR83	Acinetobacter_phage	8.1e-70	56.3
WP_005896843.1\|4895477_4896527_-	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	1.1e-111	58.0
WP_005896841.1\|4896548_4897148_-	aminodeoxychorismate/anthranilate synthase component II	A0A0P0IKJ1	Acinetobacter_phage	5.1e-74	64.2
4897126:4897142	attL	NA	NA	NA	NA
WP_005896839.1\|4897642_4898176_+	hypothetical protein	NA	NA	NA	NA
WP_005896837.1\|4898172_4898730_+	hypothetical protein	NA	NA	NA	NA
WP_031597625.1\|4898795_4899590_-	DNA adenine methylase	C7BGE1	Burkholderia_phage	1.4e-100	66.9
WP_005896833.1\|4899851_4900352_+	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_005896831.1\|4900380_4900776_+\|bacteriocin	bacteriocin	NA	NA	NA	NA
WP_005896829.1\|4900753_4901215_+	hypothetical protein	NA	NA	NA	NA
WP_005896827.1\|4901255_4901801_-	glycoside hydrolase family 19 protein	A0A2H4JHX4	uncultured_Caudovirales_phage	1.3e-68	71.3
WP_122381154.1\|4901839_4902883_-	late control protein	A0A2H4JBF6	uncultured_Caudovirales_phage	3.9e-146	77.1
WP_005896822.1\|4902975_4903182_-\|tail	phage tail protein	A0A2H4J9Z9	uncultured_Caudovirales_phage	1.8e-23	76.1
WP_005896820.1\|4903156_4904002_-\|tail	phage tail protein	A0A2H4J875	uncultured_Caudovirales_phage	8.3e-107	68.2
WP_005896818.1\|4904011_4906765_-\|tail	phage tail tape measure protein	A0A2H4JG00	uncultured_Caudovirales_phage	4.1e-110	42.1
WP_024660117.1\|4906903_4907206_-\|tail	phage tail assembly protein	A0A2H4J873	uncultured_Caudovirales_phage	2.5e-21	59.1
WP_024670873.1\|4907221_4907731_-\|tail	phage major tail tube protein	A0A2H4JBU0	uncultured_Caudovirales_phage	5.4e-69	74.3
WP_005896812.1\|4907743_4908907_-\|tail	phage tail sheath family protein	A0A2H4J869	uncultured_Caudovirales_phage	2.6e-183	82.6
WP_005896810.1\|4909000_4909543_-\|tail	tail fiber assembly protein	NA	NA	NA	NA
WP_005896808.1\|4909550_4911713_-\|tail	tail fiber protein H	A0A077K818	Ralstonia_phage	3.0e-84	53.2
WP_005896806.1\|4911709_4912315_-\|tail	phage tail protein I	A0A2H4JDH5	uncultured_Caudovirales_phage	9.6e-81	70.9
WP_005896804.1\|4912316_4913198_-\|plate	baseplate assembly protein	A0A2H4JFK9	uncultured_Caudovirales_phage	2.4e-112	71.2
WP_005896802.1\|4913194_4913521_-	hypothetical protein	A0A2H4JA09	uncultured_Caudovirales_phage	9.5e-35	65.7
WP_005896798.1\|4913845_4914430_-\|plate	phage baseplate assembly protein V	A0A2H4JG06	uncultured_Caudovirales_phage	9.0e-52	76.6
WP_005896795.1\|4914429_4914957_-	hypothetical protein	A0A2H4J881	uncultured_Caudovirales_phage	9.6e-53	58.3
WP_122381153.1\|4914949_4915606_-	hypothetical protein	A0A2H4JBV1	uncultured_Caudovirales_phage	7.2e-74	65.5
WP_005896789.1\|4915602_4915917_-	hypothetical protein	A0A2H4J879	uncultured_Caudovirales_phage	1.1e-27	57.3
WP_005896787.1\|4915919_4916915_-\|capsid	major capsid protein	A0A2H4J890	uncultured_Caudovirales_phage	4.7e-157	81.0
WP_005896785.1\|4917002_4917347_-\|head	head decoration protein	A0A2H4JF15	uncultured_Caudovirales_phage	1.0e-34	69.3
WP_005896784.1\|4917343_4918489_-\|protease	Clp protease ClpP	A0A2H4JDI2	uncultured_Caudovirales_phage	1.0e-131	66.6
WP_005896782.1\|4918485_4919967_-\|portal	phage portal protein	A0A2H4JFL5	uncultured_Caudovirales_phage	1.0e-221	77.2
WP_003377401.1\|4919963_4920170_-	hypothetical protein	A0A2H4JA19	uncultured_Caudovirales_phage	1.5e-22	77.9
WP_122381152.1\|4920171_4922202_-\|terminase	phage terminase large subunit family protein	A0A2H4J898	uncultured_Caudovirales_phage	0.0e+00	77.8
WP_005896780.1\|4922206_4922776_-	hypothetical protein	A0A2H4JG15	uncultured_Caudovirales_phage	8.5e-63	64.8
WP_005896774.1\|4923690_4924077_-	hypothetical protein	NA	NA	NA	NA
WP_005896772.1\|4924073_4924400_-\|holin	phage holin, lambda family	NA	NA	NA	NA
WP_122381151.1\|4924927_4925287_-	hypothetical protein	NA	NA	NA	NA
WP_122381150.1\|4925279_4927499_-	toprim domain-containing protein	A0A2D1GN57	Marinobacter_phage	6.0e-189	46.2
WP_005896768.1\|4927488_4927716_-	TraR/DksA family transcriptional regulator	NA	NA	NA	NA
WP_005896765.1\|4927708_4928227_-	hypothetical protein	NA	NA	NA	NA
WP_005896762.1\|4928537_4928795_-	hypothetical protein	NA	NA	NA	NA
WP_005896759.1\|4928882_4929665_+	helix-turn-helix transcriptional regulator	A0A1B0Z078	Pseudomonas_phage	3.8e-45	48.2
WP_005896756.1\|4929921_4930497_+	hypothetical protein	NA	NA	NA	NA
WP_005896753.1\|4930505_4930790_+	DNA-binding protein	NA	NA	NA	NA
WP_005896750.1\|4930930_4931305_+	hypothetical protein	NA	NA	NA	NA
WP_005896747.1\|4931301_4931625_+	transcriptional regulator	NA	NA	NA	NA
WP_005896743.1\|4931675_4932098_+	hypothetical protein	NA	NA	NA	NA
WP_005896740.1\|4932094_4932796_+	hypothetical protein	NA	NA	NA	NA
WP_005896736.1\|4932792_4933953_+	hypothetical protein	H2BDG4	Pseudomonas_virus	9.3e-40	46.1
WP_005896733.1\|4933949_4934150_+	AlpA family phage regulatory protein	NA	NA	NA	NA
WP_005896730.1\|4934476_4935544_+	hypothetical protein	NA	NA	NA	NA
WP_005896727.1\|4935540_4935933_+	hypothetical protein	NA	NA	NA	NA
WP_005896724.1\|4935925_4936579_+	hypothetical protein	NA	NA	NA	NA
WP_005896721.1\|4936622_4937804_-\|integrase	integrase arm-type DNA-binding domain-containing protein	Q8W6M6	Sinorhizobium_phage	1.1e-61	37.2
WP_005896718.1\|4938397_4938907_-\|lysis	lysis protein	A0A2H4JBH9	uncultured_Caudovirales_phage	6.1e-28	50.6
4937963:4937979	attR	NA	NA	NA	NA
WP_005896716.1\|4938903_4939449_-	glycoside hydrolase family 19 protein	A0A2H4JHX4	uncultured_Caudovirales_phage	2.4e-67	70.6
WP_122381156.1\|4939556_4940558_-\|tail	phage tail protein	NA	NA	NA	NA
WP_005896710.1\|4940866_4941433_-\|tail	phage tail protein	B5TK80	Pseudomonas_phage	5.1e-44	47.0
WP_005896706.1\|4941440_4942901_-	hypothetical protein	B5TK79	Pseudomonas_phage	1.4e-88	40.8
WP_005896702.1\|4942911_4943511_-	DUF2313 domain-containing protein	B5TK76	Pseudomonas_phage	1.4e-84	70.9
WP_005896699.1\|4943498_4944539_-\|plate	baseplate J/gp47 family protein	B5TK75	Pseudomonas_phage	2.6e-134	71.5
WP_005896695.1\|4944528_4944927_-	hypothetical protein	B5TK74	Pseudomonas_phage	2.0e-42	63.6
WP_005896692.1\|4944923_4945436_-\|plate	phage baseplate assembly protein	B5TK73	Pseudomonas_phage	3.9e-67	76.2
WP_005896689.1\|4945432_4946560_-	hypothetical protein	B5TK72	Pseudomonas_phage	1.2e-113	59.3
WP_005896685.1\|4946563_4948021_-	2-hydroxyacid dehydrogenase	B5TK71	Pseudomonas_phage	5.7e-103	43.7
WP_005896682.1\|4948017_4950177_-\|tail	phage tail tape measure protein	U5P420	Shigella_phage	7.9e-77	39.5
WP_005896678.1\|4950307_4950604_-\|tail	phage tail assembly protein	B5TK69	Pseudomonas_phage	1.6e-33	75.0
WP_005896677.1\|4950600_4950948_-\|tail	phage tail protein	B5TK68	Pseudomonas_phage	9.5e-41	69.6
WP_005896675.1\|4951009_4952506_-\|tail	tail sheath protein	B5TK67	Pseudomonas_phage	1.2e-233	79.9
WP_005896672.1\|4952524_4952713_-	DUF2635 domain-containing protein	B5TK66	Pseudomonas_phage	1.4e-14	73.5
WP_053480332.1\|4952709_4953300_-	hypothetical protein	B5TK65	Pseudomonas_phage	3.5e-51	52.0
WP_024670563.1\|4953344_4953683_-	hypothetical protein	A0A059VJW1	Pseudomonas_phage	4.9e-18	59.5
WP_024670564.1\|4953663_4954053_-	hypothetical protein	A0A059VK40	Pseudomonas_phage	5.1e-43	74.8
WP_005896669.1\|4954316_4954754_-	hypothetical protein	A0A2H4J8A5	uncultured_Caudovirales_phage	2.7e-24	46.3
WP_005896667.1\|4954943_4955555_+	helix-turn-helix domain-containing protein	A0A0M4QWY1	Salmonella_phage	3.6e-51	50.0
WP_005896665.1\|4955706_4955955_+	DUF1654 domain-containing protein	A0A0H5ARP1	Pseudomonas_phage	1.2e-05	41.2
WP_005896663.1\|4956077_4956320_+	transcriptional regulator	A0A2H4J8B4	uncultured_Caudovirales_phage	4.3e-16	50.0

DBSCAN-SWA_4

5085017 : 5138551

Bacteriophage(18.75%)

tRNA,holin,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005896431.1\|5085017_5085965_+\|holin	choline ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_005896429.1\|5086032_5086878_+\|holin	choline ABC transporter permease subunit	NA	NA	NA	NA
WP_005896426.1\|5086874_5088053_+\|holin	choline ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.8e-25	37.1
WP_005896424.1\|5088308_5089562_+	serine hydroxymethyltransferase	A0A240F3L3	Aeromonas_phage	5.4e-102	54.4
WP_005896422.1\|5089579_5090830_+	sarcosine oxidase subunit beta family protein	NA	NA	NA	NA
WP_005896420.1\|5090845_5091142_+	sarcosine oxidase subunit delta	NA	NA	NA	NA
WP_122381141.1\|5091138_5094159_+	sarcosine oxidase subunit alpha	NA	NA	NA	NA
WP_005896413.1\|5094210_5094843_+	sarcosine oxidase subunit gamma family protein	NA	NA	NA	NA
WP_024691243.1\|5095092_5095950_+	formyltetrahydrofolate deformylase	NA	NA	NA	NA
WP_005896407.1\|5095999_5097199_+	formaldehyde dehydrogenase, glutathione-independent	A0A2K9L7I1	Tupanvirus	1.1e-11	27.8
WP_154897069.1\|5097242_5098217_-	RHS repeat-associated core domain-containing protein	A0A1W5K0N1	Bacteriophage	4.4e-27	40.7
WP_154897070.1\|5098274_5099312_-	RHS repeat-associated core domain-containing protein	A0A1W5K0N1	Bacteriophage	3.5e-30	46.5
WP_005896405.1\|5099540_5100104_+	DUF2780 domain-containing protein	NA	NA	NA	NA
WP_005896403.1\|5100083_5101151_-	RHS repeat-associated core domain-containing protein	B6SD27	Bacteriophage	7.5e-28	42.2
WP_005896402.1\|5101222_5102116_-	acyltransferase	NA	NA	NA	NA
WP_005896400.1\|5102309_5102813_+\|protease	ATP-dependent zinc protease	NA	NA	NA	NA
WP_042932966.1\|5103037_5103667_-	glutathione S-transferase	NA	NA	NA	NA
WP_024670531.1\|5103741_5103924_-	hypothetical protein	NA	NA	NA	NA
WP_005896394.1\|5103920_5105054_-	PepSY domain-containing protein	NA	NA	NA	NA
WP_005896392.1\|5105359_5107066_-\|holin	choline dehydrogenase	A0A1V0SI18	Klosneuvirus	5.5e-49	30.0
WP_005896390.1\|5107207_5108680_-	betaine-aldehyde dehydrogenase	NA	NA	NA	NA
WP_005896387.1\|5108785_5109379_-	transcriptional regulator BetI	NA	NA	NA	NA
WP_005896385.1\|5109688_5111077_-	GTPase/DUF3482 domain-containing protein	A0A0R6PFW5	Moraxella_phage	3.4e-57	37.5
WP_024670536.1\|5111069_5112449_-	DUF2868 domain-containing protein	NA	NA	NA	NA
WP_005896378.1\|5112574_5113087_+	dihydrofolate reductase	F8SJN4	Pseudomonas_phage	1.2e-28	40.9
WP_005896376.1\|5113276_5114335_+	hypothetical protein	NA	NA	NA	NA
WP_005896375.1\|5114395_5115130_-\|tRNA	tRNA (guanosine(46)-N7)-methyltransferase TrmB	NA	NA	NA	NA
WP_005896373.1\|5115140_5115935_-	thiazole synthase	NA	NA	NA	NA
WP_005896371.1\|5115986_5116187_-	sulfur carrier protein ThiS	NA	NA	NA	NA
WP_005896368.1\|5116286_5116667_-	DUF423 domain-containing protein	NA	NA	NA	NA
WP_005896367.1\|5116747_5117458_+	monofunctional biosynthetic peptidoglycan transglycosylase	NA	NA	NA	NA
WP_003402233.1\|5117567_5118422_-	RNA polymerase sigma factor RpoH	A0A248SJA5	Salicola_phage	7.3e-42	38.9
WP_005896364.1\|5118540_5119575_-	cell division protein FtsX	NA	NA	NA	NA
WP_003411930.1\|5119571_5120243_-	cell division ATP-binding protein FtsE	W6JKT0	Anomala_cuprea_entomopoxvirus	5.0e-14	25.8
WP_005896359.1\|5120239_5121784_-	signal recognition particle-docking protein FtsY	NA	NA	NA	NA
WP_005896356.1\|5122040_5123393_+	insulinase family protein	G3MBJ8	Bacillus_virus	1.9e-20	24.6
WP_005896354.1\|5123389_5124892_+	insulinase family protein	NA	NA	NA	NA
WP_005896352.1\|5124891_5125482_+	16S rRNA (guanine(966)-N(2))-methyltransferase RsmD	NA	NA	NA	NA
WP_042932962.1\|5125656_5126706_+	hydrolase	NA	NA	NA	NA
WP_005896349.1\|5126713_5127571_-	sulfurtransferase	NA	NA	NA	NA
WP_005896347.1\|5127626_5128289_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_005896345.1\|5128621_5129101_+	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	1.3e-27	42.4
WP_002555640.1\|5129199_5129451_+	YfhL family 4Fe-4S dicluster ferredoxin	A0A1B1IWY9	uncultured_Mediterranean_phage	1.2e-21	61.4
WP_005896342.1\|5129459_5129798_-	hypothetical protein	NA	NA	NA	NA
WP_005896340.1\|5129893_5130706_-	bifunctional DNA-formamidopyrimidine glycosylase/DNA-(apurinic or apyrimidinic site) lyase	A0A127AWE5	Bacillus_phage	5.3e-18	28.1
WP_005896338.1\|5130751_5131618_-	HDOD domain-containing protein	NA	NA	NA	NA
WP_005896337.1\|5131803_5132343_+	type 1 glutamine amidotransferase	A0A0N7KVR4	Yellowstone_lake_phycodnavirus	1.8e-17	34.3
WP_005896336.1\|5132449_5133646_+	class I SAM-dependent rRNA methyltransferase	NA	NA	NA	NA
WP_005896335.1\|5133773_5134520_-	conjugal transfer protein TraX	NA	NA	NA	NA
WP_005896333.1\|5134619_5135660_+	low specificity L-threonine aldolase	NA	NA	NA	NA
WP_005896332.1\|5135783_5137226_+	TldD/PmbA family protein	NA	NA	NA	NA
WP_024670422.1\|5137225_5138551_+\|protease	Zn-dependent protease	NA	NA	NA	NA

DBSCAN-SWA_5

5296249 : 5345624

Paramecium_bursaria_Chlorella_virus(22.22%)

protease,integrase,plate

attL 5296135:5296167|attR 5303597:5303629

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
5296135:5296167	attL	NA	NA	NA	NA
WP_042932943.1\|5296249_5298208_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_147460290.1\|5298431_5299196_-	hypothetical protein	NA	NA	NA	NA
WP_147460289.1\|5299290_5300784_-	AAA family ATPase	NA	NA	NA	NA
WP_005896033.1\|5300963_5301539_+	recombinase family protein	A0A219Y9V9	Aeromonas_phage	6.0e-24	41.3
WP_005896031.1\|5301513_5302149_-	hypothetical protein	NA	NA	NA	NA
WP_005896029.1\|5302306_5302789_+	helix-turn-helix transcriptional regulator	A0A142K654	Streptomyces_phage	8.9e-05	39.1
WP_005896027.1\|5303957_5304437_-	hypothetical protein	NA	NA	NA	NA
5303597:5303629	attR	NA	NA	NA	NA
WP_080268066.1\|5304987_5305221_+	hypothetical protein	NA	NA	NA	NA
WP_042932937.1\|5305519_5306266_+	hypothetical protein	NA	NA	NA	NA
WP_005896023.1\|5306276_5306750_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_005896021.1\|5306864_5307413_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_024670252.1\|5307573_5308068_+	hypothetical protein	NA	NA	NA	NA
WP_005896015.1\|5308087_5309362_-	OprD family porin	NA	NA	NA	NA
WP_005896011.1\|5310017_5311124_-	agmatine deiminase	A7IVE6	Paramecium_bursaria_Chlorella_virus	1.7e-104	50.0
WP_005896010.1\|5311129_5312008_-	N-carbamoylputrescine amidase	A7IVZ1	Paramecium_bursaria_Chlorella_virus	4.6e-76	48.1
WP_122381268.1\|5312320_5315233_-	aminotransferase	A0A1V0SKB7	Klosneuvirus	6.6e-18	23.6
WP_005896004.1\|5315460_5316543_+	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	1.8e-101	55.1
WP_005896002.1\|5316623_5317169_+	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A291LA62	Escherichia_phage	2.0e-53	57.5
WP_032619206.1\|5317339_5319148_+	sensor histidine kinase	NA	NA	NA	NA
WP_005895997.1\|5319144_5320530_+	sigma-54-dependent Fis family transcriptional regulator	NA	NA	NA	NA
WP_005895995.1\|5320516_5320990_+	thioesterase	NA	NA	NA	NA
WP_005895993.1\|5321083_5321926_-	3'(2'),5'-bisphosphate nucleotidase CysQ	NA	NA	NA	NA
WP_005895991.1\|5321922_5322489_-	ADP compounds hydrolase NudE	NA	NA	NA	NA
WP_005895989.1\|5322585_5323248_+	GMP/IMP nucleotidase	NA	NA	NA	NA
WP_024670241.1\|5323365_5324247_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_005895988.1\|5324350_5325187_+	formate dehydrogenase accessory sulfurtransferase FdhD	NA	NA	NA	NA
WP_053931984.1\|5325183_5327520_+	FdhF/YdeP family oxidoreductase	NA	NA	NA	NA
WP_005895984.1\|5327736_5328174_+	hypothetical protein	NA	NA	NA	NA
WP_005895980.1\|5328245_5330180_-	RecQ family ATP-dependent DNA helicase	F2NZ48	Diadromus_pulchellus_ascovirus	6.5e-54	40.5
WP_005895978.1\|5330328_5331147_+	hypothetical protein	NA	NA	NA	NA
WP_005895972.1\|5331772_5333944_-\|protease	M48 family metalloprotease	NA	NA	NA	NA
WP_005895970.1\|5334655_5335405_+	hypothetical protein	NA	NA	NA	NA
WP_003318241.1\|5335474_5336008_+	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_005895961.1\|5336022_5337525_+	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_005895957.1\|5337555_5338038_+\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_005895954.1\|5338037_5339870_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_005895951.1\|5339833_5340904_+\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_005895948.1\|5340900_5343504_+	type VI secretion system ATPase TssH	A0A0A8J958	Klebsiella_phage	1.4e-88	30.7
WP_080267969.1\|5343528_5344284_+	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_005895938.1\|5344280_5345624_+\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage