CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP020948	Rhizobium sp. CIAT894 plasmid pRheCIAT894a, complete sequence	0 crisprs	NA	0	1
NZ_CP020952	Rhizobium sp. CIAT894 plasmid pRheCIAT894e, complete sequence	0 crisprs	csa3,WYL	0	64
NZ_CP020947	Rhizobium sp. CIAT894 chromosome, complete genome	1 crisprs	WYL,csa3,cas3,DEDDh	1	4
NZ_CP020951	Rhizobium sp. CIAT894 plasmid pRheCIAT894d, complete sequence	0 crisprs	WYL,csa3,DEDDh	0	0
NZ_CP020949	Rhizobium sp. CIAT894 plasmid pRheCIAT894b, complete sequence	0 crisprs	RT	0	0
NZ_CP020950	Rhizobium sp. CIAT894 plasmid pRheCIAT894c, complete sequence	0 crisprs	RT	0	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP020947_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP020947_1

1374288-1374369

Orphan

Consensus_repeat	Method
AAATAAAGCATGTCGCGCAAAAGTGT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP020947_1

>merge|NZ_CP020947|1|1374288-1374369|CRISPRCasFinder
AAATAAAGCATGTCGCGCAAAAGTGTAGAGCGGTTTTGCGGCACCGACATGCGCACAAACAAAGCATGTCGCGCAAAAGTGT

>NZ_CP020947|1|1|1374288-1374369|CRISPRCasFinder
AAATAAAGCATGTCGCGCAAAAGTGT	AGAGCGGTTTTGCGGCACCGACATGCGCAC
AAACAAAGCATGTCGCGCAAAAGTGT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP020947.1\|WP_085736726.1\|1376908_1377904_+\|aldo/keto-reductase	unknown	unknown	gnl\|CDD\|381312
NZ_CP020947.1\|WP_085736720.1\|1367996_1370231_+\|bifunctional-(p)ppGpp-synthetase/guanosine-3',5'-bis(diphosphate)-3'-pyrophosphohydrolase	unknown	unknown	gnl\|CDD\|223394
NZ_CP020947.1\|WP_010065637.1\|1366518_1367100_-\|NYN-domain-containing-protein	unknown	unknown	gnl\|CDD\|350235
NZ_CP020947.1\|WP_085736725.1\|1376026_1376797_+\|DNA-repair-protein-RecO	unknown	unknown	gnl\|CDD\|234622
NZ_CP020947.1\|WP_003574253.1\|1371366_1371771_+\|holo-ACP-synthase	unknown	unknown	gnl\|CDD\|234610
NZ_CP020947.1\|WP_085736727.1\|1379928_1381806_-\|EAL-domain-containing-protein	unknown	unknown	gnl\|CDD\|227334
NZ_CP020947.1\|WP_085738885.1\|1364874_1365759_+\|4-hydroxy-tetrahydrodipicolinate-synthase	unknown	unknown	gnl\|CDD\|235107
NZ_CP020947.1\|WP_003574261.1\|1367396_1367801_+\|DNA-directed-RNA-polymerase-subunit-omega	unknown	unknown	gnl\|CDD\|234744
NZ_CP020947.1\|WP_085736722.1\|1371884_1372628_+\|signal-peptidase-I	unknown	unknown	gnl\|CDD\|182787
NZ_CP020947.1\|WP_085736719.1\|1365957_1366437_+\|SsrA-binding-protein-SmpB	unknown	unknown	gnl\|CDD\|235455
NZ_CP020947.1\|WP_085736721.1\|1370737_1371328_+\|DUF2062-domain-containing-protein	unknown	unknown	gnl\|CDD\|225757
NZ_CP020947.1\|WP_003578269.1\|1372624_1373344_+\|ribonuclease-III	unknown	unknown	gnl\|CDD\|171444
NZ_CP020947.1\|WP_010068264.1\|1375457_1375943_+\|response-regulator	unknown	unknown	gnl\|CDD\|381122
NZ_CP020947.1\|WP_010069412.1\|1378147_1379005_-\|MOSC-domain-containing-protein	unknown	unknown	gnl\|CDD\|225758
NZ_CP020947.1\|WP_010067866.1\|1383283_1384180_-\|mechanosensitive-ion-channel	unknown	unknown	gnl\|CDD\|366370
NZ_CP020947.1\|WP_010068549.1\|1382243_1382585_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP020947.1\|WP_010069413.1\|1379125_1379770_-\|HD-domain-containing-protein	unknown	unknown	gnl\|CDD\|182251
NZ_CP020947.1\|WP_085736728.1\|1382713_1383229_+\|superoxide-dismutase-family-protein	unknown	unknown	gnl\|CDD\|376292
NZ_CP020947.1\|WP_003578264.1\|1370425_1370575_+\|DUF3563-family-protein	unknown	unknown	gnl\|CDD\|288904
NZ_CP020947.1\|WP_085736724.1\|1374604_1375357_+\|Crp/Fnr-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223736

Protein	Function_ID	Function_description	E-value
NZ_CP020947.1\|WP_085736726.1\|1376908_1377904_+\|aldo/keto-reductase	gnl\|CDD\|381312	cd19086, AKR_AKR11C1, AKR11C family of aldo-keto reductase (AKR). Bacillus subtilis uncharacterized oxidoreductase YqkF is a founding member of aldo-keto reductase family 11 member C1 (AKR11C1). It may function as oxidoreductase. This family also includes Bacillus halodurans AKR11C1, an NADPH-dependent 4-hydroxy-2,3-trans-nonenal reductase.	1.29324e-85
NZ_CP020947.1\|WP_085736720.1\|1367996_1370231_+\|bifunctional-(p)ppGpp-synthetase/guanosine-3',5'-bis(diphosphate)-3'-pyrophosphohydrolase	gnl\|CDD\|223394	COG0317, SpoT, Guanosine polyphosphate pyrophosphohydrolases/synthetases [Signal transduction mechanisms / Transcription].	0
NZ_CP020947.1\|WP_010065637.1\|1366518_1367100_-\|NYN-domain-containing-protein	gnl\|CDD\|350235	cd10911, PIN_LabA, PIN domain of Synechococcus elongatus LabA (low-amplitude and bright) and related proteins. This subfamily contains Synechococcus elongatus PCC 7942 LabA which participates in cyanobacterial circadian timing, it is required for negative feedback regulation of the autokinase/autophosphatase KaiC, a central component of the circadian clock system, and appears to be necessary for KaiC-dependent repression of gene expression. This subfamily belongs to the LabA-like domain family which includes the N-terminal domain of limkain b1, a human autoantigen localized to a subset of ABCD3 and PXF marked peroxisomes. Also included in the LabA-like domain family are human ZNF451, uncharacterized Bacillus subtilis YqxD, uncharacterized Escherichia coli YaiI, and the N-terminal domain of a well-conserved group of mainly bacterial proteins with no defined function, which contain a C-terminal LabA_like_C domain. Curiously Pseudomonas putida S16 NicB , which is described as a putative NADH-dependent hydroxylase involved in the microbial degradation of nicotine also falls into the LabA-like family. The PIN (PilT N terminus) domain belongs to a large nuclease superfamily. The structural properties of the PIN domain indicate its active center, consisting of three highly conserved catalytic residues which coordinate metal ions; in some members, additional metal coordinating residues can be found while some others lack several of these key catalytic residues. The PIN active site is geometrically similar in the active center of structure-specific 5' nucleases, PIN-domain ribonucleases of eukaryotic rRNA editing proteins, and bacterial toxins of toxin-antitoxin (TA) operons.	1.89305e-65
NZ_CP020947.1\|WP_085736725.1\|1376026_1376797_+\|DNA-repair-protein-RecO	gnl\|CDD\|234622	PRK00085, recO, DNA repair protein RecO; Reviewed.	2.74668e-68
NZ_CP020947.1\|WP_003574253.1\|1371366_1371771_+\|holo-ACP-synthase	gnl\|CDD\|234610	PRK00070, acpS, 4'-phosphopantetheinyl transferase; Provisional.	4.65079e-65
NZ_CP020947.1\|WP_085736727.1\|1379928_1381806_-\|EAL-domain-containing-protein	gnl\|CDD\|227334	COG5001, COG5001, Predicted signal transduction protein containing a membrane domain, an EAL and a GGDEF domain [Signal transduction mechanisms].	2.00465e-115
NZ_CP020947.1\|WP_085738885.1\|1364874_1365759_+\|4-hydroxy-tetrahydrodipicolinate-synthase	gnl\|CDD\|235107	PRK03170, PRK03170, dihydrodipicolinate synthase; Provisional.	5.06842e-170
NZ_CP020947.1\|WP_003574261.1\|1367396_1367801_+\|DNA-directed-RNA-polymerase-subunit-omega	gnl\|CDD\|234744	PRK00392, rpoZ, DNA-directed RNA polymerase subunit omega; Reviewed.	2.39873e-25
NZ_CP020947.1\|WP_085736722.1\|1371884_1372628_+\|signal-peptidase-I	gnl\|CDD\|182787	PRK10861, PRK10861, signal peptidase I.	4.09055e-54
NZ_CP020947.1\|WP_085736719.1\|1365957_1366437_+\|SsrA-binding-protein-SmpB	gnl\|CDD\|235455	PRK05422, smpB, SsrA-binding protein SmpB.	1.37727e-88
NZ_CP020947.1\|WP_085736721.1\|1370737_1371328_+\|DUF2062-domain-containing-protein	gnl\|CDD\|225757	COG3216, COG3216, Uncharacterized protein conserved in bacteria [Function unknown].	4.65411e-60
NZ_CP020947.1\|WP_003578269.1\|1372624_1373344_+\|ribonuclease-III	gnl\|CDD\|171444	PRK12371, PRK12371, ribonuclease III; Reviewed.	4.68147e-156
NZ_CP020947.1\|WP_010068264.1\|1375457_1375943_+\|response-regulator	gnl\|CDD\|381122	cd17586, REC_PFxFATGY, phosphoacceptor receiver (REC) domain of PFxFATGY motif single-domain (stand-alone) response regulators. This subfamily is composed of stand-alone response regulators (RRs) containing the PFxFATG[G/Y] motif; RRs with such a motif are also called ''FAT GUY'' response regulators. Included in this subfamily are Sphingomonas melonis SdrG, Sinorhizobium meliloti Sma0114, and Erythrobacter litoralis EL_LovR. SdrG is involved in the control of the general stress response. Sma0114 is part of the Sma0113/Sma0114 two-component system (TCS) that is involved in catabolite repression and polyhydroxy butyrate synthesis. EL_LovR is involved in a light-regulated TCS. PFxFATG[G/Y] RRs are typically associated with histidine-tryptophan-glutamate (HWE) histidine kinases that constitute a subclass of the larger histidine kinase superfamily characterized by an altered ATP binding site, which lacks the F-box that is normally an integral component of the ATP lid. The PFxFATG[G/Y] motif is involved in conformational changes after phosphorylation that results in the activation of the RR. REC domains function as phosphorylation-mediated switches within response regulators, but some also transfer phosphoryl groups in multistep phosphorelays.	1.65319e-22
NZ_CP020947.1\|WP_010069412.1\|1378147_1379005_-\|MOSC-domain-containing-protein	gnl\|CDD\|225758	COG3217, COG3217, Uncharacterized Fe-S protein [General function prediction only].	3.92194e-91
NZ_CP020947.1\|WP_010067866.1\|1383283_1384180_-\|mechanosensitive-ion-channel	gnl\|CDD\|366370	pfam00924, MS_channel, Mechanosensitive ion channel. Two members of this protein family of M. jannaschii have been functionally characterized. Both proteins form mechanosensitive (MS) ion channels upon reconstitution into liposomes and functional examination by the patch-clamp technique. Therefore this family are likely to also be MS channel proteins.	4.8112e-58
NZ_CP020947.1\|WP_010069413.1\|1379125_1379770_-\|HD-domain-containing-protein	gnl\|CDD\|182251	PRK10119, PRK10119, putative hydrolase; Provisional.	1.03156e-63
NZ_CP020947.1\|WP_085736728.1\|1382713_1383229_+\|superoxide-dismutase-family-protein	gnl\|CDD\|376292	pfam00080, Sod_Cu, Copper/zinc superoxide dismutase (SODC). superoxide dismutases (SODs) catalyze the conversion of superoxide radicals to hydrogen peroxide and molecular oxygen. Three evolutionarily distinct families of SODs are known, of which the copper/zinc-binding family is one. Defects in the human SOD1 gene cause familial amyotrophic lateral sclerosis (Lou Gehrig's disease). Structure is an eight-stranded beta sandwich, similar to the immunoglobulin fold.	2.32118e-44
NZ_CP020947.1\|WP_003578264.1\|1370425_1370575_+\|DUF3563-family-protein	gnl\|CDD\|288904	pfam12086, DUF3563, Protein of unknown function (DUF3563). This family of proteins is functionally uncharacterized. This protein is found in bacteria. Proteins in this family are about 50 amino acids in length. This protein has conserved AYL and DLE sequence motifs.	0.00198331
NZ_CP020947.1\|WP_085736724.1\|1374604_1375357_+\|Crp/Fnr-family-transcriptional-regulator	gnl\|CDD\|223736	COG0664, Crp, cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms].	3.29883e-39

>NZ_CP020947.1|WP_003578269.1|1372624_1373344_+|ribonuclease-III
MSKAQTLSAADRAKLEGLIGHDFAEKERLDRALTHASARTEKGGNYERLEFLGDRVLGLCIAELLFRTFGTAGEGELSVRLNQLVSAETCAAVADELNLHLYIRTGADVKKLTGKRMMNVRADVVESLIAAIYLDGGLEVARRFILRYWQGRAVRADGAKRDAKTELQEWSHAKFGVTPNYRVDERSGPDHDPRFKVTVEVAGIKPETGVERSKRAAEQVAATKMLEREGIWQQSPAGN
>NZ_CP020947.1|WP_085736722.1|1371884_1372628_+|signal-peptidase-I
MSEKVQAKPNALWENIKVIIQALILAMVIRTVLFQPFTIPSGSMMPTLLVGDYIFVNKFAYGYSKYSLPFSPDIFSGRLFGADPKRGDIVVFRFPPNPEVDYIKRCIGLPGDHVQVTDGVLYVNGKPVPKVADGTFTSDYKLDPGADVPVFRETLDNGKTYDTLDQSPVSRGDNTREFIVPEGHYFMMGDNRDNSLDSRFDVGFVPAENLVGRASVIFFSLGNDTSFREIWKWPTNMRWDRLFKVVE
>NZ_CP020947.1|WP_003574253.1|1371366_1371771_+|holo-ACP-synthase
MIIGIGSDLIDIRRVEKSIERFGDRFTHRCFTEVERARSDRRANRGASYAKRFAAKEACSKALGTGIAQGVFWKDMGVVNLPSGKPTMVLSGAAALILESMLPAGHRPAIHLTITDDYPLAQAFVIIEALPENL
>NZ_CP020947.1|WP_085736721.1|1370737_1371328_+|DUF2062-domain-containing-protein
MLFRRRKPAGFKEKMRELLWPRKGFLRPIRYLSMRILRLSASPHAVAAGVAAGVFVSWTPFIGVHFIMAFVITYFLSGSMVAAALGCAAFGNPLTYPFIWGITWEIGHLLLSREDHLAGQTVDLAALFHKLNFMELWKPVLEPMLVGAIPPAIVTSVALYALTFYTVKGFQTRRHTRLLERARLRLASPAGDMPSV
>NZ_CP020947.1|WP_003578264.1|1370425_1370575_+|DUF3563-family-protein
MFDPIRKIARALRAPTAQEREMAYLNGSFDRIDLEFRQRQVDRGLFRNR
>NZ_CP020947.1|WP_085736720.1|1367996_1370231_+|bifunctional-(p)ppGpp-synthetase/guanosine-3',5'-bis(diphosphate)-3'-pyrophosphohydrolase
MMRQYELVERVQQYKPDANEALLNKAYVYAMQKHGQQKRASGDPYISHPLEVAAILTDMHLDESTIAVALLHDTIEDTTATRAEIDELFGEDIGRLVEGLTKIKKLDLVTKKAKQAENLRKLLLAISDDVRVLLVKLADRLHNMRTLDHMSADKRARISEETMEIYAPLAGRMGMQDMREELEELSFRHMNPEAYETVTKRLEELSKRNEGIVKKIEAELRDLLVASGLTSAYVKGRQKKPYSVFRKMQSKSLSFEQLSDVYGFRLIVEDIPSCYRALGIVHTRWRVVPGRFKDYISTPKQNDYRSLHTTIVGPSSQRIELQIRTKRMHEIAEFGIAAHTLYKDGATNADGDILSRESNAYSWLRHTIEALAEGDSPEEFLEHTKLELFQDQVFCFTPKGKLIALPRGATPIDFAYAVHTNIGDTTVGAKINGRIMPLVTRLANGDEVEIIRSGVQVPPAAWEEIVVTGKARAAIRRATRMAIRKQYAGLGHRILERTFDRAGKIFSREAMKPALHRLGQKDVEDAIAAVGRGEMSSLDVLRAVYPDHQDERVTVKPSGDDGWFNVRSAAGMIFKIPGKAKPGLDGSHPEVDTDVDIGPIRGLSGNVDVKFASTGAVPGDRIVGIMDQGKGITIYPIQSPSLQRFDDQPDRWIDVRWDLDEANKSRFMARIMVNGLNEPGTLAKVAQTVAGLDVNIRLLNTVRVAADFTEMMLEVEVWDLRQLNQLLAQMKDLDCIATVRRLYE
>NZ_CP020947.1|WP_003574261.1|1367396_1367801_+|DNA-directed-RNA-polymerase-subunit-omega
MARVTVEDCIDKVENRFELVLLASHRARLISQGASITIDRDNDKNPVVALREIADETLSPDDLKEDLIHSLQKHVEVDEPEPDPASMIAAGGVAAADSEEQDDLPETITFDQMSEEELLAGIEGLVPPEKSDDY
>NZ_CP020947.1|WP_010065637.1|1366518_1367100_-|NYN-domain-containing-protein
MFDPREKIALFIDGANLYAASKSLGFDIDYRKLLKAFQKRGYLLRAYYYTALIEDQEYSSIRPLIDWLDYNGYKVVTKPAKEFTDSMGRRKIKGNMDIELAIDAMEQSETVDHLVIFSGDGDFTNLVEALQRRGRKVSVISTMATQPPMIADDLRRQADHFIDLLSLKAEIGRDPAERAPRQAEVAPASDFED
>NZ_CP020947.1|WP_085736719.1|1365957_1366437_+|SsrA-binding-protein-SmpB
MAPKGSQRVVNKVVAENRKARFNYEIIDTYEAGLVLMGTEVKSLREGKANIAESYASDEDGEIWLINSYLPEYLQANRFNHEPRRRRKLLLSGREIHRLRSAVNREGMTLIPLKIYFNDRGRAKMELALAKGKKLHDKRESEKERDWNRQKSRLLKDNG
>NZ_CP020947.1|WP_085738885.1|1364874_1365759_+|4-hydroxy-tetrahydrodipicolinate-synthase
MFNGSIPALVTPFTDSGLIDEDSFAAHVDWQIKEGSGGLVPVGTTGESPTLSHAEHKRVVELCIEVAAKRVPVMAGAGSNNTGEAIELAQHAEKVGADAVLVVTPYYNKPTQKGLIAHFSAIAEAVDLPIYIYNIPGRSVVDMTPETMGALARAHRNIVGVKDATGKIERVSEQRITCGKDFRQLSGEDATALGFNAHGGVGCISVTANVAPRLCADFQAATLKGDYASALEYQDRLMPLHKAIFLEPGLCGAKYGLSRLGRMSRNVRSPLLSTLEPATEAAIDAALRHAGLLN
>NZ_CP020947.1|WP_085736724.1|1374604_1375357_+|Crp/Fnr-family-transcriptional-regulator
MATSKRIHSFKTPCEQCPLRPLPHFREFSRDELEFVSHFKRGELAVDAGSTILVEGAHSAHLFTVLSGWGFRYKMLEDGRRQILNYIMPGDLIGLQGTIAGEMQHSVEALSPVSLCVFERDRLMTLYNKHPSLAFDITWIAAREERILDEHLLSIGRRTALERAAYLLAFLFERGRQLGLFNGRKFIPITQQHIADTLGLSIVHTNKTLKKLGERGLIRWQERSCEVLNGEELLAISGWEGLGEGKRPFI
>NZ_CP020947.1|WP_010068264.1|1375457_1375943_+|response-regulator
MFYSKMVAEFTDSVPCGAPEGNDVGEKAGALRQAPDGGHGLMSAIRVLVLEDSLIIAMEAEDMLRLAGVESIDIVGSVEQARAAISAQTYDFALLDVNLGEGMSFGFARHLLDIGIPFGFVSGYSDTGDFPPDLQHIPLLVKPFDETAMREFLLRLFPAVA
>NZ_CP020947.1|WP_085736725.1|1376026_1376797_+|DNA-repair-protein-RecO
MQWQDHAIILGVKRHGETSVIAEVMTRDRGRHLGLVRSGRSRAMQPVLQAGNAVEVLWRARLDEHLGEFRVEPVTLRAARLMETATAVYGVQAMGALLRLLPERDPHPHLFDALEVILDHLHNPADAGELFVRFELAVLNDLGFGLDLAECAATGARSDLAYVSPKSGRAISRSAGAPWADKMLLLPPFLSIEGNQAADFDSLAAAFRLTGFFLHRHVYEPRGIEAVAARDGFVQAALKALNPALRTLSAPDGVSA
>NZ_CP020947.1|WP_085736726.1|1376908_1377904_+|aldo/keto-reductase
MLTKTASPTTITLWNGREIPRLGMGCWAIGGPFFAGDTPLGWGDVDDNESVEAINRAIELGIRFFDTASNYGAGHSEEVLGLAVGNRDDVVVATKFGFATDPATKQAIGAFADEAFIRRSVETSLRRLKRDRLDLLQFHINDFPLEQSDAVFDTLEALRTEGKIDAFGWSTDFPDRAARHARRQGYVSVQHTMNVFEPVPEMIAVIDGKGLISINRGPLAMGLLTGKFTADKAVGAKDVRGAALDWMVYFKDGRMAPEFAARLDAVRDLLTSGGRTLTQGALAWLWAKSPRTLPIPGFRTVAQVEENAGALEKGPLPADVMAEIDVALDRV
>NZ_CP020947.1|WP_010069412.1|1378147_1379005_-|MOSC-domain-containing-protein
MHISDLFIYPLKSARGIALPAADIDAQGLSGDRRAMITDPEGHFITQRELPDLARIALRPEPGAFRLLMEGKPELSVPPPRPETRTDVTVWKSTVSAAVADPDSNRRLSEWLGREVRLVFFDGQARRTANAEWAGEGTPVTFTDGYQILVTTTGSLKALNADLAAHGEGSVGMERFRPNIVIDIDEAWPEDRWAAIEISGIRFDLVKPCSRCIMTTQDQLTGSREGPNPMPSMGRIRMSADRRVPGPLFGWNVTPRGSGRITIGDTVKIVEERPEGWALKVRARS
>NZ_CP020947.1|WP_010069413.1|1379125_1379770_-|HD-domain-containing-protein
MFEAEAFSPHETLAAALIAHAADGDDGSHDLAHIFRVFRNAMRIHAGEGGDGRVLAASVLLHDCVAVEKNSPLRAKASALAAEKASAILAELGWSKADIDAAAHAITAHSFSAGVAPQTLEAKILQDADRLDAIGMVGAARCFYIAGRLGSGLYDPFDPTAEHRPLDDKRYAIDHFQTKLFKLAEGFQTETGRRLAAARDKSLRDFLSAFMNEI
>NZ_CP020947.1|WP_085736727.1|1379928_1381806_-|EAL-domain-containing-protein
MKAEALFWQQCSQAVTADGSVDAQRLMELVIATYRVHESDYDEIERSAETLLQENHALRGNISALSQAFDGQQRLFEIILNNLPLGLSVFDADQRLTLSNIRFAQLFGLTQDDVTVGATIADLIAKMRGAEGAGAKPDRRIGRHSPAIAASGSIRRREWLMDDGRTIQSMVTILADGSSIAMHADITEDRKAAERITYLAHHDPLTGLPNRIHFREQVDAALIERKPDGQIALVHLNLDRFKSINNTMGVSVGDKILQQVAERIRASAGSKNVLARLGSDEFAILQTARQQPWNVTALAEQIRDELSEPFFHGEKQVELSVSMGIAIAPGDGEETDILLKHAGVALSHAKADGRKRERFFDSEMEAQMQLRHALEADLRAAVATDEFELHYQPLYDLSQRRICGFEALIRWNHPVRGRVAPMDFIPLAEEVGLIVDIGRWVLRQACSDAAQWPEDIKVAVNVSAIQFSGSDLTKDVGEALAAASLSPSRLELEITESVLMENLDEVLPILHALKERGIRISMDDFGTGYSSLSYLSSFPFDKIKIDKSFVSDIAGNKEAHALMHAIILLGDALGMRVTVEGVETAAQLTLLECEECDEIQGYHISPPRPARDVPHLLSLSPRTAA
>NZ_CP020947.1|WP_010068549.1|1382243_1382585_+|hypothetical-protein
MTSTTSVSDTSYAYLATLSRLDSNGDGVLSRGERAADEKPGIIKELLEDDRTNETQPRFSGSLIALMMDTRDSGTASNIAVPYPLQQTAPTSGDQSDVLYRNTYGQFDFNAVA
>NZ_CP020947.1|WP_085736728.1|1382713_1383229_+|superoxide-dismutase-family-protein
MKAMCTIAALSLLAVALPAGAQDKQTAIANFVGKDGKEDGRAQLTAAANGGVLIEVEISGLPANKWVAFHVHETGRCDAATHHESAGGHFNPGKAEHGILAAKGPHAGDLPNQYVGQDGMLRAQVFDSMVTLDGKTDGIRGRALMVHANSDDYRSQPSGDAGERLSCGVIQ
>NZ_CP020947.1|WP_010067866.1|1383283_1384180_-|mechanosensitive-ion-channel
MEQQAADVLLATQTALSQASALAVQYSFSVLGAVILLVLGWTLAGFASRWAYEGLSRVHGIDETLARFFTNVLRYVLLILVFITVLGQFGVQTASIIAALGAAGLAIGLALQGTLQNIAAGIMLLILRPFRVGEYIETSSVAGTVREIGLFATELRTTDGLYRLAPNSTLWNTPITNFSREATRQNELKIKVADEDDLDQAMERLMGLAKADSRVLTSPAPSVFIDSLGDNAIAVTLRYWAKTGDWWVVSRDMVKRVKLAFDEKANDKPAVVANVSDTAPAKTSNGRATAKKPAPTRQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP035000	Rhizobium acidisoli strain FH23 plasmid pRapFH23b, complete sequence	565934-565963	3	0.9
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP035000	Rhizobium acidisoli strain FH23 plasmid pRapFH23b, complete sequence	102047-102076	4	0.867
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP020951	Rhizobium sp. CIAT894 plasmid pRheCIAT894d, complete sequence	97289-97318	4	0.867
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP050092	Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b6, complete sequence	389435-389464	5	0.833
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP020897	Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5a, complete sequence	103-132	5	0.833
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP021026	Rhizobium sp. TAL182 plasmid pRetTAL182b, complete sequence	85-114	5	0.833
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP013553	Rhizobium phaseoli strain N931 plasmid pRphaN931a, complete sequence	103-132	5	0.833
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP013597	Rhizobium sp. N741 plasmid pRspN741b, complete sequence	6-35	5	0.833
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP013559	Rhizobium phaseoli strain N841 plasmid pRphaN841b, complete sequence	103-132	5	0.833
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP013576	Rhizobium phaseoli strain N671 plasmid pRphaN671b, complete sequence	103-132	5	0.833
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP013548	Rhizobium phaseoli strain R611 plasmid pRetR611a, complete sequence	103-132	5	0.833
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP013528	Rhizobium phaseoli strain R723 plasmid pRphaR723a, complete sequence	103-132	5	0.833
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP013533	Rhizobium phaseoli strain R650 plasmid pRphaR650a, complete sequence	103-132	5	0.833
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP013538	Rhizobium phaseoli strain R630 plasmid pRphaR630a, complete sequence	103-132	5	0.833
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP013543	Rhizobium phaseoli strain R620 plasmid pRphaR620a, complete sequence	103-132	5	0.833
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP013564	Rhizobium phaseoli strain N831 plasmid pRphaN831a, complete sequence	103-132	5	0.833
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP013501	Rhizobium esperanzae strain N561 plasmid pRspN561a, complete sequence	6-35	5	0.833
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NC_020062	Rhizobium tropici CIAT 899 plasmid pRtrCIAT899c, complete sequence	486569-486598	5	0.833
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP013581	Rhizobium phaseoli strain N261 plasmid pRphaN261a, complete sequence	103-132	5	0.833
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP013507	Rhizobium sp. N1341 plasmid pRspN1341b, complete sequence	6-35	5	0.833
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP013518	Rhizobium sp. N113 plasmid pRspN113a, complete sequence	6-35	5	0.833
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP013570	Rhizobium phaseoli strain N771 plasmid pRphaN771b, complete sequence	103-132	5	0.833
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP013491	Rhizobium sp. N6212 plasmid pRspN6212a, complete sequence	6-35	5	0.833
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP013513	Rhizobium sp. N1314 plasmid pRspN1314b, complete sequence	6-35	5	0.833
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP013496	Rhizobium sp. N621 plasmid pRspN621a, complete sequence	6-35	5	0.833
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP013591	Rhizobium sp. N871 plasmid pRspN871a, complete sequence	6-35	5	0.833
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP013603	Rhizobium sp. N731 plasmid pRspN731b, complete sequence	6-35	5	0.833
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP053440	Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eF, complete sequence	706466-706495	5	0.833
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP024314	Rhizobium sp. NXC24 plasmid pRspNXC24c, complete sequence	1988936-1988965	5	0.833
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP050092	Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b6, complete sequence	791945-791974	6	0.8
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NC_007762	Rhizobium etli CFN 42 plasmid p42a, complete sequence	44570-44599	6	0.8
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NC_011371	Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG204, complete sequence	146080-146109	6	0.8
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP053440	Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eF, complete sequence	908330-908359	6	0.8
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP021127	Rhizobium sp. Kim5 plasmid pRetKim5c, complete sequence	54390-54419	6	0.8
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP021127	Rhizobium sp. Kim5 plasmid pRetKim5c, complete sequence	275268-275297	6	0.8
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	CP007644	Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803c, complete sequence	287697-287726	6	0.8
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NC_012848	Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132501, complete sequence	680357-680386	6	0.8
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP050098	Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b4, complete sequence	837681-837710	6	0.8
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP050098	Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b4, complete sequence	635747-635776	6	0.8
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP054028	Rhizobium sp. JKLM19E plasmid pPR19E01, complete sequence	849421-849450	6	0.8
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP022567	Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK03, complete sequence	104993-105022	6	0.8
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP032685	Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence	307428-307457	6	0.8
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP032690	Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence	307427-307456	6	0.8
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP025013	Rhizobium leguminosarum strain Norway plasmid pRLN1, complete sequence	287486-287515	6	0.8
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP025017	Rhizobium leguminosarum strain Norway plasmid pRLN5, complete sequence	160189-160218	6	0.8
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP013635	Rhizobium sp. N324 plasmid pRspN324e, complete sequence	495319-495348	6	0.8
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP013524	Rhizobium phaseoli strain R744 plasmid pRphaR744b, complete sequence	76-105	6	0.8
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP013586	Rhizobium phaseoli strain N161 plasmid pRphaN161a, complete sequence	103-132	6	0.8
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP054022	Rhizobium sp. JKLM12A2 plasmid pPR12A201, complete sequence	594233-594262	6	0.8
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP050094	Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b4, complete sequence	24352-24381	6	0.8
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP050082	Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b4, complete sequence	575331-575360	6	0.8
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP050099	Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b5, complete sequence	241898-241927	6	0.8
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP050105	Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b6, complete sequence	551833-551862	6	0.8
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP049732	Rhizobium leguminosarum strain A1 plasmid pRL11, complete sequence	239606-239635	6	0.8
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP025507	Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvA, complete sequence	1052720-1052749	6	0.8
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP050110	Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b4, complete sequence	551835-551864	6	0.8
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP054023	Rhizobium sp. JKLM12A2 plasmid pPR12A202, complete sequence	53831-53860	6	0.8
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP022666	Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR1, complete sequence	476257-476286	6	0.8
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP053208	Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1B, complete sequence	212857-212886	6	0.8
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP053208	Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1B, complete sequence	473168-473197	6	0.8
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP050086	Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b7, complete sequence	72171-72200	6	0.8
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP018229	Rhizobium leguminosarum strain Vaf-108 plasmid unnamed1, complete sequence	1211765-1211794	6	0.8
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP020951	Rhizobium sp. CIAT894 plasmid pRheCIAT894d, complete sequence	435129-435158	7	0.767
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	CP007644	Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803c, complete sequence	55998-56027	7	0.767
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP013634	Rhizobium sp. N324 plasmid pRspN324d, complete sequence	349359-349388	7	0.767
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP049732	Rhizobium leguminosarum strain A1 plasmid pRL11, complete sequence	516782-516811	7	0.767
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP006990	Rhizobium sp. IE4771 plasmid pRetIE4771d, complete sequence	55776-55805	7	0.767
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP006990	Rhizobium sp. IE4771 plasmid pRetIE4771d, complete sequence	288634-288663	7	0.767
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP049248	Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed2, complete sequence	115958-115987	7	0.767
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP050083	Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b3, complete sequence	485247-485276	7	0.767
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP049733	Rhizobium leguminosarum strain A1 plasmid pRL10, complete sequence	472925-472954	7	0.767
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP022667	Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR2, complete sequence	176475-176504	7	0.767
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP053207	Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1C, complete sequence	501969-501998	7	0.767
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP025508	Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvB, complete sequence	461100-461129	7	0.767
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP016287	Rhizobium leguminosarum strain Vaf10 plasmid unnamed1, complete sequence	643876-643905	7	0.767
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP030764	Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed4, complete sequence	401201-401230	7	0.767
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP049249	Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence	709944-709973	7	0.767
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP050087	Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b5, complete sequence	459884-459913	7	0.767
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP018229	Rhizobium leguminosarum strain Vaf-108 plasmid unnamed1, complete sequence	687056-687085	7	0.767
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_AP014579	Burkholderia sp. RPE67 plasmid p1, complete sequence	614263-614292	7	0.767
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NC_016626	Burkholderia sp. YI23 plasmid byi_1p, complete sequence	474683-474712	7	0.767
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP022567	Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK03, complete sequence	86531-86560	8	0.733
NZ_CP020947_1	1.1\|1374314\|30\|NZ_CP020947\|CRISPRCasFinder	1374314-1374343	30	NZ_CP021373	Rhizobium sp. ACO-34A plasmid pRACO34Ac, complete sequence	247628-247657	8	0.733

1. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP035000 (Rhizobium acidisoli strain FH23 plasmid pRapFH23b, complete sequence) position: , mismatch: 3, identity: 0.9

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gcagcggttttgcggcaccgacatgcgcaa	Protospacer
. ***************************

2. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP035000 (Rhizobium acidisoli strain FH23 plasmid pRapFH23b, complete sequence) position: , mismatch: 4, identity: 0.867

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gcagcggttttgcggcaacgacatgcgcaa	Protospacer
. *************** ***********

3. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP020951 (Rhizobium sp. CIAT894 plasmid pRheCIAT894d, complete sequence) position: , mismatch: 4, identity: 0.867

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gcagcggttttgcggcaacgacatgcgcaa	Protospacer
. *************** ***********

4. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP050092 (Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b6, complete sequence) position: , mismatch: 5, identity: 0.833

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gcagcggttttgcggcaacgacatgcgtaa	Protospacer
. *************** *********.*

5. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP020897 (Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5a, complete sequence) position: , mismatch: 5, identity: 0.833

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gcagcggttttgcggcaacgacatgcgtaa	Protospacer
. *************** *********.*

6. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP021026 (Rhizobium sp. TAL182 plasmid pRetTAL182b, complete sequence) position: , mismatch: 5, identity: 0.833

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gcagcggttttgcggcaacgacatgcgtaa	Protospacer
. *************** *********.*

7. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP013553 (Rhizobium phaseoli strain N931 plasmid pRphaN931a, complete sequence) position: , mismatch: 5, identity: 0.833

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gcagcggttttgcggcaacgacatgcgtaa	Protospacer
. *************** *********.*

8. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP013597 (Rhizobium sp. N741 plasmid pRspN741b, complete sequence) position: , mismatch: 5, identity: 0.833

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gcagcggttttgcggcaacgacatgcgtaa	Protospacer
. *************** *********.*

9. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP013559 (Rhizobium phaseoli strain N841 plasmid pRphaN841b, complete sequence) position: , mismatch: 5, identity: 0.833

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gcagcggttttgcggcaacgacatgcgtaa	Protospacer
. *************** *********.*

10. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP013576 (Rhizobium phaseoli strain N671 plasmid pRphaN671b, complete sequence) position: , mismatch: 5, identity: 0.833

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gcagcggttttgcggcaacgacatgcgtaa	Protospacer
. *************** *********.*

11. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP013548 (Rhizobium phaseoli strain R611 plasmid pRetR611a, complete sequence) position: , mismatch: 5, identity: 0.833

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gcagcggttttgcggcaacgacatgcgtaa	Protospacer
. *************** *********.*

12. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP013528 (Rhizobium phaseoli strain R723 plasmid pRphaR723a, complete sequence) position: , mismatch: 5, identity: 0.833

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gcagcggttttgcggcaacgacatgcgtaa	Protospacer
. *************** *********.*

13. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP013533 (Rhizobium phaseoli strain R650 plasmid pRphaR650a, complete sequence) position: , mismatch: 5, identity: 0.833

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gcagcggttttgcggcaacgacatgcgtaa	Protospacer
. *************** *********.*

14. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP013538 (Rhizobium phaseoli strain R630 plasmid pRphaR630a, complete sequence) position: , mismatch: 5, identity: 0.833

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gcagcggttttgcggcaacgacatgcgtaa	Protospacer
. *************** *********.*

15. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP013543 (Rhizobium phaseoli strain R620 plasmid pRphaR620a, complete sequence) position: , mismatch: 5, identity: 0.833

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gcagcggttttgcggcaacgacatgcgtaa	Protospacer
. *************** *********.*

16. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP013564 (Rhizobium phaseoli strain N831 plasmid pRphaN831a, complete sequence) position: , mismatch: 5, identity: 0.833

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gcagcggttttgcggcaacgacatgcgtaa	Protospacer
. *************** *********.*

17. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP013501 (Rhizobium esperanzae strain N561 plasmid pRspN561a, complete sequence) position: , mismatch: 5, identity: 0.833

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gcagcggttttgcggcaacgacatgcgtaa	Protospacer
. *************** *********.*

18. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NC_020062 (Rhizobium tropici CIAT 899 plasmid pRtrCIAT899c, complete sequence) position: , mismatch: 5, identity: 0.833

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gcagcggttttgcgacaacgacatgcgcaa	Protospacer
. ************.** ***********

19. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP013581 (Rhizobium phaseoli strain N261 plasmid pRphaN261a, complete sequence) position: , mismatch: 5, identity: 0.833

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gcagcggttttgcggcaacgacatgcgtaa	Protospacer
. *************** *********.*

20. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP013507 (Rhizobium sp. N1341 plasmid pRspN1341b, complete sequence) position: , mismatch: 5, identity: 0.833

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gcagcggttttgcggcaacgacatgcgtaa	Protospacer
. *************** *********.*

21. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP013518 (Rhizobium sp. N113 plasmid pRspN113a, complete sequence) position: , mismatch: 5, identity: 0.833

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gcagcggttttgcggcaacgacatgcgtaa	Protospacer
. *************** *********.*

22. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP013570 (Rhizobium phaseoli strain N771 plasmid pRphaN771b, complete sequence) position: , mismatch: 5, identity: 0.833

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gcagcggttttgcggcaacgacatgcgtaa	Protospacer
. *************** *********.*

23. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP013491 (Rhizobium sp. N6212 plasmid pRspN6212a, complete sequence) position: , mismatch: 5, identity: 0.833

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gcagcggttttgcggcaacgacatgcgtaa	Protospacer
. *************** *********.*

24. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP013513 (Rhizobium sp. N1314 plasmid pRspN1314b, complete sequence) position: , mismatch: 5, identity: 0.833

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gcagcggttttgcggcaacgacatgcgtaa	Protospacer
. *************** *********.*

25. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP013496 (Rhizobium sp. N621 plasmid pRspN621a, complete sequence) position: , mismatch: 5, identity: 0.833

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gcagcggttttgcggcaacgacatgcgtaa	Protospacer
. *************** *********.*

26. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP013591 (Rhizobium sp. N871 plasmid pRspN871a, complete sequence) position: , mismatch: 5, identity: 0.833

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gcagcggttttgcggcaacgacatgcgtaa	Protospacer
. *************** *********.*

27. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP013603 (Rhizobium sp. N731 plasmid pRspN731b, complete sequence) position: , mismatch: 5, identity: 0.833

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gcagcggttttgcggcaacgacatgcgtaa	Protospacer
. *************** *********.*

28. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP053440 (Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eF, complete sequence) position: , mismatch: 5, identity: 0.833

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gcagcggttttgcggcaacgacatgcgtaa	Protospacer
. *************** *********.*

29. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP024314 (Rhizobium sp. NXC24 plasmid pRspNXC24c, complete sequence) position: , mismatch: 5, identity: 0.833

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gcagcggttttgcgacaacgacatgcgcaa	Protospacer
. ************.** ***********

30. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP050092 (Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b6, complete sequence) position: , mismatch: 6, identity: 0.8

-agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
ctgtgc-gttttgcgacaacgacatgcgcag	Protospacer
  * ** ********.** ***********

31. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NC_007762 (Rhizobium etli CFN 42 plasmid p42a, complete sequence) position: , mismatch: 6, identity: 0.8

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gcagcggttttgcggcaacgacatgcgtta	Protospacer
. *************** *********.

32. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NC_011371 (Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG204, complete sequence) position: , mismatch: 6, identity: 0.8

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gtagcggttttgcggcaacgacatgcgtca	Protospacer
. *************** *********.

33. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP053440 (Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eF, complete sequence) position: , mismatch: 6, identity: 0.8

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gcagcggttttgcgacaacgacatgcgcga	Protospacer
. ************.** **********.

34. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP021127 (Rhizobium sp. Kim5 plasmid pRetKim5c, complete sequence) position: , mismatch: 6, identity: 0.8

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gcagcggttttgcggcaacgacatgcgtga	Protospacer
. *************** *********..

35. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP021127 (Rhizobium sp. Kim5 plasmid pRetKim5c, complete sequence) position: , mismatch: 6, identity: 0.8

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gcagcggttttgcggcaacgacatgcgaga	Protospacer
. *************** ********* .

36. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to CP007644 (Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803c, complete sequence) position: , mismatch: 6, identity: 0.8

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gcagcggttttgcggcaacgacatgcgaga	Protospacer
. *************** ********* .

37. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NC_012848 (Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132501, complete sequence) position: , mismatch: 6, identity: 0.8

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gcagcggttttgcgacaacgacatgcgtaa	Protospacer
. ************.** *********.*

38. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP050098 (Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b4, complete sequence) position: , mismatch: 6, identity: 0.8

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gcagcggttttgcgacaacgacatgcgcga	Protospacer
. ************.** **********.

39. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP050098 (Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b4, complete sequence) position: , mismatch: 6, identity: 0.8

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gcagcggttttgcggcaacgtcatgcgtaa	Protospacer
. *************** ** ******.*

40. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP054028 (Rhizobium sp. JKLM19E plasmid pPR19E01, complete sequence) position: , mismatch: 6, identity: 0.8

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gcagcggttttgcgacaacgacatgcgtag	Protospacer
. ************.** *********.*

41. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP022567 (Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK03, complete sequence) position: , mismatch: 6, identity: 0.8

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gcagcggttttgcgacaacgacatgcgcta	Protospacer
. ************.** **********

42. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP032685 (Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence) position: , mismatch: 6, identity: 0.8

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gcagcggttttgcgacaacgacatgcgaaa	Protospacer
. ************.** ********* *

43. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP032690 (Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence) position: , mismatch: 6, identity: 0.8

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gcagcggttttgcgacaacgacatgcgaaa	Protospacer
. ************.** ********* *

44. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP025013 (Rhizobium leguminosarum strain Norway plasmid pRLN1, complete sequence) position: , mismatch: 6, identity: 0.8

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gcagcggttttgcgacaacgacatgcgtaa	Protospacer
. ************.** *********.*

45. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP025017 (Rhizobium leguminosarum strain Norway plasmid pRLN5, complete sequence) position: , mismatch: 6, identity: 0.8

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gcagcggttttgcgacaacgacatgcgtaa	Protospacer
. ************.** *********.*

46. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP013635 (Rhizobium sp. N324 plasmid pRspN324e, complete sequence) position: , mismatch: 6, identity: 0.8

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gaagcgcttttgcggcaacgacatgcgaaa	Protospacer
..**** ********** ********* *

47. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP013524 (Rhizobium phaseoli strain R744 plasmid pRphaR744b, complete sequence) position: , mismatch: 6, identity: 0.8

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gcagcggttttgctgcaacgacatgcgtaa	Protospacer
. *********** *** *********.*

48. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP013586 (Rhizobium phaseoli strain N161 plasmid pRphaN161a, complete sequence) position: , mismatch: 6, identity: 0.8

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gcagcggttttgcggcaacgacatgggtaa	Protospacer
. *************** ******* *.*

49. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP054022 (Rhizobium sp. JKLM12A2 plasmid pPR12A201, complete sequence) position: , mismatch: 6, identity: 0.8

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gcagcggttttgcggtaacgacatgcggaa	Protospacer
. *************.* ********* *

50. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP050094 (Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b4, complete sequence) position: , mismatch: 6, identity: 0.8

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gcagcggttttgcgacaacgacatgcggaa	Protospacer
. ************.** ********* *

51. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP050082 (Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b4, complete sequence) position: , mismatch: 6, identity: 0.8

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gcagcggttttgcgacaacgacatgcgtaa	Protospacer
. ************.** *********.*

52. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP050099 (Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b5, complete sequence) position: , mismatch: 6, identity: 0.8

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gcagcggttttgcggcaacggcatgcgtaa	Protospacer
. *************** **.******.*

53. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP050105 (Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b6, complete sequence) position: , mismatch: 6, identity: 0.8

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gcagcggttttgcgacaacgacatgcgtaa	Protospacer
. ************.** *********.*

54. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP049732 (Rhizobium leguminosarum strain A1 plasmid pRL11, complete sequence) position: , mismatch: 6, identity: 0.8

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gcagcggttttgcggcaacggcatgcgtaa	Protospacer
. *************** **.******.*

55. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP025507 (Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvA, complete sequence) position: , mismatch: 6, identity: 0.8

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gcagcggttttgcggtagcgacatgcggaa	Protospacer
. *************.* ********* *

56. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP050110 (Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b4, complete sequence) position: , mismatch: 6, identity: 0.8

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gcagcggttttgcgacaacgacatgcgtaa	Protospacer
. ************.** *********.*

57. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP054023 (Rhizobium sp. JKLM12A2 plasmid pPR12A202, complete sequence) position: , mismatch: 6, identity: 0.8

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gcagcggttttgcggcaacggcatgcgtaa	Protospacer
. *************** **.******.*

58. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP022666 (Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR1, complete sequence) position: , mismatch: 6, identity: 0.8

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gcagcggttttgcggtagcgacatgcggaa	Protospacer
. *************.* ********* *

59. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP053208 (Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1B, complete sequence) position: , mismatch: 6, identity: 0.8

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gcagcggttttgcggcaacggcatgcgtaa	Protospacer
. *************** **.******.*

60. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP053208 (Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1B, complete sequence) position: , mismatch: 6, identity: 0.8

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gcagcggttttgcgacaacgacatgcgtaa	Protospacer
. ************.** *********.*

61. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP050086 (Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b7, complete sequence) position: , mismatch: 6, identity: 0.8

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gcagcggttttgcggtagcgacatgcggaa	Protospacer
. *************.* ********* *

62. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP018229 (Rhizobium leguminosarum strain Vaf-108 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

-agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
ctgtgc-gttttgcgacaacgacatgcgcag	Protospacer
  * ** ********.** ***********

63. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP020951 (Rhizobium sp. CIAT894 plasmid pRheCIAT894d, complete sequence) position: , mismatch: 7, identity: 0.767

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gccgcggttttgcggcaacgacatgcgtga	Protospacer
.  ************** *********..

64. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to CP007644 (Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803c, complete sequence) position: , mismatch: 7, identity: 0.767

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gcagcggttttgcgacaacgacatgcgtga	Protospacer
. ************.** *********..

65. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP013634 (Rhizobium sp. N324 plasmid pRspN324d, complete sequence) position: , mismatch: 7, identity: 0.767

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gcagcggttttgcgacaacgacatgcgtta	Protospacer
. ************.** *********.

66. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP049732 (Rhizobium leguminosarum strain A1 plasmid pRL11, complete sequence) position: , mismatch: 7, identity: 0.767

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gctgcggttttgcgacaacgacatgcgtaa	Protospacer
.  ***********.** *********.*

67. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP006990 (Rhizobium sp. IE4771 plasmid pRetIE4771d, complete sequence) position: , mismatch: 7, identity: 0.767

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gcagcggttttgcgacaacgacatgcgtga	Protospacer
. ************.** *********..

68. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP006990 (Rhizobium sp. IE4771 plasmid pRetIE4771d, complete sequence) position: , mismatch: 7, identity: 0.767

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gcagcggttttgcggcaacgacgtgcgaga	Protospacer
. *************** ****.**** .

69. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP049248 (Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.767

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gcagcggttttgcggtaacgacatgcggtg	Protospacer
. *************.* *********

70. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP050083 (Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b3, complete sequence) position: , mismatch: 7, identity: 0.767

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gcggcggttttgcgacaacgacatgcgtaa	Protospacer
. .***********.** *********.*

71. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP049733 (Rhizobium leguminosarum strain A1 plasmid pRL10, complete sequence) position: , mismatch: 7, identity: 0.767

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gcggcggttttgcgacaacgacatgcgtaa	Protospacer
. .***********.** *********.*

72. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP022667 (Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR2, complete sequence) position: , mismatch: 7, identity: 0.767

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gccgcggttttgcgacaacgacatgcgtaa	Protospacer
.  ***********.** *********.*

73. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP053207 (Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1C, complete sequence) position: , mismatch: 7, identity: 0.767

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gcggcggttttgcgacaacgacatgcgtaa	Protospacer
. .***********.** *********.*

74. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP025508 (Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvB, complete sequence) position: , mismatch: 7, identity: 0.767

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gccgcggttttgcgacaacgacatgcgtaa	Protospacer
.  ***********.** *********.*

75. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP016287 (Rhizobium leguminosarum strain Vaf10 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gccgcggttttgcgataccgacatgcgtaa	Protospacer
.  ***********..***********.*

76. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP030764 (Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed4, complete sequence) position: , mismatch: 7, identity: 0.767

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gccgcggttttgcgacaacgacatgcgtaa	Protospacer
.  ***********.** *********.*

77. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP049249 (Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.767

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gctgcggttttgcggtaacgacatgcgatc	Protospacer
.  ************.* *********  *

78. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP050087 (Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b5, complete sequence) position: , mismatch: 7, identity: 0.767

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gccgcggttttgcgacaacgacatgcgtaa	Protospacer
.  ***********.** *********.*

79. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP018229 (Rhizobium leguminosarum strain Vaf-108 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

agagcggttttgcggcaccgacatg-cgcac	CRISPR spacer
gcagcggttttgcgacaacgacatgttgta-	Protospacer
. ************.** ******* .*.*

80. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_AP014579 (Burkholderia sp. RPE67 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.767

--agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gcgcaacga--ttgcggcaccgtcatgcgcac	Protospacer
  . *.**.  *********** *********

81. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NC_016626 (Burkholderia sp. YI23 plasmid byi_1p, complete sequence) position: , mismatch: 7, identity: 0.767

--agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gcgcaacga--ttgcggcaccgtcatgcgcac	Protospacer
  . *.**.  *********** *********

82. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP022567 (Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK03, complete sequence) position: , mismatch: 8, identity: 0.733

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gctgcggttttgcggtaacgacatgcataa	Protospacer
.  ************.* ********..*

83. spacer 1.1|1374314|30|NZ_CP020947|CRISPRCasFinder matches to NZ_CP021373 (Rhizobium sp. ACO-34A plasmid pRACO34Ac, complete sequence) position: , mismatch: 8, identity: 0.733

agagcggttttgcggcaccgacatgcgcac	CRISPR spacer
gtagcggttttgcggtaacgacatgtgaga	Protospacer
. *************.* *******.* .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1045614 : 1101214

Stx2-converting_phage(10.0%)

capsid,transposase,terminase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010069756.1\|1045614_1047180_+\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	1.9e-112	44.3
WP_010069757.1\|1047179_1047485_+	hypothetical protein	NA	NA	NA	NA
WP_010069758.1\|1048028_1048595_+	hypothetical protein	NA	NA	NA	NA
WP_010069759.1\|1048761_1049541_-	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_085735942.1\|1049903_1051100_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_085736502.1\|1051277_1051895_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_085736503.1\|1052006_1052693_+	PspA/IM30 family protein	NA	NA	NA	NA
WP_003569708.1\|1052735_1053017_+	hypothetical protein	NA	NA	NA	NA
WP_085736504.1\|1053111_1056507_+	acyl-[ACP]--phospholipid O-acyltransferase	NA	NA	NA	NA
WP_085736505.1\|1057158_1057443_-	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_085736506.1\|1057835_1058837_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_085736507.1\|1058891_1060007_-	mandelate racemase/muconate lactonizing enzyme family protein	Q6A202	Oenococcus_phage	1.9e-10	22.4
WP_085736508.1\|1060034_1061162_-	zinc-binding dehydrogenase	NA	NA	NA	NA
WP_010069682.1\|1061399_1062338_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_010069681.1\|1062806_1064000_-	TCR/Tet family MFS transporter	A0A2H4UVM2	Bodo_saltans_virus	4.2e-11	27.5
WP_085736509.1\|1064459_1064867_-	hypothetical protein	NA	NA	NA	NA
WP_085736510.1\|1065302_1066451_-	hypothetical protein	NA	NA	NA	NA
WP_010068417.1\|1066638_1066878_+	DUF982 domain-containing protein	NA	NA	NA	NA
WP_010068418.1\|1066904_1067132_-	hypothetical protein	NA	NA	NA	NA
WP_010068419.1\|1067143_1067407_-	hypothetical protein	NA	NA	NA	NA
WP_085736511.1\|1068205_1068853_-	transcriptional regulator	A0A1X9HW95	Ruegeria_phage	1.4e-08	29.4
WP_089152726.1\|1068936_1069164_+	hypothetical protein	NA	NA	NA	NA
WP_085736512.1\|1069293_1069569_+	RNA polymerase subunit sigma-70	NA	NA	NA	NA
WP_010066830.1\|1069595_1069976_+	hypothetical protein	NA	NA	NA	NA
WP_085736513.1\|1069941_1070337_+	hypothetical protein	NA	NA	NA	NA
WP_010066828.1\|1070333_1070630_+	hypothetical protein	NA	NA	NA	NA
WP_085736514.1\|1070626_1070854_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_085736515.1\|1070867_1071461_+	hypothetical protein	NA	NA	NA	NA
WP_085736516.1\|1071526_1072354_+	DUF3800 domain-containing protein	NA	NA	NA	NA
WP_085736517.1\|1073464_1074160_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_085736518.1\|1074584_1075058_-	nucleoside deaminase	NA	NA	NA	NA
WP_010065665.1\|1075260_1076091_+	glycosyltransferase family 25 protein	NA	NA	NA	NA
WP_085738861.1\|1076153_1077551_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_085738862.1\|1077662_1078340_-	response regulator	W8CYM9	Bacillus_phage	2.7e-23	29.9
WP_085736519.1\|1078480_1079818_-	pilus assembly protein	NA	NA	NA	NA
WP_010069739.1\|1080004_1080349_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_085736520.1\|1080456_1081203_+	glucose 1-dehydrogenase	NA	NA	NA	NA
WP_085736521.1\|1081478_1083185_-	adenylate/guanylate cyclase domain-containing protein	NA	NA	NA	NA
WP_085736522.1\|1083712_1085674_+	elongation factor G	NA	NA	NA	NA
WP_085736523.1\|1085707_1086646_-	hypothetical protein	NA	NA	NA	NA
WP_085736524.1\|1086931_1087744_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_085738863.1\|1088183_1088504_+	hypothetical protein	NA	NA	NA	NA
WP_085736525.1\|1088639_1088981_+	hypothetical protein	NA	NA	NA	NA
WP_085736526.1\|1089116_1089659_+	DUF937 domain-containing protein	NA	NA	NA	NA
WP_089152704.1\|1089788_1090748_-	dienelactone hydrolase family protein	NA	NA	NA	NA
WP_085736528.1\|1091621_1091858_+	hypothetical protein	NA	NA	NA	NA
WP_085736529.1\|1091876_1092347_+\|terminase	terminase small subunit protein	F8TUR4	EBPR_podovirus	2.4e-31	58.5
WP_085736530.1\|1092312_1093884_+\|terminase	terminase	A0A0H5ARR1	Pseudomonas_phage	1.3e-113	44.4
WP_085736531.1\|1093883_1096019_+	hypothetical protein	X2CY04	Brucella_phage	2.9e-87	31.8
WP_010064012.1\|1096036_1096348_+	hypothetical protein	NA	NA	NA	NA
WP_085736532.1\|1096440_1097457_+	hypothetical protein	NA	NA	NA	NA
WP_085736533.1\|1097506_1098481_+\|capsid	phage major capsid protein	Q94MS1	Myxococcus_phage	2.3e-84	51.4
WP_010067950.1\|1098505_1099291_+	hypothetical protein	NA	NA	NA	NA
WP_085736534.1\|1099489_1100056_+	hypothetical protein	NA	NA	NA	NA
WP_085735807.1\|1100275_1101214_+\|transposase	IS110 family transposase	Q75QL1	Wolbachia_phage	3.6e-26	35.1

DBSCAN-SWA_2

1499797 : 1508954

Aeromonas_phage(14.29%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085736814.1\|1499797_1501096_+	serine hydroxymethyltransferase	A0A219Y950	Aeromonas_phage	8.3e-98	51.3
WP_085736815.1\|1501105_1501582_+	transcriptional repressor NrdR	NA	NA	NA	NA
WP_085736816.1\|1501585_1502893_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A1V0SE20	Indivirus	1.3e-34	39.1
WP_085736817.1\|1502892_1503504_+	riboflavin synthase	A0A2I2L4R9	Orpheovirus	2.6e-17	35.4
WP_085736818.1\|1503554_1504424_-	glucose-1-phosphate thymidylyltransferase RfbA	K7QKA7	Escherichia_phage	2.6e-95	59.2
WP_085736819.1\|1504434_1505322_-	dTDP-4-dehydrorhamnose reductase	NA	NA	NA	NA
WP_085736820.1\|1505324_1506380_-	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	1.1e-95	51.1
WP_010068585.1\|1506386_1506965_-	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A218MN57	uncultured_virus	3.5e-32	45.6
WP_085736821.1\|1506989_1508954_-	hypothetical protein	A0A0G2Y9S0	Acanthamoeba_polyphaga_mimivirus	1.9e-05	26.9

DBSCAN-SWA_3

1910611 : 1919746

uncultured_Mediterranean_phage(88.89%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085737074.1\|1910611_1911625_+	beta-N-acetylhexosaminidase	A0A1B1IVS3	uncultured_Mediterranean_phage	3.6e-24	42.6
WP_085737075.1\|1911643_1912501_+	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	5.6e-34	37.2
WP_085737076.1\|1912497_1913214_+	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	5.3e-38	47.2
WP_085737077.1\|1913395_1913587_+	twin-arginine translocase TatA/TatE family subunit	A0A1B1IVR9	uncultured_Mediterranean_phage	5.2e-09	74.4
WP_085737078.1\|1913638_1914265_+	twin-arginine translocase subunit TatB	NA	NA	NA	NA
WP_085737079.1\|1914261_1915089_+	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	1.2e-52	46.1
WP_085737080.1\|1915186_1916470_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	2.4e-97	45.6
WP_017964058.1\|1916474_1917248_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	3.1e-23	30.2
WP_085737081.1\|1917244_1917898_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	2.4e-16	35.3
WP_085737082.1\|1918150_1919746_+	peptidoglycan DD-metalloendopeptidase family protein	I3PV24	Clostridium_phage	5.0e-12	29.2

DBSCAN-SWA_4

3930182 : 3940597

Mycobacterium_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085738480.1\|3930182_3930893_+	7-cyano-7-deazaguanine synthase QueC	A0A2P1JXV3	Rhodococcus_phage	2.3e-49	47.8
WP_085738481.1\|3930892_3931249_+	6-carboxytetrahydropterin synthase QueD	NA	NA	NA	NA
WP_085738482.1\|3931245_3931974_+	7-carboxy-7-deazaguanine synthase QueE	A0A1U9WRB6	Streptococcus_virus	8.1e-42	38.5
WP_085738483.1\|3932115_3933339_-	adenylate/guanylate cyclase domain-containing protein	M1HLN3	Pelagibacter_phage	9.2e-14	29.4
WP_010067493.1\|3933444_3934419_-	class 1b ribonucleoside-diphosphate reductase subunit beta	R4TBI6	Mycobacterium_phage	7.3e-139	75.4
WP_089152720.1\|3934598_3936803_-	class 1b ribonucleoside-diphosphate reductase subunit alpha	A8E2R1	Enterococcus_phage	2.3e-212	51.7
WP_085738485.1\|3936781_3937186_-	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	A0A249Y1D6	Staphylococcus_phage	7.2e-08	35.8
WP_010068756.1\|3937199_3937421_-	glutaredoxin-like protein NrdH	V5UN81	Mycobacterium_phage	1.8e-16	52.1
WP_085738486.1\|3938329_3940597_-	cadmium-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	3.3e-126	41.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP020948

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

146886 : 155977

Planktothrix_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085739207.1\|146886_147678_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	8.9e-18	33.0
WP_085739208.1\|147674_148454_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.1e-15	30.6
WP_085739209.1\|148465_149560_+	alanine--glyoxylate aminotransferase family protein	NA	NA	NA	NA
WP_085739210.1\|149629_150493_+	glycerophosphodiester phosphodiesterase	NA	NA	NA	NA
WP_085739211.1\|150611_152291_+	diguanylate cyclase	A0A127AWB9	Bacillus_phage	5.3e-20	37.3
WP_085739212.1\|152345_153155_-	inositol monophosphatase	NA	NA	NA	NA
WP_085739213.1\|153154_154159_-	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	7.0e-20	29.9
WP_085739214.1\|154142_154922_-	glycerophosphodiester phosphodiesterase	A0A173GBD0	Staphylococcus_phage	3.7e-08	35.2
WP_085739215.1\|154921_155977_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	9.7e-28	34.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP020950

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

257690 : 311819

Enterobacteria_phage(100.0%)

plate,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029875552.1\|257690_258917_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_008536039.1\|258880_260767_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_004680427.1\|260766_261270_-\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_004680426.1\|261356_261890_-	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_004680425.1\|262005_263493_-	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_004680424.1\|263495_264050_-	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_004680423.1\|264085_265078_-	type VI secretion system protein TssA	NA	NA	NA	NA
WP_071089837.1\|266814_269094_-	hypothetical protein	NA	NA	NA	NA
WP_010069402.1\|271651_273007_+\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_029875554.1\|273068_274235_+	FHA domain-containing protein	NA	NA	NA	NA
WP_071089834.1\|274234_275524_+	type VI secretion system protein TssL	NA	NA	NA	NA
WP_012489525.1\|275533_279139_+	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
WP_004678816.1\|279224_279413_+	hypothetical protein	NA	NA	NA	NA
WP_012489526.1\|279435_281052_+	hypothetical protein	NA	NA	NA	NA
WP_008536071.1\|281147_281390_+	hypothetical protein	NA	NA	NA	NA
WP_012489527.1\|282731_283742_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_008536079.1\|286760_287648_-	hypothetical protein	NA	NA	NA	NA
WP_085739695.1\|288718_292027_+	hypothetical protein	NA	NA	NA	NA
WP_085739628.1\|293101_295579_+	hypothetical protein	NA	NA	NA	NA
WP_016737538.1\|296876_298163_-\|transposase	IS21 family transposase	U5N3F9	Enterobacteria_phage	5.3e-44	34.3
WP_085739629.1\|298876_301966_+	hypothetical protein	NA	NA	NA	NA
WP_085739630.1\|304532_307808_+	hypothetical protein	NA	NA	NA	NA
WP_041684032.1\|310397_311819_-\|transposase	ISNCY-like element ISRel10 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_CP020952

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 6596

Ostreococcus_lucimarinus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085740671.1\|569_1064_+	excisionase family DNA-binding protein	NA	NA	NA	NA
WP_085740154.1\|1124_2927_-	methyl-accepting chemotaxis protein	NA	NA	NA	NA
WP_085740155.1\|2937_3924_-	c-type cytochrome	NA	NA	NA	NA
WP_010025823.1\|4129_4612_-	hypothetical protein	NA	NA	NA	NA
WP_010068662.1\|4845_5778_+	pantoate--beta-alanine ligase	NA	NA	NA	NA
WP_085740156.1\|5774_6596_+	3-methyl-2-oxobutanoate hydroxymethyltransferase	M4QNT1	Ostreococcus_lucimarinus_virus	2.5e-39	37.5

DBSCAN-SWA_2

15087 : 20739

Ectocarpus_siliculosus_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085740159.1\|15087_15750_+	response regulator transcription factor	Q8QKV7	Ectocarpus_siliculosus_virus	7.2e-05	32.1
WP_085740160.1\|15746_17699_+	PAS domain S-box protein	A0A1V0SGX0	Hokovirus	5.6e-21	32.0
WP_085740161.1\|17940_18408_+	response regulator	NA	NA	NA	NA
WP_164517730.1\|18414_19500_-	ROK family protein	NA	NA	NA	NA
WP_089152760.1\|19476_20739_+	ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	4.5e-24	33.2

DBSCAN-SWA_3

31671 : 43379

Orpheovirus(25.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085740173.1\|31671_32955_-	cystathionine gamma-synthase family protein	A0A2I2L687	Orpheovirus	1.1e-06	24.4
WP_085740174.1\|33041_34118_-	YihY/virulence factor BrkB family protein	NA	NA	NA	NA
WP_085740175.1\|35177_36125_+\|transposase	IS110 family transposase	Q75QL1	Wolbachia_phage	3.9e-28	36.2
WP_085740176.1\|38409_38919_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_085740177.1\|39115_40558_+	hypothetical protein	A0A221J7A7	Mycobacterium_phage	3.5e-20	29.5
WP_085740178.1\|40595_41534_-	sugar kinase	NA	NA	NA	NA
WP_085740179.1\|41520_42555_-	hypothetical protein	NA	NA	NA	NA
WP_085740180.1\|42683_43379_+	NUDIX hydrolase	G3MA14	Bacillus_virus	1.5e-21	30.3

DBSCAN-SWA_4

48707 : 51092

Vibrio_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085740625.1\|48707_48965_+	hypothetical protein	A0A2I7REY7	Vibrio_phage	6.4e-10	49.2
WP_085740184.1\|49341_49662_+	hypothetical protein	NA	NA	NA	NA
WP_010069091.1\|50021_51092_-	GDP-L-fucose synthase	R9S8B8	Prochlorococcus_phage	3.8e-96	56.0

DBSCAN-SWA_5

63514 : 65618

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085740191.1\|63514_64567_+	SDR family oxidoreductase	A0A2K9KZK0	Tupanvirus	7.0e-87	48.4
WP_085740192.1\|64628_65618_+	glycosyltransferase family 8 protein	A0ZYL4	Archaeal_BJ1_virus	7.7e-11	29.1

DBSCAN-SWA_6

69686 : 73690

Bathycoccus_sp._RCC1105_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085740195.1\|69686_70790_+	DegT/DnrJ/EryC1/StrS family aminotransferase	E5ES42	Bathycoccus_sp._RCC1105_virus	1.5e-47	33.1
WP_085740196.1\|70779_71496_+	acyltransferase	NA	NA	NA	NA
WP_085740197.1\|71492_72464_+	NAD-dependent epimerase/dehydratase family protein	A0A2H4UUK0	Bodo_saltans_virus	1.1e-41	35.5
WP_085740198.1\|72460_73690_+	DegT/DnrJ/EryC1/StrS family aminotransferase	A0A2K9L470	Tupanvirus	8.3e-39	33.7

DBSCAN-SWA_7

84947 : 85697

Trichoplusia_ni_ascovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085740628.1\|84947_85697_-	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	1.8e-20	32.7

DBSCAN-SWA_8

94053 : 96198

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085740208.1\|94053_96198_+	peptidase domain-containing ABC transporter	W8CYL7	Bacillus_phage	2.2e-39	29.2

DBSCAN-SWA_9

99337 : 104624

uncultured_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085740211.1\|99337_101821_-	copper-translocating P-type ATPase	A0A218MNH6	uncultured_virus	1.5e-87	33.9
WP_085740212.1\|101982_102174_+	heavy-metal-associated domain-containing protein	NA	NA	NA	NA
WP_085740213.1\|102280_103810_+	multicopper oxidase family protein	NA	NA	NA	NA
WP_085740214.1\|103862_104624_-	SDR family oxidoreductase	F2NZ40	Diadromus_pulchellus_ascovirus	1.8e-07	27.1

DBSCAN-SWA_10

112302 : 113115

Synechococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085740220.1\|112302_113115_-	NAD(P)-dependent oxidoreductase	M4QPK0	Synechococcus_phage	2.9e-08	26.7

DBSCAN-SWA_11

123179 : 124307

Synechococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085740228.1\|123179_124307_+	S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase	E3SJ82	Synechococcus_phage	2.1e-33	27.4

DBSCAN-SWA_12

127623 : 129219

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085740232.1\|127623_129219_+	GMC family oxidoreductase	A0A1V0SI18	Klosneuvirus	3.5e-53	30.4

DBSCAN-SWA_13

132489 : 136886

Staphylococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085740236.1\|132489_133194_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	6.3e-07	23.9
WP_085740237.1\|133195_133912_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.1e-09	27.9
WP_085740630.1\|133927_134872_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_010068307.1\|134901_135291_-	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_085740238.1\|135298_136078_-	molybdenum cofactor biosynthesis protein F	NA	NA	NA	NA
WP_085740239.1\|136097_136886_-	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	4.9e-08	26.2

DBSCAN-SWA_14

145378 : 148020

Rhodococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085740247.1\|145378_146662_-	aspartate aminotransferase family protein	M9MUV3	Rhodococcus_phage	1.1e-09	34.0
WP_085740248.1\|146664_148020_-	aspartate aminotransferase family protein	A0A1V0SKB7	Klosneuvirus	1.9e-15	24.1

DBSCAN-SWA_15

154146 : 163000

Enterobacteria_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085740254.1\|154146_154659_-	flavin reductase	Q9KX93	Enterobacteria_phage	8.3e-09	38.6
WP_085740255.1\|154669_156232_-	Pyoverdin chromophore biosynthetic protein pvcC	NA	NA	NA	NA
WP_164517735.1\|156329_157217_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_085740257.1\|157560_158385_+	universal stress protein	A0A2H4J154	uncultured_Caudovirales_phage	3.1e-05	30.3
WP_085740258.1\|158480_159458_-	ABC transporter ATP-binding protein	NA	NA	NA	NA
WP_085740259.1\|159604_160324_-	CBS domain-containing protein	NA	NA	NA	NA
WP_085740260.1\|160735_163000_+	cadmium-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	4.3e-57	27.9

DBSCAN-SWA_16

167451 : 171219

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_049732194.1\|167451_168177_-	response regulator	W8CYM9	Bacillus_phage	1.7e-28	30.7
WP_085740264.1\|168366_168693_-	hypothetical protein	NA	NA	NA	NA
WP_164517732.1\|168847_169528_-	NnrU family protein	NA	NA	NA	NA
WP_071089705.1\|169567_170263_-	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_085740266.1\|170265_171219_-	SUMF1/EgtB/PvdO family nonheme iron enzyme	A0A075BSL8	Microcystis_phage	1.6e-05	33.6

DBSCAN-SWA_17

179668 : 180346

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071089731.1\|179668_180346_+	response regulator transcription factor	W8CYM9	Bacillus_phage	9.2e-24	28.3

DBSCAN-SWA_18

183903 : 186524

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071089735.1\|183903_184347_-	pseudoazurin	E3SLB8	Synechococcus_phage	9.7e-06	38.1
WP_085740633.1\|184598_186524_-	PAS domain S-box protein	A0A1V0S925	Catovirus	3.9e-11	34.7

DBSCAN-SWA_19

193344 : 197796

uncultured_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085740280.1\|193344_195633_+	cadmium-translocating P-type ATPase	A0A218MNH6	uncultured_virus	2.1e-80	30.7
WP_049732167.1\|195629_195788_+	cbb3-type cytochrome oxidase assembly protein CcoS	NA	NA	NA	NA
WP_085740281.1\|195820_196486_+	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_010010410.1\|196516_196990_+	cytochrome c maturation protein CcmE	NA	NA	NA	NA
WP_085740282.1\|197118_197796_+	CBS domain-containing protein	A0A2I6B2H4	Macacine_betaherpesvirus	3.0e-06	26.8

DBSCAN-SWA_20

208641 : 210144

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085740290.1\|208641_210144_-	sugar ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	7.1e-08	23.9

DBSCAN-SWA_21

214931 : 215693

Chrysochromulina_ericina_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010069390.1\|214931_215693_-	SDR family oxidoreductase	A0A0N9R355	Chrysochromulina_ericina_virus	1.7e-05	22.5

DBSCAN-SWA_22

225450 : 227025

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_164517733.1\|225450_227025_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.1e-14	32.6

DBSCAN-SWA_23

244879 : 249134

Klosneuvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085740643.1\|244879_246493_-	FAD-dependent oxidoreductase	A0A1V0SI18	Klosneuvirus	2.2e-63	33.1
WP_085740313.1\|246528_248025_-	GMC family oxidoreductase	NA	NA	NA	NA
WP_085740314.1\|248033_249134_-	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	Q6GZ03	Mycoplasma_phage	9.4e-18	44.8

DBSCAN-SWA_24

253728 : 255534

Micromonas_sp._RCC1109_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085740644.1\|253728_255534_-	thiamine pyrophosphate-binding protein	E5EQ70	Micromonas_sp._RCC1109_virus	1.8e-37	26.4

DBSCAN-SWA_25

261661 : 265207

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085740322.1\|261661_262402_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.5e-32	38.0
WP_085740323.1\|262443_263292_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_012490243.1\|263361_264012_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_010067548.1\|264736_265207_-	RidA family protein	M1I5B0	Acanthocystis_turfacea_Chlorella_virus	2.8e-27	39.7

DBSCAN-SWA_26

273796 : 274585

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085740329.1\|273796_274585_+	NAD(P)-dependent oxidoreductase	A0A1V0SKV4	Klosneuvirus	4.7e-11	31.2

DBSCAN-SWA_27

280795 : 286762

Bacillus_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085740335.1\|280795_282337_-	sugar ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.7e-12	25.9
WP_085740336.1\|282415_283378_-	substrate-binding domain-containing protein	NA	NA	NA	NA
WP_085740337.1\|283703_284813_+	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	3.5e-28	30.9
WP_085740338.1\|284837_285719_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_010069336.1\|286036_286762_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.0e-33	44.5

DBSCAN-SWA_28

289996 : 295283

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085740341.1\|289996_290767_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.1e-28	37.4
WP_085740342.1\|290779_291439_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_085740343.1\|291444_292107_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_085740344.1\|292235_293075_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_085740345.1\|293495_295283_-	PAS domain S-box protein	A0A2H4J162	uncultured_Caudovirales_phage	8.7e-05	84.4

DBSCAN-SWA_29

307264 : 309082

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085740353.1\|307264_309082_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	4.7e-14	33.5

DBSCAN-SWA_30

315059 : 330753

Ochrobactrum_phage(28.57%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085740358.1\|315059_316364_-	replication initiation protein RepC	L7TKN6	Rhizobium_phage	2.3e-18	27.2
WP_010069192.1\|316518_317520_-	plasmid partitioning protein RepB	A0A240F4U0	Ochrobactrum_phage	7.4e-54	37.6
WP_010069193.1\|317524_318718_-	plasmid partitioning protein RepA	A0A240F4U1	Ochrobactrum_phage	4.8e-116	54.9
WP_010069195.1\|319171_319924_-	NAD(P)H-binding protein	NA	NA	NA	NA
WP_085740359.1\|320266_323902_+	PAS domain-containing protein	W8CYF6	Bacillus_phage	2.1e-05	23.5
WP_085740360.1\|323898_324540_+	response regulator transcription factor	NA	NA	NA	NA
WP_085740361.1\|324542_324920_+	response regulator	NA	NA	NA	NA
WP_085740362.1\|324921_325614_+	response regulator transcription factor	NA	NA	NA	NA
WP_085740363.1\|325801_326155_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_085740647.1\|326608_327796_-	mandelate racemase/muconate lactonizing enzyme family protein	Q6A202	Oenococcus_phage	2.7e-47	31.2
WP_085740364.1\|327808_329020_-	mandelate racemase/muconate lactonizing enzyme family protein	Q6A202	Oenococcus_phage	1.7e-52	35.6
WP_085740365.1\|329016_330753_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.0e-18	31.7

DBSCAN-SWA_31

335975 : 336806

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085740369.1\|335975_336806_+	NAD(P)-dependent oxidoreductase	A0A1V0SKV4	Klosneuvirus	3.5e-09	30.7

DBSCAN-SWA_32

343210 : 349519

Planktothrix_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085740376.1\|343210_343954_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.3e-23	35.5
WP_085740377.1\|343977_345066_-	hypothetical protein	NA	NA	NA	NA
WP_085740378.1\|345404_345917_+	hypothetical protein	NA	NA	NA	NA
WP_003572688.1\|346016_346220_+	cold-shock protein	A0A1X9IGI9	Lactococcus_phage	3.3e-09	56.1
WP_085740379.1\|346380_346563_-	GMC family oxidoreductase	NA	NA	NA	NA
WP_085740380.1\|346562_347909_-	hypothetical protein	NA	NA	NA	NA
WP_085740381.1\|348004_349519_-	malonyl-CoA synthase	Q75ZG1	Hepacivirus	4.2e-40	27.6

DBSCAN-SWA_33

359158 : 361663

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085740389.1\|359158_361663_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.7e-14	37.8

DBSCAN-SWA_34

374350 : 382957

Escherichia_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010069576.1\|374350_374632_+	type II toxin-antitoxin system ParD family antitoxin	A0A0N7C055	Escherichia_phage	5.7e-12	51.2
WP_085740398.1\|374631_374937_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_085740399.1\|374970_376647_-	response regulator	Q8QNA2	Ectocarpus_siliculosus_virus	3.8e-10	30.6
WP_085740400.1\|376657_382957_-	HAMP domain-containing protein	A0A1V0SGX0	Hokovirus	2.7e-32	39.4

DBSCAN-SWA_35

386135 : 390331

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010068433.1\|386135_386897_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.3e-13	28.9
WP_085740405.1\|386909_387377_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_085740406.1\|387530_388706_+	aspartate/tyrosine/aromatic aminotransferase	NA	NA	NA	NA
WP_085740407.1\|388702_390331_+	hypothetical protein	A9YVT5	Ostreococcus_tauri_virus	5.9e-16	22.5

DBSCAN-SWA_36

402971 : 404852

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085740413.1\|402971_404852_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	2.3e-11	36.3

DBSCAN-SWA_37

407853 : 410925

Leptospira_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085740415.1\|407853_410925_-	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	2.7e-38	20.5

DBSCAN-SWA_38

413982 : 415023

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085740419.1\|413982_415023_+	LacI family transcriptional regulator	C6ZCU4	Enterobacteria_phage	2.3e-13	25.3

DBSCAN-SWA_39

419744 : 420851

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085740424.1\|419744_420851_-	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	G9BWD6	Planktothrix_phage	4.0e-24	36.5

DBSCAN-SWA_40

432832 : 438310

Streptococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085740433.1\|432832_433549_-	YafY family transcriptional regulator	A0A1B0RXM1	Streptococcus_phage	8.3e-15	28.6
WP_085740434.1\|433646_434579_-	NAD(P)-dependent alcohol dehydrogenase	E3SJ82	Synechococcus_phage	5.9e-05	27.8
WP_085740435.1\|434575_435448_-	NmrA family NAD(P)-binding protein	NA	NA	NA	NA
WP_010066356.1\|435470_435848_-	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_085740655.1\|436165_438310_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	3.6e-05	54.1

DBSCAN-SWA_41

447518 : 451554

Bacillus_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085740442.1\|447518_448337_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.9e-31	36.3
WP_085740443.1\|448349_449231_+	ABC transporter permease	NA	NA	NA	NA
WP_085740444.1\|449495_450896_-	sensor histidine kinase	W8CYF6	Bacillus_phage	6.4e-19	28.2
WP_085740445.1\|450885_451554_-	response regulator	Q56AR1	Bacillus_thuringiensis_phage	5.0e-06	31.3

DBSCAN-SWA_42

459184 : 460294

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085740452.1\|459184_460294_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.9e-27	33.7

DBSCAN-SWA_43

465179 : 465599

uncultured_marine_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085740456.1\|465179_465599_-	HD domain-containing protein	A0A0F7L746	uncultured_marine_virus	3.5e-13	43.1

DBSCAN-SWA_44

472311 : 478635

Escherichia_phage(75.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085740464.1\|472311_472980_-	aldolase	A0A077SK32	Escherichia_phage	6.3e-49	49.3
WP_085740465.1\|472996_473995_-	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	2.4e-12	27.3
WP_085740466.1\|474231_475548_+	MFS transporter	NA	NA	NA	NA
WP_085740467.1\|475617_476559_+	NAD(P)-dependent oxidoreductase	A0A077SLF7	Escherichia_phage	2.0e-69	49.8
WP_085740468.1\|476574_477351_+	hydroxypyruvate isomerase family protein	NA	NA	NA	NA
WP_085740469.1\|477354_478635_+	four-carbon acid sugar kinase family protein	A0A077SLJ7	Escherichia_phage	7.7e-72	41.3

DBSCAN-SWA_45

483564 : 485220

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085740473.1\|483564_485220_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.6e-16	30.5

DBSCAN-SWA_46

495940 : 501190

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085740477.1\|495940_498088_-	type I secretion system permease/ATPase	W8CYL7	Bacillus_phage	1.1e-38	28.7
WP_085740478.1\|498652_501190_-	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	4.1e-08	25.2

DBSCAN-SWA_47

509767 : 513097

Burkholderia_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085740482.1\|509767_510655_-	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	3.4e-26	29.7
WP_085740483.1\|510765_512019_+	aromatic ring-hydroxylating dioxygenase subunit alpha	NA	NA	NA	NA
WP_085740484.1\|512008_513097_+	hybrid-cluster NAD(P)-dependent oxidoreductase	A0A1D8KTE3	Synechococcus_phage	6.1e-09	43.2

DBSCAN-SWA_48

518359 : 519451

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085740490.1\|518359_519451_-	glycine betaine/L-proline ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.5e-31	40.3

DBSCAN-SWA_49

526741 : 527869

Prochlorococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085740498.1\|526741_527869_-	S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase	A0A0K0KVL7	Prochlorococcus_phage	8.2e-33	27.7

DBSCAN-SWA_50

536817 : 537900

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085740507.1\|536817_537900_+	glycine betaine/L-proline ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	6.2e-30	37.6

DBSCAN-SWA_51

543062 : 547724

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085740510.1\|543062_544949_-	diguanylate cyclase	A0A127AWB9	Bacillus_phage	8.6e-19	37.4
WP_085740511.1\|545262_546192_-	ribokinase	NA	NA	NA	NA
WP_085740512.1\|546188_546650_-	fucose-binding protein	NA	NA	NA	NA
WP_085740513.1\|546701_547724_-	LacI family transcriptional regulator	C6ZCU4	Enterobacteria_phage	1.1e-25	31.3

DBSCAN-SWA_52

551820 : 552888

Mycoplasma_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085740515.1\|551820_552888_+	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	Q6GZ03	Mycoplasma_phage	4.0e-21	31.7

DBSCAN-SWA_53

559569 : 566576

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085740520.1\|559569_560676_-	NAD(P)-dependent alcohol dehydrogenase	E3SJ82	Synechococcus_phage	8.0e-25	27.6
WP_085740521.1\|560733_561573_-	p-hydroxycinnamoyl CoA hydratase/lyase	NA	NA	NA	NA
WP_085740522.1\|561615_563199_-	AMP-binding protein	A0A2H4PQM9	Staphylococcus_phage	1.8e-38	29.0
WP_085740523.1\|563397_563883_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_085740524.1\|563988_564465_-	NUDIX domain-containing protein	NA	NA	NA	NA
WP_085740525.1\|564655_565579_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_085740660.1\|565757_566576_+	alpha/beta hydrolase	A0A220NRX7	Mycobacterium_phage	1.1e-15	26.5

DBSCAN-SWA_54

587422 : 591726

Moraxella_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085740531.1\|587422_589519_-	carboxy terminal-processing peptidase	A0A0R6PIZ1	Moraxella_phage	5.5e-83	33.0
WP_010069429.1\|589697_590051_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_010069430.1\|590047_590488_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_010069431.1\|590503_591031_+	arsenate reductase ArsC	A0A2H4J8A6	uncultured_Caudovirales_phage	5.7e-29	45.2
WP_010069432.1\|591030_591726_+	aquaporin family protein	A0A1B1ISL4	uncultured_Mediterranean_phage	7.6e-05	43.3

DBSCAN-SWA_55

596780 : 597532

Paenibacillus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_089152714.1\|596780_597532_-\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	6.9e-28	48.8

DBSCAN-SWA_56

604972 : 606450

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085740538.1\|604972_605725_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	9.0e-12	24.9
WP_085740539.1\|605721_606450_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	3.9e-12	27.5

DBSCAN-SWA_57

611028 : 613287

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085740663.1\|611028_613287_+	EAL domain-containing protein	G3MA91	Bacillus_virus	1.0e-13	29.9

DBSCAN-SWA_58

616487 : 622086

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_089152763.1\|616487_619067_-	EAL domain-containing protein	G3MA91	Bacillus_virus	1.7e-25	35.1
WP_010067820.1\|619835_619973_+	hypothetical protein	NA	NA	NA	NA
WP_085740550.1\|619983_622086_+	EAL domain-containing protein	G3MA91	Bacillus_virus	1.5e-11	30.3

DBSCAN-SWA_59

633961 : 638158

Mycobacterium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085740559.1\|633961_635296_+	aspartate aminotransferase family protein	A0A2D1G879	Mycobacterium_phage	1.4e-07	28.0
WP_085740560.1\|635454_636174_+	DNA-binding protein	NA	NA	NA	NA
WP_085740561.1\|636475_638158_+	globin-coupled sensor protein	A0A2H4J162	uncultured_Caudovirales_phage	2.8e-05	71.8

DBSCAN-SWA_60

650353 : 651388

Megavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085740573.1\|650353_651388_-	L-idonate 5-dehydrogenase	K7Z7U2	Megavirus	1.0e-05	24.8

DBSCAN-SWA_61

659130 : 667429

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085740581.1\|659130_661008_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	2.6e-15	35.6
WP_085740582.1\|661398_662112_+	4'-phosphopantetheinyl transferase superfamily protein	NA	NA	NA	NA
WP_085740583.1\|662084_663440_-	lysine N(6)-hydroxylase/L-ornithine N(5)-oxygenase family protein	NA	NA	NA	NA
WP_085740584.1\|663436_667429_-	non-ribosomal peptide synthetase	A0A2K9KZV5	Tupanvirus	2.5e-52	25.7

DBSCAN-SWA_62

677968 : 683900

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085740595.1\|677968_679852_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	3.9e-11	35.4
WP_085740596.1\|680033_682205_-	TonB-dependent siderophore receptor	NA	NA	NA	NA
WP_085740597.1\|682619_683900_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	3.3e-14	32.8

DBSCAN-SWA_63

691086 : 691881

Organic_Lake_phycodnavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010067585.1\|691086_691881_-	sugar ABC transporter ATP-binding protein	F2Y2R6	Organic_Lake_phycodnavirus	4.6e-14	30.0

DBSCAN-SWA_64

713281 : 718394

Ochrobactrum_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085740615.1\|713281_714343_+	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	G3M9Y6	Bacillus_virus	4.1e-26	33.2
WP_085740616.1\|714582_715791_+	plasmid partitioning protein RepA	A0A240F4U1	Ochrobactrum_phage	2.5e-141	64.6
WP_085740617.1\|715860_716838_+	plasmid partitioning protein RepB	A0A240F4U0	Ochrobactrum_phage	3.6e-61	41.0
WP_085740618.1\|717050_718394_+	replication initiation protein RepC	L7TKN6	Rhizobium_phage	1.3e-13	26.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP020947

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP020948

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP020950

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

4. NZ_CP020952

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection