CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NC_017960	Enterococcus faecium DO, complete sequence	1 crisprs	DEDDh,cas2,DinG,cas3,RT,csa3,cas14j	0	8
NC_017962	Enterococcus faecium DO plasmid 2, complete sequence	0 crisprs	WYL	0	2
NC_017961	Enterococcus faecium DO plasmid 1, complete sequence	0 crisprs	RT	0	2
NC_017963	Enterococcus faecium DO plasmid 3, complete sequence	1 crisprs	cas14j	1	3

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_017960_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_017960_1

2333405-2333514

Orphan

Consensus_repeat	Method
CTTTGCTCAACCAGTATTATTCATCA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_017960_1

>merge|NC_017960|1|2333405-2333514|CRISPRCasFinder
CTTTGCTCAACCAGTATTATTCATCACCTATTCACTTCGTTCATAGTGATTCTACTCGCTTTGCTCGAAAGGAAACTCCTTTCGCTTTGCTCAACCAGTATTGTTCATCA

>NC_017960|1|1|2333405-2333514|CRISPRCasFinder
CTTTGCTCAACCAGTATTATTCATCA	CCTATTCACTTCGTTCATAGTGATTCTACTCGCTTTGCTCGAAAGGAAACTCCTTTCG
CTTTGCTCAACCAGTATTGTTCATCA

Protein	Signature genes	Signature genes Name	Protein_function
NC_017960.1\|WP_002296327.1\|2331613_2332303_-\|TVP38/TMEM64-family-protein	unknown	unknown	gnl\|CDD\|223475
NC_017960.1\|WP_002287787.1\|2326624_2327326_-\|glucosamine-6-phosphate-deaminase	unknown	unknown	gnl\|CDD\|238693
NC_017960.1\|WP_002295743.1\|2329481_2330389_-\|IS982-like-element-ISEfm1-family-transposase	unknown	unknown	gnl\|CDD\|372648
NC_017960.1\|WP_002294585.1\|2335299_2335968_+\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-beta	unknown	unknown	gnl\|CDD\|224674
NC_017960.1\|WP_002294587.1\|2333741_2334431_-\|50S-ribosomal-protein-L1	unknown	unknown	gnl\|CDD\|180071
NC_017960.1\|WP_002320938.1\|2330482_2331532_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340882
NC_017960.1\|WP_002287792.1\|2323157_2324123_+\|class-1b-ribonucleoside-diphosphate-reductase-subunit-beta	unknown	unknown	gnl\|CDD\|275027
NC_017960.1\|WP_002294578.1\|2339938_2340091_-\|50S-ribosomal-protein-L33	unknown	unknown	gnl\|CDD\|234783
NC_017960.1\|WP_002290558.1\|2327559_2329092_+\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|223562
NC_017960.1\|WP_002294584.1\|2335980_2336853_+\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha	unknown	unknown	gnl\|CDD\|129801
NC_017960.1\|WP_002289897.1\|2338134_2339040_-\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|283645
NC_017960.1\|WP_002287791.1\|2324211_2325351_-\|AI-2E-family-transporter	unknown	unknown	gnl\|CDD\|223701
NC_017960.1\|WP_002294577.1\|2340252_2340897_+\|CBS-domain-containing-protein	unknown	unknown	gnl\|CDD\|341358
NC_017960.1\|WP_002294548.1\|2340952_2341456_-\|QueT-transporter-family-protein	unknown	unknown	gnl\|CDD\|377623
NC_017960.1\|WP_002287788.1\|2325657_2326371_-\|MgtC/SapB-family-protein	unknown	unknown	gnl\|CDD\|224204
NC_017960.1\|WP_002294588.1\|2332408_2332777_-\|50S-ribosomal-protein-L7/L12	unknown	unknown	gnl\|CDD\|234671
NC_017960.1\|WP_002294580.1\|2339098_2339644_-\|transcription-termination/antitermination-protein-NusG	unknown	unknown	gnl\|CDD\|180161
NC_017960.1\|WP_002291634.1\|2332828_2333332_-\|50S-ribosomal-protein-L10	unknown	unknown	gnl\|CDD\|234632
NC_017960.1\|WP_002291638.1\|2334534_2334957_-\|50S-ribosomal-protein-L11	unknown	unknown	gnl\|CDD\|234661
NC_017960.1\|WP_002294579.1\|2339744_2339915_-\|preprotein-translocase-subunit-SecE	unknown	unknown	gnl\|CDD\|376355

Protein	Function_ID	Function_description	E-value
NC_017960.1\|WP_002296327.1\|2331613_2332303_-\|TVP38/TMEM64-family-protein	gnl\|CDD\|223475	COG0398, COG0398, Uncharacterized conserved protein [Function unknown].	2.9371e-19
NC_017960.1\|WP_002287787.1\|2326624_2327326_-\|glucosamine-6-phosphate-deaminase	gnl\|CDD\|238693	cd01399, GlcN6P_deaminase, GlcN6P_deaminase: Glucosamine-6-phosphate (GlcN6P) deaminase subfamily; GlcN6P deaminase catalyzes the reversible conversion of GlcN6P to D-fructose-6-phosphate (Fru6P) and ammonium. The reaction is an aldo-keto isomerization coupled with an amination or deamination. It is the last step of the metabolic pathway of N-acetyl-D-glucosamine-6-phosphate (GlcNAc6P). GlcN6P deaminase is a hexameric enzyme that is allosterically activated by GlcNAc6P.	8.8122e-119
NC_017960.1\|WP_002295743.1\|2329481_2330389_-\|IS982-like-element-ISEfm1-family-transposase	gnl\|CDD\|372648	pfam13612, DDE_Tnp_1_3, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contains three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	2.39418e-18
NC_017960.1\|WP_002294585.1\|2335299_2335968_+\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-beta	gnl\|CDD\|224674	COG1760, SdaA, L-serine deaminase [Amino acid transport and metabolism].	1.41351e-73
NC_017960.1\|WP_002294587.1\|2333741_2334431_-\|50S-ribosomal-protein-L1	gnl\|CDD\|180071	PRK05424, rplA, 50S ribosomal protein L1; Validated.	1.66496e-146
NC_017960.1\|WP_002320938.1\|2330482_2331532_-\|MFS-transporter	gnl\|CDD\|340882	cd17324, MFS_NepI_like, Purine ribonucleoside efflux pump NepI and similar transporters of the Major Facilitator Superfamily. This family is composed of purine efflux pumps such as Escherichia coli NepI and Bacillus subtilis PbuE, sugar efflux transporters such as Corynebacterium glutamicum arabinose efflux permease, multidrug resistance (MDR) transporters such as Streptomyces lividans chloramphenicol resistance protein (CmlR), and similar proteins. NepI and PbuE are involved in the efflux of purine ribonucleosides such as guanosine, adenosine and inosine, as well as purine bases like guanine, adenine, and hypoxanthine, and purine base analogs. They play a role in the maintenance of cellular purine base pools, as well as in protecting the cells and conferring resistance against toxic purine base analogs such as 6-mercaptopurine. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The NepI-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	4.96069e-56
NC_017960.1\|WP_002287792.1\|2323157_2324123_+\|class-1b-ribonucleoside-diphosphate-reductase-subunit-beta	gnl\|CDD\|275027	TIGR04171, ribonucleotide-diphosphate_reductase_subunit_beta, ribonucleoside-diphosphate reductase, class 1b, beta subunit. Members of this family are NrdF, the beta subunit of class 1b ribonucleotide reductase. This form uses a dimanganese moiety associated with a tyrosine radical to reduce the cellular requirement for iron. [Purines, pyrimidines, nucleosides, and nucleotides, 2'-Deoxyribonucleotide metabolism].	0
NC_017960.1\|WP_002294578.1\|2339938_2340091_-\|50S-ribosomal-protein-L33	gnl\|CDD\|234783	PRK00504, rpmG, 50S ribosomal protein L33; Validated.	3.12722e-17
NC_017960.1\|WP_002290558.1\|2327559_2329092_+\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|223562	COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only].	5.56109e-170
NC_017960.1\|WP_002294584.1\|2335980_2336853_+\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha	gnl\|CDD\|129801	TIGR00718, Probable_L-serine_dehydratase_alpha_chain, L-serine dehydratase, iron-sulfur-dependent, alpha subunit. This enzyme is also called serine deaminase. L-serine dehydratase converts serine into pyruvate in the gluconeogenesis pathway from serine. This model describes the alpha chain of an iron-sulfur-dependent L-serine dehydratase, found in Bacillus subtilis. A fairly deep split in a UPGMA tree separates members of this family of alpha chains from the homologous region of single chain forms such as found in Escherichia coli. This family of enzymes is not homologous to the pyridoxal phosphate-dependent threonine deaminases and eukaryotic serine deaminases. [Energy metabolism, Amino acids and amines, Energy metabolism, Glycolysis/gluconeogenesis].	2.63238e-103
NC_017960.1\|WP_002289897.1\|2338134_2339040_-\|alpha/beta-fold-hydrolase	gnl\|CDD\|283645	pfam06028, DUF915, Alpha/beta hydrolase of unknown function (DUF915). This family consists of several bacterial proteins of unknown function. Members of this family have an alpha/beta hydrolase fold.	9.73807e-81
NC_017960.1\|WP_002287791.1\|2324211_2325351_-\|AI-2E-family-transporter	gnl\|CDD\|223701	COG0628, yhhT, Predicted permease, member of the PurR regulon [General function prediction only].	2.06838e-61
NC_017960.1\|WP_002294577.1\|2340252_2340897_+\|CBS-domain-containing-protein	gnl\|CDD\|341358	cd02205, CBS_pair_SF, Two tandem repeats of the cystathionine beta-synthase (CBS pair) domains superfamily. The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase).	5.69774e-14
NC_017960.1\|WP_002294548.1\|2340952_2341456_-\|QueT-transporter-family-protein	gnl\|CDD\|377623	pfam06177, QueT, QueT transporter. This family includes the queT gene encoding a hypothetical integral membrane protein with 5 predicted transmembrane regions. The queT genes in Firmicutes are often preceded by the PreQ1 (7-aminomethyl-7-deazaguanine) riboswitches of two distinct classes, suggesting involvement of the QueT transporters in uptake of a queuosine biosynthetic intermediate.	1.05399e-35
NC_017960.1\|WP_002287788.1\|2325657_2326371_-\|MgtC/SapB-family-protein	gnl\|CDD\|224204	COG1285, SapB, Uncharacterized membrane protein [Function unknown].	6.15701e-49
NC_017960.1\|WP_002294588.1\|2332408_2332777_-\|50S-ribosomal-protein-L7/L12	gnl\|CDD\|234671	PRK00157, rplL, 50S ribosomal protein L7/L12; Reviewed.	5.30333e-45
NC_017960.1\|WP_002294580.1\|2339098_2339644_-\|transcription-termination/antitermination-protein-NusG	gnl\|CDD\|180161	PRK05609, nusG, transcription antitermination protein NusG; Validated.	1.97252e-86
NC_017960.1\|WP_002291634.1\|2332828_2333332_-\|50S-ribosomal-protein-L10	gnl\|CDD\|234632	PRK00099, rplJ, 50S ribosomal protein L10; Reviewed.	3.03735e-67
NC_017960.1\|WP_002291638.1\|2334534_2334957_-\|50S-ribosomal-protein-L11	gnl\|CDD\|234661	PRK00140, rplK, 50S ribosomal protein L11; Validated.	9.059e-96
NC_017960.1\|WP_002294579.1\|2339744_2339915_-\|preprotein-translocase-subunit-SecE	gnl\|CDD\|376355	pfam00584, SecE, SecE/Sec61-gamma subunits of protein translocation complex. SecE is part of the SecYEG complex in bacteria which translocates proteins from the cytoplasm. In eukaryotes the complex, made from Sec61-gamma and Sec61-alpha translocates protein from the cytoplasm to the ER. Archaea have a similar complex.	1.48e-13

>NC_017960.1|WP_002291634.1|2332828_2333332_-|50S-ribosomal-protein-L10
MSEAIIAKKAAIVDEVSEKFTAAASVVVVDYRGLTVDEVTRLRKQLRDANVEMKVIKNSILSRAAKKAGLEGMDEVFTGPTAVAFSNEDVVAPAKIMDEFAKEAKALEIKGGIIEGKVSSLEEITALAKLPNREGLLSMLLSVLQAPVRNVAYAVKAVADKEDGDAA
>NC_017960.1|WP_002294588.1|2332408_2332777_-|50S-ribosomal-protein-L7/L12
MALNIENIVAELKEATILELNDLVKAIEEEFGVSAAAPVAVAAAGGAAAAEEQTEFTVELTAAGDQKVKVIKAVREATGLGLKEAKAVVDGAPAPVKEGVSKEEAEELKAKLEEVGASVTVK
>NC_017960.1|WP_002296327.1|2331613_2332303_-|TVP38/TMEM64-family-protein
MKKKIIRLMLISLGIILILVVGYRLYLEYQTDIQLFLNPRASKAELLAHIRSHGTFASILLIVLTAVMCAVPGIPTSVVGVIAGLSFGPLTGAIINILGNALGNITAIFLMHRLKFLDKKTETNHWVQAIRQMKHPKIGVMLGYMIPVIPSSMVNFAADAMKLPLQQIILSIVIGVIPSSVLYACGGEALFHGYNKTAVTLVASVTVLVGLVVFIYKDRKKKQGKQKHK
>NC_017960.1|WP_002320938.1|2330482_2331532_-|MFS-transporter
MKSNEKTPLTTSLILLLSITCGVVVANMYYIQPIGTKVAASLSVSTSAVGILTMLTQLGYALGLLFLVPLGDVVDRPKLIIRMVALSAVSLLAAFFAPSFTLFACASFLIGLLSIVPQIIIPYGAVLAGPKARGKVMGTLLSGLLVGILLSRTVSGIVASLFSWRMIYLFALCAVGILTLLLYWKMPRSVQQSSTAVSYLDSLKSLPHLVASQRLLREAAVSGFFMFGTFSIFWSTLIFYISSPAYNWGTFEAGILAIFGLSGAVAAPIVGRLADSYSERKIVYMGLVMQTISFIALLVGGSHLAILLLAIILLDVGNQFGQVANQTRVQGLGEAASNRNNTVFTRGAS
>NC_017960.1|WP_002295743.1|2329481_2330389_-|IS982-like-element-ISEfm1-family-transposase
MRSSKYTEHYTDTFITFKEIMRTVSNIYHNCVPDKIKNRRNTDQLKQRDTVIIACVIWGIINGYTSQRATYRAVCSVLFPNGDFPSRSRFTRLSSNLAYTIKIIRYFFIKKLTKGELVGIIDSFPSPLCKPVRNRQAKLLNQIAKVGYNSTKKSYFYGLKIHMIVTKTGFPITYSITNPGVHDVKVLETLSEEANLPNILGDKGYISHKIHEKLALKGITISVPPRKNMDKSEKLDHSLLGKQRKTVETVFSSLEKLGCQNFNSRSVKGLESRFESILLAYSVLLSRAQRRFEGTLRYSLGY
>NC_017960.1|WP_002290558.1|2327559_2329092_+|ABC-F-family-ATP-binding-cassette-domain-containing-protein
MSILTLNNITQQFGDKILYEGVDLQLNAGEHLGLIGQNGAGKSTLIKIITGEILPDDGQIHWQKNIHKGYLDQYVEVDETLTIEEFLKTAYAKEYEKEEKIAFLYQTYSETFDDSLLEKAGKLQTELDQGVFYQIDTLVAEMSSGLGIDVLGLDSLLKNLSGGQRSKVILAKLLLENPDVLILDEPTNHLDDQHIQWLTQFLQDFDGAYIVISHDQEFLDQITTHIADIEFGKITKYTGHLKQALKQKEQNRESYLRQYHAQQKQIEKTEAYIRKYKAGSRSTMAKSRQKQLDKIERLTPPASASKAVFDFPFSPIVTTLAVETTDLVIGYDRPLLAPINLTIRFGENIAIRGFNGIGKSTLLKTLIGEIEKISGDFHFPDNTKINYFSQDLYWENPLETPLQYLSSQFPKATIKELRRQLAKAGLVNQLASEPLTTLSGGEQTKVKLAQLTMNQGNLLILDEPTNHIDQETKESLQDGIQKFPGTVIIVSHEQEFYQDLVQRVIEIEPK
>NC_017960.1|WP_002287787.1|2326624_2327326_-|glucosamine-6-phosphate-deaminase
MEIIRVKNAEEGGKKAFEIIKEGMNKGAKVLGLATGSTPVTLYKEMTSSDLDFSEMTSVNLDEYVGLGGSDEQSYRHFMDVQLFDKKPFKETFVPDGKAEDLEAACKKYDQIIDAHPIDIQILGIGQNGHIGFNEPGASFDGTTSVVDLTESTINANKRFFDKAEDVPTKAVSMGIGSIMKSKEIVLMAFGESKADAIKGMIEGPVTNHLPASVLQNHDNVVVIIDEEAASKL
>NC_017960.1|WP_002287788.1|2325657_2326371_-|MgtC/SapB-family-protein
MNDMVLTIPEIILRLGIAMLFGGAIGFERQYKNRPAGMRTHILVCMGACIIALIQVEIASGALRDALEYPQLAGTIRSDEARLIAQVVSGVGFLGAGTIIVTKQSVTGLTTAASLWAIAGLGIAIGMGYYSIAIISFIGIAIALTVVKRVIHVPTTKKLEIQFIHRKETKDFLTDYFEEKNIVIEDVNFDVKFVDDYRVYKNIYTIDLPKGLTYADVIEELSVHKNITKLHLVSIAQ
>NC_017960.1|WP_002287791.1|2324211_2325351_-|AI-2E-family-transporter
MQSRFKQSKLFFWTVELVLTIIGVYFILQMPNIFSPILKMLSAIFLPLLVAGFIYYMFDPIVVFLEKHRIPRVFGFLLTFLVVIILVVLTVMNVVPQLMEQTIQLTQSLPMYADETSKWLNELAQREEFKNFNLEEQLASANLSLSNLFNIILVSLSASVSKIISFMMQFFILLFTVPFILLFMFKDGHKFIDALSHFFPKAIRKELRQTVKELNETLSAYISSTILDALIIGVMSFLAMRIFDQPYSLLLAVICGITNIIPYVGPFIGAVPAIIVGLFISPFQALYMALSILVIQQLDGNLIKPLLFGKSMNIHPLTIILVLIGAGSVAGILGMLICIPVYAVIKTIILNIRKIYLLRRMEHVSEKLDSPKVLEETSE
>NC_017960.1|WP_002287792.1|2323157_2324123_+|class-1b-ribonucleoside-diphosphate-reductase-subunit-beta
MSETYYEAINWNEIEDIIDKSTWEKLTEQFWLDTRIPLSNDLDDWRTLSQLEKDTVGHVFGGLTLLDTVQSESGMDQLRKDVRTPHEEAVLNNIQFMESVHAKSYSSIFSTLNTKKEIEEIFDWTNTNPYLQKKAERINEIYKHGTPLEKKIASVFLETFLFYSGFYTPLYYLGNNKLANVAEIIKLIIRDESVHGTYIGYKFQLGFNELPEAEQETLKDWMYNLLYELYENEERYTEELYDPIGWTEEVKTFLRYNANKALMNLGMDPLFPDTANDVNPIVMNGISTGTSNHDFFSQVGNGYLLGHVEAMKDDDYLIGLE
>NC_017960.1|WP_002294587.1|2333741_2334431_-|50S-ribosomal-protein-L1
MAKKSKKMQDALKKVDSSKVYPVAEAVALAKETNIAKFDATVEVAYRLNVDPKKADQQIRGAVVLPNGTGKTQTVLVFAKGDKAKEAEAAGADFVGDDDMVQKIQNGWFDFDVVVATPDMMATVGRLGRVLGPKGLMPNPKTGTVTMDVTKAVNEVKAGKVTYRVDKAGNIHVPIGKVSFDDEKLVENFAAIHDVLLKAKPSAAKGQYMKNVTITTTFGPGIHVDQASF
>NC_017960.1|WP_002291638.1|2334534_2334957_-|50S-ribosomal-protein-L11
MAKKVEKIVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGLIIPVVISVYEDRSFTFVTKTPPAAVLLKKAAKIEKGSGEPNKNKVAKVSSDQVREIAELKMEDLNAANVEAAMRMVEGTARSMGITVE
>NC_017960.1|WP_002294585.1|2335299_2335968_+|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-beta
MKDLRYRSVFDIIGPVMIGPSSSHTAGAARIGKIIRSIFGEQPDSVDIYLYESFAKTYRGHGTDIALVGGLLGMEPDDERLADSLKLAYEAGMEVLFVPKSEKAEHPNSVKMLLKKGTRKLSVTGISIGGGNIQISELNGFKISLSMGTPTLIVVHQDVPGMIAKVTSILSETNTNIGTMTVTRESKGENAIMIIEVDDPQVEETVKRLKQLPNIDSVNYFD
>NC_017960.1|WP_002294584.1|2335980_2336853_+|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha
MFLSIEELVDQAKAYPSVAELMIAVEMEMSGRSRSHIIEIMEKNLSVMEQSINEGKEGVTSVTGITGGDAKKLDDYLNEADFLSGETILKAVRNAVAVNEVNAKMGLICATPTAGSAGVVPGVLMAVRDRLDLTHEQQLEFLFTAGAFGLVIANNASISGAEGGCQAEVGSASAMAAAALVCAKNGTPHQAAQAVAITLKNMMGLICDPVAGLVEVPCVKRNALGSSQAFISADMALAGIESVIPPDEVVAAMYQVGRQMPSIFKETAEGGLAVTPTAKRLAEEILNKRA
>NC_017960.1|WP_002289897.1|2338134_2339040_-|alpha/beta-fold-hydrolase
MERKRCMTEPIKNLCKRATAAALVLISLFALSGCQTTKINTTEVSDKEKTAESSKVIEKTTIPTLFFHGYSGTENSFKGMLRRLEKNQQAVKELVLTVGTDGQIQATGDLSGKADNPMVQVLFEDNKNNEWNQAEWIKTCLLYLKENYGIDKVNIVGHSMGGVSALRYLGTYGQDTSLPQVQTLTAIGAPFNDFVDDSAQSLTDELAKGPAVVSNRYQDYQQMIGNIPITTRFFLIAGQLDETDLSDGTVPLNSALAVYALLKQRGNEIEEKVVTGENASHSMLHENQEVDQLVSRFIWKE
>NC_017960.1|WP_002294580.1|2339098_2339644_-|transcription-termination/antitermination-protein-NusG
MESFEKNWYVLHTYSGYENKVKANIESRAQSMKMADFIFRVVVPEEKETEVKNGKEKEIVHKTFPGYVLVEMIMTDASWYVVRNTPGVTGFVGSHGAGSKPAPLLPEEVNHILRSIGMSLRQNDLEVEVGEVVKIIEGAFAGLEGQVTEVDGEKEKLKVNIDMFGRETSTELDFDQVDKID
>NC_017960.1|WP_002294579.1|2339744_2339915_-|preprotein-translocase-subunit-SecE
MKFLKSVKDEIKQVTWPSRKQLRKDTLVVIETSIIFGLMFYVMDTAIQSLFGWILK
>NC_017960.1|WP_002294578.1|2339938_2340091_-|50S-ribosomal-protein-L33
MAKKKAALACSVCGSRNYTKSVSEGKSGERLEINKFCKYCNQYTLHKETK
>NC_017960.1|WP_002294577.1|2340252_2340897_+|CBS-domain-containing-protein
MLLKTLVYKKKDLTTVTETSTLEEALKILETSGYRCVPILDSSGNIFRGNIYKMHIYRHKANGGDMTLPVTHLLKNATKFIYLDTSFFKVFFTIKELPYIAVLDSENHFYGILTHSTLLNMLSQSWSVEQGSYVLTIASTGKQGDLAAIAKIISKHSSIASCITLDIEKDEYIRRTLITLPANTEAKVCETIVNHLEKKNYKVVEIENLQNQEA
>NC_017960.1|WP_002294548.1|2340952_2341456_-|QueT-transporter-family-protein
MQKTKSRQRLSVIVVNGIIMALYLALTILVAPVSSGPIQFRISESLNHLVVFNRKLLWGVLGGVIVYNAFFGFGIMDVVFGGGQTLLSLGLTALLQNKVKNVKMRLVLNTIFFTISMGLIAYMLVPTGGQAFWTTYGTLALSEFIVMAVSAPLMYYLDRALDFEKRV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

743115 : 751587

Streptococcus_phage(66.67%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002294039.1\|743115_743760_+	dTMP kinase	M1PSC7	Streptococcus_phage	4.2e-58	52.6
WP_002292340.1\|743774_744104_+	cyclic-di-AMP receptor	NA	NA	NA	NA
WP_002288071.1\|744117_745056_+	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	3.3e-35	34.4
WP_002288073.1\|745091_745916_+	stage 0 sporulation family protein	NA	NA	NA	NA
WP_002288076.1\|745908_746256_+	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	5.1e-18	41.1
WP_002288078.1\|746324_747197_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	3.1e-88	60.4
WP_002294035.1\|747305_748427_+	DNA polymerase IV	NA	NA	NA	NA
WP_002288081.1\|748480_749083_-	anaerobic ribonucleoside-triphosphate reductase activating protein	A0A288TZV3	Enterococcus_phage	1.7e-53	58.6
WP_002288083.1\|749397_751587_-	anaerobic ribonucleoside-triphosphate reductase	A0A0C5KKX3	Enterococcus_phage	1.8e-286	66.6

DBSCAN-SWA_2

804597 : 905084

115

Enterococcus_phage(24.39%)

holin,transposase,tRNA,integrase,terminase,head,capsid,protease,portal,tail

attL 829918:829934|attR 889508:889524

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002286621.1\|804597_807396_+\|tRNA	isoleucine--tRNA ligase	A0A2H4UVG0	Bodo_saltans_virus	1.6e-74	26.4
WP_002286618.1\|807444_808971_-	glucose-6-phosphate dehydrogenase	H6WFS4	Cyanophage	8.9e-75	35.3
WP_002286616.1\|808985_809633_-	metal-dependent transcriptional regulator	NA	NA	NA	NA
WP_002286678.1\|809816_810146_-	DUF4828 domain-containing protein	NA	NA	NA	NA
WP_002286614.1\|810322_811051_+	DNA/RNA nuclease SfsA	NA	NA	NA	NA
WP_002286612.1\|811066_812080_+	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_002286608.1\|812079_813357_+	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	5.8e-35	28.8
WP_002286607.1\|813419_816122_+	sigma-54-dependent transcriptional regulator	NA	NA	NA	NA
WP_002286606.1\|816273_816591_+	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_002286604.1\|816620_816941_+	PTS lactose/cellobiose transporter subunit IIA	NA	NA	NA	NA
WP_002286601.1\|817048_818509_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_002286598.1\|818576_818798_+	hypothetical protein	NA	NA	NA	NA
WP_002286596.1\|818828_819011_+	DUF3188 domain-containing protein	NA	NA	NA	NA
WP_002286592.1\|819010_819424_+	DUF3284 domain-containing protein	NA	NA	NA	NA
WP_002286589.1\|819546_820728_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002286676.1\|820798_820963_-	hypothetical protein	NA	NA	NA	NA
WP_002286587.1\|821258_822398_-\|integrase	site-specific integrase	Q9AZR0	Lactococcus_phage	2.6e-95	47.1
WP_002286584.1\|822514_823099_-	DUF4352 domain-containing protein	A8ASM1	Listeria_phage	1.2e-16	42.3
WP_002286582.1\|823225_823657_-	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_002286580.1\|823674_823995_-	helix-turn-helix transcriptional regulator	M1I9X0	Streptococcus_phage	7.7e-21	50.0
WP_002286578.1\|824288_824429_+	hypothetical protein	NA	NA	NA	NA
WP_002286679.1\|824726_824984_+	phosphomannomutase	NA	NA	NA	NA
WP_002286674.1\|824954_825263_-	hypothetical protein	NA	NA	NA	NA
WP_002286575.1\|825340_826087_+	phage antirepressor	A0A0B5A507	Paenibacillus_phage	2.5e-54	44.1
WP_002296611.1\|826101_826305_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002286573.1\|826320_826659_+	DUF771 domain-containing protein	NA	NA	NA	NA
WP_002296610.1\|826645_826825_+	hypothetical protein	NA	NA	NA	NA
WP_002286568.1\|826867_827338_-	hypothetical protein	NA	NA	NA	NA
WP_002286562.1\|827424_828123_+	phage regulatory protein	D2IYT0	Enterococcus_phage	1.7e-25	34.6
WP_002286559.1\|828300_828642_+	hypothetical protein	NA	NA	NA	NA
WP_002286557.1\|828634_829306_+	DUF1071 domain-containing protein	A0A1B1P7F0	Bacillus_phage	4.2e-29	47.4
WP_002286553.1\|829311_829998_+	hypothetical protein	C9E2N1	Enterococcus_phage	3.2e-88	69.1
829918:829934	attL	NA	NA	NA	NA
WP_002286552.1\|830000_830750_+	helix-turn-helix domain-containing protein	A0A1L2BY83	Clostridium_phage	1.7e-31	54.0
WP_002286696.1\|830761_831031_+	hypothetical protein	NA	NA	NA	NA
WP_002296607.1\|831035_831200_+	hypothetical protein	NA	NA	NA	NA
WP_002286695.1\|831192_831495_+	hypothetical protein	NA	NA	NA	NA
WP_002296606.1\|831491_831653_+	antitoxin	NA	NA	NA	NA
WP_002286694.1\|831649_831955_+	hypothetical protein	NA	NA	NA	NA
WP_002286550.1\|831954_832311_+	DUF1140 family protein	A0A2H4JAZ4	uncultured_Caudovirales_phage	3.1e-10	37.4
WP_002322165.1\|832297_832516_+	hypothetical protein	NA	NA	NA	NA
WP_002286547.1\|832512_832932_+	YopX family protein	D2IZL0	Enterococcus_phage	4.1e-30	54.3
WP_002286545.1\|832928_833486_+	DUF1642 domain-containing protein	A0A0C5KKV2	Enterococcus_phage	2.8e-10	36.2
WP_002286693.1\|833482_833779_+	hypothetical protein	NA	NA	NA	NA
WP_002286542.1\|833855_834269_+	autolysin	C9E2P5	Enterococcus_phage	1.5e-56	81.0
WP_002296602.1\|834577_834730_+	hypothetical protein	NA	NA	NA	NA
WP_002300143.1\|834726_835002_-	hypothetical protein	A0A2H4JEH2	uncultured_Caudovirales_phage	9.9e-17	45.7
WP_002311723.1\|835455_835662_+	hypothetical protein	NA	NA	NA	NA
WP_002296600.1\|835857_836025_+	thymidylate synthase	NA	NA	NA	NA
WP_002286540.1\|836050_836395_+	HNH endonuclease	A0A1B1P757	Bacillus_phage	3.8e-26	57.1
WP_002296599.1\|836399_836681_+	hypothetical protein	NA	NA	NA	NA
WP_002286538.1\|836783_837098_+\|terminase	terminase	A0A1S7FYW6	Listeria_phage	3.3e-08	37.9
WP_002286533.1\|837075_838770_+\|terminase	terminase large subunit	A0A1B1P766	Bacillus_phage	3.0e-148	49.6
WP_002286530.1\|838789_839968_+\|portal	phage portal protein	A0A1B1P754	Bacillus_phage	5.4e-80	40.4
WP_002286527.1\|839930_840617_+\|protease	Clp protease ClpP	A0A2I6PDD0	Staphylococcus_phage	1.0e-30	39.7
WP_002286525.1\|840616_841777_+\|capsid	phage major capsid protein	A0A1B1P752	Bacillus_phage	1.8e-99	50.1
WP_002286524.1\|841786_842662_+	hypothetical protein	D2IYX3	Enterococcus_phage	5.6e-130	74.2
WP_002286523.1\|842658_842970_+	hypothetical protein	A0A1B1P751	Bacillus_phage	6.3e-12	42.1
WP_002286522.1\|842959_843313_+\|head	phage head closure protein	NA	NA	NA	NA
WP_002296598.1\|843302_843704_+	hypothetical protein	A0A1B1P759	Bacillus_phage	1.1e-13	33.3
WP_002286516.1\|843696_844101_+	hypothetical protein	R4IBU7	Listeria_phage	6.1e-07	29.5
WP_002286512.1\|844112_844721_+	hypothetical protein	Q8W5Z9	Listeria_phage	3.0e-34	41.1
WP_002286510.1\|844739_845102_+	hypothetical protein	NA	NA	NA	NA
WP_002286502.1\|845303_848735_+\|tail	phage tail tape measure protein	A0A1D3SNL5	Enterococcus_phage	3.1e-67	44.4
WP_002286500.1\|848785_849523_+\|tail	phage tail protein	NA	NA	NA	NA
WP_002286497.1\|849532_851824_+\|tail	phage tail protein	A0A1D3SNL1	Enterococcus_phage	9.6e-89	30.0
WP_002286495.1\|851847_853974_+	hypothetical protein	A0A060AI60	Enterococcus_phage	1.4e-62	40.1
WP_002290627.1\|853990_854140_+	hypothetical protein	NA	NA	NA	NA
WP_002286491.1\|854136_854583_+	hypothetical protein	NA	NA	NA	NA
WP_002296594.1\|854584_854722_+	XkdX family protein	NA	NA	NA	NA
WP_002286686.1\|854759_855053_+	hypothetical protein	NA	NA	NA	NA
WP_002286683.1\|855049_855274_+\|holin	phage holin	NA	NA	NA	NA
WP_002286484.1\|855270_856296_+	N-acetylmuramoyl-L-alanine amidase	A0A139ZVY1	Enterococcus_phage	2.1e-64	61.3
WP_087046766.1\|857235_858397_+\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	4.1e-80	54.2
WP_002286474.1\|859320_859728_+	hypothetical protein	NA	NA	NA	NA
WP_002296902.1\|859741_860143_+	hypothetical protein	NA	NA	NA	NA
WP_002286473.1\|860144_860516_+	hypothetical protein	NA	NA	NA	NA
WP_002286680.1\|860551_860854_-	hypothetical protein	NA	NA	NA	NA
WP_002286470.1\|861102_861303_-\|integrase	tyrosine-type recombinase/integrase	Q9AZR0	Lactococcus_phage	4.6e-08	75.7
WP_002286469.1\|861607_862840_-	aminopeptidase	NA	NA	NA	NA
WP_002286467.1\|863093_863663_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_002286465.1\|863840_864281_-	flavodoxin	NA	NA	NA	NA
WP_002286463.1\|864438_865203_+	type I methionyl aminopeptidase	NA	NA	NA	NA
WP_002286461.1\|865234_866158_+	YihY/virulence factor BrkB family protein	NA	NA	NA	NA
WP_002286457.1\|866233_867373_+	undecaprenyl/decaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphate transferase	NA	NA	NA	NA
WP_002286455.1\|867365_868166_+	glycosyltransferase	NA	NA	NA	NA
WP_002286453.1\|868165_868993_+	glycosyltransferase	NA	NA	NA	NA
WP_002321540.1\|868970_869705_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_002286449.1\|869804_870671_+	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	3.7e-102	62.5
WP_002286442.1\|870684_871257_+	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A291LA62	Escherichia_phage	8.3e-42	49.2
WP_002286428.1\|872406_873258_+	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	1.7e-38	39.0
WP_002302719.1\|873291_875325_+	hypothetical protein	NA	NA	NA	NA
WP_002322625.1\|875368_876649_+	EpaQ family protein	NA	NA	NA	NA
WP_002289081.1\|876858_877665_+	ABC transporter permease	NA	NA	NA	NA
WP_002289079.1\|877676_878897_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.1e-11	26.9
WP_002289078.1\|878886_880473_+	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_002289076.1\|880511_882650_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_002289074.1\|883017_884001_-	serine hydrolase	NA	NA	NA	NA
WP_002289073.1\|884378_885770_+	sugar transferase	NA	NA	NA	NA
WP_002289071.1\|885785_886826_+	glycosyltransferase family 2 protein	I1TED8	Salmonella_phage	2.4e-07	35.3
WP_002289069.1\|886844_887930_+	glycosyltransferase family 1 protein	NA	NA	NA	NA
WP_002289068.1\|887962_888925_+	glycosyl transferase	NA	NA	NA	NA
WP_002302730.1\|890345_891416_+	hypothetical protein	NA	NA	NA	NA
889508:889524	attR	NA	NA	NA	NA
WP_002292875.1\|891402_892824_+	oligosaccharide flippase family protein	NA	NA	NA	NA
WP_002289359.1\|892836_893844_+	polysaccharide biosynthesis protein	A0A1V0SAI8	Catovirus	1.2e-40	35.9
WP_002292874.1\|893855_894860_+	N-acetylneuraminate synthase	NA	NA	NA	NA
WP_002289362.1\|894856_896005_+	UDP-N-acetylglucosamine 2-epimerase (hydrolyzing)	NA	NA	NA	NA
WP_002289363.1\|895977_896655_+	acetyltransferase	NA	NA	NA	NA
WP_002326811.1\|896644_897787_+	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	A0A2K9L0G1	Tupanvirus	2.4e-24	27.9
WP_002289366.1\|897799_898777_+	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_002289368.1\|898776_899685_+	dehydrogenase	NA	NA	NA	NA
WP_002289370.1\|899685_900438_+	acylneuraminate cytidylyltransferase family protein	NA	NA	NA	NA
WP_002289372.1\|900442_901390_+	NAD-dependent epimerase/dehydratase family protein	A0A1V0SKV4	Klosneuvirus	2.8e-50	37.7
WP_002285758.1\|902898_903093_+	hypothetical protein	NA	NA	NA	NA
WP_014387108.1\|903082_903448_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_002296127.1\|903536_905084_+\|transposase	IS66 family transposase	NA	NA	NA	NA

DBSCAN-SWA_3

1187268 : 1196329

Gordonia_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002288023.1\|1187268_1188564_+	adenylosuccinate lyase	A0A1B3B081	Gordonia_phage	4.5e-19	33.1
WP_002297115.1\|1188743_1189121_-	hypothetical protein	NA	NA	NA	NA
WP_002288021.1\|1189376_1190105_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	E3SPA9	Prochlorococcus_phage	4.6e-45	41.4
WP_002295474.1\|1190104_1190359_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_002288017.1\|1190360_1191032_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_002288015.1\|1191032_1193255_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	1.9e-150	41.3
WP_002288013.1\|1193239_1194679_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	5.3e-53	33.1
WP_002288011.1\|1194701_1195754_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A1D7SE90	Cyanophage	2.7e-62	43.7
WP_002288010.1\|1195750_1196329_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.3e-26	37.4

DBSCAN-SWA_4

1657392 : 1710213

Streptococcus_phage(16.67%)

tRNA,protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002288495.1\|1657392_1659102_-\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
WP_002288494.1\|1659169_1660438_-\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
WP_002296531.1\|1660598_1661399_-	phosphatidate cytidylyltransferase	NA	NA	NA	NA
WP_002294134.1\|1661395_1662208_-	isoprenyl transferase	R9W0U9	Flavobacterium_phage	2.0e-25	46.8
WP_002293875.1\|1662401_1662959_-	ribosome recycling factor	NA	NA	NA	NA
WP_002293877.1\|1662961_1663684_-	UMP kinase	NA	NA	NA	NA
WP_002293878.1\|1663819_1664701_-	elongation factor Ts	NA	NA	NA	NA
WP_002293880.1\|1664799_1665582_-	30S ribosomal protein S2	NA	NA	NA	NA
WP_002293881.1\|1665940_1666420_+	ArgR family transcriptional regulator	NA	NA	NA	NA
WP_002288429.1\|1666636_1667728_+	2-aminoethylphosphonate--pyruvate transaminase	NA	NA	NA	NA
WP_002288464.1\|1667720_1667849_+	phosphonoacetaldehyde hydrolase	NA	NA	NA	NA
WP_002288430.1\|1667852_1668398_+	phosphonoacetaldehyde hydrolase	NA	NA	NA	NA
WP_002288432.1\|1668851_1670543_-\|tRNA	arginine--tRNA ligase	A0A2I2L3K1	Orpheovirus	2.9e-74	32.6
WP_002288434.1\|1670962_1671910_-	carbamate kinase	NA	NA	NA	NA
WP_002288437.1\|1672024_1673044_-	ornithine carbamoyltransferase	NA	NA	NA	NA
WP_002288439.1\|1673134_1674364_-	arginine deiminase	NA	NA	NA	NA
WP_002288442.1\|1674824_1675526_+	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_002288444.1\|1676134_1677151_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	7.1e-60	41.0
WP_002288445.1\|1677147_1677612_-	ribosomal protein S18-alanine N-acetyltransferase	NA	NA	NA	NA
WP_002288446.1\|1677618_1678161_-	ribosomal protein S18-alanine N-acetyltransferase	NA	NA	NA	NA
WP_002288447.1\|1678144_1678969_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA
WP_002288449.1\|1679057_1680038_-	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	5.8e-19	28.9
WP_002288451.1\|1680061_1681546_-	UDP-glucose--hexose-1-phosphate uridylyltransferase	NA	NA	NA	NA
WP_002288452.1\|1681557_1682547_-	UDP-glucose 4-epimerase GalE	A0A1V0SG19	Hokovirus	2.1e-48	36.8
WP_002288457.1\|1682794_1682962_+	DUF3042 family protein	NA	NA	NA	NA
WP_002288458.1\|1683023_1684835_-	FAD/NAD(P)-binding protein	NA	NA	NA	NA
WP_002288459.1\|1684831_1685197_-	DUF488 family protein	NA	NA	NA	NA
WP_002288461.1\|1685359_1685755_-	rhodanese-like domain-containing protein	NA	NA	NA	NA
WP_002288462.1\|1685772_1686735_-	ROK family glucokinase	NA	NA	NA	NA
WP_002293902.1\|1686734_1686947_-	YqgQ family protein	NA	NA	NA	NA
WP_002289885.1\|1686967_1687666_-\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_002289886.1\|1687685_1688228_-	5-formyltetrahydrofolate cyclo-ligase	NA	NA	NA	NA
WP_002296124.1\|1688359_1689364_-	iron ABC transporter permease	NA	NA	NA	NA
WP_164927925.1\|1689360_1690311_-	iron chelate uptake ABC transporter family permease subunit	NA	NA	NA	NA
WP_002293905.1\|1690345_1691152_-	ABC transporter ATP-binding protein	A0A1V0SJ29	Klosneuvirus	1.0e-13	32.1
WP_002293906.1\|1691317_1692274_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002296121.1\|1692349_1692868_-	dihydrofolate reductase	G3MBI7	Bacillus_virus	7.1e-24	39.1
WP_002296119.1\|1692955_1693105_-	50S ribosomal protein L33	NA	NA	NA	NA
WP_002288531.1\|1693332_1693779_+	DUF2188 domain-containing protein	NA	NA	NA	NA
WP_002288533.1\|1693973_1695869_-	asparagine synthase (glutamine-hydrolyzing)	F2Y2L7	Organic_Lake_phycodnavirus	6.0e-20	26.2
WP_002296918.1\|1696143_1697589_-\|transposase	IS1182-like element ISEfa7 family transposase	A0A1X9I5T2	Streptococcus_phage	1.5e-124	48.0
WP_080475345.1\|1698216_1699374_-\|transposase	IS256-like element ISEf1 family transposase	NA	NA	NA	NA
WP_002296332.1\|1700638_1701205_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_002296334.1\|1701460_1702792_+	DUF1576 domain-containing protein	NA	NA	NA	NA
WP_002296335.1\|1702757_1703108_+	hypothetical protein	NA	NA	NA	NA
WP_002296336.1\|1703199_1703619_-	cupin domain-containing protein	NA	NA	NA	NA
WP_002296337.1\|1703619_1703964_-	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_002287760.1\|1704235_1705189_+\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_002287776.1\|1705380_1705977_+	TVP38/TMEM64 family protein	M1Q152	Streptococcus_phage	8.7e-34	41.7
WP_002287775.1\|1706100_1707900_+	glycerophosphoryl diester phosphodiesterase membrane domain-containing protein	I6XE30	Staphylococcus_phage	5.3e-10	26.5
WP_002297633.1\|1708177_1708390_-	hypothetical protein	NA	NA	NA	NA
WP_002293931.1\|1708851_1709001_+	hypothetical protein	NA	NA	NA	NA
WP_002311774.1\|1709253_1710213_-\|transposase	IS30 family transposase	H7BW61	unidentified_phage	7.5e-11	27.2

DBSCAN-SWA_5

1714999 : 1847770

120

Streptococcus_phage(41.67%)

tRNA,transposase,integrase

attL 1744809:1744824|attR 1755544:1755559

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002288576.1\|1714999_1716253_+	NAD(P)/FAD-dependent oxidoreductase	A0A2H4PQX1	Staphylococcus_phage	7.7e-24	55.3
WP_002288577.1\|1716323_1716809_-\|tRNA	Cys-tRNA(Pro) deacylase	NA	NA	NA	NA
WP_002288579.1\|1716831_1717590_-	type I 3-dehydroquinate dehydratase	W6LP76	Streptococcus_phage	1.9e-25	36.4
WP_002288581.1\|1717605_1718784_-	class I SAM-dependent rRNA methyltransferase	W6LLI2	Streptococcus_phage	3.9e-102	48.9
WP_002288584.1\|1719013_1721134_+	LTA synthase family protein	W6LM83	Streptococcus_phage	2.8e-220	58.1
WP_002296838.1\|1721356_1722082_+	hypothetical protein	NA	NA	NA	NA
WP_002288586.1\|1722071_1722581_+	hypothetical protein	NA	NA	NA	NA
WP_002288588.1\|1722651_1724100_-	HAMP domain-containing histidine kinase	A0A1V0SGX0	Hokovirus	1.7e-19	29.3
WP_002288590.1\|1724099_1724816_-	response regulator transcription factor	W8CYM9	Bacillus_phage	1.0e-33	35.7
WP_002288595.1\|1724796_1725147_-	SdpI family protein	NA	NA	NA	NA
WP_002288592.1\|1725290_1726064_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_002302293.1\|1726820_1727123_+	hypothetical protein	NA	NA	NA	NA
WP_000997695.1\|1727326_1728505_-\|transposase	IS256-like element ISEf1 family transposase	NA	NA	NA	NA
WP_002323892.1\|1729612_1729927_-	hypothetical protein	NA	NA	NA	NA
WP_000997695.1\|1730043_1731222_+\|transposase	IS256-like element ISEf1 family transposase	NA	NA	NA	NA
WP_002321266.1\|1731558_1731798_+	hypothetical protein	NA	NA	NA	NA
WP_002289617.1\|1732159_1732420_-	hypothetical protein	NA	NA	NA	NA
WP_002289618.1\|1732604_1733102_-	GAF domain-containing protein	NA	NA	NA	NA
WP_002289619.1\|1733231_1733942_-	acetolactate decarboxylase	NA	NA	NA	NA
WP_002289620.1\|1733954_1735619_-	acetolactate synthase AlsS	NA	NA	NA	NA
WP_002321263.1\|1735823_1736291_-	hypothetical protein	NA	NA	NA	NA
WP_002321035.1\|1737617_1737833_-	hypothetical protein	NA	NA	NA	NA
WP_002303949.1\|1737842_1738658_-	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_002288989.1\|1738918_1739362_-	LysR family transcriptional regulator substrate-binding protein	NA	NA	NA	NA
WP_002321036.1\|1739495_1739834_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_002288986.1\|1739821_1740199_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_002288985.1\|1740422_1741616_+	MFS transporter	NA	NA	NA	NA
WP_002288984.1\|1741781_1742204_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002321037.1\|1742598_1742793_+	hypothetical protein	NA	NA	NA	NA
WP_002288983.1\|1742789_1743284_+	hypothetical protein	NA	NA	NA	NA
WP_002288982.1\|1743445_1744618_-	class C sortase	NA	NA	NA	NA
1744809:1744824	attL	NA	NA	NA	NA
WP_002288981.1\|1744823_1745639_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_002288979.1\|1745788_1746235_-	cell wall anchor	NA	NA	NA	NA
WP_158003446.1\|1746231_1747236_-	isopeptide-forming domain-containing fimbrial protein	NA	NA	NA	NA
WP_002352916.1\|1747275_1747605_-	hypothetical protein	NA	NA	NA	NA
WP_002305732.1\|1747730_1750058_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_002288970.1\|1750900_1751194_-	DUF2087 domain-containing protein	NA	NA	NA	NA
WP_002288969.1\|1751596_1752775_-\|integrase	site-specific integrase	S6C485	Thermus_phage	1.4e-30	31.1
WP_002300928.1\|1752878_1753193_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002288966.1\|1753299_1753515_+	hypothetical protein	NA	NA	NA	NA
WP_002288964.1\|1753814_1754057_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002288962.1\|1754043_1754472_-	hypothetical protein	NA	NA	NA	NA
WP_002296127.1\|1754623_1756171_-\|transposase	IS66 family transposase	NA	NA	NA	NA
1755544:1755559	attR	NA	NA	NA	NA
WP_014748682.1\|1756259_1756625_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_002285758.1\|1756614_1756809_-	hypothetical protein	NA	NA	NA	NA
WP_002289210.1\|1757297_1757672_-	VOC family protein	NA	NA	NA	NA
WP_002296814.1\|1757694_1759095_-	beta-fructofuranosidase	NA	NA	NA	NA
WP_002289214.1\|1759098_1759509_-	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_002289215.1\|1759526_1760018_-	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_002289216.1\|1760027_1760819_-	PTS system mannose/fructose/sorbose family transporter subunit IID	NA	NA	NA	NA
WP_002289217.1\|1760811_1761585_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_002296812.1\|1761740_1764263_-	sigma 54-interacting transcriptional regulator	NA	NA	NA	NA
WP_002289219.1\|1764354_1765227_-	ROK family protein	NA	NA	NA	NA
WP_002289220.1\|1765262_1765730_-	PTS glucose transporter subunit IIA	NA	NA	NA	NA
WP_002289221.1\|1765739_1767209_-	PTS transporter subunit EIIC	NA	NA	NA	NA
WP_002296810.1\|1767279_1768698_-	family 43 glycosylhydrolase	NA	NA	NA	NA
WP_002296809.1\|1768819_1769800_-	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_087040414.1\|1770079_1771242_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	1.6e-79	53.5
WP_002305710.1\|1771334_1771844_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_002343922.1\|1772182_1773136_+\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_077828749.1\|1773088_1773325_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002289051.1\|1773744_1774866_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_002321361.1\|1775193_1776603_+\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_002289053.1\|1776599_1777328_+	ATP-binding protein	A0A2L1IVB6	Escherichia_phage	5.1e-36	37.1
WP_002289055.1\|1777455_1778367_-	conjugal transfer protein	A0A1S5SF22	Streptococcus_phage	1.1e-59	42.2
WP_002289057.1\|1778383_1779391_-	lipoprotein	A0A1S5SEZ8	Streptococcus_phage	4.8e-117	63.9
WP_002289059.1\|1779387_1781517_-	FUSC family protein	A0A1S5SF30	Streptococcus_phage	3.1e-182	60.3
WP_002296840.1\|1781817_1783005_-\|transposase	IS256-like element IS16 family transposase	A0A0K2CZ57	Paenibacillus_phage	8.2e-92	46.3
WP_002321772.1\|1783097_1785443_-	ATP-binding protein	A0A1S5SF64	Streptococcus_phage	0.0e+00	76.0
WP_002288938.1\|1785429_1785819_-	conjugal transfer protein	A0A1S5SEX7	Streptococcus_phage	1.4e-40	65.9
WP_002297208.1\|1785868_1786765_-	AAA family ATPase	A0A1B1IUG5	uncultured_Mediterranean_phage	1.1e-16	29.7
WP_002288935.1\|1786767_1788615_-	PHP domain-containing protein	NA	NA	NA	NA
WP_002288934.1\|1788711_1789212_-	antirestriction protein ArdA	A0A1S5SF25	Streptococcus_phage	7.0e-53	59.6
WP_033657400.1\|1789224_1789449_-	hypothetical protein	A0A1S5SEY0	Streptococcus_phage	8.8e-24	83.8
WP_002286940.1\|1789552_1791463_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	7.1e-37	29.8
WP_002305703.1\|1792208_1792346_-	DUF3789 domain-containing protein	NA	NA	NA	NA
WP_002286934.1\|1792342_1793527_-	XRE family transcriptional regulator	A0A1S5SEX3	Streptococcus_phage	1.9e-141	60.8
WP_002286933.1\|1793782_1794037_-	hypothetical protein	NA	NA	NA	NA
WP_002286932.1\|1794061_1795204_-	DNA cytosine methyltransferase	A0A1S5SEK0	Streptococcus_phage	1.7e-126	62.1
WP_002286930.1\|1795263_1796616_-	DUF87 domain-containing protein	A0A1S5SFB5	Streptococcus_phage	5.9e-163	64.6
WP_002286928.1\|1796686_1797031_-	type II toxin-antitoxin system RelB/DinJ family antitoxin	NA	NA	NA	NA
WP_002286926.1\|1797040_1797415_-	YdcP family protein	A0A1S5SF96	Streptococcus_phage	1.1e-34	62.9
WP_002286925.1\|1797427_1797742_-	YdcP family protein	A0A1S5SF38	Streptococcus_phage	1.7e-25	53.4
WP_002286924.1\|1797855_1801083_-	fibrinogen-binding MSCRAMM adhesin Fss3	NA	NA	NA	NA
WP_002286921.1\|1801161_1801824_-	hypothetical protein	NA	NA	NA	NA
WP_002286913.1\|1802196_1802544_-	50S ribosomal protein L19	NA	NA	NA	NA
WP_002293717.1\|1802679_1803441_-\|tRNA	tRNA (guanosine(37)-N1)-methyltransferase TrmD	NA	NA	NA	NA
WP_002293716.1\|1803430_1803952_-	ribosome maturation factor RimM	NA	NA	NA	NA
WP_002297190.1\|1804121_1804913_-	hypothetical protein	NA	NA	NA	NA
WP_002290277.1\|1805036_1805288_-	KH domain-containing protein	NA	NA	NA	NA
WP_002290274.1\|1805299_1805575_-	30S ribosomal protein S16	NA	NA	NA	NA
WP_002293714.1\|1805827_1806382_+	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	2.3e-12	29.3
WP_002297192.1\|1806460_1806982_-	dihydrofolate reductase	NA	NA	NA	NA
WP_002293710.1\|1806985_1807564_-	DNA-3-methyladenine glycosylase I	NA	NA	NA	NA
WP_002293709.1\|1807675_1809094_-	signal recognition particle protein	NA	NA	NA	NA
WP_002293708.1\|1809114_1809453_-	putative DNA-binding protein	NA	NA	NA	NA
WP_002297194.1\|1809412_1809916_-	DUF523 domain-containing protein	NA	NA	NA	NA
WP_002293705.1\|1810046_1810751_+	response regulator transcription factor	W8CYM9	Bacillus_phage	1.4e-38	36.2
WP_002297195.1\|1810747_1812484_+	two-component sensor histidine kinase	W8CYF6	Bacillus_phage	1.2e-27	34.1
WP_002297196.1\|1812586_1815058_-	cation-translocating P-type ATPase	M1HBF8	Paramecium_bursaria_Chlorella_virus	7.0e-45	28.8
WP_002289807.1\|1818402_1819293_-	phosphate ABC transporter substrate-binding protein PstS family protein	NA	NA	NA	NA
WP_002289809.1\|1819489_1819972_-	hypothetical protein	NA	NA	NA	NA
WP_002289810.1\|1820179_1820545_+	hypothetical protein	NA	NA	NA	NA
WP_002326708.1\|1820635_1820953_-	SdpI family protein	NA	NA	NA	NA
WP_002296840.1\|1821213_1822401_-\|transposase	IS256-like element IS16 family transposase	A0A0K2CZ57	Paenibacillus_phage	8.2e-92	46.3
WP_002347285.1\|1823223_1824519_+\|transposase	ISL3-like element ISEfa5 family transposase	A0A2D1GQC1	Lysinibacillus_phage	5.0e-10	21.4
WP_002287105.1\|1824674_1825649_-	choloylglycine hydrolase family protein	M1HVK5	Paramecium_bursaria_Chlorella_virus	5.4e-25	31.8
WP_002305693.1\|1828086_1828518_-	DUF4231 domain-containing protein	NA	NA	NA	NA
WP_002294831.1\|1832952_1833645_-	N-acetylmuramoyl-L-alanine amidase	Q9MCC6	Lactobacillus_phage	2.3e-30	43.4
WP_002294835.1\|1834081_1834651_-	prevent-host-death protein	NA	NA	NA	NA
WP_002304701.1\|1834724_1835048_-	hypothetical protein	NA	NA	NA	NA
WP_002294839.1\|1835201_1836014_-	hypothetical protein	NA	NA	NA	NA
WP_002304700.1\|1836367_1837216_+	MoxR family ATPase	NA	NA	NA	NA
WP_002289045.1\|1837360_1838302_+	DUF58 domain-containing protein	NA	NA	NA	NA
WP_002296533.1\|1840574_1842746_-	copper/silver-translocating P-type ATPase CopB	A0A218MNH6	uncultured_virus	5.0e-71	32.3
WP_002289041.1\|1842765_1844952_-	copper-translocating P-type ATPase	A0A218MNH6	uncultured_virus	1.5e-120	38.6
WP_002289040.1\|1844951_1845161_-	copper chaperone CopZ	NA	NA	NA	NA
WP_002289038.1\|1845173_1845614_-	CopY/TcrY family copper transport repressor	NA	NA	NA	NA
WP_002289037.1\|1845687_1846227_-	transcriptional regulator	A0A097BYE2	Leuconostoc_phage	3.8e-20	34.5
WP_002297185.1\|1846474_1847770_+\|transposase	ISL3-like element ISEfa5 family transposase	A0A2D1GQC1	Lysinibacillus_phage	3.8e-10	21.4

DBSCAN-SWA_6

1855185 : 1914045

Streptococcus_phage(28.57%)

tRNA,transposase,portal

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002288767.1\|1855185_1856484_-\|tRNA	asparagine--tRNA ligase	A0A2P1EMB4	Moumouvirus	1.2e-59	30.3
WP_002296294.1\|1856523_1857714_-	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
WP_002321579.1\|1857734_1858262_-	DUF5590 domain-containing protein	NA	NA	NA	NA
WP_002288763.1\|1858308_1861098_-	DEAD/DEAH box helicase family protein	A0A1X9I5C8	Streptococcus_phage	1.4e-89	30.9
WP_002288762.1\|1861244_1861445_-	cold-shock protein	Q9AZD3	Lactococcus_phage	2.5e-22	74.2
WP_002323868.1\|1861896_1862217_-	hypothetical protein	NA	NA	NA	NA
WP_002288760.1\|1862719_1863838_-	hypothetical protein	NA	NA	NA	NA
WP_002299522.1\|1864308_1865616_+	D-alanyl-D-alanine carboxypeptidase	NA	NA	NA	NA
WP_002289548.1\|1865734_1866934_+	YdcF family protein	NA	NA	NA	NA
WP_002289547.1\|1866960_1868229_-	voltage-gated chloride channel family protein	A0A1X9I5Z9	Streptococcus_phage	2.2e-42	31.1
WP_002289561.1\|1868391_1869039_-	elongation factor G-binding protein	NA	NA	NA	NA
WP_002289559.1\|1869446_1869950_-	HD domain-containing protein	NA	NA	NA	NA
WP_002289551.1\|1870945_1871221_+	acylphosphatase	NA	NA	NA	NA
WP_002289550.1\|1871421_1871769_-	hypothetical protein	NA	NA	NA	NA
WP_002304673.1\|1871936_1872866_+	membrane protein insertase YidC	NA	NA	NA	NA
WP_002326704.1\|1874414_1875323_+\|transposase	IS982-like element ISEfm1 family transposase	NA	NA	NA	NA
WP_002295755.1\|1875378_1875876_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002289246.1\|1875858_1876596_-	hypothetical protein	NA	NA	NA	NA
WP_014748700.1\|1877093_1877315_-	hypothetical protein	NA	NA	NA	NA
WP_115250347.1\|1878218_1879380_+\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	1.6e-79	51.3
WP_073981173.1\|1879786_1880140_-	polysaccharide biosynthesis C-terminal domain-containing protein	NA	NA	NA	NA
WP_002287760.1\|1880383_1881337_-\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_044051698.1\|1882105_1882297_-	hypothetical protein	NA	NA	NA	NA
WP_164927922.1\|1882736_1882964_-\|portal	phage portal protein	M1PLL1	Streptococcus_phage	1.9e-13	47.7
WP_014748707.1\|1883899_1884316_-	hypothetical protein	NA	NA	NA	NA
WP_134789284.1\|1884282_1884477_-	hypothetical protein	NA	NA	NA	NA
WP_002296127.1\|1885080_1886628_-\|transposase	IS66 family transposase	NA	NA	NA	NA
WP_002287659.1\|1886729_1887083_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_002285758.1\|1887072_1887267_-	hypothetical protein	NA	NA	NA	NA
WP_134789296.1\|1887589_1887916_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002338465.1\|1888132_1888300_-	endo-1,4-beta-xylanase	NA	NA	NA	NA
WP_002289864.1\|1888327_1889194_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002338467.1\|1889216_1890869_-	phospho-sugar mutase	A0A1X9I671	Streptococcus_phage	2.4e-102	39.4
WP_002288192.1\|1890870_1891386_-	NUDIX hydrolase	NA	NA	NA	NA
WP_002288195.1\|1892364_1893678_-	cupin domain-containing protein	A0A1V0SH58	Hokovirus	1.3e-37	26.1
WP_002288197.1\|1893746_1894691_-	GDP-L-fucose synthase	A0A0E3HQW0	Synechococcus_phage	2.9e-92	54.2
WP_002288198.1\|1894712_1895768_-	GDP-mannose 4,6-dehydratase	M4QRT5	Synechococcus_phage	8.8e-122	62.8
WP_082206211.1\|1896083_1896275_-	WecB/TagA/CpsF family glycosyltransferase	NA	NA	NA	NA
WP_133141719.1\|1896392_1897178_-	nucleoside-diphosphate sugar epimerase	NA	NA	NA	NA
WP_025479580.1\|1898020_1898536_-	dTDP-4-dehydrorhamnose 3,5-epimerase family protein	H9NC63	Sphingomonas_phage	2.0e-18	32.9
WP_002338472.1\|1899100_1900630_-	oligosaccharide flippase family protein	NA	NA	NA	NA
WP_002288219.1\|1900716_1901931_-	O-antigen ligase family protein	NA	NA	NA	NA
WP_002288204.1\|1901934_1902846_-	alpha-1,2-fucosyltransferase	NA	NA	NA	NA
WP_002288205.1\|1902983_1903850_-	hypothetical protein	R4THE2	Phaeocystis_globosa_virus	7.7e-15	26.5
WP_002288206.1\|1903846_1905013_-	hypothetical protein	NA	NA	NA	NA
WP_002288207.1\|1905026_1907102_-	glycosyltransferase	NA	NA	NA	NA
WP_002288221.1\|1907375_1908188_-	acyltransferase	NA	NA	NA	NA
WP_002288208.1\|1908201_1909452_-	nucleotide sugar dehydrogenase	M1HHY3	Acanthocystis_turfacea_Chlorella_virus	2.3e-105	50.1
WP_193354329.1\|1909471_1910515_-	GDP-mannose 4,6-dehydratase	A0A2K9L0I7	Tupanvirus	2.1e-30	29.3
WP_002288211.1\|1910563_1911358_-	WecB/TagA/CpsF family glycosyltransferase	NA	NA	NA	NA
WP_002288215.1\|1913091_1914045_-\|transposase	IS30 family transposase	NA	NA	NA	NA

DBSCAN-SWA_7

2073417 : 2079090

uncultured_Caudovirales_phage(50.0%)

terminase,head,capsid,portal,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002296483.1\|2073417_2073753_-\|head	phage head closure protein	V5UQC7	Enterococcus_phage	4.7e-13	35.6
WP_002296484.1\|2073739_2074024_-\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
WP_002296485.1\|2074079_2075603_-\|capsid	phage major capsid protein	A0A1W6JPR8	Staphylococcus_phage	1.4e-48	37.4
WP_002296486.1\|2075595_2076771_-\|portal	phage portal protein	A0A2H4J5A4	uncultured_Caudovirales_phage	3.2e-64	35.6
WP_002317249.1\|2076774_2076960_-	hypothetical protein	NA	NA	NA	NA
WP_002296487.1\|2076925_2078620_-\|terminase	terminase large subunit	A0A2H4JBN3	uncultured_Caudovirales_phage	9.1e-129	43.8
WP_002296488.1\|2078616_2079090_-\|terminase	phage terminase small subunit P27 family	NA	NA	NA	NA

DBSCAN-SWA_8

2296939 : 2313194

uncultured_virus(28.57%)

protease,transposase,bacteriocin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002296840.1\|2296939_2298127_-\|transposase	IS256-like element IS16 family transposase	A0A0K2CZ57	Paenibacillus_phage	8.2e-92	46.3
WP_002288864.1\|2298539_2300165_-	chaperonin GroEL	A0A219YK78	uncultured_virus	2.2e-156	56.8
WP_002288862.1\|2300215_2300500_-	co-chaperone GroES	A0A221S4M3	uncultured_virus	2.0e-12	40.2
WP_002288860.1\|2300724_2301387_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_002288858.1\|2301462_2302755_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_002288856.1\|2302924_2303554_+	NAD(P)H-binding protein	NA	NA	NA	NA
WP_002288854.1\|2303656_2304466_-	MBL fold metallo-hydrolase	A0A0C5AJ83	Bacteriophage	3.1e-34	33.6
WP_002288853.1\|2304520_2305390_-	two-component system regulatory protein YycI	NA	NA	NA	NA
WP_002288852.1\|2305390_2306707_-	hypothetical protein	NA	NA	NA	NA
WP_002288851.1\|2306703_2308539_-	cell wall metabolism sensor histidine kinase WalK	W8CYF6	Bacillus_phage	4.0e-37	37.7
WP_002288850.1\|2308543_2309248_-	response regulator transcription factor	W8CYM9	Bacillus_phage	5.8e-45	41.6
WP_002288847.1\|2309437_2310298_-	DegV family protein	A0A1X9I5J4	Streptococcus_phage	2.7e-12	24.4
WP_002322652.1\|2310284_2310854_-	DUF1836 domain-containing protein	NA	NA	NA	NA
WP_000222572.1\|2311483_2312437_+\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_002321654.1\|2312433_2312580_-\|bacteriocin	EntF family bacteriocin induction factor	NA	NA	NA	NA
WP_002287810.1\|2312683_2312995_-\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_002304799.1\|2312996_2313194_-\|bacteriocin	leucocin A/sakacin P family class II bacteriocin	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NC_017962

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 60059

Streptococcus_phage(62.07%)

transposase,bacteriocin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002287920.1\|514_1195_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	7.6e-127	99.1
WP_002289340.1\|1496_2036_+	DUF536 domain-containing protein	NA	NA	NA	NA
WP_002292472.1\|2051_2222_+	hypothetical protein	NA	NA	NA	NA
WP_000389746.1\|2535_2997_-	helix-turn-helix transcriptional regulator	D2XQ11	Bacillus_virus	1.7e-05	36.1
WP_000713874.1\|3129_3504_+\|bacteriocin	lactococcin 972 family bacteriocin	NA	NA	NA	NA
WP_002289343.1\|3557_5684_+	hypothetical protein	NA	NA	NA	NA
WP_002289345.1\|5680_6301_+	ABC transporter ATP-binding protein	A0A2H4UUX5	Bodo_saltans_virus	8.2e-11	29.0
WP_002303562.1\|6414_6552_+	hypothetical protein	NA	NA	NA	NA
WP_002298770.1\|6993_7374_+	MobC family plasmid mobilization relaxosome protein	NA	NA	NA	NA
WP_002289347.1\|7355_8270_+	relaxase/mobilization nuclease domain-containing protein	A0A1B0RXG0	Streptococcus_phage	5.8e-05	47.3
WP_002289349.1\|8509_9199_+	hypothetical protein	NA	NA	NA	NA
WP_110300541.1\|9319_9406_-	type I toxin-antitoxin system Fst family toxin	NA	NA	NA	NA
WP_002298753.1\|10827_11115_-	PrgN	NA	NA	NA	NA
WP_002298755.1\|11250_12750_-	primase C-terminal domain-containing protein	NA	NA	NA	NA
WP_002389872.1\|13341_13767_-	hypothetical protein	NA	NA	NA	NA
WP_002297404.1\|14176_15427_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.0e-113	63.3
WP_002287942.1\|15567_16380_-	AAA family ATPase	F0PIG8	Enterococcus_phage	4.7e-30	32.6
WP_002287941.1\|16580_17759_-\|transposase	IS256-like element ISEfm2 family transposase	A0A220NQR7	Corynebacterium_phage	3.4e-29	24.9
WP_002287940.1\|18307_19687_+	Y-family DNA polymerase	M1Q231	Streptococcus_phage	2.8e-96	42.5
WP_002287938.1\|20270_20861_+	SOS response-associated peptidase	A0A1P8CX02	Bacillus_phage	2.1e-08	33.0
WP_002287937.1\|20891_22319_-\|transposase	IS1182-like element ISEfa12 family transposase	A0A1X9I5T2	Streptococcus_phage	4.4e-124	47.8
WP_014748756.1\|22421_22643_-	hypothetical protein	NA	NA	NA	NA
WP_014748757.1\|22675_22876_-	hypothetical protein	NA	NA	NA	NA
WP_002287936.1\|23032_23647_+	recombinase family protein	M9Q1K0	Clostridium_phage	5.3e-18	32.4
WP_002287934.1\|24071_25061_+\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	1.1e-57	43.1
WP_002287933.1\|25301_25715_-	type II toxin-antitoxin system death-on-curing family toxin	A0A0N9SKD8	Staphylococcus_phage	4.3e-16	40.6
WP_002287931.1\|25711_25948_-	addiction module antitoxin	NA	NA	NA	NA
WP_002287944.1\|26139_26766_-	hypothetical protein	NA	NA	NA	NA
WP_002287930.1\|27137_29150_-	beta-galactosidase	NA	NA	NA	NA
WP_002287929.1\|29779_30841_-	SIS domain-containing protein	NA	NA	NA	NA
WP_002287928.1\|31036_31771_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_002287927.1\|31784_32582_-	fructoselysine 6-kinase	NA	NA	NA	NA
WP_002287926.1\|32604_33315_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_002287925.1\|33439_34795_-	amino acid permease	NA	NA	NA	NA
WP_002287924.1\|34840_35287_-	YjbQ family protein	NA	NA	NA	NA
WP_002287922.1\|36259_37834_+	amidohydrolase family protein	NA	NA	NA	NA
WP_002287920.1\|38850_39531_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	7.6e-127	99.1
WP_072387101.1\|39611_40019_-	WYL domain-containing protein	A0A1B0RXM3	Streptococcus_phage	1.1e-59	98.3
WP_001079938.1\|39991_40564_-	HTH domain-containing protein	A0A1B0RXM1	Streptococcus_phage	5.5e-102	99.5
WP_001096887.1\|40839_41634_-	aminoglycoside O-phosphotransferase APH(3')-IIIa	E4ZFP6	Streptococcus_phage	2.3e-154	100.0
WP_000627290.1\|41726_42269_-	streptothricin N-acetyltransferase Sat4	A0A1B0RXL7	Streptococcus_phage	8.9e-94	100.0
WP_001255866.1\|42265_43174_-	aminoglycoside nucleotidyltransferase ANT(6)-Ia	E4ZFP8	Streptococcus_phage	2.8e-177	100.0
WP_000662263.1\|43206_43941_-	class I SAM-dependent methyltransferase	A0A1X9I6N4	Streptococcus_phage	1.5e-141	100.0
WP_000228166.1\|43921_44791_-	nucleotidyltransferase domain-containing protein	A0A1X9I6C9	Streptococcus_phage	4.3e-159	95.8
WP_000567888.1\|44893_45139_-	single-stranded DNA-binding protein	NA	NA	NA	NA
WP_001038792.1\|46432_47170_-	23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B)	E4ZFQ0	Streptococcus_phage	7.0e-134	99.2
WP_001814874.1\|47294_47378_-	23S rRNA methyltransferase attenuation leader peptide	NA	NA	NA	NA
WP_001015311.1\|48064_48745_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	1.5e-127	99.6
WP_002296840.1\|49311_50499_+\|transposase	IS256-like element IS16 family transposase	A0A0K2CZ57	Paenibacillus_phage	8.2e-92	46.3
WP_000143686.1\|50788_51436_+	type A-8 chloramphenicol O-acetyltransferase	A0A1X9I6V6	Streptococcus_phage	4.3e-71	57.2
WP_002340414.1\|51750_52149_+	plasmid mobilization relaxosome protein MobC	NA	NA	NA	NA
WP_002287920.1\|52570_53251_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	7.6e-127	99.1
WP_000997689.1\|53866_54907_-	replication initiator protein A	NA	NA	NA	NA
WP_000796719.1\|55255_55582_-	hypothetical protein	NA	NA	NA	NA
WP_002311905.1\|55568_56372_-	ParA family protein	H7BUL8	unidentified_phage	3.6e-27	35.7
WP_000026576.1\|56724_57015_-	hypothetical protein	NA	NA	NA	NA
WP_001021554.1\|57150_57330_-	hypothetical protein	NA	NA	NA	NA
WP_000568378.1\|57326_57677_-	hypothetical protein	NA	NA	NA	NA
WP_000969590.1\|57669_58995_-	Y-family DNA polymerase	M1Q231	Streptococcus_phage	6.3e-101	44.0
WP_001261742.1\|59444_60059_+	recombinase family protein	M9Q1K0	Clostridium_phage	3.8e-16	30.9

DBSCAN-SWA_2

63653 : 65740

Streptococcus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001015311.1\|63653_64334_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	1.5e-127	99.6
WP_001096887.1\|64945_65740_-	aminoglycoside O-phosphotransferase APH(3')-IIIa	E4ZFP6	Streptococcus_phage	2.3e-154	100.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NC_017961

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

3749 : 10178

Bacillus_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001015311.1\|3749_4430_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	1.5e-127	99.6
WP_000599739.1\|4627_5233_+	cell filamentation protein	NA	NA	NA	NA
WP_000170424.1\|5248_5821_+	recombinase family protein	A0A1J1J8Z4	Escherichia_phage	6.8e-36	46.0
WP_073120187.1\|6293_6866_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	5.0e-55	57.1
WP_002322130.1\|8165_8420_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	4.1e-09	50.0
WP_000199136.1\|8530_8785_-\|transposase	transposase	A0A1P8CWP5	Bacillus_phage	2.1e-13	47.6
WP_001196543.1\|8977_9253_-	hypothetical protein	NA	NA	NA	NA
WP_000429439.1\|9224_10178_-	ParA family protein	F0PIG8	Enterococcus_phage	7.7e-16	26.1

DBSCAN-SWA_2

18943 : 35886

Streptococcus_phage(92.31%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002328852.1\|18943_19624_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	7.6e-127	99.1
WP_000774078.1\|20674_21187_-	hypothetical protein	NA	NA	NA	NA
WP_000420682.1\|21717_22032_+	YdcP family protein	A0A1S5SF38	Streptococcus_phage	5.2e-54	100.0
WP_000985015.1\|22047_22434_+	YdcP family protein	A0A1S5SF96	Streptococcus_phage	3.0e-64	100.0
WP_000813488.1\|22462_23848_+	DNA translocase FtsK	A0A1S5SFB5	Streptococcus_phage	1.1e-265	100.0
WP_000879507.1\|23850_24003_+	hypothetical protein	NA	NA	NA	NA
WP_000398284.1\|24025_25231_+	replication initiation factor domain-containing protein	A0A1S5SEX3	Streptococcus_phage	2.8e-233	100.0
WP_002286940.1\|26014_27925_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	7.1e-37	29.8
WP_032509114.1\|28028_28253_+	hypothetical protein	A0A1S5SEY0	Streptococcus_phage	8.5e-27	97.1
WP_000342539.1\|28369_28867_+	antirestriction protein ArdA	A0A1S5SF25	Streptococcus_phage	1.7e-91	100.0
WP_000506270.1\|28841_29348_+	conjugal transfer protein	A0A1S5SEX7	Streptococcus_phage	8.6e-91	100.0
WP_000331160.1\|29331_31779_+	ATP-binding protein	A0A1S5SF64	Streptococcus_phage	0.0e+00	100.0
WP_014748747.1\|31781_33959_+	YtxH domain-containing protein	A0A1S5SF30	Streptococcus_phage	5.7e-309	85.8
WP_001574272.1\|33955_34957_+	lysozyme family protein	A0A1S5SEZ8	Streptococcus_phage	2.5e-190	99.7
WP_001224319.1\|34953_35886_+	conjugal transfer protein	A0A1S5SF22	Streptococcus_phage	1.1e-171	100.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NC_017963

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_017963_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_017963_1

33016-33144

Orphan

Consensus_repeat	Method
GGTATGATTTTCATACCCTCTTGA	CRISPRCasFinder

2 spacers

The CRISPR arrays of NC_017963_1

>merge|NC_017963|1|33016-33144|CRISPRCasFinder
GGTATGATTTTCATACCCTCTGATTTATCAACGTTTTGGCACGGTATGATTTTCATACCCTCTTGAGCCCCAAGGGATTCAGCGTCTGATTTTTCGTCGAGGGTGGGTATGATTTTCATACCCTCTGAT

>NC_017963|1|1|33016-33144|CRISPRCasFinder
GGTATGATTTTCATACCCTCTGAT	TTATCAACGTTTTGGCAC
GGTATGATTTTCATACCCTCTTGA	GCCCCAAGGGATTCAGCGTCTGATTTTTCGTCGAGGGTG
GGTATGATTTTCATACCCTCTGAT

Protein	Signature genes	Signature genes Name	Protein_function
NC_017963.1\|WP_002305223.1\|25424_26180_-\|hypothetical-protein	unknown	unknown	unknown
NC_017963.1\|WP_002390044.1\|42334_43759_-\|IS21-family-transposase	unknown	unknown	gnl\|CDD\|226950
NC_017963.1\|WP_002390108.1\|28991_29663_-\|class-A-sortase	unknown	unknown	gnl\|CDD\|320680
NC_017963.1\|WP_002302867.1\|25151_25412_-\|hypothetical-protein	unknown	unknown	unknown
NC_017963.1\|WP_002390049.1\|40211_40892_-\|IS6-family-transposase	unknown	unknown	gnl\|CDD\|225853
NC_017963.1\|WP_002299885.1\|30054_30294_-\|hypothetical-protein	unknown	unknown	unknown
NC_017963.1\|WP_002390106.1\|26962_28939_-\|isopeptide-forming-domain-containing-fimbrial-protein	unknown	unknown	gnl\|CDD\|374637
NC_017963.1\|WP_002290394.1\|37462_37780_+\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	unknown	unknown	gnl\|CDD\|368240
NC_017963.1\|WP_002390051.1\|39986_40199_+\|hypothetical-protein	unknown	unknown	unknown
NC_017963.1\|WP_002390052.1\|38338_39265_+\|hypothetical-protein	unknown	unknown	unknown
NC_017963.1\|WP_002305108.1\|39637_39910_+\|Txe/YoeB-family-addiction-module-toxin	unknown	unknown	gnl\|CDD\|131171
NC_017963.1\|WP_002290397.1\|37207_37462_+\|AbrB-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|274230
NC_017963.1\|WP_002297422.1\|39374_39638_+\|type-II-toxin-antitoxin-system-Phd/YefM-family-antitoxin	unknown	unknown	gnl\|CDD\|376852
NC_017963.1\|WP_014748767.1\|29748_29943_-\|hypothetical-protein	unknown	unknown	unknown
NC_017963.1\|WP_002390046.1\|41591_42335_-\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|181681
NC_017963.1\|WP_002390104.1\|23064_25155_-\|isopeptide-forming-domain-containing-fimbrial-protein	unknown	unknown	gnl\|CDD\|375475
NC_017963.1\|WP_002305221.1\|26195_26948_-\|class-C-sortase	unknown	unknown	gnl\|CDD\|320676
NC_017963.1\|WP_000997695.1\|35249_36428_-\|IS256-like-element-ISEf1-family-transposase	unknown	unknown	gnl\|CDD\|307151
NC_017963.1\|WP_002332266.1\|30407_30749_-\|DUF5406-domain-containing-protein	unknown	unknown	gnl\|CDD\|379975
NC_017963.1\|WP_002332265.1\|31367_31700_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NC_017963.1\|WP_002390108.1\|28991_29663_-\|class-A-sortase	gnl\|CDD\|320680	cd06165, Sortase_A, Sortase domain found in class A sortases. Class A sortases are membrane-bound cysteine transpeptidases distributed in Gram-positive bacteria (mainly present in Firmicutes). They perform a housekeeping role in the cell as members of this group are capable of anchoring a large number of functionally distinct surface proteins containing a cell wall sorting signal to an amino group located on the bacterial cell wall. They do so by catalyzing a transpeptidation reaction in which the surface protein substrate is cleaved at a conserved cell wall-sorting signal (Class A sortases recognize a canonical LPXTG motif, X can be any amino acid), and covalently linked to peptidoglycan for display on the bacterial surface. The prototypical sortase A protein from Staphylococcus aureus (named Sa-SrtA) cleaves the amide bond between threonine and glycine residues of the canonical LPXTG motif in a wide range of protein substrates with diverse functions that can promote bacterial adhesion, nutrient acquisition, host cell invasion, and immune evasion. Next, it catalyzes a transpeptidation reaction by which the proteins are covalently linked to the peptidoglycan precursor lipid II. SrtA is therefore affects the ability of a pathogen to establish successful infection. SrtA contains an N-terminal hydrophobic segment, a linker region and an extra-cellular C-terminal catalytic domain. The hydrophobic segment functions as both a signal peptide for secretion and a stop-transfer signal for membrane anchoring. The catalytic domain contains the catalytic TLXTC signature sequence where X is usually a valine, isoleucine or a threonine. The gene encoding SrtA is generally not located in the same gene cluster as its substrates while the gene encoding SrtB is usually clustered in the same locus as its substrate.	2.40988e-45
NC_017963.1\|WP_002305221.1\|26195_26948_-\|class-C-sortase	gnl\|CDD\|320676	cd05827, Sortase_C, Sortase domain found in class C sortases. Class C sortases are membrane-bound cysteine transpeptidases broadly distributed in Gram-positive bacteria (mainly present in Firmicutes and Actinobacteria). They function as pilin polymerases responsible for the assembly of pili, which are multi-subunit hair-like fibres that extend from the cell surface to promote microbial adhesion and biofilm formation. First, one or more class C sortases form the long thin shaft of the pilus through linking together pilin subunits via isopeptide bonds. The base of the pilus is then anchored to the cell wall by a housekeeping sortase or, in some cases, the class C sortase itself. Depending upon the organism both the number and type of sortase enzymes involved varies, and in some cases, accessory factors appear to be needed. In three-component spaA pilus from Corynebacterium diphtheriae, the prototypical class C sortase (named Cd-SrtA) catalyzes polymerization of the SpaA-type pilus, consisting of the shaft pilin SpaA, tip pilin SpaC and minor pilin SpaB. The pilus shaft is then attached to the cell wall by a housekeeping class E sortase, Cd-SrtF. In the absence of Cd-SrtF, Cd-SrtA attaches the pilus to the cell wall, albeit at a reduced rate. Cd-SrtA can recognize two distinct sorting signals (LPLTG in SpaA and SpaC, and LAFTG in SpaB) and it can employ lysine residues that originate from different proteins (either Lys190 within the pilin motif of SpaA or Lys139 in SpaB). However, Cd-SrtA cannot be able to polymerize the major pilin subunit SpaH, even though it contains LPLTG motif. In two-component pili of prototypical Bacillus cereus, the class C sortase (named Bc-SrtD) cleaves related sorting signals within a major pilin protein BcpA (LPVTG) and a minor tip pilin BcpB (IPNTG), and catalyzes a transpeptidation that joins the threonine residues in each signal to the side-chain of Lys162 in BcpA (located within a pilin motif). Unlike the SpaA pilus in C. diphtheriae, in B. cereus Bc-SrtD is unable to covalently attach the pilus to the cell wall without the help of the housekeeping sortase.	1.70826e-57
NC_017963.1\|WP_002390049.1\|40211_40892_-\|IS6-family-transposase	gnl\|CDD\|225853	COG3316, COG3316, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	1.54575e-90
NC_017963.1\|WP_002297422.1\|39374_39638_+\|type-II-toxin-antitoxin-system-Phd/YefM-family-antitoxin	gnl\|CDD\|376852	pfam02604, PhdYeFM_antitox, Antitoxin Phd_YefM, type II toxin-antitoxin system. Members of this family act as antitoxins in type II toxin-antitoxin systems. When bound to their toxin partners, they can bind DNA via the N-terminus and repress the expression of operons containing genes encoding the toxin and the antitoxin. This domain complexes with Txe toxins containing pfam06769, Fic/DOC toxins containing pfam02661 and YafO toxins containing pfam13957.	6.33891e-07
NC_017963.1\|WP_002290394.1\|37462_37780_+\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	gnl\|CDD\|368240	pfam05016, ParE_toxin, ParE toxin of type II toxin-antitoxin system, parDE. ParE is the toxin family of a type II toxin-antitoxin family. It is toxic towards DNA gyrase, but is neutralized by the antitoxin ParD. The family also encompasses RelE/ParE described in.	2.94793e-05
NC_017963.1\|WP_002390106.1\|26962_28939_-\|isopeptide-forming-domain-containing-fimbrial-protein	gnl\|CDD\|374637	pfam16569, GramPos_pilinBB, Gram-positive pilin backbone subunit 2, Cna-B-like domain. GramPos_pilinBB is one of the major backbone units of Gram-positive pili, such as those from S.pneumoniae. There are three major pilin subunits that form the polymeric backbone of the pilin from S. pneumoniae, constructed of three transthyretin-like, CnaB, domains along with a crucial N-terminal domain, D1. The three Cna-B like domains are stabilized by internal Lys-Asn isopeptdie bonds, Gram-positive pili are formed from a single chain of covalently linked subunit proteins (pilins), usually comprising an adhesin at the distal tip, a major pilin that forms the polymer shaft and a minor pilin that mediates cell wall anchoring at the base.	1.38517e-30
NC_017963.1\|WP_002305108.1\|39637_39910_+\|Txe/YoeB-family-addiction-module-toxin	gnl\|CDD\|131171	TIGR02116, Hypothetical_protein_Rv3358/MT3466/Mb3393., toxin-antitoxin system, toxin component, Txe/YoeB family. The Axe-Txe pair in Enterococcus faecium and the homologous YefM-YoeB pair in Escherichia coli have been shown to act as an antitoxin-toxin pair. This model describes the toxin component. Nearly every example found is next to an identifiable antitoxin, as indicated by match to models TIGR01552 and/or pfam02604. [Cellular processes, Toxin production and resistance, Mobile and extrachromosomal element functions, Other].	8.93834e-22
NC_017963.1\|WP_002290397.1\|37207_37462_+\|AbrB-family-transcriptional-regulator	gnl\|CDD\|274230	TIGR02609, hypothetical_protein_XAC1195, putative addiction module antidote. Members of this protein family are putative addiction module antidote proteins that appear recurringly in two-gene operons with members of the Doc (death-on-curing) family TIGR01550. Members of this family contain a SpoVT/AbrB-like domain (pfam04014). Note that the gene pairs with a member of this family tend to be found on bacterial chromosomes, not on plasmids. [Mobile and extrachromosomal element functions, Other].	1.45571e-07
NC_017963.1\|WP_002332266.1\|30407_30749_-\|DUF5406-domain-containing-protein	gnl\|CDD\|379975	pfam17400, DUF5406, Family of unknown function (DUF5406). This is a family of unknown function found in Bacteria.	9.92925e-51
NC_017963.1\|WP_002390046.1\|41591_42335_-\|ATP-binding-protein	gnl\|CDD\|181681	PRK09183, PRK09183, transposase/IS protein; Provisional.	2.01052e-65
NC_017963.1\|WP_002390104.1\|23064_25155_-\|isopeptide-forming-domain-containing-fimbrial-protein	gnl\|CDD\|375475	pfam17998, AgI_II_C2, Cell surface antigen I/II C2 terminal domain. This is the second domain (C2) located in the C-terminal region found in antigen I/II type adhesin protein AspA from S. pyogenes. Together with C3, these two domains form an elongated structure, each domain adopts the DEv-IgG fold. Similar to the classical IgG folds, it is comprised of two major antiparallel beta-sheets, designated ABED and CFG. For the C2-domain, there are two additional strands on the CFG sheet. Furthermore, sheets ABED and CFG are interconnected by several cross-connecting loops and one alpha-helix (DH1). The side chains of D982 and N996 in the C2-domain are involved in hydrogen bonding with the side chains of R1264 and N1295 in the C3 domain. Main chain hydrogen bonding can also be observed between S992 in C2 and N1189/G1191 in C3, furthermore stabilizing the interaction between the domains. The C2 domain contains one bound metal ion, modeled as Ca2+, and both the C2- and C3-domains are stabilized by conserved isopeptide bonds, which connect the beta-sheets of the central DEv-IgG motifs.Other members of this family include Major cell-surface adhesin PAc from Streptococcus mutans and SspB from Streptococcus gordonii.	1.07051e-15
NC_017963.1\|WP_000997695.1\|35249_36428_-\|IS256-like-element-ISEf1-family-transposase	gnl\|CDD\|307151	pfam00872, Transposase_mut, Transposase, Mutator family.	1.3476e-109
NC_017963.1\|WP_002390044.1\|42334_43759_-\|IS21-family-transposase	gnl\|CDD\|226950	COG4584, COG4584, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	3.21294e-24

>NC_017963.1|WP_002332265.1|31367_31700_-|hypothetical-protein
MSYTGILSLEDICHYGKRCTATEKITKKLSTGQSKTVVQCKKYIIQKDKVSEEMIYYAGKQKQIILKDPIPLKELYPTIKHVYDQNGVLIGRRKNGVLRCTAKGMGRLIS
>NC_017963.1|WP_002332266.1|30407_30749_-|DUF5406-domain-containing-protein
MKNYDPNIRLGTHTIKVSFQRWDYKGFVTFRRGGNCKGLDVLALDEDDLYYQKLTDNPIGFGLLPEDDEGNEWFKMTLTNDNGDELSVEDTWSYLSDYIVSVEIIEFVADKEE
>NC_017963.1|WP_002299885.1|30054_30294_-|hypothetical-protein
MARPVLEAMDMDTLTKGRYVQLLARGYSPKDVFKSLSKGTDMEKERLRKEFDYWRTHNGIKDLKPARPVIKRKKKITQD
>NC_017963.1|WP_014748767.1|29748_29943_-|hypothetical-protein
MEEKLLKTMKQKHLKRLSVMQYINDMQITGKEKACLLGSMKNFEQLRRTYVKTSSNCQLLLEVS
>NC_017963.1|WP_002390108.1|28991_29663_-|class-A-sortase
MRKWLFGFLGVALIVVCSVFGYVSYQKHEGEVFKQNIEKKMPVDQINAHAKSYKEDATNVNNDMSLGQMLSIQQEAIEMGVNKQVFAQIQIPALGLALPIFKGANQYTLSLGAATYFYEDAEMGKGNYVLAGHNMEMPGVLFSDIQKLSLGEVMDLVSNDGVYRYKVTRKFIVPEYFKLIDGVPEENSFLSLPKKGEKPLLTLFTCVYTSQGKERYVVQGELQ
>NC_017963.1|WP_002390106.1|26962_28939_-|isopeptide-forming-domain-containing-fimbrial-protein
MAINRYVKKAGMLIGMLGIIAGCFQGYRAYAEDVTQKTPPEKVNITVHKLMYDQGTQLNVDIDGIKNDGYTHDQYPTGVTKYNKADYGDVEFTLGNITDQVLPTEDSDLTNAKVDEIVKDVEDKGSNSEYVKNATNKITSAVDENGEITFADQPAYVNSKGNVYVVYESKSAAGLVTQKAKPMVVIAPMTDNTGSGFLKDIHLYPKNIVSKLSFELTKFGDDGTAQSKQTPLKGAKFELYKGEPGKGTKLGDLVSDDQGKLTATDLTLGKYYFVEVPSEVVVGSDKEPTADQYLLGADARNDAHNKLTFEITNDGVTSDLKASYVNYKAPVIDKTVTNGTGQEHSFQIGDAVNYQGTIHIPTDIAGGADGITVNGVKSETSPYSVFKWGDTAEQGLSYVAAKANIKVTNKDGSVVLKENTDYKIQNSENGFVIDFIVNNGQVSDTVASLHGQDLQMTYNMYVNDSAAVANPLTNSVDFVYNNNPFNQEEHHEKTKADVVTYGAKFLKVDSGLFGTGIKATPLEGAEFAAKNAEGKYYGGLVDTDKDGVKEAVWVDDVANAAILKSDKEGHFEITGLTEGEYSLEETKAPENYQKLTKEISFKVDKDSYKEENRITIKNNQKASVPMTGSNGFQTYVLISCLLLGAGALSAVVYFKKKA
>NC_017963.1|WP_002305221.1|26195_26948_-|class-C-sortase
MIIRKPKKKRIMGKWIIAFWLLSAVGVLLLMPAEASVAKYQQNQQIAAIDRTGTAAETDSSLDVAKIELGDPVGILTILSISLKLPIYDGTSDKILENGVGITEGTGDITGGNGKNPLIAGHSGLYKDNLFDDLPSVKKGEKFYIKVDGEQHAYQIDRIEEVQKDELQRNFVTYLESNPNEDRVTLMTCTPKGINTHRFLVYGKRVTFTKSELKDEENKKQKLSWKWLLGSTVFLSVMIIGSLFVYKKKK
>NC_017963.1|WP_002305223.1|25424_26180_-|hypothetical-protein
MRNRKWLFVCAAALFSFTAYTQLTFADRQESTDSTEQTIQTSDSSTIQSSDETVDSSTVDSSEEPKIAEDDQIVKQTIHVQKIISSEQLDNQGHEKQEGVNGAKFSVYDVSDILQKMDVKDLTTDQIESQLKNRVKKLSSDQLKLVSNGETKTIDQQTGVFEFSVEVQANQKQAYYIVNESSPENISNSEDILLLTPVSDKNGEFLKDVWIYPKSEASQPKEEVKKIVSTGVKKNFFENCWDFVTHLFSRD
>NC_017963.1|WP_002302867.1|25151_25412_-|hypothetical-protein
MKLIKLLLFNFSCLTAVFLYCGLLFSKLSILPSYQLYLMRILNIPAASMPLDIMEKLIRNPLFTTINLIVIVGISLVIYKKEGMKG
>NC_017963.1|WP_002390104.1|23064_25155_-|isopeptide-forming-domain-containing-fimbrial-protein
MNFKHSWTRRLKYVFPIMMMLGTLFGLKTANVFAEKVIVDPSNPIQNVKNNFIIPKDVPNAKTNITVNGASKVYKYHVDANKGGFTDDYVGLVEGNKKIRYPSFQKEYGETNLVLEGVTTNTKVNIDYGKIGTYNGKKVNIKLVLSNIHLYSDTLPWNLLDNNYTKTHFRDDGYKNTNGAMSKSKKRTVLWISDNLFSGIIYHSTQMNVQLVATYEDGSPVQFSGDTFISFNSLNPAGGKSTDLKGEYAHYDKMNTTDWYVRKDTVLSEFKSFYNNLNVVGGHPGGSSKLTQADNDFNNLHDKLGDPKFGQGTVSFKISEANPTFVIGSSNVQTWFTLSSATIFSVVPDQPEKTGVDKNGNNVNDKMLQVGDTIQYRIKQKVNRLGVDLLAVYDRFELIDNLPKEVNYVDAHVESGTNKKFDVSGEVTYDKTKHQVKYAAKADTLKNRMKYNGETYELVINVKVNELANQNSVAKNQGTSIINKVEKDTNIITVYFPKIPVKEVQQNGKDVNGRNDGKKGTPTAPLNAGSEVQYLVTQKWHTKGVDAASDHYKQFSIQDPIEARLTYKEGSAQVIDKSKGKDITSEGTLTYDSNSRTLKWEASADFLSNNLLDGREIQLIFTAKTPLQSEKNIDNQAVVAVDNVSNKTNVVTIGVDPNLPQVIVPKTGSTHLVTISAVSLLLLVLATFSYAVLRYI
>NC_017963.1|WP_000997695.1|35249_36428_-|IS256-like-element-ISEf1-family-transposase
MNDFTTEIVQTLVTKGDLNELFRSHLEKAINTLLRTELTAFLDYEKYDRTGFNSGNSRNGSYFRSIKTEYGELTLEIPRDRNGEFKQQTLPAYKRTNDTLETTIIHLFEKGVTMSEIADLIEKMYGHHYTPQTMSNMTKVLTEEVNAFKSRALNDKYVAIFMDATYIPLKRQTVSKEAIYIAIGIREDGTKEVLSYAIAPTESTYVWNELLQDINSRGVQEVLLFITDGLKGMKDTIHQIYPKAKYQHCCIHVSRNIAHKVRVKDRKEICDDFKAVYQANSKEEANTFLSGMIEKWKKNYPKVTQSLIENQDLLTFYDFPPSIRRTIYSTNLIESFNKQIKRYSRRKEQFQNEESLERFLVSIFDTYNQKFLNRSHKGFQQVTDTLVSMFTE
>NC_017963.1|WP_002290397.1|37207_37462_+|AbrB-family-transcriptional-regulator
MGKELKVRKIGNSVGVILPSSLGLKSGDTIQAKQEGNLFILDTTQIAKEHDRKLIEESFQDFEKGLTVSEIEMVKAFGKYGWSE
>NC_017963.1|WP_002290394.1|37462_37780_+|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin
MKEYTLVYSKSFQTSLETIIEEWENELALSPASIKRFVGAIQKALELTKNFPTMHEEVSEIYGMDIPTYRIVIGKSYALFYRIDHEKKEILVGRIFQSKQMKLGF
>NC_017963.1|WP_002390052.1|38338_39265_+|hypothetical-protein
MNILNEKRYVWFAGKKYITTFKRLSELMQQTVKSAMPEGYKFNFVQSSVSTESIYFSILSESRLFHFRISSHVKKTDVDIYTFRTNNYKNLNDLSRSISEYLKGNSYLKIRFSHILILLPYLNENFTLIQVDKSFIASGNQGNMNIKSNKTSRVLLALMGYGILYRDDQNGQILITRAGRSLLMKYRKFIPEDFQNLQLENMCLEDLFRLAEDDKYRFEVLKIQKNELLNKLYPENAIKAHFGDANHMYSWFIPKRFRGKINAGDQVKVLNRNSTDVVMITDIYVEDEDIIKYMKPVIKLVNKNKGNG
>NC_017963.1|WP_002297422.1|39374_39638_+|type-II-toxin-antitoxin-system-Phd/YefM-family-antitoxin
MAKTVLNPSSARKNFYKLLKDVNENHTEIEIISERSENNAVLIGLDDWKAIKETLLLEQIGTLGVVRKREKDDSGFTNVDEIDWDNL
>NC_017963.1|WP_002305108.1|39637_39910_+|Txe/YoeB-family-addiction-module-toxin
MNNYSVMIKNSAKADLKKIKQSNLKPQFEKVIQTLKEDPYLPTQSFEKLKPTYEGRYSRRLNRQHRVVYKVDEDEHVVEIYSARTHYESQ
>NC_017963.1|WP_002390051.1|39986_40199_+|hypothetical-protein
MITKTRKQGNSIMLTVPKDFNVPNGVEVEAKLVENGILYEFVEPQKEFYDFSEDILSGSVAKFENQTRPL
>NC_017963.1|WP_002390049.1|40211_40892_-|IS6-family-transposase
MNHFKGKQFKKDVIIVAVGYYLRYNLSYREVQELLYDRGINVCHTTIYRWVQEYSKVLYYLWKKKNRQSFYSWKMDETYIKIKGRWHYLYRAIDADGLTLDIWLRKKRDTQAAYDFLKRLHKQFGEPKAIVTDKAPSLGSAFRKLQSVGLYTKTEHRTVKYLNNLIEQDHRPIKRRNKFYQSLRTASSTIKGMETIRGIYKKNRRNGTLFGFSVSTEIKVLMGITA
>NC_017963.1|WP_002390046.1|41591_42335_-|ATP-binding-protein
MDQAKSLETACKLLRLSHVLPTLVRKDLDYSFETKEDWLMYLLEKELACREELKTARLLKQAKFPNKRTLEDYEWHDHICLPNATTKDELLSLSFIHQKENAVFVGTPGTGKTHLACGLGQLAAKSGIDTRFWRVSDLVNELEHHWKNNTLEVFKHRFDKVKLIILDEMGYVPFTKEGAELLFQLISDWYETKSVIVTSNLEFSKWNKVFVDARLTAALVDRLIHHAHILSFTGESFRLKNALSKSN
>NC_017963.1|WP_002390044.1|42334_43759_-|IS21-family-transposase
MLTMTDINTIRNLRNNHDKSINHIAKELDVNWRTAKKYADDDLLPQPKARKKTGMMYTKKWGGIVSLWLSEDAKLPNKKRRTAEAMTTALKADGFPGSYRTVCVFIQDWKATHYLETLEDQGFERLEHPPAEAQLDFGTMEVCHDGAFKDVKVLVMTFPFSNAGFAVVLPAENQECLLEGMKELFSQSGGVPRKIRIDNMSTAVTQTKTKTEQAVLTDGFLRFSMHYGFETQVCNPRSGNEKGSMENKVGYVRYNFFSSTPIMKDFASFNEALAVELSHDRERIHYEKHVIINDLWNTEKTDLLALPDTDYPVFKEIEVKANKYNEIKLDNERIHVPRVRNYSIIYGLLRFDSYQLISTDGEIISEGLRPYMMKKRAIDWQAILPDWRRKPRAMHYSRYWKYLPERIKLFLSHPDWKEQEKRLNQISGLLVTHDMLGIDTHFYDMFSASTTTDAYDIDWHQYDAFLSLTGEVID

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_CP011282	Enterococcus faecium strain E39 plasmid p1, complete sequence	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_CP025426	Enterococcus faecium strain SC4 plasmid p1, complete sequence	221216-221254	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	LT603679	Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 2	452-490	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_CP018832	Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence	244126-244164	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_CP040369	Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_CP043485	Enterococcus faecium strain DMEA02 plasmid pDMEA1, complete sequence	27883-27921	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_CP020485	Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence	96547-96585	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_CP041262	Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence	454-492	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_CP012385	Enterococcus durans strain KLDS 6.0930 plasmid unnamed 1, complete sequence	95092-95130	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_CP013995	Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence	358205-358243	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_CP014450	Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence	119937-119975	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_CP018073	Enterococcus faecium strain VRE001 plasmid unnamed3, complete sequence	111370-111408	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_CP027518	Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_CP027498	Enterococcus faecium strain AUSMDU00004167 plasmid unnamed1, complete sequence	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_CP027507	Enterococcus faecium strain AUSMDU00004055 plasmid unnamed1, complete sequence	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_CP027502	Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_LR135298	Enterococcus faecium isolate E7429 plasmid 2	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_LR135288	Enterococcus faecium isolate E7199 plasmid 2	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_LR135333	Enterococcus faecium isolate E7471 plasmid 3	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_LR135340	Enterococcus faecium isolate E7356 plasmid 2	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_CP046076	Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	MT074686	Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_CP025756	Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence	126934-126972	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_CP027513	Enterococcus faecium strain AUSMDU00004028 plasmid unnamed1, complete sequence	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_LR135244	Enterococcus faecium isolate E6988 plasmid 2	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_LR135279	Enterococcus faecium isolate E6975 plasmid 2	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_LR135783	Enterococcus faecium isolate E4239 plasmid 2	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_LR135294	Enterococcus faecium isolate E7237 plasmid 2	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_LR135255	Enterococcus faecium isolate E7098 plasmid 2	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_LR135236	Enterococcus faecium isolate E7067 plasmid 2	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_LR135198	Enterococcus faecium isolate E6055 plasmid 2	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_LR135259	Enterococcus faecium isolate E4457 plasmid 2	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_LR135182	Enterococcus faecium isolate E1774 plasmid 2	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_CP040905	Enterococcus faecium strain N56454 plasmid unnamed, complete sequence	153621-153659	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_CP041256	Enterococcus faecium strain 515 plasmid p26, complete sequence	129212-129250	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_CP019209	Enterococcus faecium strain 2014-VREF-41 plasmid p41-1, complete sequence	71269-71307	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_CP019989	Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence	249118-249156	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_CP017798	Enterococcus faecium strain E243 plasmid unnamed1, complete sequence	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_LR135429	Enterococcus faecium isolate E8927 plasmid 2	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_LR135436	Enterococcus faecium isolate E8691 plasmid 2	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_LR135483	Enterococcus faecium isolate E4456 plasmid 2	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_LR135476	Enterococcus faecium isolate E8423 plasmid 2	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_LR135204	Enterococcus faecium isolate E7171 plasmid 2	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_LR135180	Enterococcus faecium isolate E0595 plasmid 2	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_LR135227	Enterococcus faecium isolate E7025 plasmid 2	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_LR135489	Enterococcus faecium isolate E8414 plasmid 2	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_LR135365	Enterococcus faecium isolate E8195 plasmid 2	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_LR135220	Enterococcus faecium isolate E7040 plasmid 2	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_LR135415	Enterococcus faecium isolate E8328 plasmid 2	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_LR135395	Enterococcus faecium isolate E8290 plasmid 2	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NC_021987	Enterococcus faecium Aus0085 plasmid p1, complete sequence	107198-107236	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_LR135345	Enterococcus faecium isolate E8202 plasmid 2	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_LR135325	Enterococcus faecium isolate E7654 plasmid 2	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_LR135358	Enterococcus faecium isolate E7948 plasmid 2	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_LR135409	Enterococcus faecium isolate E8284 plasmid 2	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_LR135352	Enterococcus faecium isolate E8014 plasmid 2	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_CP050649	Enterococcus faecium strain BIOPOP-3 ALE plasmid pBIOPOP-3_ALE	91402-91440	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_CP050651	Enterococcus faecium strain BIOPOP-3 WT plasmid pBIOPOP-3_WT	102426-102464	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_LR135385	Enterococcus faecium isolate E7933 plasmid 2	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_CP044265	Enterococcus faecium strain V1836 plasmid pHVH-V1836-1, complete sequence	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_LR135318	Enterococcus faecium isolate E7663 plasmid 2	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_LR134106	Enterococcus faecium isolate E6043 plasmid 2	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_LR135373	Enterococcus faecium isolate E8172 plasmid 2	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_CP006031	Enterococcus faecium T110 plasmid pEFT110, complete sequence	1397-1435	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_CP011829	Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence	60362-60400	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_LR132068	Enterococcus faecium isolate E0139 plasmid 2	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_AP019395	Enterococcus faecium strain QU 50 plasmid pQL50, complete sequence	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_LN999988	Enterococcus faecium isolate EFE11651 plasmid II, complete sequence	97677-97715	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_CP033042	Enterococcus faecium strain Enterococcus faecium JE1 plasmid unnamed, complete sequence	52637-52675	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_CP025687	Enterococcus faecium strain CBA7134 plasmid pCBA710401, complete sequence	102651-102689	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_CP040741	Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_CP014530	Enterococcus faecium strain E745 plasmid pl1, complete sequence	200630-200668	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_CP023424	Enterococcus faecium strain K60-39 plasmid pTT39_p1, complete sequence	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_AP022342	Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_CP040877	Enterococcus faecium strain HB-1 plasmid punnamed, complete sequence	56543-56581	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_CP032307	Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence	65333-65371	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_CP040704	Enterococcus faecium strain HOU503 plasmid p1, complete sequence	67328-67366	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_CP044275	Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_CP017793	Enterococcus faecium strain E240 plasmid unnamed1, complete sequence	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_CP019993	Enterococcus faecium isolate 2014-VREF-268 plasmid p268-1, complete sequence	14572-14610	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_CP035655	Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_CP023790	Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_CP023800	Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_CP035137	Enterococcus faecium strain SRCM103341 plasmid unnamed1, complete sequence	178898-178936	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_CP035661	Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_CP035667	Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NC_017963	Enterococcus faecium DO plasmid 3, complete sequence	33082-33120	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_CP035649	Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_CP040850	Enterococcus faecium strain F17E0263 plasmid p_unnamned1, complete sequence	105709-105747	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_CP042840	Enterococcus sp. DA9 plasmid unnamed4	39887-39925	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_LR135171	Enterococcus faecium isolate E4227 plasmid 2	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_LR135192	Enterococcus faecium isolate E4438 plasmid 2	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_CP041271	Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S1, complete sequence	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_CP037956	Enterococcus hirae strain CQP3-9 plasmid pCQP3-9_1, complete sequence	35165-35203	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_LR135308	Enterococcus faecium isolate E7240 plasmid 2	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_CP040237	Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_CP018066	Enterococcus faecium strain E1 plasmid pE1_230, complete sequence	225612-225650	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_CP023809	Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_CP033207	Enterococcus faecium strain RBWH1 plasmid pRBWH1.1, complete sequence	92046-92084	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_CP018129	Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence	17089-17127	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_CP023805	Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_CP035221	Enterococcus faecium strain SRCM103470 plasmid unnamed1	86167-86205	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_AP019409	Enterococcus faecium strain SMVRE20 plasmid pSMVRE20L, complete sequence	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NC_020208	Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence	61653-61691	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_CP034948	Enterococcus faecium strain NM213 plasmid unnamed5, complete sequence	5084-5122	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_CP016164	Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p1, complete sequence	177278-177316	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_CP018827	Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence	244126-244164	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	LR135186	Enterococcus faecium isolate E4413 genome assembly, plasmid: 2	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_CP012461	Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p1, complete sequence	192113-192151	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_CP023795	Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_MG674581	Enterococcus faecium strain HL1 plasmid pHLSA, complete sequence	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_CP023781	Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence	453-491	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_LT598664	Enterococcus faecium isolate Ef_aus00233 plasmid 2	168263-168301	0	1.0
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_CP027401	Enterococcus faecium strain FDAARGOS_323 plasmid unnamed, complete sequence	109448-109486	1	0.974
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_LR135175	Enterococcus faecium isolate E4402 plasmid 2	453-491	1	0.974
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_LR134096	Enterococcus faecium isolate E1334 plasmid 2	453-491	1	0.974
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_CP042833	Enterococcus faecium strain FA3 plasmid unnamed1	47629-47667	1	0.974
NC_017963_1	1.2\|33082\|39\|NC_017963\|CRISPRCasFinder	33082-33120	39	NZ_CP012367	Enterococcus durans strain KLDS 6.0933 plasmid unnamed 1, complete sequence	3358-3396	4	0.897

1. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_CP011282 (Enterococcus faecium strain E39 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

2. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_CP025426 (Enterococcus faecium strain SC4 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

3. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to LT603679 (Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

4. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_CP018832 (Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

5. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_CP040369 (Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

6. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_CP043485 (Enterococcus faecium strain DMEA02 plasmid pDMEA1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

7. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_CP020485 (Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

8. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_CP041262 (Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

9. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_CP012385 (Enterococcus durans strain KLDS 6.0930 plasmid unnamed 1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

10. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_CP013995 (Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

11. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_CP014450 (Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

12. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_CP018073 (Enterococcus faecium strain VRE001 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

13. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_CP027518 (Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

14. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_CP027498 (Enterococcus faecium strain AUSMDU00004167 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

15. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_CP027507 (Enterococcus faecium strain AUSMDU00004055 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

16. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_CP027502 (Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

17. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_LR135298 (Enterococcus faecium isolate E7429 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

18. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_LR135288 (Enterococcus faecium isolate E7199 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

19. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_LR135333 (Enterococcus faecium isolate E7471 plasmid 3) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

20. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_LR135340 (Enterococcus faecium isolate E7356 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

21. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_CP046076 (Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

22. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to MT074686 (Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

23. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_CP025756 (Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

24. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_CP027513 (Enterococcus faecium strain AUSMDU00004028 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

25. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_LR135244 (Enterococcus faecium isolate E6988 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

26. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_LR135279 (Enterococcus faecium isolate E6975 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

27. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_LR135783 (Enterococcus faecium isolate E4239 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

28. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_LR135294 (Enterococcus faecium isolate E7237 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

29. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_LR135255 (Enterococcus faecium isolate E7098 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

30. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_LR135236 (Enterococcus faecium isolate E7067 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

31. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_LR135198 (Enterococcus faecium isolate E6055 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

32. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_LR135259 (Enterococcus faecium isolate E4457 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

33. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_LR135182 (Enterococcus faecium isolate E1774 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

34. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_CP040905 (Enterococcus faecium strain N56454 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

35. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_CP041256 (Enterococcus faecium strain 515 plasmid p26, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

36. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_CP019209 (Enterococcus faecium strain 2014-VREF-41 plasmid p41-1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

37. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_CP019989 (Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

38. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_CP017798 (Enterococcus faecium strain E243 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

39. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_LR135429 (Enterococcus faecium isolate E8927 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

40. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_LR135436 (Enterococcus faecium isolate E8691 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

41. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_LR135483 (Enterococcus faecium isolate E4456 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

42. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_LR135476 (Enterococcus faecium isolate E8423 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

43. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_LR135204 (Enterococcus faecium isolate E7171 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

44. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_LR135180 (Enterococcus faecium isolate E0595 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

45. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_LR135227 (Enterococcus faecium isolate E7025 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

46. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_LR135489 (Enterococcus faecium isolate E8414 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

47. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_LR135365 (Enterococcus faecium isolate E8195 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

48. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_LR135220 (Enterococcus faecium isolate E7040 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

49. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_LR135415 (Enterococcus faecium isolate E8328 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

50. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_LR135395 (Enterococcus faecium isolate E8290 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

51. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NC_021987 (Enterococcus faecium Aus0085 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

52. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_LR135345 (Enterococcus faecium isolate E8202 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

53. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_LR135325 (Enterococcus faecium isolate E7654 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

54. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_LR135358 (Enterococcus faecium isolate E7948 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

55. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_LR135409 (Enterococcus faecium isolate E8284 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

56. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_LR135352 (Enterococcus faecium isolate E8014 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

57. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_CP050649 (Enterococcus faecium strain BIOPOP-3 ALE plasmid pBIOPOP-3_ALE) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

58. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_CP050651 (Enterococcus faecium strain BIOPOP-3 WT plasmid pBIOPOP-3_WT) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

59. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_LR135385 (Enterococcus faecium isolate E7933 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

60. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_CP044265 (Enterococcus faecium strain V1836 plasmid pHVH-V1836-1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

61. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_LR135318 (Enterococcus faecium isolate E7663 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

62. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_LR134106 (Enterococcus faecium isolate E6043 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

63. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_LR135373 (Enterococcus faecium isolate E8172 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

64. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_CP006031 (Enterococcus faecium T110 plasmid pEFT110, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

65. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_CP011829 (Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

66. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_LR132068 (Enterococcus faecium isolate E0139 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

67. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_AP019395 (Enterococcus faecium strain QU 50 plasmid pQL50, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

68. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_LN999988 (Enterococcus faecium isolate EFE11651 plasmid II, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

69. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_CP033042 (Enterococcus faecium strain Enterococcus faecium JE1 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

70. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_CP025687 (Enterococcus faecium strain CBA7134 plasmid pCBA710401, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

71. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_CP040741 (Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

72. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_CP014530 (Enterococcus faecium strain E745 plasmid pl1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

73. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_CP023424 (Enterococcus faecium strain K60-39 plasmid pTT39_p1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

74. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_AP022342 (Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

75. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_CP040877 (Enterococcus faecium strain HB-1 plasmid punnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

76. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_CP032307 (Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

77. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_CP040704 (Enterococcus faecium strain HOU503 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

78. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_CP044275 (Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

79. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_CP017793 (Enterococcus faecium strain E240 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

80. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_CP019993 (Enterococcus faecium isolate 2014-VREF-268 plasmid p268-1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

81. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_CP035655 (Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

82. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_CP023790 (Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

83. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_CP023800 (Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

84. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_CP035137 (Enterococcus faecium strain SRCM103341 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

85. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_CP035661 (Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

86. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_CP035667 (Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

87. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NC_017963 (Enterococcus faecium DO plasmid 3, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

88. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_CP035649 (Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

89. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_CP040850 (Enterococcus faecium strain F17E0263 plasmid p_unnamned1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

90. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_CP042840 (Enterococcus sp. DA9 plasmid unnamed4) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

91. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_LR135171 (Enterococcus faecium isolate E4227 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

92. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_LR135192 (Enterococcus faecium isolate E4438 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

93. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_CP041271 (Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

94. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_CP037956 (Enterococcus hirae strain CQP3-9 plasmid pCQP3-9_1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

95. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_LR135308 (Enterococcus faecium isolate E7240 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

96. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_CP040237 (Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

97. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_CP018066 (Enterococcus faecium strain E1 plasmid pE1_230, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

98. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_CP023809 (Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

99. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_CP033207 (Enterococcus faecium strain RBWH1 plasmid pRBWH1.1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

100. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_CP018129 (Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

101. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_CP023805 (Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

102. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_CP035221 (Enterococcus faecium strain SRCM103470 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

103. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_AP019409 (Enterococcus faecium strain SMVRE20 plasmid pSMVRE20L, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

104. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NC_020208 (Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

105. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_CP034948 (Enterococcus faecium strain NM213 plasmid unnamed5, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

106. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_CP016164 (Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

107. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_CP018827 (Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

108. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to LR135186 (Enterococcus faecium isolate E4413 genome assembly, plasmid: 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

109. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_CP012461 (Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

110. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_CP023795 (Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

111. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_MG674581 (Enterococcus faecium strain HL1 plasmid pHLSA, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

112. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_CP023781 (Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

113. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_LT598664 (Enterococcus faecium isolate Ef_aus00233 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

114. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_CP027401 (Enterococcus faecium strain FDAARGOS_323 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgcctgatttttcgtcgagggtg	Protospacer
******************.********************

115. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_LR135175 (Enterococcus faecium isolate E4402 plasmid 2) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgcctgatttttcgtcgagggtg	Protospacer
******************.********************

116. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_LR134096 (Enterococcus faecium isolate E1334 plasmid 2) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgcctgatttttcgtcgagggtg	Protospacer
******************.********************

117. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_CP042833 (Enterococcus faecium strain FA3 plasmid unnamed1) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgaggatg	Protospacer
************************************.**

118. spacer 1.2|33082|39|NC_017963|CRISPRCasFinder matches to NZ_CP012367 (Enterococcus durans strain KLDS 6.0933 plasmid unnamed 1, complete sequence) position: , mismatch: 4, identity: 0.897

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
agccccaaggattcagcgtctgatttttcgtcgagggtg	Protospacer
. *** *.*******************************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

35249 : 58385

Streptococcus_phage(37.5%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000997695.1\|35249_36428_-\|transposase	IS256-like element ISEf1 family transposase	A0A220NQR7	Corynebacterium_phage	3.0e-30	25.6
WP_002290397.1\|37207_37462_+	AbrB family transcriptional regulator	NA	NA	NA	NA
WP_002290394.1\|37462_37780_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_002390052.1\|38338_39265_+	hypothetical protein	NA	NA	NA	NA
WP_002297422.1\|39374_39638_+	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_002305108.1\|39637_39910_+	Txe/YoeB family addiction module toxin	NA	NA	NA	NA
WP_002390051.1\|39986_40199_+	hypothetical protein	NA	NA	NA	NA
WP_002390049.1\|40211_40892_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	9.4e-109	83.6
WP_002390046.1\|41591_42335_-	ATP-binding protein	A0A059NT77	Lactococcus_phage	3.4e-35	36.3
WP_002390044.1\|42334_43759_-\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_002311511.1\|44153_44996_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_002298377.1\|45320_45737_+	PTS fructose transporter subunit IIA	NA	NA	NA	NA
WP_002298375.1\|45733_46204_+	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_002298373.1\|46217_46991_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_002298371.1\|47004_47817_+	PTS system mannose/fructose/sorbose family transporter subunit IID	NA	NA	NA	NA
WP_002322451.1\|47870_48836_+	SIS domain-containing protein	NA	NA	NA	NA
WP_002330554.1\|48972_51696_+	sigma 54-interacting transcriptional regulator	NA	NA	NA	NA
WP_002311505.1\|51708_52341_+	HAD family phosphatase	A0A1D8KNV9	Synechococcus_phage	1.0e-08	28.4
WP_002296127.1\|53106_54654_-\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	1.7e-44	28.9
WP_002287659.1\|54755_55109_-	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	5.7e-17	38.7
WP_002285758.1\|55098_55293_-	hypothetical protein	NA	NA	NA	NA
WP_002322453.1\|55592_56420_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002390042.1\|56442_57126_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	9.4e-125	98.2
WP_002285820.1\|57179_58385_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	2.5e-35	30.7

DBSCAN-SWA_2

79098 : 134652

Streptococcus_phage(33.33%)

integrase,transposase

attL 98686:98712|attR 103143:103169

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002331383.1\|79098_79779_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	5.8e-127	99.1
WP_002289583.1\|80168_82013_+	PTS glucose transporter subunit IIA	NA	NA	NA	NA
WP_002289584.1\|82068_83535_+	glycoside hydrolase family 1 protein	NA	NA	NA	NA
WP_002289586.1\|83571_84414_+	PRD domain-containing protein	NA	NA	NA	NA
WP_002389992.1\|88500_89460_+\|transposase	IS30-like element IS6770 family transposase	W5R8L2	Staphylococcus_phage	5.1e-36	36.4
WP_002343830.1\|89456_90335_+	hypothetical protein	NA	NA	NA	NA
WP_164927926.1\|90947_92110_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	1.0e-78	50.9
WP_002287870.1\|93288_93807_+	ClbS/DfsB family four-helix bundle protein	NA	NA	NA	NA
WP_002287871.1\|94210_95380_-\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_002349114.1\|95617_96478_+	Rossmann-like and DUF2520 domain-containing protein	NA	NA	NA	NA
WP_002287874.1\|96489_97317_+	3-methyl-2-oxobutanoate hydroxymethyltransferase	NA	NA	NA	NA
WP_002287875.1\|97331_98180_+	pantoate--beta-alanine ligase	NA	NA	NA	NA
WP_002287876.1\|98189_98585_+	aspartate 1-decarboxylase	NA	NA	NA	NA
98686:98712	attL	NA	NA	NA	NA
WP_025481469.1\|99589_99886_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	A0A0C5AEB1	Paenibacillus_phage	5.1e-19	59.2
WP_002287879.1\|100088_102056_+	hypothetical protein	NA	NA	NA	NA
WP_014748775.1\|102058_102709_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	2.3e-24	34.4
WP_002285758.1\|103893_104088_+	hypothetical protein	NA	NA	NA	NA
103143:103169	attR	NA	NA	NA	NA
WP_014748777.1\|104077_104461_+	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	6.2e-17	38.7
WP_002296127.1\|104532_106080_+\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	1.7e-44	28.9
WP_014748778.1\|106207_107503_-\|transposase	ISL3-like element ISEfa5 family transposase	A0A1S5SBP9	Streptococcus_phage	1.5e-43	29.5
WP_014748779.1\|107697_108990_+\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	2.5e-33	41.5
WP_002301131.1\|109417_110152_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_002301130.1\|110167_111337_+	SIS domain-containing protein	NA	NA	NA	NA
WP_002301128.1\|111352_112348_+	tagatose-bisphosphate aldolase	NA	NA	NA	NA
WP_002298736.1\|112426_113353_+	PEP phosphonomutase	NA	NA	NA	NA
WP_002330944.1\|113371_114622_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_002389951.1\|114840_115794_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	5.6e-35	36.1
WP_014748780.1\|116004_117300_-\|transposase	ISL3-like element ISEfa5 family transposase	A0A1S5SBP9	Streptococcus_phage	6.9e-44	29.8
WP_002389920.1\|118934_120020_-	tyrosine recombinase XerS	NA	NA	NA	NA
WP_002295743.1\|120689_121598_+\|transposase	IS982-like element ISEfm1 family transposase	NA	NA	NA	NA
WP_002390200.1\|122940_124398_-	arylsulfatase	NA	NA	NA	NA
WP_002390201.1\|124716_125532_-	PTS system mannose/fructose/sorbose family transporter subunit IID	NA	NA	NA	NA
WP_002364110.1\|125518_126331_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_002390202.1\|126352_126670_-	hypothetical protein	NA	NA	NA	NA
WP_002390204.1\|126920_127328_-	PTS fructose transporter subunit IIA	NA	NA	NA	NA
WP_002364114.1\|127350_127830_-	PTS system mannose/fructose/N-acetylgalactosamine-transporter subunit IIB	NA	NA	NA	NA
WP_002364115.1\|127833_129612_-	beta-galactosidase	NA	NA	NA	NA
WP_025186461.1\|129731_130436_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_002390206.1\|130516_131629_+	SPASM domain-containing protein	NA	NA	NA	NA
WP_002390209.1\|131625_132402_+	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
WP_014748778.1\|133356_134652_+\|transposase	ISL3-like element ISEfa5 family transposase	A0A1S5SBP9	Streptococcus_phage	1.5e-43	29.5

DBSCAN-SWA_3

141361 : 211309

Streptococcus_phage(31.58%)

integrase,transposase

attL 184400:184459|attR 187350:187517

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014748795.1\|141361_142636_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	1.3e-55	36.4
WP_032494987.1\|142690_144256_+	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	2.4e-19	31.6
WP_002288609.1\|144614_145547_-	hypothetical protein	NA	NA	NA	NA
WP_002288608.1\|145586_147248_-	hyaluronate lyase	NA	NA	NA	NA
WP_002288607.1\|147244_150226_-	glycoside hydrolase family 42	L0N6M2	Herpes_simplex_virus	1.3e-122	28.8
WP_002288601.1\|150353_152267_-	beta-N-acetylhexosaminidase	NA	NA	NA	NA
WP_002288600.1\|152296_152908_-	DUF624 domain-containing protein	NA	NA	NA	NA
WP_010729380.1\|152958_154431_-	extracellular solute-binding protein	NA	NA	NA	NA
WP_002289655.1\|154454_155366_-	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_002289657.1\|155377_156316_-	sugar ABC transporter permease	NA	NA	NA	NA
WP_002289659.1\|156544_158119_+	histidine kinase	Q9EYF3	Enterobacteria_phage	9.4e-11	30.0
WP_014748796.1\|159206_160481_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	7.0e-57	36.6
WP_014748797.1\|162040_163336_+\|transposase	ISL3-like element ISEfa5 family transposase	A0A1S5SBP9	Streptococcus_phage	1.2e-43	29.5
WP_002299919.1\|163434_163764_-	type II toxin-antitoxin system PemK/MazF family toxin	NA	NA	NA	NA
WP_002299921.1\|163753_164026_-	type II toxin-antitoxin system RelB/DinJ family antitoxin	NA	NA	NA	NA
WP_002389938.1\|164476_165280_-	metallophosphoesterase	NA	NA	NA	NA
WP_002299925.1\|165257_166382_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.0e-22	32.2
WP_002299926.1\|166397_167213_-	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_014748799.1\|167202_168093_-	sugar ABC transporter permease	NA	NA	NA	NA
WP_002389936.1\|168159_169449_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002298085.1\|173589_174966_-	ABC transporter permease	NA	NA	NA	NA
WP_002298083.1\|174965_175622_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.3e-22	32.1
WP_002301194.1\|175631_176909_-	ABC transporter permease	NA	NA	NA	NA
WP_111944785.1\|177158_178320_+\|transposase	IS3-like element ISEfa8 family transposase	A0A2I7SC85	Paenibacillus_phage	1.8e-80	54.2
WP_002298088.1\|178944_179487_-	hypothetical protein	NA	NA	NA	NA
WP_002389951.1\|181882_182836_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	5.6e-35	36.1
WP_002288845.1\|182832_183432_-	hypothetical protein	NA	NA	NA	NA
WP_002295743.1\|183637_184546_+\|transposase	IS982-like element ISEfm1 family transposase	NA	NA	NA	NA
184400:184459	attL	NA	NA	NA	NA
WP_002301108.1\|184732_185287_-\|integrase	tyrosine-type recombinase/integrase	W8CYP1	Bacillus_phage	8.6e-36	46.1
WP_165442593.1\|185791_187258_-\|transposase	IS1182-like element ISEfa7 family transposase	A0A1X9I5T2	Streptococcus_phage	3.1e-125	48.2
WP_143350988.1\|188083_189245_+\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	1.6e-79	51.3
187350:187517	attR	NA	NA	NA	NA
WP_002289249.1\|189752_191048_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	7.4e-54	37.2
WP_002289250.1\|191255_191732_-	PTS glucose transporter subunit IIA	NA	NA	NA	NA
WP_002289252.1\|191744_193247_-	PTS transporter subunit EIIC	NA	NA	NA	NA
WP_002289253.1\|193260_193950_-	N-acetylmannosamine-6-phosphate 2-epimerase	NA	NA	NA	NA
WP_002289254.1\|194110_194929_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_014748810.1\|195928_197224_+\|transposase	ISL3-like element ISEfa5 family transposase	A0A1S5SBP9	Streptococcus_phage	6.9e-44	29.5
WP_014748811.1\|197403_198276_-	ROK family protein	NA	NA	NA	NA
WP_002305939.1\|198503_199463_-\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	4.5e-32	33.9
WP_002389917.1\|200428_200860_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002389916.1\|200882_202037_-	iron-containing alcohol dehydrogenase	NA	NA	NA	NA
WP_002389915.1\|202058_203975_-	3D-(3,5/4)-trihydroxycyclohexane-1,2-dione acylhydrolase (decyclizing)	H8ZJ31	Ostreococcus_tauri_virus	4.3e-18	24.1
WP_002389914.1\|203967_204945_-	5-dehydro-2-deoxygluconokinase	NA	NA	NA	NA
WP_134789279.1\|204994_205816_-	5-deoxy-glucuronate isomerase	NA	NA	NA	NA
WP_002389911.1\|205887_207255_-	C1 family peptidase	R4TV59	Phaeocystis_globosa_virus	5.4e-71	36.5
WP_002389909.1\|207223_210313_-	alpha-mannosidase	NA	NA	NA	NA
WP_002389907.1\|210355_211309_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	1.1e-33	35.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_017960

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NC_017962

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NC_017961

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

4. NC_017963

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection