CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
NC_014816	Asticcacaulis excentricus CB 48 chromosome 1, complete sequence	1 crisprs	csa3,DEDDh,DinG,WYL,cas3	2
NC_014819	Asticcacaulis excentricus CB 48 plasmid pASTEX02, complete sequence	0 crisprs	DEDDh,csa3	0
NC_014818	Asticcacaulis excentricus CB 48 plasmid pASTEX01, complete sequence	0 crisprs	PrimPol	0
NC_014817	Asticcacaulis excentricus CB 48 chromosome 2, complete sequence	1 crisprs	NA	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_014816_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_014816_1

1908172-1908380

Orphan

Consensus_repeat	Method
TCAGTCCGCAAACGGATCACGCATGAGAATGGTGTCCTTTCGCGACTCTTTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_014816_1

>merge|NC_014816|1|1908172-1908380|CRISPRCasFinder
TCAGTCCGCAAACGGATCACGCATGAGAATGGTGTCCTTTCGCGACTCTTTTGGTTTCCGGAGGCCACCACTCGCCCGTCAGTCCGCAAACGGATCACGCATGAGAATGGTGTCCTCTCGCGACTCTTTTTGGTTTCCGGAGGCCACCACTCGCCCGTCAGTCCGCAAACGGATCACGCATGAGAATGGTGTCCTCTCGCTCTGGGCTG

>NC_014816|1|1|1908172-1908380|CRISPRCasFinder
TCAGTCCGCAAACGGATCACGCATGAGAATGGTGTCCTTTCGCGACTCTTTT	GGTTTCCGGAGGCCACCACTCGCCCGTCAGTCCGCAAACGGATCACGCATGAGAATGGTGTCCTCTCGCGACTCTTTTTGGTTTCCGGAGGCCACCACTCGCCCG
TCAGTCCGCAAACGGATCACGCATGAGAATGGTGTCCTCTCGCTCTGGGCTG

Protein	Signature genes	Signature genes Name	Protein_function
NC_014816.1\|WP_013479260.1\|1901661_1902330_+\|GTP-cyclohydrolase-I-FolE	unknown	unknown	gnl\|CDD\|236472
NC_014816.1\|WP_013479261.1\|1902576_1903014_+\|biopolymer-transporter-ExbD	unknown	unknown	gnl\|CDD\|223917
NC_014816.1\|WP_013479274.1\|1913506_1913860_-\|hypothetical-protein	unknown	unknown	unknown
NC_014816.1\|WP_013479265.1\|1906261_1907176_-\|aspartyl-protease-family-protein	unknown	unknown	gnl\|CDD\|133150
NC_014816.1\|WP_013479262.1\|1903122_1904127_+\|RluA-family-pseudouridine-synthase	unknown	unknown	gnl\|CDD\|161659
NC_014816.1\|WP_013479259.1\|1900050_1901442_-\|cysteine--tRNA-ligase	unknown	unknown	gnl\|CDD\|234705
NC_014816.1\|WP_013479273.1\|1913142_1913505_+\|hypothetical-protein	unknown	unknown	unknown
NC_014816.1\|WP_013479257.1\|1899140_1899563_-\|iron-sulfur-cluster-assembly-scaffold-protein	unknown	unknown	gnl\|CDD\|223892
NC_014816.1\|WP_144004719.1\|1914041_1914821_-\|dihydropteroate-synthase	unknown	unknown	gnl\|CDD\|238380
NC_014816.1\|WP_013479258.1\|1899609_1900047_-\|SRPBCC-domain-containing-protein	unknown	unknown	gnl\|CDD\|176864
NC_014816.1\|WP_013479270.1\|1911528_1911921_+\|hypothetical-protein	unknown	unknown	unknown
NC_014816.1\|WP_013479266.1\|1907242_1908043_-\|response-regulator	unknown	unknown	gnl\|CDD\|381085
NC_014816.1\|WP_013479277.1\|1915925_1917353_-\|UDP-N-acetylmuramate--L-alanine-ligase	unknown	unknown	gnl\|CDD\|234757
NC_014816.1\|WP_013479272.1\|1912900_1913140_+\|DUF1653-domain-containing-protein	unknown	unknown	gnl\|CDD\|377930
NC_014816.1\|WP_013479268.1\|1909846_1910119_+\|hypothetical-protein	unknown	unknown	unknown
NC_014816.1\|WP_083805610.1\|1904331_1905234_+\|RNA-polymerase-sigma-factor-RpoH	unknown	unknown	gnl\|CDD\|235838
NC_014816.1\|WP_013479271.1\|1912042_1912822_-\|bifunctional-hydroxymethylpyrimidine-kinase/phosphomethylpyrimidine-kinase	unknown	unknown	gnl\|CDD\|369938
NC_014816.1\|WP_013479269.1\|1910123_1911302_-\|phosphoserine-transaminase	unknown	unknown	gnl\|CDD\|235103
NC_014816.1\|WP_013479276.1\|1915026_1915929_-\|UDP-N-acetylmuramate-dehydrogenase	unknown	unknown	gnl\|CDD\|237553
NC_014816.1\|WP_013479264.1\|1905342_1906206_+\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293806

Protein	Function_ID	Function_description	E-value
NC_014816.1\|WP_013479260.1\|1901661_1902330_+\|GTP-cyclohydrolase-I-FolE	gnl\|CDD\|236472	PRK09347, folE, GTP cyclohydrolase I; Provisional.	2.62047e-106
NC_014816.1\|WP_013479261.1\|1902576_1903014_+\|biopolymer-transporter-ExbD	gnl\|CDD\|223917	COG0848, ExbD, Biopolymer transport protein [Intracellular trafficking and secretion].	6.28529e-38
NC_014816.1\|WP_013479265.1\|1906261_1907176_-\|aspartyl-protease-family-protein	gnl\|CDD\|133150	cd05483, retropepsin_like_bacteria, Bacterial aspartate proteases, retropepsin-like protease family. This family of bacteria aspartate proteases is a subfamily of retropepsin-like protease family, which includes enzymes from retrovirus and retrotransposons. While fungal and mammalian pepsin-like aspartate proteases are bilobal proteins with structurally related N- and C-termini, this family of bacteria aspartate proteases is half as long as their fungal and mammalian counterparts. The monomers are structurally related to one lobe of the pepsin molecule and function as homodimers. The active site aspartate occurs within a motif (Asp-Thr/Ser-Gly), as it does in pepsin. In aspartate peptidases, Asp residues are ligands of an activated water molecule in all examples where catalytic residues have been identified. This group of aspartate proteases is classified by MEROPS as the peptidase family A2 (retropepsin family, clan AA), subfamily A2A.	1.15299e-12
NC_014816.1\|WP_013479262.1\|1903122_1904127_+\|RluA-family-pseudouridine-synthase	gnl\|CDD\|161659	TIGR00005, Ribosomal_large_subunit_pseudouridine_synthase_D, pseudouridine synthase, RluA family. In E. coli, RluD (SfhB) modifies uridine to pseudouridine at 23S RNA U1911, 1915, and 1917, RluC modifies 955, 2504 and 2580, and RluA modifies U746 and tRNA U32. An additional homolog from E. coli outside this family, TruC (SP\|Q46918), modifies uracil-65 in transfer RNAs to pseudouridine. [Protein synthesis, tRNA and rRNA base modification].	4.33007e-110
NC_014816.1\|WP_013479259.1\|1900050_1901442_-\|cysteine--tRNA-ligase	gnl\|CDD\|234705	PRK00260, cysS, cysteinyl-tRNA synthetase; Validated.	0
NC_014816.1\|WP_013479257.1\|1899140_1899563_-\|iron-sulfur-cluster-assembly-scaffold-protein	gnl\|CDD\|223892	COG0822, IscU, NifU homolog involved in Fe-S cluster formation [Energy production and conversion].	3.94162e-29
NC_014816.1\|WP_144004719.1\|1914041_1914821_-\|dihydropteroate-synthase	gnl\|CDD\|238380	cd00739, DHPS, DHPS subgroup of Pterin binding enzymes. DHPS (dihydropteroate synthase), a functional homodimer, catalyzes the condensation of p-aminobenzoic acid (pABA) in the de novo biosynthesis of folate, which is an essential cofactor in both nucleic acid and protein biosynthesis. Prokaryotes (and some lower eukaryotes) must synthesize folate de novo, while higher eukaryotes are able to utilize dietary folate and therefore lack DHPS. Sulfonamide drugs, which are substrate analogs of pABA, target DHPS.	7.95632e-117
NC_014816.1\|WP_013479269.1\|1910123_1911302_-\|phosphoserine-transaminase	gnl\|CDD\|235103	PRK03080, PRK03080, phosphoserine transaminase.	0
NC_014816.1\|WP_013479266.1\|1907242_1908043_-\|response-regulator	gnl\|CDD\|381085	cd00156, REC, phosphoacceptor receiver (REC) domain of response regulators (RRs) and pseudo response regulators (PRRs). Two-component systems (TCSs) involving a sensor and a response regulator are used by bacteria to adapt to changing environments. Processes regulated by two-component systems in bacteria include sporulation, pathogenicity, virulence, chemotaxis, and membrane transport. Response regulators (RRs) share the common phosphoacceptor REC domain and different effector/output domains such as DNA, RNA, ligand-binding, protein-binding, or enzymatic domains. Response regulators regulate transcription, post-transcription or post-translation, or have functions such as methylesterases, adenylate or diguanylate cyclase, c-di-GMP-specific phosphodiesterases, histidine kinases, serine/threonine protein kinases, and protein phosphatases, depending on their output domains. The function of some output domains are still unknown. TCSs are found in all three domains of life - bacteria, archaea, and eukaryotes, however, the presence and abundance of particular RRs vary between the lineages. Archaea encode very few RRs with DNA-binding output domains; most are stand-alone REC domains. Among eukaryotes, TCSs are found primarily in protozoa, fungi, algae, and green plants. REC domains function as phosphorylation-mediated switches within RRs, but some also transfer phosphoryl groups in multistep phosphorelays.	3.78467e-09
NC_014816.1\|WP_013479277.1\|1915925_1917353_-\|UDP-N-acetylmuramate--L-alanine-ligase	gnl\|CDD\|234757	PRK00421, murC, UDP-N-acetylmuramate--L-alanine ligase; Provisional.	0
NC_014816.1\|WP_013479272.1\|1912900_1913140_+\|DUF1653-domain-containing-protein	gnl\|CDD\|377930	pfam07866, DUF1653, Protein of unknown function (DUF1653). This is a family of hypothetical bacterial proteins of unknown function.	1.09903e-25
NC_014816.1\|WP_013479258.1\|1899609_1900047_-\|SRPBCC-domain-containing-protein	gnl\|CDD\|176864	cd07822, SRPBCC_4, Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins. Uncharacterized group of the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily. SRPBCC domains have a deep hydrophobic ligand-binding pocket and they bind diverse ligands. SRPBCC domains include the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domains of mammalian STARD1-STARD15, the C-terminal catalytic domains of the alpha oxygenase subunit of Rieske-type non-heme iron aromatic ring-hydroxylating oxygenases (RHOs_alpha_C), Class I and II phosphatidylinositol transfer proteins (PITPs), Bet v 1 (the major pollen allergen of white birch, Betula verrucosa), CoxG, CalC, and related proteins. Other members of the superfamily include PYR/PYL/RCAR plant proteins, the aromatase/cyclase (ARO/CYC) domains of proteins such as Streptomyces glaucescens tetracenomycin, and the SRPBCC domains of Streptococcus mutans Smu.440 and related proteins.	2.17004e-26
NC_014816.1\|WP_083805610.1\|1904331_1905234_+\|RNA-polymerase-sigma-factor-RpoH	gnl\|CDD\|235838	PRK06596, PRK06596, RNA polymerase factor sigma-32; Reviewed.	5.33556e-179
NC_014816.1\|WP_013479271.1\|1912042_1912822_-\|bifunctional-hydroxymethylpyrimidine-kinase/phosphomethylpyrimidine-kinase	gnl\|CDD\|369938	pfam08543, Phos_pyr_kin, Phosphomethylpyrimidine kinase. This enzyme EC:2.7.4.7 is part of the Thiamine pyrophosphate (TPP) synthesis pathway, TPP is an essential cofactor for many enzymes.	2.09729e-112
NC_014816.1\|WP_013479276.1\|1915026_1915929_-\|UDP-N-acetylmuramate-dehydrogenase	gnl\|CDD\|237553	PRK13905, murB, UDP-N-acetylmuramate dehydrogenase.	2.11493e-164
NC_014816.1\|WP_013479264.1\|1905342_1906206_+\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293806	cd07720, OPHC2-like_MBL-fold, Pseudomonas pseudoalcaligenes organophosphorus hydrolase C2, and related proteins; MBL-fold metallo hydrolase domain. Pseudomonas pseudoalcaligenes OPHC2 is a thermostable organophosphorus hydrolase which a broad substrate activity spectrum: it hydrolyzes various phosphotriesters, esters, and a lactone. This subgroup also includes Pseudomonas oleovorans PoOPH which exhibits high lactonase and esterase activities, and latent PTE activity. However, double mutations His250Ile/Ile263Trp switch PoOPH into an efficient and thermostable PTE. Members of this subgroup belong to the MBL-fold metallo-hydrolase superfamily which is comprised mainly of hydrolytic enzymes which carry out a variety of biological functions.	7.95558e-82

>NC_014816.1|WP_013479266.1|1907242_1908043_-|response-regulator
MYGQNPATAQKLRATLKLVLLVEANPNYARMLSDMLRMLGAEQISHYRDHEEALDKAPGLLYTLIVCSHQAPECDALAFTKGLRRSNASCRKSPIITIAPEITMSLLNDIRDSGADEFMRKPFTWGDLQKRVEHVSLKARPWIEAVGYVGPDRRRFNSGDYNGPRKRAADNKDQKTAQVEQAVRILKAAFEQYNSDPLQARRAMYAQLEVLVPACKTIASQSFHNDVRTILTQLREEWPDLKQIRPAILSLAAFMKIEDRHPSTAA
>NC_014816.1|WP_013479265.1|1906261_1907176_-|aspartyl-protease-family-protein
MLTRRHLCAGLGAAGLGFWAGGAAAQAKIIRVPLTLSASKKPIVEVTLNGKGPYRFILDTGASHTVIRASLASELGLAVAGQGRNRSLKGTEYTTRYIVSDVTVGGQLGLHDWEVFASKGFEAAEYDGLLSADLLTRLPCQLDQTGGEIRYYLGGDMPLNGFAPLDSIYKRDITGGADKVHIRLRFAGHELDCLLDTGASRPLYIRGDFVRKHGLWDKYPLLNESALTGVNGQQVKVRHVEVRDLQIGGIDVPRLLVALGDPHDRAAFGEEGDRAEGIVGAPFLSGFVLAFTARRSLLVRRSVR
>NC_014816.1|WP_013479264.1|1905342_1906206_+|MBL-fold-metallo-hydrolase
MKRLIALVTISTLLAGSALAQTAGQVPADATPYTLGDIQLYSLRDMQFVIPNDGKVFGIDAGPQAVAEVLKANNAPTDKITLSVDALLVKDEARLILIDTGVGGVLGDSLKKAGYGPADITDVLISHPHGDHIGGLVKEGKPAFPNAKIRIAEADWAFLKGQANQAALVAAITPQVETFAPGAVITPHVKAVAIEGHTPGHSGYEIASGKDRLLAIGDAAHSSIISLAKPDWSIQFDTDKTEAKQSRRALLTELAKSNTLIFAPHFPYPGLGHVAASKDGFVFVPVK
>NC_014816.1|WP_083805610.1|1904331_1905234_+|RNA-polymerase-sigma-factor-RpoH
MSTSSLTSNALSMPNPSVLSPDGGLNRYLSEIRKFPMLAKDEEFMLAKRWAEHADPKAAHKLVTSHLRLVAKIAMGYRGYGLPIGEVISEGNVGLMQAVKKFDPDKGFRLATYAMWWIKAAIQEYVLRSWSLVKMGTTAAQKKLFFNLRKVKSEISALEEGDMRHEQVAQIATKLGVSEDDVISMNRRMSSPDSSLNAPLRVSEGDSEWQDWLADDSTPSQETVLADSEEYKLRMSLLEEAMGELNERERAILTARRLQENPTTLEDLADRFGVSRERVRQIEVRAFEKLQKAMMASAQG
>NC_014816.1|WP_013479262.1|1903122_1904127_+|RluA-family-pseudouridine-synthase
MTPDDDIDDDLPLASNGETHDLVLTSDMAGDRLDRALLPLLPDLSRARLQALISDGHLSHDGQTIADGKHKARAGLYRLFVPAPVSAIPEAQNLPLEVLYEDAHLIVVNKPAGMAAHPAPGTADGTLVNALLFHCGESLSGIGGVLRPGIVHRLDKDTSGVMVAAKSDAAHRGLSELFSRHDIDRAYEALVRGAPKTASGTVTTRIGRSPHDRKKMAVLKSGGREAISHYRTLNSFGGEKPVAARVRCTLETGRTHQIRVHMAYLGCPCLGDPVYGSGAPHRAVAEALKTLSFARQALHAAHLGFVHPVTGERLAFEAPLPADMADLLSALKLL
>NC_014816.1|WP_013479261.1|1902576_1903014_+|biopolymer-transporter-ExbD
MGAKLGGGGGSRYNVEQNSDINVTPFVDIMLVLLIIFMVSAPMATVSIKLDMPPPIPSDKPLDKPKDPVFISIQGTDDIYIGAKKTSLATLPADLAVALESPNPTEERVLVRGDADIEYNDFMSVLNTLQDNGYFKVALINEDLS
>NC_014816.1|WP_013479260.1|1901661_1902330_+|GTP-cyclohydrolase-I-FolE
MDSLDPNSRPHSEDPLTQALAQTRSKGFSEILNVERPSKEEAMAAVRTLLAWAGDDPTREGLIDTPKRVVEAYDEWFSGYQADPAKELSRTFEDVQGYDDMVMLRHIDVESHCEHHMASFLGKAYVAYMPTAKVVGISKIARVVEIFSKRLQTQETLTKQIADAIEQSLAPLGVAVLIDAEHQCMTTRGVHHKNVTTVTTRFTGVFKADLALQDRFMRFCQA
>NC_014816.1|WP_013479259.1|1900050_1901442_-|cysteine--tRNA-ligase
MKLRLSDTLKRHKVDFVPKNPQRVTMYVCGPTVYNYAHIGNARPVVVFDVLFRLLRYIYGEEAVIYARNITDVDDKINQKAMAEGVDIDVITSKFADIYNADMRALNALEPTIQPRVTQNMSAIVAQIAALIRNGHAYAAEGHVLFDVESYRAYGALSNRSLDDMIAGARVEVAPYKKNPQDFVLWKPSKPGEPKWPSPWGEGRPGWHIECSAMIEANLGLPIDIHGGGHDLIFPHHENEIAQGVCAQHGHSHQEESYARYWMHNGFLTMDAEKMSKSLGNVLLVHDLIKEFPGEVIRLALLSAHYRAPLDWNSDLLVQTRKRLDGLYEALRKAANVPVVETAVPEAVIDALCDDLSTPRVLAELSALASALEKASQSEKPLAKAQLLAAGALMGILQQEAESWFKGGADDDLSAKVETLLIARKTARAEKNWAEADRIRNELTALNVEVMDGPEGATWKLKA
>NC_014816.1|WP_013479258.1|1899609_1900047_-|SRPBCC-domain-containing-protein
MAIKVEKRIGIQTPVDTVYEILQDIEGWVEWSPIHKEAKGKLGFGAPVRFMEHYEGLGDWEIHGFVSDWSPLSHIHIGVPKKFYEGSLIRFYELNILSDTACDFAIGAQFSGFLSEREGKKYRSYLREGFAKFAEALKAKAEGTI
>NC_014816.1|WP_013479257.1|1899140_1899563_-|iron-sulfur-cluster-assembly-scaffold-protein
MIDELYSREILRRTAQLDHVGRLKAPDGAADRTAKLCGSTIHVEVKLADGVITDFAQEVEACALGQAAAAILSQSVIEAPVVEVIAARDAMKAMLKGGAFDYPERFADFAILQSVKDFPARHASTLLALEATVEAAGRAG
>NC_014816.1|WP_013479268.1|1909846_1910119_+|hypothetical-protein
MWTLLTILAGLFVLVGLGGMIWGATGRTQARRKQGLWALETGMVLGSICLSLKAFSGDTSNIIYGMMLLVFGTAVTDLGPKADKSGKPEA
>NC_014816.1|WP_013479269.1|1910123_1911302_-|phosphoserine-transaminase
MSAKPATIPERPWFSSGPTAKRPGWTPEALSGAPVGRSNRSKVTVGRICQALDMTREILRIPVDYQVFMVPGSDTGAFEAAMWNLLGARRVQLLAFENFGQLWADDATKHLKLDAEVLSAPYGELPDLTQIDPQADLIFPWNGTTSGVRVPNSDFLNGHAVADSGLVLCDATSAAFCMDLPWDKLDVATFSFQKALGGEAGIGVLILSPKAVERLNSFDSARAIPKVLRLKKGNAADAAILGGDAINTFSFLVIEDYLDALRWAQREGGLEGLIQRCDEAAGALFNWVEKTPWIDFVAVDKATRSTTSVCLKFVDPAIRALSAEAQAKLATRVGSLLELEGVAFDITGYRAAPPGLRVWCGCTVEAEDVEALLPWLEWAYAVAVSELGLVAA
>NC_014816.1|WP_013479270.1|1911528_1911921_+|hypothetical-protein
MTKLKTIATAVVAIAGLAAITPAFAAGQHDRYDRYDRREDVRDYRDNRVDARIERLEDRLDMGRRSGRLTRSEFGRLSSELNGIERLSNQYERSGRGIDRQEMANLSYRLDRFEQKLHWERNDRDTAWRR
>NC_014816.1|WP_013479271.1|1912042_1912822_-|bifunctional-hydroxymethylpyrimidine-kinase/phosphomethylpyrimidine-kinase
MRRVLIIAGSDPSGGAGIQADLKTVTCLGGYAMTAITALTVQNTLGVTDVMPVPEALITAQAEACLSDIGADAVKTGMLGTTAVVETVAALLDKAGVFAVVDPVMVAKGGHPLLVDEAIDAIRTLLIPRAGLLTPNAPEAAVLTGIEVVDEASQQRAGEALLNMGAKAVLMKGGHIDSANVVDWLLWEEDARRYVSERIETRHTHGTGCTLASACAVLAGPDRCLADSVEMARDYVMGALVTAPNLGGGHGPLRHNWVL
>NC_014816.1|WP_013479272.1|1912900_1913140_+|DUF1653-domain-containing-protein
MTRPIADYPSALATGLYRHYKGKDYVVFGCVTHSETEEVLVLYAPVIQADPARLWVRPLAMFSESVDSDGEILPRFRKL
>NC_014816.1|WP_013479273.1|1913142_1913505_+|hypothetical-protein
MTANTDDSRWNELVPEAFAEASDPMVRVLLGKILVVRLNQIGTNDDLLSFELIGGRVIRANRKEGLVLSLVGTPQGEEFFLPLVPEAYLMVDPGDYALTCGTVIRNPDFSAAFDIYAQIN
>NC_014816.1|WP_013479274.1|1913506_1913860_-|hypothetical-protein
MMKRVLTKKPQFSKTVLPDRQKRNLKFSHAPQEVEVGVDTVPQILSGPVEMEVPAYEWASAEEPTPPAVIAQQSRNLFQWIVAIVLPVAALGVIALSVVALAQAGGYDADFIASRLK
>NC_014816.1|WP_144004719.1|1914041_1914821_-|dihydropteroate-synthase
MGVINATPDSFSDGGSYDPVAQGLRLIAEGADVLDIGGESTRPGAEPVSVAEEIARVVPVIEALRARWSGPLSIDTLKPDVARAAFAAGATLWNDVTALSHSPDSLATAAELQGRVILMHMQGEPRTMQVAPQYDDVVAEVETYLLARAAAAIQAGVPRENIWLDPGIGFGKTLDHNLSLIRATPRLASHGFPLLMAASRKRFIAALEEREGAPPSDATQRIGGTLAIHLYAAQNGARMVRVHDVAEMRQALRLWAALA
>NC_014816.1|WP_013479276.1|1915026_1915929_-|UDP-N-acetylmuramate-dehydrogenase
MSDWADALPAVRGKIVKQAELAPFTWFRVGGPADVLFLPEDEADLATFLKGLDPAVPVTPIGVGSNLLVRDGGLEGVVVRLGRNFAQIVTDDWGLTAGAAALDAQVAKVAARAGLAGLEFYAGIPGTVGGAVTMNAGCYGRETKDALLSARIMDRSGNVVTLSNAELQFAYRHSILQEKNWIVLGAAYELQEGNDPSEVIARIEEITAKRETSQPIREKTGGSTFKNPEGHSAWKLVDEAGWRGKFFGGAKFSELHSNFMINADNATAADLEGLGDTVRAEVKDKFGIDLHWEIKRIGRK
>NC_014816.1|WP_013479277.1|1915925_1917353_-|UDP-N-acetylmuramate--L-alanine-ligase
MIAPAKLRPTPFDLGPVHFVGIGGIGMSGIAEIMIKIGYKVQGSDAKASANTERLQKLGAKIFIGHEASHVSDDVSALVYSTAVKHDNPEMVAARSRRIPLVRRAEMLAELMRLQFSIAVGGTHGKTTTTSMVAALLDAGGLDPTVVNGGIINAYGTNAKVGDGDWIVVEADESDGSFLRLKSTLAIVTNIDAEHLDHWGDFEAVKKGFVDFVENIPFYGFAAVCVDHPEVLALTAKVENRRLIPYGVSPQAEVRCTNIDFGPEGATFDVVFSPVGVEPFVWAGLKLPMTGNHNVSNATAAIAIARELGVSEDDVRKGLGAFGGVKRRFTTTGIVNGVRIIDDYGHHPVEIAAVLKAARQVTQGKVIAVVQPHRYTRLRDLMTEFSTCFHDADKVIVADVYSAGEVPIEGVSKDALVEALHRHGHRNAVGLDGPAALAGLVAAEAKAGDLVVCLGAGDITQWAYALPAQLEGVAA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

328018 : 352549

Sinorhizobium_phage(25.0%)

protease,capsid,terminase,tail,portal,head,integrase

attL 324493:324507|attR 332156:332170

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
324493:324507	attL	NA	NA	NA	NA
WP_013477832.1\|328018_329089_-\|integrase	tyrosine-type recombinase/integrase	A0A291AUF0	Sinorhizobium_phage	2.8e-51	37.0
WP_013477833.1\|329070_329322_-	hypothetical protein	A0A291AUJ1	Sinorhizobium_phage	6.0e-13	62.3
WP_013477834.1\|329318_329708_-	hypothetical protein	NA	NA	NA	NA
WP_013477835.1\|329704_330382_-	hypothetical protein	NA	NA	NA	NA
WP_013477836.1\|330381_330933_-	hypothetical protein	NA	NA	NA	NA
WP_013477837.1\|330922_331459_-	hypothetical protein	NA	NA	NA	NA
WP_013477838.1\|331455_332007_-	hypothetical protein	W6MW33	Pseudomonas_phage	6.6e-12	50.7
WP_013477839.1\|332008_332293_-	hypothetical protein	NA	NA	NA	NA
332156:332170	attR	NA	NA	NA	NA
WP_013477840.1\|332644_333127_-	single-stranded DNA-binding protein	R9TP78	Rhizobium_phage	5.2e-45	54.5
WP_013477842.1\|333227_333539_-	hypothetical protein	NA	NA	NA	NA
WP_083805599.1\|333541_333874_-	DUF2312 domain-containing protein	Q8W6H2	Sinorhizobium_phage	4.8e-18	48.5
WP_013477844.1\|334145_334421_-	hypothetical protein	NA	NA	NA	NA
WP_144004583.1\|335060_335753_-	S24 family peptidase	A0A0M3LP76	Mannheimia_phage	4.4e-05	30.9
WP_013477849.1\|336094_336676_+	hypothetical protein	NA	NA	NA	NA
WP_013477850.1\|336672_337263_+	hypothetical protein	NA	NA	NA	NA
WP_013477851.1\|337259_337709_+	hypothetical protein	NA	NA	NA	NA
WP_013477852.1\|337705_338449_+	GcrA cell cycle regulator	NA	NA	NA	NA
WP_013477853.1\|338438_338768_+	hypothetical protein	NA	NA	NA	NA
WP_144004584.1\|338760_339468_+	hypothetical protein	A0A1C9LW48	Vibrio_phage	4.1e-14	29.3
WP_013477855.1\|339464_340634_+	hypothetical protein	NA	NA	NA	NA
WP_013477856.1\|340630_342196_+	phage/plasmid primase, p4 family	A0A0M7RDT6	Lactobacillus_phage	7.3e-64	31.2
WP_013477857.1\|342484_343021_+	ngn domain-containing protein	NA	NA	NA	NA
WP_013477858.1\|343346_343646_+	HNH endonuclease	I3ULZ4	Rhodobacter_phage	1.1e-18	49.4
WP_013477859.1\|343820_344318_+	hypothetical protein	I3ULZ5	Rhodobacter_phage	1.5e-18	38.2
WP_013477860.1\|344322_346011_+\|terminase	terminase large subunit	A0A2H4J6B3	uncultured_Caudovirales_phage	1.6e-120	40.3
WP_013477861.1\|346020_347259_+\|portal	phage portal protein	Q3HQS8	Burkholderia_phage	5.9e-77	43.7
WP_013477862.1\|347230_348055_+\|protease	Clp protease ClpP	Q3HQS9	Burkholderia_phage	1.8e-58	48.0
WP_013477863.1\|348082_349384_+\|capsid	phage major capsid protein	Q3HQT0	Burkholderia_phage	5.5e-73	40.6
WP_013477864.1\|349466_349904_+	hypothetical protein	NA	NA	NA	NA
WP_013477865.1\|349977_350283_+\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
WP_013477866.1\|350293_350479_+	hypothetical protein	NA	NA	NA	NA
WP_013477867.1\|350478_350817_+\|head,tail	head-tail adaptor protein	NA	NA	NA	NA
WP_013477868.1\|350813_351230_+	hypothetical protein	NA	NA	NA	NA
WP_013477869.1\|351233_351656_+	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_013477870.1\|351728_352196_+\|tail	major tail protein tp901-1	A0A2D2W2I6	Sinorhizobium_phage	2.5e-12	31.4
WP_013477871.1\|352195_352549_+	gene transfer agent family protein	B4UTQ4	Rhizobium_phage	4.0e-10	38.7

DBSCAN-SWA_2

1444692 : 1458897

uncultured_Mediterranean_phage(75.0%)

protease,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013478847.1\|1444692_1445979_-	MHS family MFS transporter	Q6JIH2	Burkholderia_virus	2.1e-40	29.1
WP_013478848.1\|1446128_1446554_+	hypothetical protein	NA	NA	NA	NA
WP_013478849.1\|1446607_1447375_-	response regulator	NA	NA	NA	NA
WP_083805561.1\|1447921_1448194_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_013478850.1\|1448330_1448645_-	hypothetical protein	NA	NA	NA	NA
WP_013478851.1\|1448727_1450134_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	5.3e-98	44.9
WP_013478852.1\|1450295_1451195_-	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	3.2e-40	37.8
WP_013478853.1\|1451191_1451779_-	twin-arginine translocase subunit TatB	NA	NA	NA	NA
WP_013478854.1\|1451865_1452072_-	twin-arginine translocase TatA/TatE family subunit	A0A1B1IVR9	uncultured_Mediterranean_phage	1.3e-05	61.4
WP_013478855.1\|1452192_1452864_-	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	5.0e-38	47.0
WP_144004706.1\|1452860_1453697_-	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	8.7e-32	34.9
WP_013478857.1\|1453721_1454813_-	beta-N-acetylhexosaminidase	A0A1B1IVS3	uncultured_Mediterranean_phage	3.6e-25	44.9
WP_013478858.1\|1454827_1455601_-	SPOR domain-containing protein	NA	NA	NA	NA
WP_013478859.1\|1455839_1456328_+	hypothetical protein	NA	NA	NA	NA
WP_013478860.1\|1456345_1457263_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_013478861.1\|1457319_1458897_-	cisplatin damage response ATP-dependent DNA ligase	C5IHN5	Burkholderia_virus	2.6e-08	33.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NC_014817

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_014817_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_014817_1

854316-854459

Orphan

Consensus_repeat	Method
ACGGATACGCACGCTGATGTTCTTCGTTCTTCGCCATGGTCAGACGGACTGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_014817_1

>merge|NC_014817|1|854316-854459|CRISPRCasFinder
ACGGATACGCACGCTGATGTTCTTCGTTCTTCGCCATGGTCAGACGGACTGGCCCGTCCCGGCAGCGCAGCAACGGGACAAAACCCAGGAAAACGGATACGCACGCTGATGTTCTTCGTTCTTCGCCATGGTCAAACGGACTGG

>NC_014817|1|1|854316-854459|CRISPRCasFinder
ACGGATACGCACGCTGATGTTCTTCGTTCTTCGCCATGGTCAGACGGACTGG	CCCGTCCCGGCAGCGCAGCAACGGGACAAAACCCAGGAAA
ACGGATACGCACGCTGATGTTCTTCGTTCTTCGCCATGGTCAAACGGACTGG

Protein	Signature genes	Signature genes Name	Protein_function
NC_014817.1\|WP_013480596.1\|844906_846220_-\|HAMP-domain-containing-protein	unknown	unknown	gnl\|CDD\|214599
NC_014817.1\|WP_013480600.1\|849324_850473_+\|N-acetyltransferase	unknown	unknown	gnl\|CDD\|377314
NC_014817.1\|WP_013480609.1\|857888_858242_-\|glyoxalase/bleomycin-resistance/dioxygenase-family-protein	unknown	unknown	gnl\|CDD\|319911
NC_014817.1\|WP_013480603.1\|852365_853373_-\|RluA-family-pseudouridine-synthase	unknown	unknown	gnl\|CDD\|223638
NC_014817.1\|WP_013480616.1\|866499_867216_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|349772
NC_014817.1\|WP_013480610.1\|858412_859405_-\|LLM-class-flavin-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|274646
NC_014817.1\|WP_013480599.1\|848733_849201_+\|RidA-family-protein	unknown	unknown	gnl\|CDD\|100006
NC_014817.1\|WP_013480607.1\|855247_857371_+\|EAL-domain-containing-protein	unknown	unknown	gnl\|CDD\|236645
NC_014817.1\|WP_013480614.1\|864221_864989_+\|polysaccharide-deacetylase-family-protein	unknown	unknown	gnl\|CDD\|200589
NC_014817.1\|WP_144004789.1\|860300_861839_+\|exopolysaccharide-biosynthesis-polyprenyl-glycosylphosphotransferase	unknown	unknown	gnl\|CDD\|274396
NC_014817.1\|WP_013480615.1\|865198_866500_-\|O-antigen-ligase-family-protein	unknown	unknown	gnl\|CDD\|225844
NC_014817.1\|WP_013480605.1\|853832_854264_+\|HIT-family-protein	unknown	unknown	gnl\|CDD\|238608
NC_014817.1\|WP_013480613.1\|863304_864222_+\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|366154
NC_014817.1\|WP_013480598.1\|848062_848431_-\|response-regulator	unknown	unknown	gnl\|CDD\|381100
NC_014817.1\|WP_013480608.1\|857557_857746_+\|hypothetical-protein	unknown	unknown	unknown
NC_014817.1\|WP_013480601.1\|850832_851576_-\|ATPase	unknown	unknown	gnl\|CDD\|227677
NC_014817.1\|WP_013480597.1\|846691_848056_-\|PleD-family-two-component-system-response-regulator	unknown	unknown	gnl\|CDD\|236577
NC_014817.1\|WP_013480604.1\|853369_853750_-\|fluoride-efflux-transporter-CrcB	unknown	unknown	gnl\|CDD\|376809
NC_014817.1\|WP_013480602.1\|851695_852364_-\|HAD-IA-family-hydrolase	unknown	unknown	gnl\|CDD\|319835
NC_014817.1\|WP_013480612.1\|861844_863308_+\|lipopolysaccharide-biosynthesis-protein	unknown	unknown	gnl\|CDD\|225153

Protein	Function_ID	Function_description	E-value
NC_014817.1\|WP_013480596.1\|844906_846220_-\|HAMP-domain-containing-protein	gnl\|CDD\|214599	smart00283, MA, Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer). Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.	3.56325e-37
NC_014817.1\|WP_013480600.1\|849324_850473_+\|N-acetyltransferase	gnl\|CDD\|377314	pfam04339, FemAB_like, Peptidogalycan biosysnthesis/recognition. FemAB_like is a family of both baterial and Viridiplantae proteins with responsibility for building interpeptide bridges in peptidoglycan. Such a function is feasible for bacteria but less likely for the plant members of this family. Perhaps the plant-members are using homologous proteins to recognize bacterial peptidoglcans as part of their innate immune system.	0
NC_014817.1\|WP_013480609.1\|857888_858242_-\|glyoxalase/bleomycin-resistance/dioxygenase-family-protein	gnl\|CDD\|319911	cd07247, SgaA_N_like, N-terminal domain of Streptomyces griseus SgaA and similar domains. SgaA suppresses the growth disturbances caused by high osmolarity and a high concentration of A-factor, a microbial hormone, during the early growth phase in Streptomyces griseus. A-factor (2-isocapryloyl-3R-hydroxymethyl-gamma-butyrolactone) controls morphological differentiation and secondary metabolism in Streptomyces griseus. It is a chemical signaling molecule that at a very low concentration acts as a switch for yellow pigment production, aerial mycelium formation, streptomycin production, and streptomycin resistance. The structure and amino acid sequence of SgaA are closely related to a group of antibiotics resistance proteins, including bleomycin resistance protein, mitomycin resistance protein, and fosfomycin resistance proteins. SgaA might also function as a streptomycin resistance protein.	1.2016e-05
NC_014817.1\|WP_013480603.1\|852365_853373_-\|RluA-family-pseudouridine-synthase	gnl\|CDD\|223638	COG0564, RluA, Pseudouridylate synthases, 23S RNA-specific [Translation, ribosomal structure and biogenesis].	6.40959e-86
NC_014817.1\|WP_013480616.1\|866499_867216_-\|hypothetical-protein	gnl\|CDD\|349772	cd05387, BY-kinase, bacterial tyrosine-kinase. Bacterial tyrosine (BY)-kinases catalyze the autophosphorylation on a C-terminal tyrosine cluster and also phosphorylate endogenous protein substrates by using ATP as phosphoryl donor. Besides their capacity to function as tyrosine kinase, most of these proteins are also involved in the production and transport of exopolysaccharides. BY-kinases are involved in a number of physiological processes ranging from stress resistance to pathogenicity.	1.99725e-13
NC_014817.1\|WP_013480610.1\|858412_859405_-\|LLM-class-flavin-dependent-oxidoreductase	gnl\|CDD\|274646	TIGR03558, oxido_grp_1, luciferase family oxidoreductase, group 1. The Pfam domain family pfam00296 is named for luciferase-like monooxygenases, but the family also contains several coenzyme F420-dependent enzymes. This protein family represents a well-resolved clade within family pfam00296 and shows no restriction to coenzyme F420-positive species, unlike some other clades within pfam00296. [Unknown function, Enzymes of unknown specificity].	1.675e-175
NC_014817.1\|WP_013480599.1\|848733_849201_+\|RidA-family-protein	gnl\|CDD\|100006	cd02199, YjgF_YER057c_UK114_like_1, This group of proteins belong to a large family of YjgF/YER057c/UK114-like proteins present in bacteria, archaea, and eukaryotes with no definitive function. The conserved domain is similar in structure to chorismate mutase but there is no sequence similarity and no functional connection. Members of this family have been implicated in isoleucine (Yeo7, Ibm1, aldR) and purine (YjgF) biosynthesis, as well as threonine anaerobic degradation (tdcF) and mitochondrial DNA maintenance (Ibm1). This domain homotrimerizes forming a distinct intersubunit cavity that may serve as a small molecule binding site.	5.57792e-68
NC_014817.1\|WP_013480607.1\|855247_857371_+\|EAL-domain-containing-protein	gnl\|CDD\|236645	PRK10060, PRK10060, cyclic di-GMP phosphodiesterase.	2.8805e-127
NC_014817.1\|WP_013480614.1\|864221_864989_+\|polysaccharide-deacetylase-family-protein	gnl\|CDD\|200589	cd10967, CE4_GLA_like_6s, Putative catalytic NodB homology domain of gellan lyase and similar proteins. This family is represented by the extracellular polysaccharide-degrading enzyme, gellan lyase (gellanase, EC 4.2.2.-), from Bacillus sp. The enzyme acts on gellan exolytically and releases a tetrasaccharide of glucuronyl-glucosyl-rhamnosyl-glucose with unsaturated glucuronic acid at the nonreducing terminus. The family also includes many uncharacterized prokaryotic polysaccharide deacetylases, which show high sequence similarity to Bacillus sp. gellan lyase. Although their biological functions remain unknown, all members of the family contain a conserved domain with a 6-stranded beta/alpha barrel, which is similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, belonging to the larger carbohydrate esterase 4 (CE4) superfamily.	1.55066e-40
NC_014817.1\|WP_013480615.1\|865198_866500_-\|O-antigen-ligase-family-protein	gnl\|CDD\|225844	COG3307, RfaL, Lipid A core - O-antigen ligase and related enzymes [Cell envelope biogenesis, outer membrane].	1.76335e-18
NC_014817.1\|WP_013480605.1\|853832_854264_+\|HIT-family-protein	gnl\|CDD\|238608	cd01277, HINT_subgroup, HINT (histidine triad nucleotide-binding protein) subgroup: Members of this CD belong to the superfamily of histidine triad hydrolases that act on alpha-phosphate of ribonucleotides. This subgroup includes members from all three forms of cellular life. Although the biochemical function has not been characterised for many of the members of this subgroup, the proteins from Yeast have been shown to be involved in secretion, peroxisome formation and gene expression.	2.34244e-47
NC_014817.1\|WP_013480613.1\|863304_864222_+\|glycosyltransferase-family-2-protein	gnl\|CDD\|366154	pfam00535, Glycos_transf_2, Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.	4.50764e-18
NC_014817.1\|WP_013480598.1\|848062_848431_-\|response-regulator	gnl\|CDD\|381100	cd17548, REC_DivK-like, phosphoacceptor receiver (REC) domain of DivK and similar proteins. Caulobacter crescentus DivK is an essential response regulator that is involved in the complex phosphorelay pathways controlling both cell division and motility. It localizes cell cycle regulators to specific poles of the cell during division. DivK contains a stand-alone REC domain. REC domains function as phosphorylation-mediated switches within response regulators, but some also transfer phosphoryl groups in multistep phosphorelays.	3.48548e-70
NC_014817.1\|WP_144004789.1\|860300_861839_+\|exopolysaccharide-biosynthesis-polyprenyl-glycosylphosphotransferase	gnl\|CDD\|274396	TIGR03023, Sugar_transferase., Undecaprenyl-phosphate glucose phosphotransferase. This family of proteins encompasses the E. coli WcaJ protein involved in colanic acid biosynthesis, the Methylobacillus EpsB protein involved in methanolan biosynthesis, as well as the GumD protein involved in the biosynthesis of xanthan. All of these are closely related to the well-characterized WbaP (formerly RfbP) protein, which is the first enzyme in O-antigen biosynthesis in Salmonella typhimurium. The enzyme transfers galactose from UDP-galactose (NOTE: not glucose) to a polyprenyl carrier (utilizing the highly conserved C-terminal sugar transferase domain, pfam02397) a reaction which takes place at the cytoplasmic face of the inner membrane. The N-terminal hydrophobic domain is then believed to facilitate the "flippase" function of transferring the liposaccharide unit from the cytoplasmic face to the periplasmic face of the inner membrane. Most of these genes are found within large operons dedicated to the production of complex exopolysaccharides such as the enterobacterial O-antigen. Colanic acid biosynthesis utilizes a glucose-undecaprenyl carrier, knockout of EpsB abolishes incorporation of UDP-glucose into the lipid phase, and the C-terminal portion of GumD has been shown to be responsible for the glucosyl-1-transferase activity.	1.59408e-135
NC_014817.1\|WP_013480601.1\|850832_851576_-\|ATPase	gnl\|CDD\|227677	COG5387, COG5387, Chaperone required for the assembly of the mitochondrial F1-ATPase [Posttranslational modification, protein turnover, chaperones].	7.80568e-51
NC_014817.1\|WP_013480597.1\|846691_848056_-\|PleD-family-two-component-system-response-regulator	gnl\|CDD\|236577	PRK09581, pleD, response regulator PleD; Reviewed.	0
NC_014817.1\|WP_013480604.1\|853369_853750_-\|fluoride-efflux-transporter-CrcB	gnl\|CDD\|376809	pfam02537, CRCB, CrcB-like protein, Camphor Resistance (CrcB). CRCB is a family of bacterial integral membrane proteins with four TMs.. Over expression in E. coli also leads to camphor resistance.	3.47188e-28
NC_014817.1\|WP_013480602.1\|851695_852364_-\|HAD-IA-family-hydrolase	gnl\|CDD\|319835	cd07533, HAD_like, uncharacterized family of the haloacid dehalogenase-like (HAD) hydrolase superfamily, similar to Parvibaculum lavamentivorans HAD-superfamily hydrolase, subfamily IA, variant 1. This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	2.18898e-67
NC_014817.1\|WP_013480612.1\|861844_863308_+\|lipopolysaccharide-biosynthesis-protein	gnl\|CDD\|225153	COG2244, RfbX, Membrane protein involved in the export of O-antigen and teichoic acid [General function prediction only].	1.78711e-32

>NC_014817.1|WP_013480605.1|853832_854264_+|HIT-family-protein
MSLYGDYDPKNIFAKILAGDIPCAKVYEDARVLSFMDAFPQTRGHTLVIPKVAARNLFDISSEHLQNLIHHTQRIGRAVRDALEPEGVRIAQFNGEVGGQTVFHLHFHIIPCYANGAIKHHASGQMADLKDLQDMAARIKAKL
>NC_014817.1|WP_013480604.1|853369_853750_-|fluoride-efflux-transporter-CrcB
MSNLLLVMIGGALGSAARYGLARLWPAAAMPFGWPIGTFAANLLGGLMMGLLAGWLLAKGGDERLRLLLGVGVLGGFTTFSTYSLEVVHMLERRDYGLAGLYAVSSAALAILAVMIGLFVFRKVAG
>NC_014817.1|WP_013480603.1|852365_853373_-|RluA-family-pseudouridine-synthase
MSREVKILYVAEGEDGVRIDKFFKRRWPHLNHIQLNKLLRSGQVRVDGARAKADTRLSTGQSVRVPPLPDAPSEEQQKRERAELSPQEVRYAKSLVLYEDEDVIAINKPSGLAVQGGTKTKNHIDRLLSAWGEGLERPRLVHRLDRDTSGVLLLGKSPSAAARLAGAFAKRKAYKTYWALVAGTPDPKEGVIDVPLVKKGINDREMVMPADPKEPGAEAAETEYVTISRAAHRLAWMALRPHTGRTHQLRAHMQAIGHCILGDPKYKDEKSIALSEGLGLQLHHRRIEIPHPTHGTLIVEAPLDPVIQAGFDRYGFDEHEASPEPFRKATRASRR
>NC_014817.1|WP_013480602.1|851695_852364_-|HAD-IA-family-hydrolase
MRLAVFDVDGTLIDSRASIHRAAVEAAKVLNLTPPTYDEVRAIVGMSLFEALQAMRPDLDPETVAAYTREFQNAFLTFHADPDFTEALYLGAQETLERLKNDNWLIGMATGNSRRGVTRIVEKHGWGDLFDVTFCADDGPSKPHPHMLQCNLTALGVGTHQAVMIGDATHDMRMARSAQVQAIGVSWGFHTVDELEAAGAHHIVHDFSELGAVLDRFVPELI
>NC_014817.1|WP_013480601.1|850832_851576_-|ATPase
MTYKAEAPSKRSDQIGAKPKRFWKTVEIKADGPGYGVTLDGRAVKTPKGATLVLPNFALAALVGREWEAVEETVDFTAMPLTRLGFAALDHMDSGLEAALAEAARFAETDLVCYPSDYPQALIAREQAAWGPVIDWLRRELSLEFVPQTSIMARGQPVATIEGVKTLLTTASVYVRAGLMAAIPLLGSVALALALYKGRLSAEEAFAASRVGETFQKETWGEDAEALKREAAMRHDLTHLEAWFRGV
>NC_014817.1|WP_013480600.1|849324_850473_+|N-acetyltransferase
MPVPALTADLHRSISEIDPAVWDGLKGDGNPFNSHAFLESLEQTGCVGEDSGWVPHHLSLSDEAGTIRGVMPLYLKYHSMGEYVFDHSWAQAYERAGGRYYPKLLSASPFTPVTGTRLLSPEPEVRAALIRTAVQLCDTNGLSSFHLNFPTPDEWALMGEEGLLLRQDQQFWWTNDGYQSFDDFLAALSANRRKVIRRERRDVQAALSLKIHSGRDITEAHLDHLHAFIEDTYDRKWGSPYLTRDFFSVITERMRDQIVLVFAYDGAQPVAGAINYRGGDTLYGRQWGARVDVPFLHFEVCYYQAIDYAIAHGLSRVEAGTQGEHKISRGYLPHPVYSAHHIRDRALREPVARYLAQERAAVAAQMTEYAAELSPFKARDQT
>NC_014817.1|WP_013480599.1|848733_849201_+|RidA-family-protein
MSKIEARLQELGITLPVPAAPVANYVPFVRSGNLIHISGQISNDNTGRYKGTVGVDVSLEDATEAARVCGINLLAQMKAAVGDLDNVVRVVKLGAFVQAGPDFYDVPQVVNGCSNLMVEVLGEAGKHARSAVGVYKIPLGFAVEVDAVIEVADRR
>NC_014817.1|WP_013480598.1|848062_848431_-|response-regulator
MSAKKVLIVEDNELNMKLFHDLLDAQGYETLQTGEGLSALSLARKHRPDLILMDIQLPEISGLEVTKWLKEDDELSHIPVVAVTAFAMKGDEERIREGGCEAYISKPISVSHFLDTVRRYLG
>NC_014817.1|WP_013480597.1|846691_848056_-|PleD-family-two-component-system-response-regulator
MTAKVLVVDDIPANVRLLQAKLEADYYDVVTAHSGQEAIETAIIEQPDIILLDVMMPGVDGYEVTRQLKELAETRHIPIILVTALDGRDDRLSGLEAGADDFLTKPLDDVILFARLKALVRLKHLSDELRQREQSSRRMGLIDANQLHRQMTAPGNVLILDDQVRQAERLMVALGEQHRCAYETDPKAALKIALGRVDLLVLNLAARDFDPLRFVAHLRSSELTRQLPVLGLFNPDERPTLLKGLELGVSDVLPRPVDIQELLARARGQIRRKRYADFLRASLDRSLELAVTDPLTGLNNRRFMDLQLTQLMRRHLKTDDPVSLLLLDIDHFKRVNDGFGHDAGDEVLKEFARRVSQNVRAIDMPCRLGGEEFVVLMPDTPADAAQTIAERVRQAVAEAPFSLPDGRTLDVTVSVGVSSLLGLGDTLEAFIKRADEAVYEAKQSGRNRVILRAA
>NC_014817.1|WP_013480596.1|844906_846220_-|HAMP-domain-containing-protein
MTLPPIKARIRGLFALFLLLLASLTAVALGHEGAVISGLQATLATAPQSEAQLRPLLAAAETFRAGIWVVAIGVGLAGLVAIVYFDREVFSALERMSRLMSRFAERDFEAEVEGAQRSDEIGAMARALQIFRGNGRALIALEAENARRAEVLAQERQKALQEMGERLHAQVSALIVGLSRSSEAMTDSAETMSEQAKGAVSRIENVTATAEATSRQAHHVAETVQGLSSSASDIAQAAVASSEVSAQAVGQSEATSEIMGRLNRSAEEISAVVDIISGIARQTNLLALNATIEAARAGEAGAGFAVVASEVKTLAQQTEKATRDITDKVTHIQSDTTQAVEAIGHIVGVIQELRASADGIAEAVSAQQSATRDIASTVDALASGAQSVGRDIDAVRHVAAATDQAAGTVSLESRSVQAVAGDLKGQIEAFIQSLRAA
>NC_014817.1|WP_013480607.1|855247_857371_+|EAL-domain-containing-protein
MQKAAHVSDITDTVDPVFPQTTNSQIYDSFRDNSDLLVLAVVDTCGRVLGLIERHSFNLKMASEYGRALFGNKSVTTMMDTCPLTVEAETPLRDFMQATLAERASELLRGFIVTRDGAYAGVGTTLSILKAMNDDLQDSLLQQREMVSDLIRLSAESERHQSFLNTIIDNIPAMVLVKDAHSRVKLINPAGEDMLGVKRSDVVGKTSHDIFPAEQADTFTRSDRRVLASGEAVMIEEEAIYNGVRQRTVQLKKTVLRGPDGAPDSILTLGIDLTEQKAAEARIAQLAHYDPLTGLGNRTLYTHEIEQALSRVQRHGHHLALHCLDLDRFKTVNDSFGHLAGDALLRQVGERLRLCVRKGDFIARMGGDEFAIIQNIERPEDARCLAERVIEVMKSPFDINGIRLEAGVSVGIALAPEDAADANNLLSRADLALYRVKSEGRNGWCFYHAEMDAVVQQRLEMEHELRTALSEQQFQLHFQPLLNLDSGEVVSFEALLRWHHPHRGMVSPGEFIPVAEDSGLIGPIGDWVLREACRQAAQWPTPWRIAVNISPLQFRDGSLPRLVKDALKASGLDPRRLELEITESVLLADEKHNLKILNTVRDMGVRIAMDDFGTGYSSLSYLRAFPFDKIKIDQSFVRDLPHDQNALSIIRAISDMAEALGVHITAEGVETEAQMEALKAMNCREAQGYLIGRPAAAIEAYAAVKVA
>NC_014817.1|WP_013480608.1|857557_857746_+|hypothetical-protein
MSLLSLVAVLIVVGVLLWLVNTYIPMDPKIKNILNAVVVIGVVIWLLQVFGLLGSLSNIRVG
>NC_014817.1|WP_013480609.1|857888_858242_-|glyoxalase/bleomycin-resistance/dioxygenase-family-protein
MGVTGIGGFFFRAKDPKALAAWYAEHLGVGAGPYGHWDTQAGPSVFSPFAADTDYFAADRQWMLNLRAEGLDDLCAALRAAGIEVITQADWDMPGVGRFARIHDPEGNAIELWEPAG
>NC_014817.1|WP_013480610.1|858412_859405_-|LLM-class-flavin-dependent-oxidoreductase
MVPFSILDLSQVGEGSRVADAFANTARMARQAEALGYHRYWLAEHHGMPGVASSATAVAIAHVGHHTSTIRIGSGGIMLPNHAPLVIAEQFGTLEALFPGRVDLGLGRAPGTDMRTARALRRHMDSGVDSFPYDVAELRRLMDDPDGSEPILAVPGYGAKVPIWVLGSSTYGAQLAAQMGLPYAFASHFAPDLLHQALRLYRQQYRPSVDHPHPKAMVGIMGVAADTDEEAQYLFTSMRQAFAALRRNERKPFPAPVRGLQLSPEETQMVEHMLQYAVVGSPQTIERKLENFLAATEADELIISMPIHDVEARLRSVEIFSQLPLMQRVA
>NC_014817.1|WP_144004789.1|860300_861839_+|exopolysaccharide-biosynthesis-polyprenyl-glycosylphosphotransferase
MPPTTPDRVTGETALRVQGLSQGRTAEAAADHRRGPFRPERLVPLRERRANEAYAYLFRFSDLLLIAGVSLFVAQGLSSQGWQEALAADILPLLVAAVSLCWSLKSFDLYVYRRQERLSGHLLRVLAAVTLSLIAGFGTAGLSGRADLLIPVFGLWAVGVWLGLGSLHGASFGLVARWRRKGLLTPNIVIVGATRDAKILIEAALERRDVNILGIFDDRLSRAPGDVCGVPVLGDTEALLSHKITPYVDRVVVAVDPSARARVEGLIRRLSLLPNAVSLLVDVDSEAGRKTALDRLSEQSLSANGVGPSDTHRTLHKRLQDVVIGTLALLIFAPVMVVVAVLIKLDSPGPIFFRQRRHGMNNEVINVWKFRSMRTEAADPTAARQVSRDDDRVTRVGRFIRKTSLDELPQLFNVLRGDMSLVGPRPHAIGMKTGDANSAKLVAEYAWRHRIKPGMTGWAAIKGSRGALENAEDVRRRVQLDIDYIERQSFWFDLYIMAMTVPCILGDRHAVR
>NC_014817.1|WP_013480612.1|861844_863308_+|lipopolysaccharide-biosynthesis-protein
MFWKGLWGYLPANVLQGLIGFATLITFTRLLSPDDYGRYALAFGVSSLAQTLCFTWIEAAMARFYPSESRENPEAPALYGTLYRLFAAVTVVFAVVCAAGLWLWPAPDAHTQALKLAIGCGLGVVVFRSLIKMVQEQRRSEGRVGTASTLDIIQTVGGFGLGALLAWAGLGGGAPLLAAGIVAAACLPFVAREDWGRARKGRFDAARARQYAHYGLPVSASLILTLALYTVDRFLIAGFLSEAEAGAYHAGYSLASRILDVLFLWFGAAGGPALVHALESGGPDVLKAHARDQFRVMALVLFPAVGGLIAVEAPLAQLLIGEGLRAQALSVTALISVGALLSGFNTYYFLQAFTLSKKTKLLTVAMAIPAIANVGLNLWLIPLYGLWGAGLATALSFGIGLVGSWALGRRAIALPVPWRDLMLTAAATVVMVLCVRLIPAFGGIGELVLKGVTGVVVYAVLALALNLNDVRAHSQRFLKRFGLGSAA
>NC_014817.1|WP_013480613.1|863304_864222_+|glycosyltransferase-family-2-protein
MTATVVTNAAREAAPPPRLSVLIPFYKESPATLLRALTPTPGVEIVLLDDGSGQAELTQEVMSTIDEVALPATFLSLTHNEGRARGRNRLTQAARGDYFLCLDSDMLPDAPDFLTRWLEVMDDNPAVVFGGFSLLQAPMDKRFAIHRMMAAKSDCLNAATRALMSEKYVFTSNLLIRRDVFATQDFDSSFTGWGWEDVEWAMRVAQQFGVQHIDNPATHLGLDTADTLMRKYEQSVGNFARVVDKHPQVVATYASYRAARLIRKLPLRGALRATLRGVIRNEALPLKARAFGLRLYRAALYSEVV
>NC_014817.1|WP_013480614.1|864221_864989_+|polysaccharide-deacetylase-family-protein
MNYAEAYAADRSLYGKLRRRASKLLFRKPAQLKGLTKPLLTFSFDDAPQSAAIAGAGILERHGYRATYFISAGLMGQDSHFGPYTTAAQIAALNARGHEIACHTLMHIDCGQAKGADIALSVDKNQKLIQSLGMPTSTTFAYPYGDVSPQAKAVLGDRYRSSRALHHGLIRSGSDLNQAPAIGIEGDAGQRLALEWMAQALKTPQSWLVLYTHDVRENPSPWGCTPETLETLATAAQTLGFEVVTYAEGARRAGG
>NC_014817.1|WP_013480615.1|865198_866500_-|O-antigen-ligase-family-protein
MVGDILPGIQEDWDGQWLSFGLAVFILFMFSQGWVSPVFGYSTEQSPMAGAIIRNIYYPVYLCALALLILTWKSVLVGLIHTPLLITLILLCGASYLWSVDPSATLRRFVAFAMTCLAGYVIAARFSWRKLIEVIAVTYLILIAGSFVMAIVFPDKGRMTELFVGAWRGVFAEKNNLGAVMDVGFLACLAAGIQVAKRRWLWFAAAGGAAFLVLMSTSKTSLLALILGAGMMAFVWLSRRGPLLGVFLTWVAVCVLLAVGSFVTLMPEQLFHLLGKDATLTGRTNIWAGIDFVMHKQPVTGYGYGVVWSTEGEWTPLRWITEVAGFRAYHAHSCWYEVWLALGYVGLTVWALVFIETWLKAFYRTYRGDGGYFALPFITVYSLMSLTESIAIGWNDIRWCLIVLIVVKLALPGDGPVIAAPVAPVRPRRGLYD
>NC_014817.1|WP_013480616.1|866499_867216_-|hypothetical-protein
MVDLTREMADLMAALRGGSQAAESGRGRALLFVSACGREGVSTMAREYARCEAAFAKRPVWLVDSDLRQQTQLEAVLEEPTRFGPPGPVSSASPDGSVFFALSPKALDPQGQPVPDSHYLIARPFLDKRMWVTRIRDHLLLPGQKARLFEQSSYWQALRTHAQAIVVDAPAFDRSDAVLKLAPLMDGVVLVVSEGEGEIDARVALKTEIEQVGGRLLGMVYNKSRSAAPPARRKVARA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_014816

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NC_014817

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection