CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NC_014934	Cellulophaga algicola DSM 14237, complete sequence	2 crisprs	DEDDh,cas3,RT	3	3	5	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_014934_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_014934_1

331520-331672

Orphan

Consensus_repeat	Method
CAAAATGAAGGCTATCGCCTTCTCACTTTTTTGATTCCAATCGTTTACAAAAAC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_014934_1

>merge|NC_014934|1|331520-331672|CRISPRCasFinder
CAAAATGAAGGCTATCGCCTTCTCACTTTTTTGATTCCAATCGTTTACAAAAACAATAGCTGGATTTGCAGAATCCTAATAAACCCTCAGTGCAAATGACAAAGTGAAGGCTATCGCCTTCTCACTTTTTTGATTCCAATCGTTTACAAAAAC

>NC_014934|1|1|331520-331672|CRISPRCasFinder
CAAAATGAAGGCTATCGCCTTCTCACTTTTTTGATTCCAATCGTTTACAAAAAC	AATAGCTGGATTTGCAGAATCCTAATAAACCCTCAGTGCAAATGA
CAAAGTGAAGGCTATCGCCTTCTCACTTTTTTGATTCCAATCGTTTACAAAAAC

Protein	Signature genes	Signature genes Name	Protein_function
NC_014934.1\|WP_013549133.1\|319407_320577_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|213701
NC_014934.1\|WP_013549146.1\|337133_337580_-\|DUF5606-domain-containing-protein	unknown	unknown	gnl\|CDD\|375774
NC_014934.1\|WP_013549142.1\|332625_334242_+\|family-20-glycosylhydrolase	unknown	unknown	gnl\|CDD\|119336
NC_014934.1\|WP_013549138.1\|326007_326997_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226609
NC_014934.1\|WP_013549140.1\|328786_329878_-\|endo-1,4-beta-xylanase	unknown	unknown	gnl\|CDD\|366032
NC_014934.1\|WP_013549150.1\|339749_340457_+\|phosphocholine-cytidylyltransferase-family-protein	unknown	unknown	gnl\|CDD\|133014
NC_014934.1\|WP_013549137.1\|324563_325694_-\|alkaline-phosphatase	unknown	unknown	gnl\|CDD\|293736
NC_014934.1\|WP_148229728.1\|320995_323188_-\|carbohydrate-binding-family-9-domain-containing-protein	unknown	unknown	gnl\|CDD\|187676
NC_014934.1\|WP_041557886.1\|317181_318336_-\|endo-1,4-beta-xylanase	unknown	unknown	gnl\|CDD\|366032
NC_014934.1\|WP_148229729.1\|327104_328742_-\|family-43-glycosylhydrolase	unknown	unknown	gnl\|CDD\|350129
NC_014934.1\|WP_013549148.1\|338231_338642_-\|Holliday-junction-resolvase-RuvX	unknown	unknown	gnl\|CDD\|234639
NC_014934.1\|WP_013549145.1\|335811_336903_-\|PAS-domain-containing-sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|223715
NC_014934.1\|WP_013549130.1\|315163_317065_+\|SulP-family-inorganic-anion-transporter	unknown	unknown	gnl\|CDD\|223732
NC_014934.1\|WP_013549141.1\|331967_332606_+\|lipolytic-protein-G-D-S-L-family	unknown	unknown	gnl\|CDD\|239946
NC_014934.1\|WP_041557887.1\|318464_319397_-\|SMP-30/gluconolactonase/LRE-family-protein	unknown	unknown	gnl\|CDD\|225921
NC_014934.1\|WP_013549147.1\|337636_338227_-\|peptide-deformylase	unknown	unknown	gnl\|CDD\|234668
NC_014934.1\|WP_013549144.1\|335419_335812_-\|response-regulator	unknown	unknown	gnl\|CDD\|381099
NC_014934.1\|WP_013549143.1\|334269_335400_+\|lactonase-family-protein	unknown	unknown	gnl\|CDD\|378416
NC_014934.1\|WP_052303966.1\|323378_324080_-\|ThuA-domain-containing-protein	unknown	unknown	gnl\|CDD\|377643
NC_014934.1\|WP_013549149.1\|338745_339561_+\|2,3,4,5-tetrahydropyridine-2,6-dicarboxylate-N-succinyltransferase	unknown	unknown	gnl\|CDD\|236996

Protein	Function_ID	Function_description	E-value
NC_014934.1\|WP_013549133.1\|319407_320577_-\|hypothetical-protein	gnl\|CDD\|213701	TIGR02336, hypothetical_protein_BL1641, 1,3-beta-galactosyl-N-acetylhexosamine phosphorylase. Members of this family are found in phylogenetically diverse bacteria, including Clostridium perfringens (in the Firmicutes), Bifidobacterium longum and Propionibacterium acnes (in the Actinobacteria), and Vibrio vulnificus (in the Proteobacteria), most of which occur as mammalian pathogens or commensals. The nominal activity, 1,3-beta-galactosyl-N-acetylhexosamine phosphorylase (EC 2.4.1.211), varies somewhat from instance to instance in relative rates for closely related substrates. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0.00162238
NC_014934.1\|WP_013549146.1\|337133_337580_-\|DUF5606-domain-containing-protein	gnl\|CDD\|375774	pfam18347, DUF5606, Domain of unknown function (DUF5606). This is a domain of unknown function found at the N-terminal region of bacterial proteins.	6.22106e-22
NC_014934.1\|WP_013549142.1\|332625_334242_+\|family-20-glycosylhydrolase	gnl\|CDD\|119336	cd06568, GH20_SpHex_like, A subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the N-acetylhexosaminidase from Streptomyces plicatus (SpHex). SpHex catalyzes the hydrolysis of N-acetyl-beta-hexosaminides. An Asp residue within the active site plays a critical role in substrate-assisted catalysis by orienting the 2-acetamido group and stabilizing the transition state. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself. Proteins belonging to this subgroup lack the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases.	0
NC_014934.1\|WP_013549138.1\|326007_326997_-\|hypothetical-protein	gnl\|CDD\|226609	COG4124, ManB, Beta-mannanase [Carbohydrate transport and metabolism].	0.00197998
NC_014934.1\|WP_013549140.1\|328786_329878_-\|endo-1,4-beta-xylanase	gnl\|CDD\|366032	pfam00331, Glyco_hydro_10, Glycosyl hydrolase family 10.	3.17719e-103
NC_014934.1\|WP_013549150.1\|339749_340457_+\|phosphocholine-cytidylyltransferase-family-protein	gnl\|CDD\|133014	cd02523, PC_cytidylyltransferase, Phosphocholine cytidylyltransferases catalyze the synthesis of CDP-choline. This family contains proteins similar to prokaryotic phosphocholine (P-cho) cytidylyltransferases. Phosphocholine (PC) cytidylyltransferases catalyze the transfer of a cytidine monophosphate from CTP to phosphocholine to form CDP-choline. PC is the most abundant phospholipid in eukaryotic membranes and it is also important in prokaryotic membranes. For pathogenic prokaryotes, the cell surface PC facilitates the interaction with host surface and induces attachment and invasion. In addition cell wall PC serves as scaffold for a group of choline-binding proteins that are secreted from the cells. Phosphocholine (PC) cytidylyltransferase is a key enzyme in the prokaryotic choline metabolism pathway. It has been hypothesized to consist of a choline transport system, a choline kinase, CTP:phosphocholine cytidylyltransferase, and a choline phosphotransferase that transfers P-Cho from CDP-Cho to either lipoteichoic acid or lipopolysaccharide.	1.58889e-48
NC_014934.1\|WP_013549137.1\|324563_325694_-\|alkaline-phosphatase	gnl\|CDD\|293736	cd16012, ALP, Alkaline Phosphatase. Alkaline phosphatases are non-specific membrane-bound phosphomonoesterases that catalyze the hydrolysis reaction via a phosphoseryl intermediate to produce inorganic phosphate and the corresponding alcohol, optimally at high pH. Alkaline phosphatase exists as a dimer, each monomer binding 2 zinc atoms and one magnesium atom, which are essential for enzymatic activity. Mammalian alkaline phosphatase is divided into four isozymes depending upon the site of tissue expression. They are Intestinal ALP, Placental ALP, Germ cell ALP and tissue nonspecific alkaline phosphatase or liver/bone/kidney (L/B/K) ALP.	3.13385e-119
NC_014934.1\|WP_148229728.1\|320995_323188_-\|carbohydrate-binding-family-9-domain-containing-protein	gnl\|CDD\|187676	cd09618, CBM9_like_2, DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized subfamily are typically found at the N-terminus of longer proteins that lack additional annotation with domain footprints.	2.9151e-68
NC_014934.1\|WP_041557886.1\|317181_318336_-\|endo-1,4-beta-xylanase	gnl\|CDD\|366032	pfam00331, Glyco_hydro_10, Glycosyl hydrolase family 10.	9.41505e-108
NC_014934.1\|WP_148229729.1\|327104_328742_-\|family-43-glycosylhydrolase	gnl\|CDD\|350129	cd18617, GH43_XynB-like, Glycosyl hydrolase family 43, such as Bacteroides ovatus alpha-L-arabinofuranosidase (BoGH43, XynB). This glycosyl hydrolase family 43 (GH43) subgroup includes enzymes that have been characterized to have alpha-L-arabinofuranosidase (EC 3.2.1.55) and beta-1,4-xylosidase (beta-D-xylosidase;xylan 1,4-beta-xylosidase; EC 3.2.1.37) activities. Beta-1,4-xylosidases are part of an array of hemicellulases that are involved in the final breakdown of plant cell-wall whereby they degrade xylan. They hydrolyze beta-1,4 glycosidic bonds between two xylose units in short xylooligosaccharides. These are inverting enzymes (i.e. they invert the stereochemistry of the anomeric carbon atom of the substrate) that have an aspartate as the catalytic general base, a glutamate as the catalytic general acid and another aspartate that is responsible for pKa modulation and orienting the catalytic acid. Also included in this subfamily are Bacteroides ovatus alpha-L-arabinofuranosidases, BoGH43A and BoGH43B, both having a two-domain architecture, consisting of an N-terminal 5-bladed beta-propeller domain harboring the catalytic active site, and a C-terminal beta-sandwich domain. However, despite significant functional overlap between these two enzymes, BoGH43A and BoGH43B share just 41% sequence identity. The latter appears to be significantly less active on the same substrates, suggesting that these paralogs may play subtly different roles during the degradation of xyloglucans from different sources, or may function most optimally at different stages in the catabolism of xyloglucan oligosaccharides (XyGOs), for example before or after hydrolysis of certain side-chain moieties. It also includes Phanerochaete chrysosporium BKM-F-1767 Xyl, a bifunctional xylosidase/arabinofuranosidase. A common structural feature of GH43 enzymes is a 5-bladed beta-propeller domain that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.	1.15203e-168
NC_014934.1\|WP_013549148.1\|338231_338642_-\|Holliday-junction-resolvase-RuvX	gnl\|CDD\|234639	PRK00109, PRK00109, Holliday junction resolvase RuvX.	9.12722e-44
NC_014934.1\|WP_013549145.1\|335811_336903_-\|PAS-domain-containing-sensor-histidine-kinase	gnl\|CDD\|223715	COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms].	6.98065e-29
NC_014934.1\|WP_013549130.1\|315163_317065_+\|SulP-family-inorganic-anion-transporter	gnl\|CDD\|223732	COG0659, SUL1, Sulfate permease and related transporters (MFS superfamily) [Inorganic ion transport and metabolism].	2.21488e-79
NC_014934.1\|WP_013549141.1\|331967_332606_+\|lipolytic-protein-G-D-S-L-family	gnl\|CDD\|239946	cd04502, SGNH_hydrolase_like_7, Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.	1.59053e-67
NC_014934.1\|WP_041557887.1\|318464_319397_-\|SMP-30/gluconolactonase/LRE-family-protein	gnl\|CDD\|225921	COG3386, COG3386, Gluconolactonase [Carbohydrate transport and metabolism].	7.58779e-55
NC_014934.1\|WP_013549147.1\|337636_338227_-\|peptide-deformylase	gnl\|CDD\|234668	PRK00150, def, peptide deformylase; Reviewed.	4.16844e-77
NC_014934.1\|WP_013549144.1\|335419_335812_-\|response-regulator	gnl\|CDD\|381099	cd17546, REC_hyHK_CKI1_RcsC-like, phosphoacceptor receiver (REC) domain of hybrid sensor histidine kinases/response regulators similar to Arabidopsis thaliana CKI1 and Escherichia coli RcsC. This family is composed of hybrid sensor histidine kinases/response regulators that are sensor histidine kinases (HKs) fused with a REC domain, similar to the sensor histidine kinase CKI1 from Arabidopsis thaliana, which is involved in multi-step phosphorelay (MSP) signaling that mediates responses to a variety of important stimuli in plants. MSP involves a signal being transferred from HKs via histidine phosphotransfer proteins (AHP1-AHP5) to nuclear response regulators. The CKI1 REC domain specifically interacts with the downstream signaling protein AHP2, AHP3 and AHP5. The plant MSP system has evolved from the prokaryotic two-component system (TCS), which allows organisms to sense and respond to changes in environmental conditions. This family also includes bacterial hybrid sensor HKs such as Escherichia coli RcsC, which is a component of the Rcs signalling pathway that controls a variety of physiological functions like capsule synthesis, cell division, and motility. REC domains function as phosphorylation-mediated switches within response regulators, but some also transfer phosphoryl groups in multistep phosphorelays.	2.24482e-26
NC_014934.1\|WP_013549143.1\|334269_335400_+\|lactonase-family-protein	gnl\|CDD\|378416	pfam10282, Lactonase, Lactonase, 7-bladed beta-propeller. This entry contains bacterial 6-phosphogluconolactonases (6PGL)YbhE-type (EC:3.1.1.31) which hydrolyze 6-phosphogluconolactone to 6-phosphogluconate. The entry also contains the fungal muconate lactonising enzyme carboxy-cis,cis-muconate cyclase (EC:5.5.1.5) and muconate cycloisomerase (EC:5.5.1.1), which convert cis,cis-muconates to muconolactones and vice versa as part of the microbial beta-ketoadipate pathway. Structures of proteins in this family have revealed a 7-bladed beta-propeller fold.	2.8055e-130
NC_014934.1\|WP_052303966.1\|323378_324080_-\|ThuA-domain-containing-protein	gnl\|CDD\|377643	pfam06283, ThuA, Trehalose utilisation. This family consists of several bacterial ThuA like proteins. ThuA appears to be involved in utilisation of trehalose. The thuA and thuB genes form part of the trehalose/sucrose transport operon thuEFGKAB, which is located on the pSymB megaplasmid. The thuA and thuB genes are induced in vitro by trehalose but not by sucrose and the extent of its induction depends on the concentration of trehalose available in the medium.	2.97971e-73
NC_014934.1\|WP_013549149.1\|338745_339561_+\|2,3,4,5-tetrahydropyridine-2,6-dicarboxylate-N-succinyltransferase	gnl\|CDD\|236996	PRK11830, dapD, 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase; Provisional.	5.67965e-159

>NC_014934.1|WP_013549140.1|328786_329878_-|endo-1,4-beta-xylanase
MISKKHLFYSLCTCLMLSLFFSCGKKVLPIKTSLKNNAAFPIGTAIKIKTLLSDSELQALQINNFNSITSASDMKMNKVMPSEGVYYWGGVDSIVKYAKANNQRLFGHNLIWHSSTPKWVEEKASKDSLWMSKFMEDYIKTYVGRYKGKVAAWDVVNEGLESAGGAIRKTMWYNAIGKDYIAKAFTYAHEADPNAVLFYNDFNIERDTVKLNATLKLIKELRSQNVPISGIGFQMHTRMDIPDDIIAHALKEAVKTGLQIHLSEVDIIFNTHNDTRGGGIQLYDELTDEMKNKQAEKYKNLIKMYRSIVPEKQQYGITFWDFTDRDSWISGFFKMKDWPTIYDENLEPKPAYFSVLEGLNEKL
>NC_014934.1|WP_148229729.1|327104_328742_-|family-43-glycosylhydrolase
MTYCKNESHEKQQIKSQTSTYSNPILQGFYPDPSICKVNGDFYMVNSTFAYFPGIPIFKSSDLVNWKQIGNVLDRPEQLNLDGLDVSSGIFAPAINYHKGLYYLVCTLVGGENNFVVTAKNPEGPWSNPNWIPELSGIDPSLFFDKDGKSYIVYNSESPDNKPEYDGHRTIKIYEFDLETLKVVGSAQIVINKGAKPEDKPIWIEGPHIYQENGYYYLMAAEGGTSDEHSEVVFRSKNVKGPYVSYKDNPILTQRHLDANRENPVTSTGHADIIEDNNGNWWGVFLGCRPYDNEGHFNTGRETFMVPVKWKNDWPIFDLEGDIVKDNYKISLAKLATKTTSRNVDFKDEFNSNSLAFDWIFLRTPKEKWYSILNGKLKIHTRPETTSGASNPSFIGYRQKHLFGNVTTNLTFKPVSENEKAGLIAFQNEQHYYYLCKSLKDNKPVIQLLKSKEDTLELLIEKPLQLNTSIKLKIEAKGATYSFLFAEGENNWQLLKDTVDARFLSTKVAGGFVGTIYGMYSTSLGVTCENTAEYDWFETENLNKL
>NC_014934.1|WP_013549138.1|326007_326997_-|hypothetical-protein
MHKISLIVLLLFLQNGFSQEVIPRFNYNAKYEPEIGIYHGAGQDKNGFQDYVNAVGQSKMPAIYMTYVNITAPVKKIESWGKDLKHVLDSLPKGIMPQIGLGFTGGKDTGAGLDTDVADGKYDKQLQAFYKVLLDLDRPSFTRIGYEFEGDWNGYSPESFKKVFLIISKAFKEKNIKSATVWCSGGGSANFMSLEKLMAYYPGDQYVDWWGIDIFSPEEFDHIGLQNFFDSAHIHEKPVMIGESTPRYVGVLDGEISWDKWFNPFFEMLYDNPGIKAFCYINWDWIYWSNKIGFQWHDWKDARIEKNTFVLKAYKMKMENPIFIHLENK
>NC_014934.1|WP_013549137.1|324563_325694_-|alkaline-phosphatase
MIYRNSIFIALLVTLISCKSAVIKEELRPKAKNVILLIADGTGLSQVSSAFYFKKTKPNYARFKSIGLIKTSSATEDVTDSAAGATAFSTGEKTYNGAVGVAVDSSHLKTLVEILAPQHVKTGLIATSSIQHATPASFYAHVLHRSQYEDIALDLVTSDVDFLAGGGRQFLTKRKDGKNLLAELKVNGFEVDTTALGSFSEIKKHSKMAYLLAEEHMNAVAKGRGDFLPKATELGIEFLNKDAAKSGFFMMIEGSQVDWGGHSNDADYLISELIDFDDAVGKALDFAEKDGNTLVIVTADHETGGFTLASTPKEKEDGTTYDDYKEITGTFSTKGHSATLIPVFAFGPGSEAFNGIYENTGIFHKIFELTNWKNTK
>NC_014934.1|WP_052303966.1|323378_324080_-|ThuA-domain-containing-protein
MIKTSAQDQFSVLLFTQHDDWHYNSIPVAVQAFEEMATENQFIFDWTQRPNDLIEKLPAYDVVIFMNANANYLMPKHMIALKAFMKRGGGFLGIHGTADGENDNTWFDGLVGAKFVNHPKLQAAIVNVEDKDFSATWHLPKKWLRSDEWYNFENMNLDKLTILMTVDEASYDFTAGYDDIPLKGMGEKHPISWYQEYEGGRSFYTALGHKPESFKDKNFLDHIFGAIYWLKGD
>NC_014934.1|WP_148229728.1|320995_323188_-|carbohydrate-binding-family-9-domain-containing-protein
MLPILGFGQDGTNENDSKELIAHPLNDIELHLDGIVDEEFWLSIPGNDDFLMQEPKEGGQPTEQTKVRIAFDDQNIYIAVVCYDSNPSDIKAFQKKRDASLETDDNFGFIFDTFMDKRSAYFFEINPFGLRGDALISPGQSGTFNKDWDGIWKAWTHIGDFGWSAEIRIPFRSINFDSKNDAWGINFRRTIRRKNEELLWAGHRRNQGLFRPQNAGILTGLADPSQGLGLEIIPYAITQSSKEYDKDNDAATSSTSADLGFDINYNITSQLKASFTYNTDFAQAEVDNRQINLTRFSLRFPEQRDFFLEGSSILQFAPSSGVDPYFSRRIGLVNGMRVPIKYGGRIIGNVGKNNIALLHVRTGKMGELNPENFTIGRYRRNFWKESSIGVIYTHRSTEDDIVLSNPVQDRKTWGADLNLSTSEFLGNKRLQLSAFFVAHNPASPSDNFTSISDRSVRGFRLNFPNKPWSGNVSYREFGDEYDPAVGFNQRNGFKRLQPGIKYAPLFDKSKLIREIEWGIEYEYLTSLGNKPLTEYLGFNLGTIRFESGDKLGVQVSRSFEYLNEDFDILNDSSVVVPLGEYVNWGYEIEASSASFRKISGSIAYEAGGFWTGDISSLVLGLTIRPAPGINLSSGYTHTKVSAMNSGFNTNLFQLDLGLDFTPDISISSNIQFDDVSEVLGTNTRFRWIITPGTDIFFVYNHNWLNSETLARRLTTLQEVGVVKAIYTYRF
>NC_014934.1|WP_013549133.1|319407_320577_-|hypothetical-protein
MKRKIILLAISLICSLAVDAQNIVYVYGDVAADGTLPSGNKEPFHQMRLNDEGDLGMSGFKKALEAVECTVSEVYDQEIVINVEFLKSIDVLILGSNQRVFVEAEAKALKRWVKNGGGVITWSDSGFGGEYSIVGVDNEVGRISDNVLMEQFGMYFLTDNGAGNYLVNEYTQDHFINKNNKHKGVAFRGEGVSFVRVSKPAVILAKAQEGGLGGRLVVNSNDGEFNENTDVALAIAEIGKGRVIGVFDRNLFWNAGAGTRLSHSDNSVFAQRIVLWAAGIEDEQRFANDTNALVSAINTPPTITIDYTYSKTDNSLAITAVITDEDKDAISPEIMWEQVEGPANSVFENNNPNTTTPRIFMPQAGKYVFKARILDGEFEINKFLDYERK
>NC_014934.1|WP_041557887.1|318464_319397_-|SMP-30/gluconolactonase/LRE-family-protein
MNIKGKFFKTFSSFKNIILFIILCTSCNAQNKKSNQIIGNSAELVLISNNYEFTEGPATDKDGNVFFTDQPNDRILKWEAKTNLVSEYMKPSGRSNGLYFDNNGNLLSAADEKNELWRINPNKEVTVLVDNYDGKKLNGPNDLWVDAKGGIYFTDPYYQRSWWEHKEPQQHEKRVYYLAPNTSTPRVVSNDNYVQPNGIIGTPDGKTLYVADQAGEKTYVFTIEENGNLTNRKLFTDMGSDGMTIDNLGNVYLTGKGITVFNKKGEQIQHIAVPGDWTANVTFGGLNQTTLFITAMDSVYTLEMAVHGVR
>NC_014934.1|WP_041557886.1|317181_318336_-|endo-1,4-beta-xylanase
MGVLSLSFSVCNAQKVKTNTVSKTVTTTENIALKDAFKNYFLLGSAINDDIVSGKDVASNAIVKKEFNTVTPENCMKAEVVCPSPGVYDFKLADAYVAFAEENKMFIMGHTLIWHNQTPAWFFTNDKGEPNSPEEQKEQLRTHIKAVAGRYAGKVQAWDVVNEVFDNDGSYRPTTWVNSIGDGDEMVKLAFKYASEYAPNTELYYNDFNAWRPEKRDGIVRMVKMLQAEGIRIDGIGIQAHWGLNFPKNEYIQEAIDAYAALGVKVMITELDIDVLPLTKEGQIIGRSMMEPQFQLEEFETFLDPYKKGLPKSIEIELANRYKELFEIFVKNKDKIDRVTFWGIHDGMSWKNDYPVPNRTNYPLLYNRDFQPKLAKKSILEIVK
>NC_014934.1|WP_013549130.1|315163_317065_+|SulP-family-inorganic-anion-transporter
MKHIFSNLKGDLFGGITAGIVALPLALAFGVSSGMGPSAGLYGAIFISFFAALFGGTNTQISGPTAPMTAVSMVVISGIVALNDGSLEKALPAILLVFLLAGCMQIVLGLIGVGKYIRYIPYPVVSGFMTAIGVIILVTQLLPSVGYYPKEDVAFVENFKPQAEELILSSILSEERGEGILVLDNIQETVRRAHEVTDESILKEAKTLANSDASGVFGTIKVLPRALQNINWLELMLALSTILIIYGFKKITKTIPSALVALIVVSSVAYGFNLDYRPIEQIPGGFPIPNLKMFTQFELNSITPYVFTALTLALLGAIDSLLTSVVADNMTKTKHQPNKELIGQGVGNSIAAIFGGLPGAGATIRTVVNINAGGKTKLSGMFAGVLLLLILLALGPIASQIPAAVLAGILVTVGIGVMDYKGLKAIPFMPKDAKIGPFKFSSEVTIMLVVMVLSSVWNLVYAVGVGLIIASLMFMKKMGDLTAERSDVKSLEKEKGWADEANFPQNLKEEVFIKHLKGPLFFGSTSEFLNLSKQIPKNASTVIIRMGRMQYMDQSGLYTLEDVLIDLKKENINILFVNVLKQPRYMMERVNIIPHLIPEKHIFTNFTACILWVKNNVKNQSEISSSSKNSKII
>NC_014934.1|WP_013549141.1|331967_332606_+|lipolytic-protein-G-D-S-L-family
MKFLLLFIVPFYCLAQPNEFFKDEVAAITEKYDSIWDSSKETIIFTGSSSVRMWKSLERNFPEHQILNTGFGGSQTIDLLGYTEELILMYQPKKVFIYEGDNDISSKKKHKEILRNFSKIIKQIKKNDSTTKVVIISPKPSISRWKLKGKYRKLNRKLRRFCDENENLEFANVWDIMLHRKKIKSDLFISDGLHMNEKGYQLWHSIIKKYID
>NC_014934.1|WP_013549142.1|332625_334242_+|family-20-glycosylhydrolase
MKKKILAIKIALFALAIISLSCAEKKKKINLVFPETNLASENIIPKPSKIIATNSAFGLDKNTVIYTSQASNEFEAVGQFLSDKIEELTALKIPVNSTELETVDRVIYINQSDSLDLQVKESYQLYISKDSIIINSMTAEGAFRGVQTLRQIIPEKSNDTITDHAMWLVPSGKIIDSPNFEYRGAMLDVARHFFSVSEIKKYIDLLAYYKINQLHLHLTDDQGWRIEIKSWPKLTSVSGNTEVGGGKGGFYTQEEYSEIVAYATEHHMTIIPEVDMPGHTNAASVAYPILNGNGKTLKPYTGTHVGFSTFDAHKDTVYAFIDDVVREIAALTPGPYFHIGGDESHVTKKKDYILFVNRVEKIVQKHGKQMIGWDEIMQADVDSSSIAQHWNTKKNATDAAARGSKIIMSPATRAYLDMKYDDASIHGLDWAALIPVDTAYNWSPTTYIKELKKEDILGIEAPLWSETIANMAELEYLAFPRMIGYAELGWSTDENRNWEDFKIRLANQTPYLNRMNVNYYPSELIDWKKDTTNDTLKN
>NC_014934.1|WP_013549143.1|334269_335400_+|lactonase-family-protein
MKYYTIFLVLIMLASCKPEPKNVEEASDNNNEVPVTSFYVGTYTNKESKGIYSYSLTTEGKMNKIGLAAEATNPSYLALSPNKKYLLAVNEENQDNNGFVSAYEIKNDSLLFKNKVLSGGAHPCHISINKDNYLVVSNYTGGSVGLLQLNLEGYVSDVLDLQQHTGKGTTKRQEAPHAHSSWFDNDTFISADLGTNELWFSKIDTLNNKLEAIKPYKLAMEEGAGPRHLTVHPSKNYSYVFNELDNTITSLLKSGNGTYEKVQTISTIPEGFTGATKGADIHISDDGKFVYASNRGHDSIAIFSVNESDGRLNLVGYESCHGENPRNFSLSPDNNFLIVANQDTNNLVSFKRNSQTGLLTFVAEIEAPTPVCILFN
>NC_014934.1|WP_013549144.1|335419_335812_-|response-regulator
MNNQSNSVFRILLVEDDEITNYITTTKLKNLGFENVDAVLNGELAIEYLSANQPNLIFLDVNMPVMDGFEFLDSKAVKSLYSDIPIVMLTSSGRPKDKEVASNYENVIGYLEKPLNYEKIQNIFSTINKL
>NC_014934.1|WP_013549145.1|335811_336903_-|PAS-domain-containing-sensor-histidine-kinase
MAKIDGEYDKELRGAFFNMAYSPFVILNKDLNFVDINQAALNTIKIKREDFIGRNLLDFFPYLKENERYQLYKNVLVTGKSIGFDEVSFHTDNGVLKFMIKAFKIGDYLGMSTLDVTSLTNTIDQLKAAKINLQTVNDNLKRKNQELEEFSYVAAHDLRSPLTNIHSLLDMLQSDNSISEKGMPVFEKVQQVAKQMCDKLRALNSVIALKTTLDDKIEIINFSAIVSKVKSIHIEEIVQTRTIIKEDFVHAPTIDYNLKQMESILQNLISNAIKYRNPNRKSVIFIKTSLVQGKLVLTVKDNGLGFDKTTPPEKIFGLFKRMHTHVEGLGVGLYVTHSMITNNGGEISVKSELNKGTEFKIIF
>NC_014934.1|WP_013549146.1|337133_337580_-|DUF5606-domain-containing-protein
MSLDKILSIGGKPGLFKLLTQTRAGFVAESLLDGKKITVGFKNNVSVLSEIAIYTLDAEIPLREVFLKIQEKENGEKTPVSHKDDKLKLEEYFFEILPNYDEDRVYASDIKKVIQWYNMLQEQGISDFEAKEEVKEEAKEEIKEEEKN
>NC_014934.1|WP_013549147.1|337636_338227_-|peptide-deformylase
MILPIIAYGDPVLRKVGTDIAKDYPKLETLVENMWETMYNASGVGLAAPQIGLPIRLFVIDTTPFSEDEDLSPEDQKALDGFKKVFVNAKIEEETGEEWNFNEGCLSIPDVREDVNRKETIKITYLDENFNEKSESYGGLLARVIQHEYDHIEGILFTDKLSSLKKRLLKGKLSNISKGKISADYRMRFPDIKKGR
>NC_014934.1|WP_013549148.1|338231_338642_-|Holliday-junction-resolvase-RuvX
MARIVALDYGKVRTGIAVTDELQLIASGLTTVATKELIDFLKNYVATEKVELLVVGEPKQMNNQVSESEALILPFIEKLKASFPTIKIERQDERFTSKMAFQTMIDSGLKKKQRRDKALVDEISATIILQAYLNRI
>NC_014934.1|WP_013549149.1|338745_339561_+|2,3,4,5-tetrahydropyridine-2,6-dicarboxylate-N-succinyltransferase
MTELREQIEKAWDNRDLLKEENTQTAIRSVIDLLDEGKLRCAEPTTDGWQINEWVKKAVVLYFPIQKMETLEAGIFEYHDKMPLKRGYKEKGIRVVPGATARHGAYISAGTILMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAAPVIIEDNVFVGSRCIVVEGVRVEREAVLGANVVLTASTKIIDVTGDTPVERKGLVPARSVVIPGSYTKKFPAGEYNVPCALIIGTRKESTNKKTSLNDALREYDVAV
>NC_014934.1|WP_013549150.1|339749_340457_+|phosphocholine-cytidylyltransferase-family-protein
MKIVILAAGIGSRLGNPFPKPLTPLVNGKSIMQMQLDNINTYYSVEDINVVVGFKKDLIMERFPNLSYTYNPSFNKTNTSKSLLKVLTKFRDTSVLWMNGDVVFDEKLFDVLNPFIQKKQSFIAVNTSKVADEEVKYTLENGFVKELSKTVKGGLGEAVGINYIASKDINSFITRLEECDQNDYFERGLEISIEKDDLKMCAVDISEYNCIEIDFQEDLDTANKLHKEVAFTVGL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_014934_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_014934_2

2727891-2728277

Orphan

Consensus_repeat	Method
TGATNNNGGNNNNCAAGGNATTCAAGGAGAAACNGGTNNNNNNGG	CRT

5 spacers

The CRISPR arrays of NC_014934_2

>merge|NC_014934|2|2727891-2728277|CRT
TGATACTGGCGCTCAAGGAGTTCAAGGAGAAACTGGTCCACAAGGAATTAAAGGAGATCAAGGTGATCAGGGAATCCAAGGTATTCAAGGAGAAACTGGTGATACTGGCGCTCAAGGTATTCAAGGCGAAACAGGTGACACTGGCGCTCAAGGTATTCAGGGAGAAACGGGTCCACAAGGATTAAAAGGAGATCAAGGTGATCAGGGAATCCAAGGTATTCAAGGAGAAACTGGTGATACTGGTGCTCAAGGAGTTCAAGGAGATCAAGGTGATCAGGGAATCCAAGGTATTCAAGGAGAAACTGGTGATACTGGTGCTCAAGGAGTTCAAGGAGATCAAGGTGATCAGGGAATCCAAGGAATCCAAGGCGAAACAGGAGATACTGG

>NC_014934|2|1|2727891-2728277|CRT
TGATACTGGCGCTCAAGGAGTTCAAGGAGAAACTGGTCCACAAGG	AATTAAAGGAGATCAAGG
TGATCAGGGAATCCAAGGTATTCAAGGAGAAACTGGTGATACTGG	CGCTCAAGGTATTCAAGGCGAAACAGG
TGACACTGGCGCTCAAGGTATTCAGGGAGAAACGGGTCCACAAGG	ATTAAAAGGAGATCAAGG
TGATCAGGGAATCCAAGGTATTCAAGGAGAAACTGGTGATACTGG	TGCTCAAGGAGTTCAAGGAGATCAAGG
TGATCAGGGAATCCAAGGTATTCAAGGAGAAACTGGTGATACTGG	TGCTCAAGGAGTTCAAGGAGATCAAGG
TGATCAGGGAATCCAAGGAATCCAAGGCGAAACAGGAGATACTGG

Protein	Signature genes	Signature genes Name	Protein_function
NC_014934.1\|WP_013551163.1\|2738378_2740577_-\|carbohydrate-binding-family-9-domain-containing-protein	unknown	unknown	gnl\|CDD\|187676
NC_014934.1\|WP_013551148.1\|2711174_2713112_+\|OmpA-family-protein	unknown	unknown	gnl\|CDD\|143586
NC_014934.1\|WP_013551155.1\|2732010_2732964_+\|type-IX-secretion-system-membrane-protein-PorP/SprF	unknown	unknown	gnl\|CDD\|371704
NC_014934.1\|WP_013551151.1\|2721256_2722603_+\|hypothetical-protein	unknown	unknown	unknown
NC_014934.1\|WP_013551143.1\|2699486_2703785_+\|DNA-directed-RNA-polymerase-subunit-beta'	unknown	unknown	gnl\|CDD\|234794
NC_014934.1\|WP_013551162.1\|2737549_2738368_-\|Cof-type-HAD-IIB-family-hydrolase	unknown	unknown	gnl\|CDD\|319818
NC_014934.1\|WP_013551144.1\|2703799_2704105_+\|DUF3467-domain-containing-protein	unknown	unknown	gnl\|CDD\|371814
NC_014934.1\|WP_013551150.1\|2717998_2720905_+\|thrombospondin-type-3-repeat-containing-protein	unknown	unknown	gnl\|CDD\|275366
NC_014934.1\|WP_013551145.1\|2704161_2705751_-\|peptide-chain-release-factor-3	unknown	unknown	gnl\|CDD\|179105
NC_014934.1\|WP_013551154.1\|2729990_2732009_+\|gliding-motility-associated-C-terminal-domain-containing-protein	unknown	unknown	gnl\|CDD\|372639
NC_014934.1\|WP_041558124.1\|2734096_2735059_+\|class-I-mannose-6-phosphate-isomerase	unknown	unknown	gnl\|CDD\|224399
NC_014934.1\|WP_013551157.1\|2733644_2734061_+\|6-carboxytetrahydropterin-synthase	unknown	unknown	gnl\|CDD\|376501
NC_014934.1\|WP_013551161.1\|2736261_2737524_-\|DUF819-family-protein	unknown	unknown	gnl\|CDD\|114410
NC_014934.1\|WP_013551149.1\|2713381_2717872_+\|right-handed-parallel-beta-helix-repeat-containing-protein	unknown	unknown	gnl\|CDD\|367364
NC_014934.1\|WP_013551147.1\|2710214_2711165_+\|type-IX-secretion-system-membrane-protein-PorP/SprF	unknown	unknown	gnl\|CDD\|371704
NC_014934.1\|WP_041557714.1\|2735466_2736174_-\|DUF4369-domain-containing-protein	unknown	unknown	gnl\|CDD\|379543
NC_014934.1\|WP_013551146.1\|2706169_2710177_+\|tandem-95-repeat-protein	unknown	unknown	gnl\|CDD\|372639
NC_014934.1\|WP_013551159.1\|2735124_2735394_+\|hypothetical-protein	unknown	unknown	unknown
NC_014934.1\|WP_013551142.1\|2695611_2699421_+\|DNA-directed-RNA-polymerase-subunit-beta	unknown	unknown	gnl\|CDD\|234749
NC_014934.1\|WP_013551156.1\|2733114_2733648_+\|isopentenyl-diphosphate-Delta-isomerase	unknown	unknown	gnl\|CDD\|239218

Protein	Function_ID	Function_description	E-value
NC_014934.1\|WP_013551163.1\|2738378_2740577_-\|carbohydrate-binding-family-9-domain-containing-protein	gnl\|CDD\|187676	cd09618, CBM9_like_2, DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized subfamily are typically found at the N-terminus of longer proteins that lack additional annotation with domain footprints.	4.66417e-64
NC_014934.1\|WP_013551148.1\|2711174_2713112_+\|OmpA-family-protein	gnl\|CDD\|143586	cd07185, OmpA_C-like, Peptidoglycan binding domains similar to the C-terminal domain of outer-membrane protein OmpA. OmpA-like domains (named after the C-terminal domain of Escherichia coli OmpA protein) have been shown to non-covalently associate with peptidoglycan, a network of glycan chains composed of disaccharides, which are crosslinked via short peptide bridges. Well-studied members of this family include the Escherichia coli outer membrane protein OmpA, the Escherichia coli lipoprotein PAL, Neisseria meningitdis RmpM, which interact with the outer membrane, as well as the Escherichia coli motor protein MotB, and the Vibrio flagellar motor proteins PomB and MotY, which interact with the inner membrane.	3.27836e-33
NC_014934.1\|WP_013551155.1\|2732010_2732964_+\|type-IX-secretion-system-membrane-protein-PorP/SprF	gnl\|CDD\|371704	pfam11751, PorP_SprF, Type IX secretion system membrane protein PorP/SprF. This entry describes a protein family unique to, and greatly expanded in, the Bacteriodetes. Species in this lineage include several, such as Cytophaga hutchinsonii and Cytophaga johnsonae (Flavobacterium johnsoniae), that exhibit a poorly understood rapid gliding phenotype. Several members of this protein family are found in operons with other genes whose loss leads to a loss of the rapid gliding phenotype.	1.58538e-105
NC_014934.1\|WP_013551161.1\|2736261_2737524_-\|DUF819-family-protein	gnl\|CDD\|114410	pfam05684, DUF819, Protein of unknown function (DUF819). This family contains proteins of unknown function from archaeal, bacterial and plant species.	3.52162e-66
NC_014934.1\|WP_013551143.1\|2699486_2703785_+\|DNA-directed-RNA-polymerase-subunit-beta'	gnl\|CDD\|234794	PRK00566, PRK00566, DNA-directed RNA polymerase subunit beta'; Provisional.	0
NC_014934.1\|WP_013551162.1\|2737549_2738368_-\|Cof-type-HAD-IIB-family-hydrolase	gnl\|CDD\|319818	cd07516, HAD_Pase, phosphatase, similar to Escherichia coli Cof and Thermotoga maritima TM0651; belongs to the haloacid dehalogenase-like superfamily. Escherichia coli Cof is involved in the hydrolysis of HMP-PP (4-amino-2-methyl-5-hydroxymethylpyrimidine pyrophosphate, an intermediate in thiamin biosynthesis), Cof also has phosphatase activity against the coenzymes pyridoxal phosphate (PLP) and FMN. Thermotoga maritima TM0651 acts as a phosphatase with a phosphorylated carbohydrate molecule as a possible substrate. Escherichia coli YbhA is also a member of this family and catalyzes the dephosphorylation of PLP, YbhA can also hydrolyze erythrose-4-phosphate and fructose-1,6-bis-phosphate. Members of this family belong to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	6.25332e-58
NC_014934.1\|WP_013551144.1\|2703799_2704105_+\|DUF3467-domain-containing-protein	gnl\|CDD\|371814	pfam11950, DUF3467, Protein of unknown function (DUF3467). This family of proteins are functionally uncharacterized. This protein is found in bacteria, archaea and viruses. Proteins in this family are typically between 101 to 118 amino acids in length.	4.77895e-34
NC_014934.1\|WP_013551150.1\|2717998_2720905_+\|thrombospondin-type-3-repeat-containing-protein	gnl\|CDD\|275366	sd00002, TSP3, Calcium-binding Thrombospondin type 3 (TSP3) repeat. TSP3 repeats of the vertebrate thrombospondin (TSP)-1,-2,-3,-4 and TSP-5/also known as COMP (cartilage oligomeric matrix protein), and related proteins. These short aspartate-rich repeats are a continuous series of calcium binding sites that can be divided into two sequence motifs: N-type and C-type. N-type and C-type motifs are distinguished by their sequence length, calcium ion binding, and their interactions with water molecules. C-type motifs are higher affinity binding sites compared to N-type motifs.	0.000302426
NC_014934.1\|WP_013551145.1\|2704161_2705751_-\|peptide-chain-release-factor-3	gnl\|CDD\|179105	PRK00741, prfC, peptide chain release factor 3; Provisional.	0
NC_014934.1\|WP_013551154.1\|2729990_2732009_+\|gliding-motility-associated-C-terminal-domain-containing-protein	gnl\|CDD\|372639	pfam13585, CHU_C, C-terminal domain of CHU protein family. The function of this C-terminal domain is not known; there are several conserved tryptophan and asparagine residues.	1.77618e-28
NC_014934.1\|WP_041558124.1\|2734096_2735059_+\|class-I-mannose-6-phosphate-isomerase	gnl\|CDD\|224399	COG1482, ManA, Phosphomannose isomerase [Carbohydrate transport and metabolism].	7.18247e-85
NC_014934.1\|WP_013551157.1\|2733644_2734061_+\|6-carboxytetrahydropterin-synthase	gnl\|CDD\|376501	pfam01242, PTPS, 6-pyruvoyl tetrahydropterin synthase. 6-Pyruvoyl tetrahydrobiopterin synthase catalyzes the conversion of dihydroneopterin triphosphate to 6-pyruvoyl tetrahydropterin, the second of three enzymatic steps in the synthesis of tetrahydrobiopterin from GTP. The functional enzyme is a hexamer of identical subunits.	9.52007e-42
NC_014934.1\|WP_013551149.1\|2713381_2717872_+\|right-handed-parallel-beta-helix-repeat-containing-protein	gnl\|CDD\|367364	pfam03160, Calx-beta, Calx-beta domain.	8.59748e-12
NC_014934.1\|WP_013551147.1\|2710214_2711165_+\|type-IX-secretion-system-membrane-protein-PorP/SprF	gnl\|CDD\|371704	pfam11751, PorP_SprF, Type IX secretion system membrane protein PorP/SprF. This entry describes a protein family unique to, and greatly expanded in, the Bacteriodetes. Species in this lineage include several, such as Cytophaga hutchinsonii and Cytophaga johnsonae (Flavobacterium johnsoniae), that exhibit a poorly understood rapid gliding phenotype. Several members of this protein family are found in operons with other genes whose loss leads to a loss of the rapid gliding phenotype.	1.1033e-104
NC_014934.1\|WP_013551146.1\|2706169_2710177_+\|tandem-95-repeat-protein	gnl\|CDD\|372639	pfam13585, CHU_C, C-terminal domain of CHU protein family. The function of this C-terminal domain is not known; there are several conserved tryptophan and asparagine residues.	2.62807e-25
NC_014934.1\|WP_041557714.1\|2735466_2736174_-\|DUF4369-domain-containing-protein	gnl\|CDD\|379543	pfam14289, DUF4369, Domain of unknown function (DUF4369). This domain family is found in bacteria, and is approximately 110 amino acids in length. The family is found in association with pfam00578.	3.15251e-17
NC_014934.1\|WP_013551142.1\|2695611_2699421_+\|DNA-directed-RNA-polymerase-subunit-beta	gnl\|CDD\|234749	PRK00405, rpoB, DNA-directed RNA polymerase subunit beta; Reviewed.	0
NC_014934.1\|WP_013551156.1\|2733114_2733648_+\|isopentenyl-diphosphate-Delta-isomerase	gnl\|CDD\|239218	cd02885, IPP_Isomerase, Isopentenyl diphosphate (IPP) isomerase, a member of the Nudix hydrolase superfamily, is a key enzyme in the isoprenoid biosynthetic pathway. Isoprenoids comprise a large family of natural products including sterols, carotenoids, dolichols and prenylated proteins. These compounds are synthesized from two precursors: isopentenyl diphosphate (IPP) and dimethylallyl diphosphate (DMAPP). IPP isomerase catalyzes the interconversion of IPP and DMAPP by a stereoselective antarafacial transposition of hydrogen. The enzyme requires one Mn2+ or Mg2+ ion in its active site to fold into an active conformation and also contains the Nudix motif, a highly conserved 23-residue block (GX5EX7REUXEEXGU, where U = I, L or V), that functions as a metal binding and catalytic site. The metal binding site is present within the active site and plays structural and catalytical roles. IPP isomerase is well represented in several bacteria, archaebacteria and eukaryotes, including fungi, mammals and plants. Despite sequence variations (mainly at the N-terminus), the core structure is highly conserved.	2.1592e-83

>NC_014934.1|WP_013551151.1|2721256_2722603_+|hypothetical-protein
MSVTPTTECLDSDNDGVPDVFDLDSDNDGIYDAVEAGHNQAHTDGVVTGAVGTDGVPDNVQNDPNRETVNYTLSDSDLDTIPDVLEFDSDNDGCNDSDEAYGAKDTDSDANGFYGSGQPNVDVNGRITAATYPEPNDGDSNTVYDYKEKKQAPIIADKNNTTIQACYSTDVTLINSALYADTFQWQLLNGSNWIDISDSTKYSGTGTNTLDIINVTLTENGNQYRLIASHSSTICDEDSSGVTTLNVNDEMDAPVSGGDQSYCSGDSIPQLSANVPSDETVDWYANLSGGTALLESSLSYTPAGAGTYYAEARSTTFVGCTSTTRTPITLTEESPSVVTIGADQVVFVGDNAIFTATASNSDTFHWEVSTDGGITFNSVAESSEYTGTQTVTLTVVSARALQNGYRFRFVASTAGSSCGTTNSSSAVLTVKVKTVITNRRITYRVKKN
>NC_014934.1|WP_013551150.1|2717998_2720905_+|thrombospondin-type-3-repeat-containing-protein
MNIKTFPLYIKLGIGILFLLVFFNSKAETTFTKSVGSYEPCTDPTGVDTDGDGINDVCDLDNDNDGILDEDECFRSSSLVGNGDFTSWIFYTDANNPGWTGSGNQWNKDADRAWFPQWNGTGTASFYQTINVSSGSENSITFDVGANTSYNNQVVLNVLIDGATVLSETSNQIAVTNGGQSQNGNATLNMVSRTIVFTPTSSTIVLRFNGVSTSGNHDMMYIDNVILTTGCSDFDNDGVLNIHDLDSDNDGIYDTVEAGHNQTHSNGVLIGDVGTDGIPNSVQSSPNNGTVNYTVLNSENEGNKDFIDLDSDGDGCNDVIESGFTQNSTKSGELQGSGYNATTGKVTGNLDGYTTPIDNNSNNIYDYREAGTIPIITTQPQDKFVSEGSNVIYMVATSASDNTYEWQISTNDGVTFSSISGANGASYSINGVSNSQDKNLYRVLVSDSSFKCTPAISSAAILRIVLDSDNDGVVDTDDRDDDNDGILDAIEATNCGPGAATVNVVIFSEDFGIASGSRISTPYTNYIFENGSNDLQDGYYTIFEDISSTASWAPSLWQSRGDHTSGSDRMAIFNANNTAGREFYRRTLVQVEPDVPLDISFWVMNLDVDQDNNDGRIEPDITALIQQNGATVFSFESGSIPREANGSADAWKNFIGSFTPTSTTALELVLINNAPGGLGNDLALDDIQIVQSFCDSDNNGIPNTLEADSDGDGCTDSDEAYANRDADLDNNGKYGSGAPIVNSDGTVVAASYQTPHDGNLNGIYDYAEAYTVVAITQQPLNQYTIIGDDAIFSVTATGGTSGNLDYQWQQSLDDGATFTNISGATSSSYTVSNVSTADHKKQFRVLVYDSAYICTDEYSNEVILFVDEDTDADGILNILDFDDDNDGILDVDEGCGNLIINSSFEQQDFTDPATFPDGFTDGSGTFIGATYNTNELAGWNYTTNLDGWVGGGSPSWTPDVYAPAYHGN
>NC_014934.1|WP_013551149.1|2713381_2717872_+|right-handed-parallel-beta-helix-repeat-containing-protein
MTLFKHIIFYILLLFSGMISAQETFRDNFSTVSYSNNNGSSNFSTDWIETGDNDNGPTSQYLRISSNRLELYYIWSENIRRSANLDGASIAVLSFNWQAISLGGSRVLGIQVSNNGGVSYTTIGTIGDNNSGTFSQDISGFISATTTVRFARSGNNWRNDDYAYIDNFLITATYPAPIPILEINDVTVDEDSGNAVFTVSHTGSNAAAPFTVNYQTVNGSAIDGSDYTGSTSVLSFNGTVGDTETITIPILDDGTIENPENFTIEFTLTSDPTADITDTAIGTIIDDDALIMTDGGSATTCSDTFFDPGGLSNYSNNQDVTYTICPDTADTYLNINFTSFEVVTGDILYVYDGNSTGAALIGQYDSANVPTSINSSAASGCLTFRFVSNGSNTGAGWEAEINCFPDGPIIIIEDISFDEDVGNAVFTVRSTRAAHGRNVFLFGFVEAPFTVDFQSVDGLALAGSDYTAVSGTLTFTGELNNIQTISVPIGNDGVPEFAEDFDIEFTGATAQYATVNYNDKGKGTINSQILANDPLTLFQEFDGYYDYSTTGGTLRTSPNGGSPCAVTTSSSNSLVSPVPGTAVVERAYLYWSHSSTVRDADVTFEGQSVSANFLYQTSLGNRNFFGYVSDVTTIVKGVSDLSNNVFDFEDLTINNTGEYCTTSTVLGGWALMVFYEDRSLPAVNINLYQGFDGLSNDGNSFTLDSFYAISGEGAKASFLSWEGDPDLDGSSSGSTNPEELSITNQRNQNFILTGDGGQTGNNSYNSTIYDNTVGPPVYNNANMYGVDLDTYDISSFIQPADSEVTANVDVGQDFVISAAVVLKVPSNLIAGRVFEDVNYPGGIGRDQVISGGIGMSGTIVELFDSSGVFIQRKNTEANGNYSFGGMADGDYFIKVVSSTVRSTRGNGPNCSSCYPTQTYRTEMVSGSIVDVTDEVGGANPKATQDVSLGVFNNAQSISSVEVAGNGVVGINFGFNFNTIVNTNETGQGSLQQFILNSNTLSETGLDIEANSIFDPAAEEDTSIFMIPPTGDALGRAADANYAAGIFDVLISNGNSLSEITGTNTVLDGRTQTAYSGDSNSGTIGAGGTAVGTSATALPDYIRPEIQIHRDNGDVLSASGTDVVIRNVAVYGNNNAGIIINGGAVTISNSLLGVNALGSAAGNIDYGIEIKNGVAIIDSNYISSNTDAGVFVDGGTSTLIQNNHFDANGATGCDDNILLADGSGILIHQNLIDNSAALGIDGEAISGGVVITENTITNAGQNGGNCSGKIENAGIRLHGSDSAIENNIIATNAGSGIVISGGTTSGNLISQNSIFANGTTADALGIDLDATDSLGDGVTLNDSGDGDSGPNGLLNFPIISNAFVSGSNLVIEGWSRPGATIEVFLTDINEGSASAGENQLGLATDYGEGQIYLATVIEGSSVDLLTITTPYTDVDGNTDNTNKFRFVIAGPLNIAVGNFITSTATISNSTSEFSPFSIIKNYTLITNRRITYRVKSN
>NC_014934.1|WP_013551148.1|2711174_2713112_+|OmpA-family-protein
MLRKILYTVVLLLVSIGSLSAQDKSLERANAKYDEFSFTPAIDIYKKVLDKGFVSAELLKKLGNSYYFNAEYKDASEIYGRLVTEYPTEVTPDYYFRYAQTLRSLGEYEAADDLMKKFSDMTSGDYRANNFTTERDYRKEIKENSGRYSIGPFESNTVYSEFAPSYYKEGLLFSSDRDTGNLAKYRHTWNSKDFLDIYKINVDSVSMSKVVKMDKAINTRFHESTTVATKDGKTIYFTRNNFKEGKSVKDDNGVIRLKIFRAVMEDSIFAYIEELPFNSDSYSVAHPALSPDEKTLYFASDMPGTLGESDIFKVTINDDETFGTPENLGNTINTEARETFPFVTSEEILYFSSEGHPGLGGLDVFATKIKDNNYTGIVKNVGEPINGKLDDFTFIFDEDTKTGYFASNRESGLGNDDIYSFVENIPLELDCKQPVSGVVRDKISNQVLVGATVKVINEDNVEILQILTDANGYYEILIDCDQGNFIRAMTDGYIPSEEYMGESDGKPQVIDFYLERDKIGAGFGDDLAKLLQLSTIYFDLNKYNIRPDAEVEIQKVIAAMEKYPSLKIKVNSHTDSRGKDAYNLWLSQKRAESTVGYMVSKGISADRLEGEGFGETKLVNGCGNNSKCSSKEHDLNRRSEFIIRE
>NC_014934.1|WP_013551147.1|2710214_2711165_+|type-IX-secretion-system-membrane-protein-PorP/SprF
MNKLIFLVPLVLASLFFQSSQAQQDAQYTQYMFNTMSVNPAYAGSRGQLSIGALYRSQWVGLDGSPTTQTLNLHSPIRNSRLGYGVSIVNDEIGNGTVQETYLDGVISYTIDVSQTGKLSFGLKAGGNLLNLDFNKLRNFDSETVTGDNIENKFSPNFGLGLYYHTDKFYLGLSAPNILETDHFDNSARDANSVAFLSTERINFYAITGYVFDLSSDFKFKPALLTKVVGGAPLQIDLSANFMYNEKFTFGAAYRWDAAVSAMAGFQISDQFMVGLAYDKETTELGSTRFNDGSFEVFLRFELTRSFQKLVSPRFF
>NC_014934.1|WP_013551146.1|2706169_2710177_+|tandem-95-repeat-protein
MDIFTLINKYRKLLRFSYKFFLFLFVFTALSSFSGYSKGLDFAVYFVDSDRDKIIDTKDLDSDNDGILDTVEGYSSYGSRDTDGDGIPDYLDIDSDNDGILDNVEAQTTAGFIPALGVDKDMNGLDDAYEHCPKQGLTPVDTDGDGIPDYLDIDSDNDGILDNVEAQNDASYNPKSGLDANGNGLDDQYENYYGTGLTPIDTDGDKAPDYRDLDADNDGILDNVEAQVSSAYTAPCGVDSDGNGLDDHYENSPGSGEGITPIDTDGDGTPDFRDLDSDNDGCSDTMEAGFIDALLFENRDSRLGNVSPPRVNAMGKVISGENGEGYTTPLDSNANGILDFRESAYTDACNKMITVVDDTATTEENIPVVIDVLDNDSNIPSDGTLTVTTPENGVVVINDGGTPDDISDDTITYTPNDGFTGEDDFEYTICDTLGNCETGTVTIEVTTPSTLIDVVDDTATTEENTPVVIDVLDNDSNIPSDGTLTVTIPENGIVVINDGGTPDDISDDTITYTPNDGFTGEDDFEYTICDTLGNCETGTVTIEVTTPSTLIDVVDDTATTEENTPVVIDVLDNDSNIPSDGTLTVTTPENGVVVINDGGTPDDISDDTITYTPNDGFTGEDDFEYTICDTLGNCETGTVTITVAAPVILDVVDDTATTEENTPVVIDVLDNDSNIPSDGTLTVTTPENGVVVINDGGTPNDISDDTITYTPNDGFTGEDDFEYTICDTLGNCESGTVTIEVTTPSTLIDVVDDTATTEENTPVVIDVLDNDSNIPSDGTLTVTTPENGVVVINDGGTPDDISDDTITYTPNDGFTGEDDFEYTICDTLGNCETGTVTIEVTTPSTLIDVVDDTATTEENTPVVIDVLDNDSNIPSDGTLTVTTPENGVVVINDGGTPDDISDDTITYTPNDGFTGEDDFEYTICDTLGNCETGTVTITVAAPVILDVVDDSAITDENTPVVIDVLDNDSNIPSDGTLTVTTSENGVVVINDGGTPDDISDDTITYTPNDGFTGEDDFEYTICDTLGNCDTGTVTITVTAPVILDVVDDSAITDENTPVVIDVLDNDSNIPSDGTLTVTTPENGIVVINDGGTPDDISDDTITYTPNDGFTGEDDFEYTICDTLGNCDTGTVTITVAAYDVIDAVDDIYETTTSGGTLEGNILDNDLLNGEQVSISEVEITSTPTGPLMVNTDGTVTVDTDTAPGTYTIAYTICEIAVPTNCDTATVTVIIENDYQKIEVNQMVTPNGDGKNDFLFIRNVEFALNNTLKIFNRWGISVYEGEGYNNQNNVFDGRSRGRSTFSKDEYLPSGVYFYIFDYQDVNGKAITDSAYIYISK
>NC_014934.1|WP_013551145.1|2704161_2705751_-|peptide-chain-release-factor-3
MSFEKEIQRRRTFGIISHPDAGKTTLTEKLLLFGGAIQEAGAVKNNKIKKGATSDFMEIERQRGISVATSVLAFIYRDKKINILDTPGHKDFAEDTFRTLTAVDSVIVVIDVAKGVEEQTKKLVEVCRMRKIPIIVFINKMDREGKDAFDLLDEVEQQLGLRVTPLSFPIGMGYDFKGIYNIYEKNINLFSGDNKRNIEDVIAFDTINNPELEKIIGTKAATDLRENLELVHGVYPEFDREEYLAGNLQPVFFGSALNNFGVRELLDCFVDIAPTPRPKMAEERLVKANEKGFTGFVFKIHANMDPKHRDRLAFIKIVSGTFERNTPYLHVRHNKKLKFSSPNAFFAEKKEIVDISYPGDIVGLHDTGNFKIGDTLTEGENLHYKGIPSFSPEHFRYINNADPLKSKQLFKGIDQLMDEGVAQLFTLELNGRKVIGTVGALQYEVIQYRLEHEYGAKCTYENFPVYKACWVAPKDPKNDEFKEFKRVKQKFLAKDKRGQLVFLADSQFSLQMTQQKYPSVILKFTSEFE
>NC_014934.1|WP_013551144.1|2703799_2704105_+|DUF3467-domain-containing-protein
MSDQNQKQINIELDEKTAEGIYSNLAIINHSVSEFVVDFISMMPGAPKAKVKSRIVLTPQHAKKFLKALNDNVKRFESAHGTIKDYEQPPIPMNFGPTGEA
>NC_014934.1|WP_013551143.1|2699486_2703785_+|DNA-directed-RNA-polymerase-subunit-beta'
MARQRDNNTIKRFDKISIGLASPESILAESRGEVLKPETINYRTHKPERDGLFCERIFGPVKDYECACGKYKRIRYRGIVCDRCGVEVTEKKVRRDRVGHINLVVPVAHIWYFRSLPNKIGYLLGLPSKKLDMIIYYERYVVIQPGIAKGPEGEEINKMDFLTEEEYLNILESVPVENQYLEDSDPNKFIAKMGAECLIDILARIDLDVLSYELRHKANTETSKQRKTEALKRLQVVESLRESQENRENRPEWMIMKVIPVIPPELRPLVPLDGGRFATSDLNDLYRRVIIRNNRLKRLVEIKAPEVILRNEKRMLQESVDSLFDNTRKASAVKTESNRPLKSLSDSLKGKQGRFRQNLLGKRVDYSARSVIVVGPELRLFECGIPKDMAAELYKPFVIRKLIERGIVKTVKSAKKIIDKKEPVVWDILENVLKGHPVLLNRAPTLHRLGIQAFQPKLIEGKAIRLHPLVCTAFNADFDGDQMAVHLPLGPEAILECQLLMLASHNILNPANGSPITVPSQDMVLGLYYMTKERKSTPEVPVKGEGLIFYSAEEVVIAHNEGMVDLNAGVKVRAKNFNEAGELVYQIIPTTVGRVLFNRMVPEKAGYINEVLNKKSLRDIIGGILEATDVPTTADFLDKIKTMGYEFAFKGGLSFSLGDIIIPPEKHEMIADANGQVEGIMANYNMGLITNNERYNQVIDVWTSTNSQLTELAMKRIREDQQGFNSVYMMLDSGARGSKEQIRQLTGMRGLMAKPKKSTAGGGEIIENPILSNFKEGLSILEYFISTHGARKGLADTALKTADAGYLTRRLVDVSQDVIINTEDCGTLRGIEVEALKKNEEIVETLGERILGRVSLHDVYNPLTEELILKAGQEILEVDVRLVEASPVDKIEVRSALTCEAEKGICGKCYGRNLSTNKMVQRGEAVGVVAAQSIGEPGTQLTLRTFHVGGIAGNISEDNKLSAKFGGVAEIEDLRTVTSTDNEGNPSEIVISRTSEIKVVDAKSGIVLSTNNIPYGSQLFVKNGSKVAKDEVICQWDPYNGVIVSEFPGKIAYENVDQGVTYQVEIDEQTGFQEKVISESRNKKLIPTLLIMNSKDEVLRSYNLPVGSHIMVDNGEKIKEGKILVKIPRKSAKSGDITGGLPRVTELFEARNPSNPAVVSEIDGVVSFGKIKRGNREIIIESKLGEVKKYLVKLSNQILVQENDYVRAGMPLSDGSITPEDILKIKGPSAVQQYLVNEVQEVYRLQGVKINDKHFEVVVRQMMRKVRIQDPGDTIFLENQLAHKDDFITENDGIFAKKVVVEVGESDTLKAGQIITPRQLRDENSVLRRNDKALVEARDAIAATATPILQGITRASLQTKSFISAASFQETTKVLNEAAVAGKIDDLEGLKENVIVGHKIPAGTGMRDYDSIIVGSKEEYDEIMARKEEFKF
>NC_014934.1|WP_013551142.1|2695611_2699421_+|DNA-directed-RNA-polymerase-subunit-beta
MVTNQTERINFASAKNIPNYPDFLDIQVKSFQDFFQLETKSDERGDEGLYNTFQENFPITDTRNQFVLEFLDYFIDPPRYSIQECIERGLTHSVPLKARLKLYCTDPEHEDFETIVQDVYLGTIPYMTPSGTFVINGAERVVVSQLHRSPGVFFGQSFHANGTKLYSARVIPFKGSWIEFATDINGVMYAYIDRKKKLPVTTLFRAIGFESDKDILEIFDLSEEVKVSVAGLKKVLGRKLAARVLNTWHEDFVDEDTGEVVSIERNEIVLDRDTILEKEHIEQIVDADVKTVLLHKESAAQSDYGIIHNTLQKDPTNSEKEAVEHIYRQLRNAEPPDEETARGIIDKLFFSDQRYNLGEVGRYRMNKKLGLDIGMDKQVLTKEDIITIIKYLIELINSKAEIDDIDHLSNRRVRTVGEQLSQQFGVGLARMARTIRERMNVRDNEVFTPIDLINAKTLSSVINSFFGTNQLSQFMDQTNPLAEITHKRRLSALGPGGLSRERAGFEVRDVHYTHYGRLCPIETPEGPNIGLISSLAVFSKVNSMGFLETPYRKVENGKVDIQNFGYLSAEEEEGMKIAQANIPMDEEGNITAEKVIAREEGDFPVVDPSEIQYTDVAPNQIASISASLIPFLEHDDANRALMGSNMMRQAVPLLKPQAPIVGTGLERQVASDSRVLINAEGDGVIQYVDSLMITIKYDRTEEERLVSFEDDSKTYELVKFRKTNQGTSINLKPIVRKGDKVRKGQVLCEGYATENGELALGRNLKVAFMPWKGYNFEDAIVISEKVVREDIFTSIHVDEYSLEVRDTKLGAEELTNDIPNVSEEATKDLDENGMIRIGAEVKPGDILIGKITPKGESDPTPEEKLLRAIFGDKAGDVKDASLKASPSLRGVVIDKKLFSRSVKDKRKRSEDKEAISNLELEYEVKFQQLKDVLIEKLFNLVNGKTSQGVLNDLGEEVLPKGKKYTMKMLNAVDDFAHLVGGLWTTDKDNNNLVTDLLHNYKIKLNDLQGNLRRDKFTISVGDELPAGIMKLAKVYVAKKRKLKVGDKMAGRHGNKGIVSRIVRHEDMPFLEDGTPVDIVLNPLGVPSRMNIGQIYETVLGWAGLKLGKKYATPIFDGASLDQINAYTDEAGIPRFGHTYLYDGGTGQRFDQPATVGVIYMLKLGHMVDDKMHARSIGPYSLITQQPLGGKAQFGGQRFGEMEVWALEAYGASATLREILTVKSDDVVGRAKTYEAIVKGETMPEPGLPESFNVLMHELKGLGLDIRLEE
>NC_014934.1|WP_013551154.1|2729990_2732009_+|gliding-motility-associated-C-terminal-domain-containing-protein
MKAINTYKFLFAILIGLLCSNWASAQFLLQAPNSTDENNYKWYNASDTSTVLSTDFFYEVSQPGVFFATYDGTACGKNATSYFILTDCESPNNEVTLDITANVPVGASISWSPALTGDQIAPQITATKDVIKYLATLVKAGNAKNLPSFTVVCMSQAANLVDDVATVDEDATVDISIFDNDTELPVAGTLTTSDPINGTISIDDNGTPNNPSDDIVTYIPDPDFNGQDTFTYTICNTFGDCSTATVTVDVLPIVDTFDDVVTTEENMPISIDNWSANDNDLPTVGTLTITVPTNGAVVVDGNGTPNDPFDDIITYTPNTDFSGTDSFDYTVCDTLGNCSTATITVITTDQVDLDSDDDGILDAWEDLNTDNDNNPATNPTDSDGDGIADYLDIDSDDDGIPDNVEAQTTSDYIAPSGEDANNNGLDDAYEQEGNLGIIPVNTDFEDLPDYLDDDSDNDNVPDYIEAHDHDHDGIPDVVFIGSDKDNDGLDDGFEGNTTIDIDVNDEVNDPWADLPNTDGDDESDYRDPDDDDDGIFTADEDVNLDGNYANDDTDGNGIPNYLDPDLVVSGGEEVEVFNVVTPNGDGVHDYLTITGLENFPNNTIKIYNRWGVLVFVTKAYNTQGNVFTGSSNGRVTVQKDNMLPVGTYFYILDYANATNDMKSKSGYIYINR
>NC_014934.1|WP_013551155.1|2732010_2732964_+|type-IX-secretion-system-membrane-protein-PorP/SprF
MKTLNLNTSYCKWIFGVLCLVGLLNTTSVIAQQDAQYTQYMYNTISVNPGYAGSRGNLSVGLLHRSQWLGLDGAPTTQTFNMHSPIGYRGVGLGLSIVNDKIGPTSETNFDVDFSYTIPVSVAAKISFGLKGSVNLLDIRYSELNQYASDQSLQQDISNRLSPNVGAGVYYHTDKFYAGLSVPRILETSHFDESSLSTAKEQMNFYFITGYVWDLNPNLKFKPTLLTKLVRGAPLQVDASANFMLSDKFILGAAYRWSAAVSGMAGFYVSEGFLIGIAYDRETTDLGNTSFNDGSFEIVLRYDFIKTKGNMKSPRFF
>NC_014934.1|WP_013551156.1|2733114_2733648_+|isopentenyl-diphosphate-Delta-isomerase
MKEEHVILVNQSDEQIGTMPKMEAHEKAVLHRAFSVFVMNKKGETMLQQRAAHKYHSPLLWTNTCCSHQRVGETNIEAGKRRLQEEMGFETDLKELFSFIYKAPFDNGLTEHELDHVMVGYFDNPPEINPEEVADWKWMLPEDVKNDIAANPDHYTAWFKIIFEKFYSYITQHKFES
>NC_014934.1|WP_013551157.1|2733644_2734061_+|6-carboxytetrahydropterin-synthase
MKVKVSRKAHFNAAHRLYNPDWSFEKNDTIFGLCNNPNFHGHNYELIVSVTGKIDPETGFVIDVKILKDLIKSEIEDAFDHKNLNVEVPEFKNLNPTAENIAVVIYDKLRPHITSDKDLEVVLYETPRNFVTYRGDNE
>NC_014934.1|WP_041558124.1|2734096_2735059_+|class-I-mannose-6-phosphate-isomerase
MYPLKFNPILKERLWGGTKLGDIFDKPIENDITGESWEISTVKGDISVVSNGELSGKSLQDLIDTNAEEVLGKSVVSRFGKEFPILIKFIDAKQDLSIQLHPNDELAKKRHNSFGKTEMWYIMDADEGADLIVGFNKDVTKEEYQKSIENDKLLDLLNYEKVKEGDTFFINTGKIHAIGAGVVLAEIQQTSDVTYRVFDFNRKDKDGNLRELHTEMALDAMDYTKKDDFKVAYDTTTDTVNEMVDCPYFKTNYINLTKNLKQDISSRDSFTIYMCVSGEAIVANEFGEATVKKGETVLVSANSKSIELKSKRATLLEVTI
>NC_014934.1|WP_013551159.1|2735124_2735394_+|hypothetical-protein
MASIQDLKKDINYVLGDIIEAVYFWEASNGKKSSKEGSALIDDAISVFDELIAKVNMKSVENRSKHLNGVKSELEEKATVLVEKLNKLG
>NC_014934.1|WP_041557714.1|2735466_2736174_-|DUF4369-domain-containing-protein
MKNIFLLSVVGLFLISCSGDSKNSMTINGSIKGLKKGTLYLQQLQDTILVNLDSLEIKGHGDFSFNTPIANPDIYYLYLVKNDHNDINDRITFFGEPGIITVDTAWDTFDTSVKISGSKTNEKLEEYKKGMSRYNAKNLEILQMRFDPKVNKDSIALDSLVKLSDKNIYRSYAYALNFALNNKDSYIAPYIAIKEVADANVKYLDSIHKMLTPEVAASKYGKELKKYLEEIKKDK
>NC_014934.1|WP_013551161.1|2736261_2737524_-|DUF819-family-protein
MNEILITNDAVVFGLLALCLGFIFYTSSLTTGFWSKFYNIVPAVLMCYLLPAILASCHIISDDISQLYFMASRYLLPAALVLMTLSIDLKAISNLGSKALIMFLTGSVGIIIGGPIAILLVSIFSPETVGGNDFDAIWRGLSTIAGSWIGGGANQAAMLEIFKYNPDEYGKMVLVDIVVANVWMAVILFGVGKTKAIDKWLKADTSAIETLKVKVSAFTAKITRVPTLNDYMMMLCFAFTAVGVSHYFGDNISEYLTKNSSAVADPSNFLSFLGSNFFWMVVIATASGILLSFTKAKNYEGAGASKIGSIFIYILVATIGMKMDLTKILENPGLLVVGFIWITIHALLLILVAKLIKAPYFFLAVGSQANVGGAASAPVVAAEFHSSLTSVGVLLAVFGYVVGTGGALLCAYLMELASKM
>NC_014934.1|WP_013551162.1|2737549_2738368_-|Cof-type-HAD-IIB-family-hydrolase
MKYKILCSDLDGTLLSTKSDVSEVTISEIKRIKDAVKIYLVSARMPKSMTYLQKDLGIENQPIVCYNGALILHGNTILDSVTIPLRLLKELYSHTEKHAIKLGLYYADEWYVEETSERVQKEIKYTKATPEFRPTPATFQDWRSRKVDGAHKVMLMGTKDSCDAIFPELESRYGDAIATYRSNDTLIEIAPKSVTKLSAIKTLLKADEDLADVIAFGDNYNDMDMLQYVGCGVAVGNARNEVKNISNYIAEENTAHGVAKFIKEHLCDSLYL
>NC_014934.1|WP_013551163.1|2738378_2740577_-|carbohydrate-binding-family-9-domain-containing-protein
MFKFSLYCLFFLITLSVLAQNEDKQINIKYIPEIPQIDGILDERVWEKAESATKFQQYFPSDTILAQKDTDIRMFYDGTHLYVGIRLETTGSNYVTPSLKRDFSAGGNDNISLLFDTFNDGTNAFLFGINPFGVIREALISNGGGSDGGFNTSWDVKWKGEARSFENYYTAELAIPLTSFKFKEGETKWRFNSYRFDTQNNETSTWAKIPQNQSIYSLAFMGEMTFEKPLGKYRTPIAIIPYVNTLAQKNFETNASRTNLKFGGDAKVAIGNGMNLDITLNPDFSNVEVDNVFTNLTRFEVSLPEKRQFFVDNSDLFSSFGGSQDANPFFSRRIGIARDKDNNSIENKIIGGFRLSGKLSKDWRLGFLNLQTAEDLENEIPSNNNSMFALQRKVFSRSNIGLFFINREAFKSYDFVAPEDRYNRVLGIDYNLASADNTWNGKFYIHKSFQHDSDSKDISTGAYMSYNSRKFNVFSDWVYIGDDFRSDLGFIRRTNIFKFVTGFERVFWPTASKINSHSFEVFPIFTLNPELDFKTTDYTVRASWGAEFVNQTEFNFSVDTNYTYLVNGFDPSRTKDAIALPANSEYTYATAAINFSSDSRKAYSYSLEQSYGNFFNGTRSSSAAEMTLRLQPKAAISFLVSYDKITLPAPYSSADFWLVSPSFEFTFSKSIFWSTLVQYSNQRNNLGFNSRVQWRFAPLSDLFIVYNDNYIVNNFEPRNRSINLKFTYWLNI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NC_014934_1	1.1\|331574\|45\|NC_014934\|CRISPRCasFinder	331574-331618	45	NC_014934.1	331278-331322	0	1.0
NC_014934_2	2.3\|2728071\|18\|NC_014934\|CRT	2728071-2728088	18	NC_014934.1	2728341-2728358	0	1.0
NC_014934_2	2.3\|2728071\|18\|NC_014934\|CRT	2728071-2728088	18	NC_014934.1	2728440-2728457	0	1.0
NC_014934_2	2.3\|2728071\|18\|NC_014934\|CRT	2728071-2728088	18	NC_014934.1	2728647-2728664	0	1.0
NC_014934_2	2.3\|2728071\|18\|NC_014934\|CRT	2728071-2728088	18	NC_014934.1	2728990-2729007	0	1.0
NC_014934_2	2.3\|2728071\|18\|NC_014934\|CRT	2728071-2728088	18	NC_014934.1	2729188-2729205	0	1.0
NC_014934_2	2.1\|2727936\|18\|NC_014934\|CRT	2727936-2727953	18	NC_014934.1	2727837-2727854	1	0.944
NC_014934_2	2.1\|2727936\|18\|NC_014934\|CRT	2727936-2727953	18	NC_014934.1	2728548-2728565	1	0.944
NC_014934_2	2.1\|2727936\|18\|NC_014934\|CRT	2727936-2727953	18	NC_014934.1	2728746-2728763	1	0.944
NC_014934_2	2.1\|2727936\|18\|NC_014934\|CRT	2727936-2727953	18	NC_014934.1	2728800-2728817	1	0.944
NC_014934_2	2.1\|2727936\|18\|NC_014934\|CRT	2727936-2727953	18	NC_014934.1	2728891-2728908	1	0.944
NC_014934_2	2.1\|2727936\|18\|NC_014934\|CRT	2727936-2727953	18	NC_014934.1	2729089-2729106	1	0.944

1. spacer 1.1|331574|45|NC_014934|CRISPRCasFinder matches to position: 331278-331322, mismatch: 0, identity: 1.0

aatagctggatttgcagaatcctaataaaccctcagtgcaaatga	CRISPR spacer
aatagctggatttgcagaatcctaataaaccctcagtgcaaatga	Protospacer
*********************************************

2. spacer 2.3|2728071|18|NC_014934|CRT matches to position: 2728341-2728358, mismatch: 0, identity: 1.0

attaaaaggagatcaagg	CRISPR spacer
attaaaaggagatcaagg	Protospacer
******************

3. spacer 2.3|2728071|18|NC_014934|CRT matches to position: 2728440-2728457, mismatch: 0, identity: 1.0

attaaaaggagatcaagg	CRISPR spacer
attaaaaggagatcaagg	Protospacer
******************

4. spacer 2.3|2728071|18|NC_014934|CRT matches to position: 2728647-2728664, mismatch: 0, identity: 1.0

attaaaaggagatcaagg	CRISPR spacer
attaaaaggagatcaagg	Protospacer
******************

5. spacer 2.3|2728071|18|NC_014934|CRT matches to position: 2728990-2729007, mismatch: 0, identity: 1.0

attaaaaggagatcaagg	CRISPR spacer
attaaaaggagatcaagg	Protospacer
******************

6. spacer 2.3|2728071|18|NC_014934|CRT matches to position: 2729188-2729205, mismatch: 0, identity: 1.0

attaaaaggagatcaagg	CRISPR spacer
attaaaaggagatcaagg	Protospacer
******************

7. spacer 2.1|2727936|18|NC_014934|CRT matches to position: 2727837-2727854, mismatch: 1, identity: 0.944

aattaaaggagatcaagg	CRISPR spacer
aataaaaggagatcaagg	Protospacer
*** **************

8. spacer 2.1|2727936|18|NC_014934|CRT matches to position: 2728548-2728565, mismatch: 1, identity: 0.944

aattaaaggagatcaagg	CRISPR spacer
aataaaaggagatcaagg	Protospacer
*** **************

9. spacer 2.1|2727936|18|NC_014934|CRT matches to position: 2728746-2728763, mismatch: 1, identity: 0.944

aattaaaggagatcaagg	CRISPR spacer
aataaaaggagatcaagg	Protospacer
*** **************

10. spacer 2.1|2727936|18|NC_014934|CRT matches to position: 2728800-2728817, mismatch: 1, identity: 0.944

aattaaaggagatcaagg	CRISPR spacer
aataaaaggagatcaagg	Protospacer
*** **************

11. spacer 2.1|2727936|18|NC_014934|CRT matches to position: 2728891-2728908, mismatch: 1, identity: 0.944

aattaaaggagatcaagg	CRISPR spacer
aataaaaggagatcaagg	Protospacer
*** **************

12. spacer 2.1|2727936|18|NC_014934|CRT matches to position: 2729089-2729106, mismatch: 1, identity: 0.944

aattaaaggagatcaagg	CRISPR spacer
aataaaaggagatcaagg	Protospacer
*** **************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_014934_2	2.2\|2727999\|27\|NC_014934\|CRT	2727999-2728025	27	NC_014792	Enterobacteria phage vB_EcoM-VR7, complete genome	108259-108285	3	0.889
NC_014934_2	2.2\|2727999\|27\|NC_014934\|CRT	2727999-2728025	27	KP007359	Enterobacteria phage vB_EcoM_VR5, complete genome	108105-108131	3	0.889
NC_014934_2	2.2\|2727999\|27\|NC_014934\|CRT	2727999-2728025	27	NC_006823	Aromatoleum aromaticum EbN1 plasmid 1, complete sequence	124997-125023	4	0.852
NC_014934_2	2.2\|2727999\|27\|NC_014934\|CRT	2727999-2728025	27	KC821615	Cellulophaga phage phi12:3, complete genome	26580-26606	4	0.852
NC_014934_2	2.2\|2727999\|27\|NC_014934\|CRT	2727999-2728025	27	NC_021791	Cellulophaga phage phi12:1, complete genome	26577-26603	4	0.852
NC_014934_2	2.2\|2727999\|27\|NC_014934\|CRT	2727999-2728025	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	168991-169017	4	0.852
NC_014934_2	2.2\|2727999\|27\|NC_014934\|CRT	2727999-2728025	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2749-2775	4	0.852
NC_014934_2	2.2\|2727999\|27\|NC_014934\|CRT	2727999-2728025	27	GU936714	Synechococcus phage S-CBS2, complete genome	39559-39585	4	0.852
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	274834-274860	4	0.852
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	274888-274914	4	0.852
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	274996-275022	4	0.852
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	274780-274806	4	0.852
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	NZ_CP035092	Paracoccus denitrificans strain ATCC 19367 plasmid unnamed1, complete sequence	221968-221994	4	0.852
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	NC_008688	Paracoccus denitrificans PD1222 plasmid 1, complete sequence	469316-469342	4	0.852
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	AF246223	Mycoplasma virus P1, complete genome	8327-8353	4	0.852
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	NC_002515	Mycoplasma phage P1, complete genome	8327-8353	4	0.852
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	274834-274860	4	0.852
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	274888-274914	4	0.852
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	274996-275022	4	0.852
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	274780-274806	4	0.852
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	NZ_CP035092	Paracoccus denitrificans strain ATCC 19367 plasmid unnamed1, complete sequence	221968-221994	4	0.852
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	NC_008688	Paracoccus denitrificans PD1222 plasmid 1, complete sequence	469316-469342	4	0.852
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	AF246223	Mycoplasma virus P1, complete genome	8327-8353	4	0.852
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	NC_002515	Mycoplasma phage P1, complete genome	8327-8353	4	0.852
NC_014934_2	2.2\|2727999\|27\|NC_014934\|CRT	2727999-2728025	27	NC_014792	Enterobacteria phage vB_EcoM-VR7, complete genome	108142-108168	5	0.815
NC_014934_2	2.2\|2727999\|27\|NC_014934\|CRT	2727999-2728025	27	KP007359	Enterobacteria phage vB_EcoM_VR5, complete genome	107988-108014	5	0.815
NC_014934_2	2.2\|2727999\|27\|NC_014934\|CRT	2727999-2728025	27	MN693555	Marine virus AFVG_25M96, complete genome	16843-16869	5	0.815
NC_014934_2	2.2\|2727999\|27\|NC_014934\|CRT	2727999-2728025	27	LC494302	Escherichia phage SP27 DNA, complete genome	291106-291132	5	0.815
NC_014934_2	2.2\|2727999\|27\|NC_014934\|CRT	2727999-2728025	27	LT603033	Escherichia phage vB_Eco_slurp01 genome assembly, chromosome: I	232616-232642	5	0.815
NC_014934_2	2.2\|2727999\|27\|NC_014934\|CRT	2727999-2728025	27	KM507819	Escherichia phage 121Q, complete genome	291754-291780	5	0.815
NC_014934_2	2.2\|2727999\|27\|NC_014934\|CRT	2727999-2728025	27	MK817115	Escherichia phage vB_EcoM_phAPEC6, complete genome	185436-185462	5	0.815
NC_014934_2	2.2\|2727999\|27\|NC_014934\|CRT	2727999-2728025	27	NC_027364	Escherichia phage PBECO 4, complete genome	339553-339579	5	0.815
NC_014934_2	2.2\|2727999\|27\|NC_014934\|CRT	2727999-2728025	27	MH383160	Escherichia phage UB, complete genome	52693-52719	5	0.815
NC_014934_2	2.2\|2727999\|27\|NC_014934\|CRT	2727999-2728025	27	MK327931	Escherichia phage vB_EcoM_G17, complete genome	210729-210755	5	0.815
NC_014934_2	2.2\|2727999\|27\|NC_014934\|CRT	2727999-2728025	27	MF417982	Uncultured Caudovirales phage clone 7F_2, partial genome	5699-5725	5	0.815
NC_014934_2	2.2\|2727999\|27\|NC_014934\|CRT	2727999-2728025	27	KU985096	Mycobacterium phage Kazan, complete genome	4508-4534	5	0.815
NC_014934_2	2.2\|2727999\|27\|NC_014934\|CRT	2727999-2728025	27	MG099952	Mycobacterium phage WunderPhul, complete genome	4508-4534	5	0.815
NC_014934_2	2.2\|2727999\|27\|NC_014934\|CRT	2727999-2728025	27	MK359352	Mycobacterium phage JewelBug, complete genome	4509-4535	5	0.815
NC_014934_2	2.2\|2727999\|27\|NC_014934\|CRT	2727999-2728025	27	MF417901	Uncultured Caudovirales phage clone 9S_1, partial genome	30395-30421	5	0.815
NC_014934_2	2.2\|2727999\|27\|NC_014934\|CRT	2727999-2728025	27	KX375815	Mycobacterium phage ToneTone, complete genome	4418-4444	5	0.815
NC_014934_2	2.2\|2727999\|27\|NC_014934\|CRT	2727999-2728025	27	MK494090	Mycobacterium phage Jordennis, complete genome	4508-4534	5	0.815
NC_014934_2	2.2\|2727999\|27\|NC_014934\|CRT	2727999-2728025	27	KX641261	Mycobacterium phage Isiphiwo, complete genome	4508-4534	5	0.815
NC_014934_2	2.2\|2727999\|27\|NC_014934\|CRT	2727999-2728025	27	KF560333	Mycobacterium phage Artemis2UCLA, complete genome	4391-4417	5	0.815
NC_014934_2	2.2\|2727999\|27\|NC_014934\|CRT	2727999-2728025	27	KU695582	Mycobacterium phage McFly, complete genome	4508-4534	5	0.815
NC_014934_2	2.2\|2727999\|27\|NC_014934\|CRT	2727999-2728025	27	MT024861	Mycobacterium phage Pmask, complete genome	4508-4534	5	0.815
NC_014934_2	2.2\|2727999\|27\|NC_014934\|CRT	2727999-2728025	27	MH155876	Mycobacterium phage Priamo, complete genome	4523-4549	5	0.815
NC_014934_2	2.2\|2727999\|27\|NC_014934\|CRT	2727999-2728025	27	MK359360	Mycobacterium phage Hexamo, complete genome	4463-4489	5	0.815
NC_014934_2	2.2\|2727999\|27\|NC_014934\|CRT	2727999-2728025	27	KX576638	Mycobacterium phage Gruunaga, complete genome	4502-4528	5	0.815
NC_014934_2	2.2\|2727999\|27\|NC_014934\|CRT	2727999-2728025	27	MH051253	Mycobacterium phage GreedyLawyer, complete genome	4508-4534	5	0.815
NC_014934_2	2.2\|2727999\|27\|NC_014934\|CRT	2727999-2728025	27	NC_042309	Mycobacterium virus Gladiator, complete genome	4502-4528	5	0.815
NC_014934_2	2.2\|2727999\|27\|NC_014934\|CRT	2727999-2728025	27	MT657338	Mycobacterium phage SuperCallie99, complete genome	4509-4535	5	0.815
NC_014934_2	2.2\|2727999\|27\|NC_014934\|CRT	2727999-2728025	27	NC_042334	Mycobacterium virus Jeffabunny, complete genome	4508-4534	5	0.815
NC_014934_2	2.2\|2727999\|27\|NC_014934\|CRT	2727999-2728025	27	MN728683	Mycobacterium phage Yokurt, complete genome	4508-4534	5	0.815
NC_014934_2	2.2\|2727999\|27\|NC_014934\|CRT	2727999-2728025	27	NC_022965	Mycobacterium phage CloudWang3, complete genome	4508-4534	5	0.815
NC_014934_2	2.2\|2727999\|27\|NC_014934\|CRT	2727999-2728025	27	JF937092	Mycobacterium phage DaVinci, complete genome	4509-4535	5	0.815
NC_014934_2	2.2\|2727999\|27\|NC_014934\|CRT	2727999-2728025	27	MF668288	Mycobacterium phage Wiks, complete genome	4508-4534	5	0.815
NC_014934_2	2.2\|2727999\|27\|NC_014934\|CRT	2727999-2728025	27	MH020240	Mycobacterium phage SuperAwesome, complete genome	4508-4534	5	0.815
NC_014934_2	2.2\|2727999\|27\|NC_014934\|CRT	2727999-2728025	27	MG099945	Mycobacterium phage Koko, complete genome	4508-4534	5	0.815
NC_014934_2	2.2\|2727999\|27\|NC_014934\|CRT	2727999-2728025	27	MK894433	Mycobacterium phage Kipper29, complete genome	4508-4534	5	0.815
NC_014934_2	2.2\|2727999\|27\|NC_014934\|CRT	2727999-2728025	27	NC_022985	Mycobacterium phage Zaka, complete genome	4508-4534	5	0.815
NC_014934_2	2.2\|2727999\|27\|NC_014934\|CRT	2727999-2728025	27	JN049605	Mycobacterium virus EricB, complete genome	4509-4535	5	0.815
NC_014934_2	2.2\|2727999\|27\|NC_014934\|CRT	2727999-2728025	27	MN586039	Mycobacterium phage Blinn1, complete genome	4508-4534	5	0.815
NC_014934_2	2.2\|2727999\|27\|NC_014934\|CRT	2727999-2728025	27	NC_021772	Salmonella phage FSL SP-058, complete genome	11680-11706	5	0.815
NC_014934_2	2.2\|2727999\|27\|NC_014934\|CRT	2727999-2728025	27	MH779517	Mycobacterium phage Zulu, complete genome	4508-4534	5	0.815
NC_014934_2	2.2\|2727999\|27\|NC_014934\|CRT	2727999-2728025	27	NC_029077	Mycobacterium phage VohminGhazi, complete genome	4508-4534	5	0.815
NC_014934_2	2.2\|2727999\|27\|NC_014934\|CRT	2727999-2728025	27	JN700521	Staphylococcus phage StB20, complete genome	36467-36493	5	0.815
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	NZ_CP017148	Bosea vaviloviae strain Vaf18 plasmid unnamed1, complete sequence	14712-14738	5	0.815
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	LT961841	Yersinia phage fPS-89 genome assembly, complete genome: monopartite	30610-30636	5	0.815
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	LT962475	Yersinia phage fPS-54-ocr genome assembly, complete genome: monopartite	30271-30297	5	0.815
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	LT960606	Yersinia phage fPS-9 genome assembly, complete genome: monopartite	29489-29515	5	0.815
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	LT962380	Yersinia phage fPS-85 genome assembly, complete genome: monopartite	30655-30681	5	0.815
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	NC_047935	Yersinia phage fPS-59 genome assembly, complete genome: monopartite	29752-29778	5	0.815
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	LT961837	Yersinia phage fPS-52 genome assembly, complete genome: monopartite	29965-29991	5	0.815
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	LT962907	Yersinia phage fPS-10 genome assembly, complete genome: monopartite	29546-29572	5	0.815
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	LT961839	unidentified phage genome assembly, chromosome: I	29414-29440	5	0.815
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	LT961838	Yersinia phage fPS-19 genome assembly, complete genome: monopartite	29414-29440	5	0.815
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	LT961842	Yersinia phage fPS-86 genome assembly, complete genome: monopartite	29443-29469	5	0.815
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	LT962906	Yersinia phage fPS16 genome assembly, complete genome: monopartite	29414-29440	5	0.815
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	NC_047936	Yersinia phage fPS-53 genome assembly, complete genome: monopartite	30453-30479	5	0.815
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	LT961836	Yersinia phage fPS-26 genome assembly, complete genome: monopartite	29515-29541	5	0.815
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	LT961840	Yersinia phage fPS-7 genome assembly, complete genome: monopartite	29415-29441	5	0.815
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	LT961844	Yersinia phage fPS-21 genome assembly, complete genome: monopartite	29415-29441	5	0.815
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	LT961846	Yersinia phage fPS-64 genome assembly, complete genome: monopartite	29671-29697	5	0.815
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	LT961843	Yersinia phage fPS-50 genome assembly, complete genome: monopartite	29988-30014	5	0.815
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	8321-8347	5	0.815
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	8375-8401	5	0.815
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	8429-8455	5	0.815
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	8483-8509	5	0.815
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	169054-169080	5	0.815
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	MG018928	Pseudomonas phage inbricus, complete genome	65823-65849	5	0.815
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	MK962632	Achromobacter phage vB_AxyP_19-32_Axy13, complete genome	11921-11947	5	0.815
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	NZ_CP017148	Bosea vaviloviae strain Vaf18 plasmid unnamed1, complete sequence	14712-14738	5	0.815
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	LT961841	Yersinia phage fPS-89 genome assembly, complete genome: monopartite	30610-30636	5	0.815
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	LT962475	Yersinia phage fPS-54-ocr genome assembly, complete genome: monopartite	30271-30297	5	0.815
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	LT960606	Yersinia phage fPS-9 genome assembly, complete genome: monopartite	29489-29515	5	0.815
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	LT962380	Yersinia phage fPS-85 genome assembly, complete genome: monopartite	30655-30681	5	0.815
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	NC_047935	Yersinia phage fPS-59 genome assembly, complete genome: monopartite	29752-29778	5	0.815
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	LT961837	Yersinia phage fPS-52 genome assembly, complete genome: monopartite	29965-29991	5	0.815
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	LT962907	Yersinia phage fPS-10 genome assembly, complete genome: monopartite	29546-29572	5	0.815
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	LT961839	unidentified phage genome assembly, chromosome: I	29414-29440	5	0.815
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	LT961838	Yersinia phage fPS-19 genome assembly, complete genome: monopartite	29414-29440	5	0.815
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	LT961842	Yersinia phage fPS-86 genome assembly, complete genome: monopartite	29443-29469	5	0.815
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	LT962906	Yersinia phage fPS16 genome assembly, complete genome: monopartite	29414-29440	5	0.815
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	NC_047936	Yersinia phage fPS-53 genome assembly, complete genome: monopartite	30453-30479	5	0.815
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	LT961836	Yersinia phage fPS-26 genome assembly, complete genome: monopartite	29515-29541	5	0.815
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	LT961840	Yersinia phage fPS-7 genome assembly, complete genome: monopartite	29415-29441	5	0.815
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	LT961844	Yersinia phage fPS-21 genome assembly, complete genome: monopartite	29415-29441	5	0.815
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	LT961846	Yersinia phage fPS-64 genome assembly, complete genome: monopartite	29671-29697	5	0.815
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	LT961843	Yersinia phage fPS-50 genome assembly, complete genome: monopartite	29988-30014	5	0.815
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	8321-8347	5	0.815
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	8375-8401	5	0.815
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	8429-8455	5	0.815
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	8483-8509	5	0.815
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	169054-169080	5	0.815
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	MG018928	Pseudomonas phage inbricus, complete genome	65823-65849	5	0.815
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	MK962632	Achromobacter phage vB_AxyP_19-32_Axy13, complete genome	11921-11947	5	0.815
NC_014934_2	2.2\|2727999\|27\|NC_014934\|CRT	2727999-2728025	27	HQ634192	Cellulophaga phage phiST genomic sequence	55831-55857	6	0.778
NC_014934_2	2.2\|2727999\|27\|NC_014934\|CRT	2727999-2728025	27	KC821604	Cellulophaga phage phiST, complete genome	23069-23095	6	0.778
NC_014934_2	2.2\|2727999\|27\|NC_014934\|CRT	2727999-2728025	27	KC821621	Cellulophaga phage phi19:2, complete genome	23078-23104	6	0.778
NC_014934_2	2.2\|2727999\|27\|NC_014934\|CRT	2727999-2728025	27	KC821625	Cellulophaga phage phi13:1, complete genome	20978-21004	6	0.778
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	NZ_KJ588780	Achromobacter xylosoxidans strain A22732 plasmid pA22732-IMP, complete sequence	28089-28115	6	0.778
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	NZ_KP289281	Pseudomonas sp. EGD-AKN5 plasmid unnamed, complete sequence	17527-17553	6	0.778
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	NZ_MN366359	Bacterium plasmid pALTS31, complete sequence	25682-25708	6	0.778
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	NC_001735	Enterobacter aerogenes plasmid R751, complete sequence	46027-46053	6	0.778
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	NZ_CP015373	Pandoraea pnomenusa strain MCB032 plasmid unnamed 2, complete sequence	38426-38452	6	0.778
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	AGRM01000006	Salmonella enterica subsp. houtenae str. ATCC BAA-1581 plasmid pSEHO0A1, complete sequence, whole genome shotgun sequence	20869-20895	6	0.778
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	NC_017908	Mycobacterium abscessus subsp. bolletii F1725 plasmid BRA100, complete sequence	25804-25830	6	0.778
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	AJ863570	Uncultured bacterium IncP-1beta multiresistance plasmid pB8	40621-40647	6	0.778
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	NC_008459	Bordetella pertussis plasmid pBP136 DNA, complete sequence	33909-33935	6	0.778
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	KU238092	Uncultured bacterium plasmid pDTC28, complete sequence	24800-24826	6	0.778
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	JX469834	Uncultured bacterium plasmid pDS3, complete sequence	23429-23455	6	0.778
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	JX469831	Uncultured bacterium plasmid pKSP212, complete sequence	30271-30297	6	0.778
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	JN106172	Uncultured bacterium plasmid pAKD29, complete sequence	23268-23294	6	0.778
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	JN106173	Uncultured bacterium plasmid pAKD31, complete sequence	24446-24472	6	0.778
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	JN106174	Uncultured bacterium plasmid pAKD33, complete sequence	24449-24475	6	0.778
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	NC_004956	Pseudomonas sp. ADP atrazine catabolic plasmid pADP-1, complete sequence	17527-17553	6	0.778
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	JN106164	Uncultured bacterium plasmid pAKD1, complete sequence	36596-36622	6	0.778
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	JN106165	Uncultured bacterium plasmid pAKD14, complete sequence	24446-24472	6	0.778
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	JN106166	Uncultured bacterium plasmid pAKD15, complete sequence	24446-24472	6	0.778
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	JN106168	Uncultured bacterium plasmid pAKD17, complete sequence	24446-24472	6	0.778
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	JN106169	Uncultured bacterium plasmid pAKD18, complete sequence	24431-24457	6	0.778
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	NC_014911	Alicycliphilus denitrificans BC plasmid pALIDE02, complete sequence	7014-7040	6	0.778
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	MN386974	Pseudomonas aeruginosa strain 1943 plasmid pPaeBURNS1, complete sequence	32623-32649	6	0.778
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	MG879028	Uncultured bacterium plasmid pEG1-1, complete sequence	56654-56680	6	0.778
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	NZ_CP021650	Acidovorax sp. T1 plasmid p2-T1, complete sequence	6751-6777	6	0.778
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	KF743817	Proteus mirabilis plasmid R772, complete sequence	23361-23387	6	0.778
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	KF743818	Bordetella bronchiseptica plasmid R906, complete sequence	25579-25605	6	0.778
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	NZ_CP054613	Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence	584949-584975	6	0.778
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	JX486125	Uncultured bacterium plasmid pRWC72a, complete sequence	35156-35182	6	0.778
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	NZ_CP019238	Rhodoferax koreense strain DCY-110 plasmid unnamed2	42281-42307	6	0.778
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	NZ_CP038640	Cupriavidus oxalaticus strain X32 plasmid unnamed5, complete sequence	58801-58827	6	0.778
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	KC170279	Uncultured bacterium plasmid pMBUI8, complete sequence	35415-35441	6	0.778
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	KU356987	Variovorax paradoxus plasmid pBS64, complete sequence	40846-40872	6	0.778
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	KU356988	Variovorax paradoxus plasmid pHB44, complete sequence	39551-39577	6	0.778
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	NZ_CP009797	Burkholderia ambifaria AMMD plasmid pBII_1, complete sequence	26186-26212	6	0.778
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	NC_013176	Pseudomonas putida plasmid pW2, complete sequence	19563-19589	6	0.778
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	NC_019312	Delftia sp. KV29 plasmid pKV29, complete sequence	27025-27051	6	0.778
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	NC_019320	Variovorax sp. DB1 plasmid pDB1, complete sequence	57875-57901	6	0.778
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	NZ_CP017455	Dickeya solani strain PPO 9019 plasmid unnamed, complete sequence	33277-33303	6	0.778
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	NC_021077	Comamonas sp. 7D-2 plasmid pBHB, complete sequence	95975-96001	6	0.778
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	NC_007337	Cupriavidus pinatubonensis JMP134 plasmid 1, complete sequence	80294-80320	6	0.778
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	NC_024998	Acidovorax avenae subsp. avenae plasmid pAAA83 DNA, complete sequence, strain: 83	14957-14983	6	0.778
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	NZ_MH053445	Pseudomonas aeruginosa strain PA1280 plasmid pICP-4GES, complete sequence	26170-26196	6	0.778
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	NC_005088	Delftia acidovorans B plasmid pUO1, complete sequence	51076-51102	6	0.778
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	NC_008385	Burkholderia ambifaria AMMD plasmid unnamed1, complete sequence	20249-20275	6	0.778
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	DQ222855	Bacillus anthracis phage Gamma isolate 53, complete genome	31412-31438	6	0.778
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	DQ289555	Bacillus anthracis phage W Beta, complete genome	34212-34238	6	0.778
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	NC_007734	Bacillus phage WBeta, complete genome	34212-34238	6	0.778
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	NC_048144	Microbacterium phage Schubert, complete genome	22264-22290	6	0.778
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	DQ222854	Bacillus anthracis phage Gamma collagen region, complete sequence	4329-4355	6	0.778
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	NZ_KJ588780	Achromobacter xylosoxidans strain A22732 plasmid pA22732-IMP, complete sequence	28089-28115	6	0.778
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	NZ_KP289281	Pseudomonas sp. EGD-AKN5 plasmid unnamed, complete sequence	17527-17553	6	0.778
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	NZ_MN366359	Bacterium plasmid pALTS31, complete sequence	25682-25708	6	0.778
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	NC_001735	Enterobacter aerogenes plasmid R751, complete sequence	46027-46053	6	0.778
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	NZ_CP015373	Pandoraea pnomenusa strain MCB032 plasmid unnamed 2, complete sequence	38426-38452	6	0.778
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	AGRM01000006	Salmonella enterica subsp. houtenae str. ATCC BAA-1581 plasmid pSEHO0A1, complete sequence, whole genome shotgun sequence	20869-20895	6	0.778
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	NC_017908	Mycobacterium abscessus subsp. bolletii F1725 plasmid BRA100, complete sequence	25804-25830	6	0.778
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	AJ863570	Uncultured bacterium IncP-1beta multiresistance plasmid pB8	40621-40647	6	0.778
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	NC_008459	Bordetella pertussis plasmid pBP136 DNA, complete sequence	33909-33935	6	0.778
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	KU238092	Uncultured bacterium plasmid pDTC28, complete sequence	24800-24826	6	0.778
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	JX469834	Uncultured bacterium plasmid pDS3, complete sequence	23429-23455	6	0.778
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	JX469831	Uncultured bacterium plasmid pKSP212, complete sequence	30271-30297	6	0.778
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	JN106172	Uncultured bacterium plasmid pAKD29, complete sequence	23268-23294	6	0.778
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	JN106173	Uncultured bacterium plasmid pAKD31, complete sequence	24446-24472	6	0.778
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	JN106174	Uncultured bacterium plasmid pAKD33, complete sequence	24449-24475	6	0.778
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	NC_004956	Pseudomonas sp. ADP atrazine catabolic plasmid pADP-1, complete sequence	17527-17553	6	0.778
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	JN106164	Uncultured bacterium plasmid pAKD1, complete sequence	36596-36622	6	0.778
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	JN106165	Uncultured bacterium plasmid pAKD14, complete sequence	24446-24472	6	0.778
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	JN106166	Uncultured bacterium plasmid pAKD15, complete sequence	24446-24472	6	0.778
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	JN106168	Uncultured bacterium plasmid pAKD17, complete sequence	24446-24472	6	0.778
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	JN106169	Uncultured bacterium plasmid pAKD18, complete sequence	24431-24457	6	0.778
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	NC_014911	Alicycliphilus denitrificans BC plasmid pALIDE02, complete sequence	7014-7040	6	0.778
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	MN386974	Pseudomonas aeruginosa strain 1943 plasmid pPaeBURNS1, complete sequence	32623-32649	6	0.778
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	MG879028	Uncultured bacterium plasmid pEG1-1, complete sequence	56654-56680	6	0.778
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	NZ_CP021650	Acidovorax sp. T1 plasmid p2-T1, complete sequence	6751-6777	6	0.778
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	KF743817	Proteus mirabilis plasmid R772, complete sequence	23361-23387	6	0.778
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	KF743818	Bordetella bronchiseptica plasmid R906, complete sequence	25579-25605	6	0.778
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	NZ_CP054613	Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence	584949-584975	6	0.778
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	JX486125	Uncultured bacterium plasmid pRWC72a, complete sequence	35156-35182	6	0.778
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	NZ_CP019238	Rhodoferax koreense strain DCY-110 plasmid unnamed2	42281-42307	6	0.778
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	NZ_CP038640	Cupriavidus oxalaticus strain X32 plasmid unnamed5, complete sequence	58801-58827	6	0.778
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	KC170279	Uncultured bacterium plasmid pMBUI8, complete sequence	35415-35441	6	0.778
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	KU356987	Variovorax paradoxus plasmid pBS64, complete sequence	40846-40872	6	0.778
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	KU356988	Variovorax paradoxus plasmid pHB44, complete sequence	39551-39577	6	0.778
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	NZ_CP009797	Burkholderia ambifaria AMMD plasmid pBII_1, complete sequence	26186-26212	6	0.778
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	NC_013176	Pseudomonas putida plasmid pW2, complete sequence	19563-19589	6	0.778
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	NC_019312	Delftia sp. KV29 plasmid pKV29, complete sequence	27025-27051	6	0.778
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	NC_019320	Variovorax sp. DB1 plasmid pDB1, complete sequence	57875-57901	6	0.778
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	NZ_CP017455	Dickeya solani strain PPO 9019 plasmid unnamed, complete sequence	33277-33303	6	0.778
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	NC_021077	Comamonas sp. 7D-2 plasmid pBHB, complete sequence	95975-96001	6	0.778
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	NC_007337	Cupriavidus pinatubonensis JMP134 plasmid 1, complete sequence	80294-80320	6	0.778
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	NC_024998	Acidovorax avenae subsp. avenae plasmid pAAA83 DNA, complete sequence, strain: 83	14957-14983	6	0.778
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	NZ_MH053445	Pseudomonas aeruginosa strain PA1280 plasmid pICP-4GES, complete sequence	26170-26196	6	0.778
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	NC_005088	Delftia acidovorans B plasmid pUO1, complete sequence	51076-51102	6	0.778
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	NC_008385	Burkholderia ambifaria AMMD plasmid unnamed1, complete sequence	20249-20275	6	0.778
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	DQ222855	Bacillus anthracis phage Gamma isolate 53, complete genome	31412-31438	6	0.778
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	DQ289555	Bacillus anthracis phage W Beta, complete genome	34212-34238	6	0.778
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	NC_007734	Bacillus phage WBeta, complete genome	34212-34238	6	0.778
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	NC_048144	Microbacterium phage Schubert, complete genome	22264-22290	6	0.778
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	DQ222854	Bacillus anthracis phage Gamma collagen region, complete sequence	4329-4355	6	0.778
NC_014934_2	2.4\|2728134\|27\|NC_014934\|CRT	2728134-2728160	27	MK448927	Streptococcus phage Javan394, complete genome	29554-29580	7	0.741
NC_014934_2	2.5\|2728206\|27\|NC_014934\|CRT	2728206-2728232	27	MK448927	Streptococcus phage Javan394, complete genome	29554-29580	7	0.741

1. spacer 2.2|2727999|27|NC_014934|CRT matches to NC_014792 (Enterobacteria phage vB_EcoM-VR7, complete genome) position: , mismatch: 3, identity: 0.889

cgctcaaggtattcaaggcgaaacagg	CRISPR spacer
cgaccaaggtattcaaggtgaaacagg	Protospacer
** .**************.********

2. spacer 2.2|2727999|27|NC_014934|CRT matches to KP007359 (Enterobacteria phage vB_EcoM_VR5, complete genome) position: , mismatch: 3, identity: 0.889

cgctcaaggtattcaaggcgaaacagg	CRISPR spacer
cgaccaaggtattcaaggtgaaacagg	Protospacer
** .**************.********

3. spacer 2.2|2727999|27|NC_014934|CRT matches to NC_006823 (Aromatoleum aromaticum EbN1 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

cgctcaaggtattcaaggcgaaacagg	CRISPR spacer
cgctcaaggtattcaatgcgaaatggt	Protospacer
**************** ******..*

4. spacer 2.2|2727999|27|NC_014934|CRT matches to KC821615 (Cellulophaga phage phi12:3, complete genome) position: , mismatch: 4, identity: 0.852

cgctcaaggtattcaaggcgaaacagg	CRISPR spacer
agagcaaggtattcaaggcgagacagg	Protospacer
 *  *****************.*****

5. spacer 2.2|2727999|27|NC_014934|CRT matches to NC_021791 (Cellulophaga phage phi12:1, complete genome) position: , mismatch: 4, identity: 0.852

cgctcaaggtattcaaggcgaaacagg	CRISPR spacer
agagcaaggtattcaaggcgagacagg	Protospacer
 *  *****************.*****

6. spacer 2.2|2727999|27|NC_014934|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 4, identity: 0.852

cgctcaaggtattcaaggcgaaacagg	CRISPR spacer
agttcaaggtattcaaggagaaccagg	Protospacer
 *.*************** *** ****

7. spacer 2.2|2727999|27|NC_014934|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 4, identity: 0.852

cgctcaaggtattcaaggcgaaacagg	CRISPR spacer
ggttcaaggtattcaaggagaaccagg	Protospacer
 *.*************** *** ****

8. spacer 2.2|2727999|27|NC_014934|CRT matches to GU936714 (Synechococcus phage S-CBS2, complete genome) position: , mismatch: 4, identity: 0.852

cgctcaaggtattcaaggcgaaacagg	CRISPR spacer
cgagcaaggaattcaaggcgaaaccgg	Protospacer
**  ***** ************** **

9. spacer 2.4|2728134|27|NC_014934|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 4, identity: 0.852

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
atctcaaggagttcaaggaattcaagg	Protospacer
  *****************. ******

10. spacer 2.4|2728134|27|NC_014934|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 4, identity: 0.852

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
acctcaaggagttcaaggaattcaagg	Protospacer
  *****************. ******

11. spacer 2.4|2728134|27|NC_014934|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 4, identity: 0.852

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
ccctcaaggagttcaaggaattcaagg	Protospacer
. *****************. ******

12. spacer 2.4|2728134|27|NC_014934|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 4, identity: 0.852

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tccacaaggagttcaaggaattcaagg	Protospacer
* * ***************. ******

13. spacer 2.4|2728134|27|NC_014934|CRT matches to NZ_CP035092 (Paracoccus denitrificans strain ATCC 19367 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.852

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tcgccaagcagttcaaggagatcaagg	Protospacer
*  .**** ******************

14. spacer 2.4|2728134|27|NC_014934|CRT matches to NC_008688 (Paracoccus denitrificans PD1222 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tcgccaagcagttcaaggagatcaagg	Protospacer
*  .**** ******************

15. spacer 2.4|2728134|27|NC_014934|CRT matches to AF246223 (Mycoplasma virus P1, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tcttcaaggagctcaaggagttcaagg	Protospacer
* .********.******** ******

16. spacer 2.4|2728134|27|NC_014934|CRT matches to NC_002515 (Mycoplasma phage P1, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tcttcaaggagctcaaggagttcaagg	Protospacer
* .********.******** ******

17. spacer 2.5|2728206|27|NC_014934|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 4, identity: 0.852

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
atctcaaggagttcaaggaattcaagg	Protospacer
  *****************. ******

18. spacer 2.5|2728206|27|NC_014934|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 4, identity: 0.852

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
acctcaaggagttcaaggaattcaagg	Protospacer
  *****************. ******

19. spacer 2.5|2728206|27|NC_014934|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 4, identity: 0.852

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
ccctcaaggagttcaaggaattcaagg	Protospacer
. *****************. ******

20. spacer 2.5|2728206|27|NC_014934|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 4, identity: 0.852

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tccacaaggagttcaaggaattcaagg	Protospacer
* * ***************. ******

21. spacer 2.5|2728206|27|NC_014934|CRT matches to NZ_CP035092 (Paracoccus denitrificans strain ATCC 19367 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.852

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tcgccaagcagttcaaggagatcaagg	Protospacer
*  .**** ******************

22. spacer 2.5|2728206|27|NC_014934|CRT matches to NC_008688 (Paracoccus denitrificans PD1222 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tcgccaagcagttcaaggagatcaagg	Protospacer
*  .**** ******************

23. spacer 2.5|2728206|27|NC_014934|CRT matches to AF246223 (Mycoplasma virus P1, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tcttcaaggagctcaaggagttcaagg	Protospacer
* .********.******** ******

24. spacer 2.5|2728206|27|NC_014934|CRT matches to NC_002515 (Mycoplasma phage P1, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tcttcaaggagctcaaggagttcaagg	Protospacer
* .********.******** ******

25. spacer 2.2|2727999|27|NC_014934|CRT matches to NC_014792 (Enterobacteria phage vB_EcoM-VR7, complete genome) position: , mismatch: 5, identity: 0.815

cgctcaaggtattcaaggcgaaacagg	CRISPR spacer
tgaccaaggtattcaaggggatacagg	Protospacer
.* .************** ** *****

26. spacer 2.2|2727999|27|NC_014934|CRT matches to KP007359 (Enterobacteria phage vB_EcoM_VR5, complete genome) position: , mismatch: 5, identity: 0.815

cgctcaaggtattcaaggcgaaacagg	CRISPR spacer
accaaaaggtattcaaggtgaaacagg	Protospacer
  *  *************.********

27. spacer 2.2|2727999|27|NC_014934|CRT matches to MN693555 (Marine virus AFVG_25M96, complete genome) position: , mismatch: 5, identity: 0.815

cgctcaaggtattcaaggcgaaacagg	CRISPR spacer
tattcaaggtattcaaggagaaactgg	Protospacer
...*************** ***** **

28. spacer 2.2|2727999|27|NC_014934|CRT matches to LC494302 (Escherichia phage SP27 DNA, complete genome) position: , mismatch: 5, identity: 0.815

cgctcaaggtattcaaggcgaaacagg	CRISPR spacer
tattcaaggtatacaaggcgaaccagg	Protospacer
...********* ********* ****

29. spacer 2.2|2727999|27|NC_014934|CRT matches to LT603033 (Escherichia phage vB_Eco_slurp01 genome assembly, chromosome: I) position: , mismatch: 5, identity: 0.815

cgctcaaggtattcaaggcgaaacagg	CRISPR spacer
tattcaaggtatacaaggcgaaccagg	Protospacer
...********* ********* ****

30. spacer 2.2|2727999|27|NC_014934|CRT matches to KM507819 (Escherichia phage 121Q, complete genome) position: , mismatch: 5, identity: 0.815

cgctcaaggtattcaaggcgaaacagg	CRISPR spacer
tattcaaggtatacaaggcgaaccagg	Protospacer
...********* ********* ****

31. spacer 2.2|2727999|27|NC_014934|CRT matches to MK817115 (Escherichia phage vB_EcoM_phAPEC6, complete genome) position: , mismatch: 5, identity: 0.815

cgctcaaggtattcaaggcgaaacagg	CRISPR spacer
tattcaaggtatacaaggcgaaccagg	Protospacer
...********* ********* ****

32. spacer 2.2|2727999|27|NC_014934|CRT matches to NC_027364 (Escherichia phage PBECO 4, complete genome) position: , mismatch: 5, identity: 0.815

cgctcaaggtattcaaggcgaaacagg	CRISPR spacer
tattcaaggtatacaaggcgaaccagg	Protospacer
...********* ********* ****

33. spacer 2.2|2727999|27|NC_014934|CRT matches to MH383160 (Escherichia phage UB, complete genome) position: , mismatch: 5, identity: 0.815

cgctcaaggtattcaaggcgaaacagg	CRISPR spacer
tattcaaggtatacaaggcgaaccagg	Protospacer
...********* ********* ****

34. spacer 2.2|2727999|27|NC_014934|CRT matches to MK327931 (Escherichia phage vB_EcoM_G17, complete genome) position: , mismatch: 5, identity: 0.815

cgctcaaggtattcaaggcgaaacagg	CRISPR spacer
tattcaaggtatacaaggcgaaccagg	Protospacer
...********* ********* ****

35. spacer 2.2|2727999|27|NC_014934|CRT matches to MF417982 (Uncultured Caudovirales phage clone 7F_2, partial genome) position: , mismatch: 5, identity: 0.815

cgctcaaggtattcaaggcgaaacagg	CRISPR spacer
tcctcaaggtattcaaggagaaaaggg	Protospacer
. **************** **** .**

36. spacer 2.2|2727999|27|NC_014934|CRT matches to KU985096 (Mycobacterium phage Kazan, complete genome) position: , mismatch: 5, identity: 0.815

cgctcaaggtattcaaggcgaaacagg	CRISPR spacer
gccacaaggcattcaaggcgagacagg	Protospacer
  * *****.***********.*****

37. spacer 2.2|2727999|27|NC_014934|CRT matches to MG099952 (Mycobacterium phage WunderPhul, complete genome) position: , mismatch: 5, identity: 0.815

cgctcaaggtattcaaggcgaaacagg	CRISPR spacer
gccacaaggcattcaaggcgagacagg	Protospacer
  * *****.***********.*****

38. spacer 2.2|2727999|27|NC_014934|CRT matches to MK359352 (Mycobacterium phage JewelBug, complete genome) position: , mismatch: 5, identity: 0.815

cgctcaaggtattcaaggcgaaacagg	CRISPR spacer
gccacaaggcattcaaggcgagacagg	Protospacer
  * *****.***********.*****

39. spacer 2.2|2727999|27|NC_014934|CRT matches to MF417901 (Uncultured Caudovirales phage clone 9S_1, partial genome) position: , mismatch: 5, identity: 0.815

cgctcaaggtattcaaggcgaaacagg	CRISPR spacer
tcctcaaggtattcaaggagaaaaggg	Protospacer
. **************** **** .**

40. spacer 2.2|2727999|27|NC_014934|CRT matches to KX375815 (Mycobacterium phage ToneTone, complete genome) position: , mismatch: 5, identity: 0.815

cgctcaaggtattcaaggcgaaacagg	CRISPR spacer
gccacaaggcattcaaggcgagacagg	Protospacer
  * *****.***********.*****

41. spacer 2.2|2727999|27|NC_014934|CRT matches to MK494090 (Mycobacterium phage Jordennis, complete genome) position: , mismatch: 5, identity: 0.815

cgctcaaggtattcaaggcgaaacagg	CRISPR spacer
gccacaaggcattcaaggcgagacagg	Protospacer
  * *****.***********.*****

42. spacer 2.2|2727999|27|NC_014934|CRT matches to KX641261 (Mycobacterium phage Isiphiwo, complete genome) position: , mismatch: 5, identity: 0.815

cgctcaaggtattcaaggcgaaacagg	CRISPR spacer
gccacaaggcattcaaggcgagacagg	Protospacer
  * *****.***********.*****

43. spacer 2.2|2727999|27|NC_014934|CRT matches to KF560333 (Mycobacterium phage Artemis2UCLA, complete genome) position: , mismatch: 5, identity: 0.815

cgctcaaggtattcaaggcgaaacagg	CRISPR spacer
gccacaaggcattcaaggcgagacagg	Protospacer
  * *****.***********.*****

44. spacer 2.2|2727999|27|NC_014934|CRT matches to KU695582 (Mycobacterium phage McFly, complete genome) position: , mismatch: 5, identity: 0.815

cgctcaaggtattcaaggcgaaacagg	CRISPR spacer
gccacaaggcattcaaggcgagacagg	Protospacer
  * *****.***********.*****

45. spacer 2.2|2727999|27|NC_014934|CRT matches to MT024861 (Mycobacterium phage Pmask, complete genome) position: , mismatch: 5, identity: 0.815

cgctcaaggtattcaaggcgaaacagg	CRISPR spacer
gccacaaggcattcaaggcgagacagg	Protospacer
  * *****.***********.*****

46. spacer 2.2|2727999|27|NC_014934|CRT matches to MH155876 (Mycobacterium phage Priamo, complete genome) position: , mismatch: 5, identity: 0.815

cgctcaaggtattcaaggcgaaacagg	CRISPR spacer
gccacaaggcattcaaggcgagacagg	Protospacer
  * *****.***********.*****

47. spacer 2.2|2727999|27|NC_014934|CRT matches to MK359360 (Mycobacterium phage Hexamo, complete genome) position: , mismatch: 5, identity: 0.815

cgctcaaggtattcaaggcgaaacagg	CRISPR spacer
gccacaaggcattcaaggcgagacagg	Protospacer
  * *****.***********.*****

48. spacer 2.2|2727999|27|NC_014934|CRT matches to KX576638 (Mycobacterium phage Gruunaga, complete genome) position: , mismatch: 5, identity: 0.815

cgctcaaggtattcaaggcgaaacagg	CRISPR spacer
gccacaaggcattcaaggcgagacagg	Protospacer
  * *****.***********.*****

49. spacer 2.2|2727999|27|NC_014934|CRT matches to MH051253 (Mycobacterium phage GreedyLawyer, complete genome) position: , mismatch: 5, identity: 0.815

cgctcaaggtattcaaggcgaaacagg	CRISPR spacer
gccacaaggcattcaaggcgagacagg	Protospacer
  * *****.***********.*****

50. spacer 2.2|2727999|27|NC_014934|CRT matches to NC_042309 (Mycobacterium virus Gladiator, complete genome) position: , mismatch: 5, identity: 0.815

cgctcaaggtattcaaggcgaaacagg	CRISPR spacer
gccacaaggcattcaaggcgagacagg	Protospacer
  * *****.***********.*****

51. spacer 2.2|2727999|27|NC_014934|CRT matches to MT657338 (Mycobacterium phage SuperCallie99, complete genome) position: , mismatch: 5, identity: 0.815

cgctcaaggtattcaaggcgaaacagg	CRISPR spacer
gccacaaggcattcaaggcgagacagg	Protospacer
  * *****.***********.*****

52. spacer 2.2|2727999|27|NC_014934|CRT matches to NC_042334 (Mycobacterium virus Jeffabunny, complete genome) position: , mismatch: 5, identity: 0.815

cgctcaaggtattcaaggcgaaacagg	CRISPR spacer
gccacaaggcattcaaggcgagacagg	Protospacer
  * *****.***********.*****

53. spacer 2.2|2727999|27|NC_014934|CRT matches to MN728683 (Mycobacterium phage Yokurt, complete genome) position: , mismatch: 5, identity: 0.815

cgctcaaggtattcaaggcgaaacagg	CRISPR spacer
gccacaaggcattcaaggcgagacagg	Protospacer
  * *****.***********.*****

54. spacer 2.2|2727999|27|NC_014934|CRT matches to NC_022965 (Mycobacterium phage CloudWang3, complete genome) position: , mismatch: 5, identity: 0.815

cgctcaaggtattcaaggcgaaacagg	CRISPR spacer
gccacaaggcattcaaggcgagacagg	Protospacer
  * *****.***********.*****

55. spacer 2.2|2727999|27|NC_014934|CRT matches to JF937092 (Mycobacterium phage DaVinci, complete genome) position: , mismatch: 5, identity: 0.815

cgctcaaggtattcaaggcgaaacagg	CRISPR spacer
gccacaaggcattcaaggcgagacagg	Protospacer
  * *****.***********.*****

56. spacer 2.2|2727999|27|NC_014934|CRT matches to MF668288 (Mycobacterium phage Wiks, complete genome) position: , mismatch: 5, identity: 0.815

cgctcaaggtattcaaggcgaaacagg	CRISPR spacer
gccacaaggcattcaaggcgagacagg	Protospacer
  * *****.***********.*****

57. spacer 2.2|2727999|27|NC_014934|CRT matches to MH020240 (Mycobacterium phage SuperAwesome, complete genome) position: , mismatch: 5, identity: 0.815

cgctcaaggtattcaaggcgaaacagg	CRISPR spacer
gccacaaggcattcaaggcgagacagg	Protospacer
  * *****.***********.*****

58. spacer 2.2|2727999|27|NC_014934|CRT matches to MG099945 (Mycobacterium phage Koko, complete genome) position: , mismatch: 5, identity: 0.815

cgctcaaggtattcaaggcgaaacagg	CRISPR spacer
gccacaaggcattcaaggcgagacagg	Protospacer
  * *****.***********.*****

59. spacer 2.2|2727999|27|NC_014934|CRT matches to MK894433 (Mycobacterium phage Kipper29, complete genome) position: , mismatch: 5, identity: 0.815

cgctcaaggtattcaaggcgaaacagg	CRISPR spacer
gccacaaggcattcaaggcgagacagg	Protospacer
  * *****.***********.*****

60. spacer 2.2|2727999|27|NC_014934|CRT matches to NC_022985 (Mycobacterium phage Zaka, complete genome) position: , mismatch: 5, identity: 0.815

cgctcaaggtattcaaggcgaaacagg	CRISPR spacer
gccacaaggcattcaaggcgagacagg	Protospacer
  * *****.***********.*****

61. spacer 2.2|2727999|27|NC_014934|CRT matches to JN049605 (Mycobacterium virus EricB, complete genome) position: , mismatch: 5, identity: 0.815

cgctcaaggtattcaaggcgaaacagg	CRISPR spacer
gccacaaggcattcaaggcgagacagg	Protospacer
  * *****.***********.*****

62. spacer 2.2|2727999|27|NC_014934|CRT matches to MN586039 (Mycobacterium phage Blinn1, complete genome) position: , mismatch: 5, identity: 0.815

cgctcaaggtattcaaggcgaaacagg	CRISPR spacer
gccacaaggcattcaaggcgagacagg	Protospacer
  * *****.***********.*****

63. spacer 2.2|2727999|27|NC_014934|CRT matches to NC_021772 (Salmonella phage FSL SP-058, complete genome) position: , mismatch: 5, identity: 0.815

cgctcaaggtattcaaggcgaaacagg	CRISPR spacer
tgagcaaggtattcaaggcgaagctgg	Protospacer
.*  ******************.* **

64. spacer 2.2|2727999|27|NC_014934|CRT matches to MH779517 (Mycobacterium phage Zulu, complete genome) position: , mismatch: 5, identity: 0.815

cgctcaaggtattcaaggcgaaacagg	CRISPR spacer
gccacaaggcattcaaggcgagacagg	Protospacer
  * *****.***********.*****

65. spacer 2.2|2727999|27|NC_014934|CRT matches to NC_029077 (Mycobacterium phage VohminGhazi, complete genome) position: , mismatch: 5, identity: 0.815

cgctcaaggtattcaaggcgaaacagg	CRISPR spacer
gccacaaggcattcaaggcgagacagg	Protospacer
  * *****.***********.*****

66. spacer 2.2|2727999|27|NC_014934|CRT matches to JN700521 (Staphylococcus phage StB20, complete genome) position: , mismatch: 5, identity: 0.815

cgctcaaggtattcaaggcgaaacagg	CRISPR spacer
agaacaaggtattcaaggagaaaaagg	Protospacer
 *  ************** **** ***

67. spacer 2.4|2728134|27|NC_014934|CRT matches to NZ_CP017148 (Bosea vaviloviae strain Vaf18 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
ccatcaaggagttcaaggaggtcaagc	Protospacer
.  *****************.*****

68. spacer 2.4|2728134|27|NC_014934|CRT matches to LT961841 (Yersinia phage fPS-89 genome assembly, complete genome: monopartite) position: , mismatch: 5, identity: 0.815

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
ccctcaaggagttcaaggagattaacc	Protospacer
. ********************.**

69. spacer 2.4|2728134|27|NC_014934|CRT matches to LT962475 (Yersinia phage fPS-54-ocr genome assembly, complete genome: monopartite) position: , mismatch: 5, identity: 0.815

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
ccctcaaggagttcaaggagattaacc	Protospacer
. ********************.**

70. spacer 2.4|2728134|27|NC_014934|CRT matches to LT960606 (Yersinia phage fPS-9 genome assembly, complete genome: monopartite) position: , mismatch: 5, identity: 0.815

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
ccctcaaggagttcaaggagattaacc	Protospacer
. ********************.**

71. spacer 2.4|2728134|27|NC_014934|CRT matches to LT962380 (Yersinia phage fPS-85 genome assembly, complete genome: monopartite) position: , mismatch: 5, identity: 0.815

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
ccctcaaggagttcaaggagattaacc	Protospacer
. ********************.**

72. spacer 2.4|2728134|27|NC_014934|CRT matches to NC_047935 (Yersinia phage fPS-59 genome assembly, complete genome: monopartite) position: , mismatch: 5, identity: 0.815

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
ccctcaaggagttcaaggagattaacc	Protospacer
. ********************.**

73. spacer 2.4|2728134|27|NC_014934|CRT matches to LT961837 (Yersinia phage fPS-52 genome assembly, complete genome: monopartite) position: , mismatch: 5, identity: 0.815

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
ccctcaaggagttcaaggagattaacc	Protospacer
. ********************.**

74. spacer 2.4|2728134|27|NC_014934|CRT matches to LT962907 (Yersinia phage fPS-10 genome assembly, complete genome: monopartite) position: , mismatch: 5, identity: 0.815

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
ccctcaaggagttcaaggagattaacc	Protospacer
. ********************.**

75. spacer 2.4|2728134|27|NC_014934|CRT matches to LT961839 (unidentified phage genome assembly, chromosome: I) position: , mismatch: 5, identity: 0.815

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
ccctcaaggagttcaaggagattaacc	Protospacer
. ********************.**

76. spacer 2.4|2728134|27|NC_014934|CRT matches to LT961838 (Yersinia phage fPS-19 genome assembly, complete genome: monopartite) position: , mismatch: 5, identity: 0.815

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
ccctcaaggagttcaaggagattaacc	Protospacer
. ********************.**

77. spacer 2.4|2728134|27|NC_014934|CRT matches to LT961842 (Yersinia phage fPS-86 genome assembly, complete genome: monopartite) position: , mismatch: 5, identity: 0.815

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
ccctcaaggagttcaaggagattaacc	Protospacer
. ********************.**

78. spacer 2.4|2728134|27|NC_014934|CRT matches to LT962906 (Yersinia phage fPS16 genome assembly, complete genome: monopartite) position: , mismatch: 5, identity: 0.815

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
ccctcaaggagttcaaggagattaacc	Protospacer
. ********************.**

79. spacer 2.4|2728134|27|NC_014934|CRT matches to NC_047936 (Yersinia phage fPS-53 genome assembly, complete genome: monopartite) position: , mismatch: 5, identity: 0.815

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
ccctcaaggagttcaaggagattaacc	Protospacer
. ********************.**

80. spacer 2.4|2728134|27|NC_014934|CRT matches to LT961836 (Yersinia phage fPS-26 genome assembly, complete genome: monopartite) position: , mismatch: 5, identity: 0.815

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
ccctcaaggagttcaaggagattaacc	Protospacer
. ********************.**

81. spacer 2.4|2728134|27|NC_014934|CRT matches to LT961840 (Yersinia phage fPS-7 genome assembly, complete genome: monopartite) position: , mismatch: 5, identity: 0.815

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
ccctcaaggagttcaaggagattaacc	Protospacer
. ********************.**

82. spacer 2.4|2728134|27|NC_014934|CRT matches to LT961844 (Yersinia phage fPS-21 genome assembly, complete genome: monopartite) position: , mismatch: 5, identity: 0.815

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
ccctcaaggagttcaaggagattaacc	Protospacer
. ********************.**

83. spacer 2.4|2728134|27|NC_014934|CRT matches to LT961846 (Yersinia phage fPS-64 genome assembly, complete genome: monopartite) position: , mismatch: 5, identity: 0.815

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
ccctcaaggagttcaaggagattaacc	Protospacer
. ********************.**

84. spacer 2.4|2728134|27|NC_014934|CRT matches to LT961843 (Yersinia phage fPS-50 genome assembly, complete genome: monopartite) position: , mismatch: 5, identity: 0.815

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
ccctcaaggagttcaaggagattaacc	Protospacer
. ********************.**

85. spacer 2.4|2728134|27|NC_014934|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 5, identity: 0.815

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
accccaaggagttcaaggaattcaagg	Protospacer
  *.***************. ******

86. spacer 2.4|2728134|27|NC_014934|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 5, identity: 0.815

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
accccaaggagttcaaggaattcaagg	Protospacer
  *.***************. ******

87. spacer 2.4|2728134|27|NC_014934|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 5, identity: 0.815

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
accccaaggagttcaaggaattcaagg	Protospacer
  *.***************. ******

88. spacer 2.4|2728134|27|NC_014934|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 5, identity: 0.815

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
accccaaggagttcaaggaattcaagg	Protospacer
  *.***************. ******

89. spacer 2.4|2728134|27|NC_014934|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 5, identity: 0.815

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
accccaaggagttcaaggacttcaagg	Protospacer
  *.***************  ******

90. spacer 2.4|2728134|27|NC_014934|CRT matches to MG018928 (Pseudomonas phage inbricus, complete genome) position: , mismatch: 5, identity: 0.815

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
agctcaaggagttcaccgagatcatcg	Protospacer
 **************  *******  *

91. spacer 2.4|2728134|27|NC_014934|CRT matches to MK962632 (Achromobacter phage vB_AxyP_19-32_Axy13, complete genome) position: , mismatch: 5, identity: 0.815

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
agctcaaggagttcaccgagatcatcg	Protospacer
 **************  *******  *

92. spacer 2.5|2728206|27|NC_014934|CRT matches to NZ_CP017148 (Bosea vaviloviae strain Vaf18 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
ccatcaaggagttcaaggaggtcaagc	Protospacer
.  *****************.*****

93. spacer 2.5|2728206|27|NC_014934|CRT matches to LT961841 (Yersinia phage fPS-89 genome assembly, complete genome: monopartite) position: , mismatch: 5, identity: 0.815

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
ccctcaaggagttcaaggagattaacc	Protospacer
. ********************.**

94. spacer 2.5|2728206|27|NC_014934|CRT matches to LT962475 (Yersinia phage fPS-54-ocr genome assembly, complete genome: monopartite) position: , mismatch: 5, identity: 0.815

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
ccctcaaggagttcaaggagattaacc	Protospacer
. ********************.**

95. spacer 2.5|2728206|27|NC_014934|CRT matches to LT960606 (Yersinia phage fPS-9 genome assembly, complete genome: monopartite) position: , mismatch: 5, identity: 0.815

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
ccctcaaggagttcaaggagattaacc	Protospacer
. ********************.**

96. spacer 2.5|2728206|27|NC_014934|CRT matches to LT962380 (Yersinia phage fPS-85 genome assembly, complete genome: monopartite) position: , mismatch: 5, identity: 0.815

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
ccctcaaggagttcaaggagattaacc	Protospacer
. ********************.**

97. spacer 2.5|2728206|27|NC_014934|CRT matches to NC_047935 (Yersinia phage fPS-59 genome assembly, complete genome: monopartite) position: , mismatch: 5, identity: 0.815

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
ccctcaaggagttcaaggagattaacc	Protospacer
. ********************.**

98. spacer 2.5|2728206|27|NC_014934|CRT matches to LT961837 (Yersinia phage fPS-52 genome assembly, complete genome: monopartite) position: , mismatch: 5, identity: 0.815

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
ccctcaaggagttcaaggagattaacc	Protospacer
. ********************.**

99. spacer 2.5|2728206|27|NC_014934|CRT matches to LT962907 (Yersinia phage fPS-10 genome assembly, complete genome: monopartite) position: , mismatch: 5, identity: 0.815

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
ccctcaaggagttcaaggagattaacc	Protospacer
. ********************.**

100. spacer 2.5|2728206|27|NC_014934|CRT matches to LT961839 (unidentified phage genome assembly, chromosome: I) position: , mismatch: 5, identity: 0.815

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
ccctcaaggagttcaaggagattaacc	Protospacer
. ********************.**

101. spacer 2.5|2728206|27|NC_014934|CRT matches to LT961838 (Yersinia phage fPS-19 genome assembly, complete genome: monopartite) position: , mismatch: 5, identity: 0.815

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
ccctcaaggagttcaaggagattaacc	Protospacer
. ********************.**

102. spacer 2.5|2728206|27|NC_014934|CRT matches to LT961842 (Yersinia phage fPS-86 genome assembly, complete genome: monopartite) position: , mismatch: 5, identity: 0.815

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
ccctcaaggagttcaaggagattaacc	Protospacer
. ********************.**

103. spacer 2.5|2728206|27|NC_014934|CRT matches to LT962906 (Yersinia phage fPS16 genome assembly, complete genome: monopartite) position: , mismatch: 5, identity: 0.815

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
ccctcaaggagttcaaggagattaacc	Protospacer
. ********************.**

104. spacer 2.5|2728206|27|NC_014934|CRT matches to NC_047936 (Yersinia phage fPS-53 genome assembly, complete genome: monopartite) position: , mismatch: 5, identity: 0.815

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
ccctcaaggagttcaaggagattaacc	Protospacer
. ********************.**

105. spacer 2.5|2728206|27|NC_014934|CRT matches to LT961836 (Yersinia phage fPS-26 genome assembly, complete genome: monopartite) position: , mismatch: 5, identity: 0.815

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
ccctcaaggagttcaaggagattaacc	Protospacer
. ********************.**

106. spacer 2.5|2728206|27|NC_014934|CRT matches to LT961840 (Yersinia phage fPS-7 genome assembly, complete genome: monopartite) position: , mismatch: 5, identity: 0.815

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
ccctcaaggagttcaaggagattaacc	Protospacer
. ********************.**

107. spacer 2.5|2728206|27|NC_014934|CRT matches to LT961844 (Yersinia phage fPS-21 genome assembly, complete genome: monopartite) position: , mismatch: 5, identity: 0.815

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
ccctcaaggagttcaaggagattaacc	Protospacer
. ********************.**

108. spacer 2.5|2728206|27|NC_014934|CRT matches to LT961846 (Yersinia phage fPS-64 genome assembly, complete genome: monopartite) position: , mismatch: 5, identity: 0.815

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
ccctcaaggagttcaaggagattaacc	Protospacer
. ********************.**

109. spacer 2.5|2728206|27|NC_014934|CRT matches to LT961843 (Yersinia phage fPS-50 genome assembly, complete genome: monopartite) position: , mismatch: 5, identity: 0.815

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
ccctcaaggagttcaaggagattaacc	Protospacer
. ********************.**

110. spacer 2.5|2728206|27|NC_014934|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 5, identity: 0.815

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
accccaaggagttcaaggaattcaagg	Protospacer
  *.***************. ******

111. spacer 2.5|2728206|27|NC_014934|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 5, identity: 0.815

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
accccaaggagttcaaggaattcaagg	Protospacer
  *.***************. ******

112. spacer 2.5|2728206|27|NC_014934|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 5, identity: 0.815

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
accccaaggagttcaaggaattcaagg	Protospacer
  *.***************. ******

113. spacer 2.5|2728206|27|NC_014934|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 5, identity: 0.815

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
accccaaggagttcaaggaattcaagg	Protospacer
  *.***************. ******

114. spacer 2.5|2728206|27|NC_014934|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 5, identity: 0.815

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
accccaaggagttcaaggacttcaagg	Protospacer
  *.***************  ******

115. spacer 2.5|2728206|27|NC_014934|CRT matches to MG018928 (Pseudomonas phage inbricus, complete genome) position: , mismatch: 5, identity: 0.815

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
agctcaaggagttcaccgagatcatcg	Protospacer
 **************  *******  *

116. spacer 2.5|2728206|27|NC_014934|CRT matches to MK962632 (Achromobacter phage vB_AxyP_19-32_Axy13, complete genome) position: , mismatch: 5, identity: 0.815

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
agctcaaggagttcaccgagatcatcg	Protospacer
 **************  *******  *

117. spacer 2.2|2727999|27|NC_014934|CRT matches to HQ634192 (Cellulophaga phage phiST genomic sequence) position: , mismatch: 6, identity: 0.778

cgctcaaggtattcaaggcgaaacagg	CRISPR spacer
aatccaaggaattcaaggcgaaaaagg	Protospacer
 ...***** ************* ***

118. spacer 2.2|2727999|27|NC_014934|CRT matches to KC821604 (Cellulophaga phage phiST, complete genome) position: , mismatch: 6, identity: 0.778

cgctcaaggtattcaaggcgaaacagg	CRISPR spacer
aatccaaggaattcaaggcgaaaaagg	Protospacer
 ...***** ************* ***

119. spacer 2.2|2727999|27|NC_014934|CRT matches to KC821621 (Cellulophaga phage phi19:2, complete genome) position: , mismatch: 6, identity: 0.778

cgctcaaggtattcaaggcgaaacagg	CRISPR spacer
aatccaaggaattcaaggcgaaaaagg	Protospacer
 ...***** ************* ***

120. spacer 2.2|2727999|27|NC_014934|CRT matches to KC821625 (Cellulophaga phage phi13:1, complete genome) position: , mismatch: 6, identity: 0.778

cgctcaaggtattcaaggcgaaacagg	CRISPR spacer
aatccaaggaattcaaggcgaaaaagg	Protospacer
 ...***** ************* ***

121. spacer 2.4|2728134|27|NC_014934|CRT matches to NZ_KJ588780 (Achromobacter xylosoxidans strain A22732 plasmid pA22732-IMP, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

122. spacer 2.4|2728134|27|NC_014934|CRT matches to NZ_KP289281 (Pseudomonas sp. EGD-AKN5 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

123. spacer 2.4|2728134|27|NC_014934|CRT matches to NZ_MN366359 (Bacterium plasmid pALTS31, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

124. spacer 2.4|2728134|27|NC_014934|CRT matches to NC_001735 (Enterobacter aerogenes plasmid R751, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

125. spacer 2.4|2728134|27|NC_014934|CRT matches to NZ_CP015373 (Pandoraea pnomenusa strain MCB032 plasmid unnamed 2, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

126. spacer 2.4|2728134|27|NC_014934|CRT matches to AGRM01000006 (Salmonella enterica subsp. houtenae str. ATCC BAA-1581 plasmid pSEHO0A1, complete sequence, whole genome shotgun sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

127. spacer 2.4|2728134|27|NC_014934|CRT matches to NC_017908 (Mycobacterium abscessus subsp. bolletii F1725 plasmid BRA100, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

128. spacer 2.4|2728134|27|NC_014934|CRT matches to AJ863570 (Uncultured bacterium IncP-1beta multiresistance plasmid pB8) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

129. spacer 2.4|2728134|27|NC_014934|CRT matches to NC_008459 (Bordetella pertussis plasmid pBP136 DNA, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

130. spacer 2.4|2728134|27|NC_014934|CRT matches to KU238092 (Uncultured bacterium plasmid pDTC28, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

131. spacer 2.4|2728134|27|NC_014934|CRT matches to JX469834 (Uncultured bacterium plasmid pDS3, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

132. spacer 2.4|2728134|27|NC_014934|CRT matches to JX469831 (Uncultured bacterium plasmid pKSP212, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

133. spacer 2.4|2728134|27|NC_014934|CRT matches to JN106172 (Uncultured bacterium plasmid pAKD29, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

134. spacer 2.4|2728134|27|NC_014934|CRT matches to JN106173 (Uncultured bacterium plasmid pAKD31, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

135. spacer 2.4|2728134|27|NC_014934|CRT matches to JN106174 (Uncultured bacterium plasmid pAKD33, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

136. spacer 2.4|2728134|27|NC_014934|CRT matches to NC_004956 (Pseudomonas sp. ADP atrazine catabolic plasmid pADP-1, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

137. spacer 2.4|2728134|27|NC_014934|CRT matches to JN106164 (Uncultured bacterium plasmid pAKD1, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

138. spacer 2.4|2728134|27|NC_014934|CRT matches to JN106165 (Uncultured bacterium plasmid pAKD14, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

139. spacer 2.4|2728134|27|NC_014934|CRT matches to JN106166 (Uncultured bacterium plasmid pAKD15, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

140. spacer 2.4|2728134|27|NC_014934|CRT matches to JN106168 (Uncultured bacterium plasmid pAKD17, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

141. spacer 2.4|2728134|27|NC_014934|CRT matches to JN106169 (Uncultured bacterium plasmid pAKD18, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

142. spacer 2.4|2728134|27|NC_014934|CRT matches to NC_014911 (Alicycliphilus denitrificans BC plasmid pALIDE02, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

143. spacer 2.4|2728134|27|NC_014934|CRT matches to MN386974 (Pseudomonas aeruginosa strain 1943 plasmid pPaeBURNS1, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

144. spacer 2.4|2728134|27|NC_014934|CRT matches to MG879028 (Uncultured bacterium plasmid pEG1-1, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

145. spacer 2.4|2728134|27|NC_014934|CRT matches to NZ_CP021650 (Acidovorax sp. T1 plasmid p2-T1, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

146. spacer 2.4|2728134|27|NC_014934|CRT matches to KF743817 (Proteus mirabilis plasmid R772, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

147. spacer 2.4|2728134|27|NC_014934|CRT matches to KF743818 (Bordetella bronchiseptica plasmid R906, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

148. spacer 2.4|2728134|27|NC_014934|CRT matches to NZ_CP054613 (Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggcgttcaaggagaaggacc	Protospacer
********* ***********  .*

149. spacer 2.4|2728134|27|NC_014934|CRT matches to JX486125 (Uncultured bacterium plasmid pRWC72a, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

150. spacer 2.4|2728134|27|NC_014934|CRT matches to NZ_CP019238 (Rhodoferax koreense strain DCY-110 plasmid unnamed2) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

151. spacer 2.4|2728134|27|NC_014934|CRT matches to NZ_CP038640 (Cupriavidus oxalaticus strain X32 plasmid unnamed5, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

152. spacer 2.4|2728134|27|NC_014934|CRT matches to KC170279 (Uncultured bacterium plasmid pMBUI8, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

153. spacer 2.4|2728134|27|NC_014934|CRT matches to KU356987 (Variovorax paradoxus plasmid pBS64, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

154. spacer 2.4|2728134|27|NC_014934|CRT matches to KU356988 (Variovorax paradoxus plasmid pHB44, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

155. spacer 2.4|2728134|27|NC_014934|CRT matches to NZ_CP009797 (Burkholderia ambifaria AMMD plasmid pBII_1, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

156. spacer 2.4|2728134|27|NC_014934|CRT matches to NC_013176 (Pseudomonas putida plasmid pW2, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

157. spacer 2.4|2728134|27|NC_014934|CRT matches to NC_019312 (Delftia sp. KV29 plasmid pKV29, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

158. spacer 2.4|2728134|27|NC_014934|CRT matches to NC_019320 (Variovorax sp. DB1 plasmid pDB1, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

159. spacer 2.4|2728134|27|NC_014934|CRT matches to NZ_CP017455 (Dickeya solani strain PPO 9019 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

160. spacer 2.4|2728134|27|NC_014934|CRT matches to NC_021077 (Comamonas sp. 7D-2 plasmid pBHB, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

161. spacer 2.4|2728134|27|NC_014934|CRT matches to NC_007337 (Cupriavidus pinatubonensis JMP134 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

162. spacer 2.4|2728134|27|NC_014934|CRT matches to NC_024998 (Acidovorax avenae subsp. avenae plasmid pAAA83 DNA, complete sequence, strain: 83) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

163. spacer 2.4|2728134|27|NC_014934|CRT matches to NZ_MH053445 (Pseudomonas aeruginosa strain PA1280 plasmid pICP-4GES, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

164. spacer 2.4|2728134|27|NC_014934|CRT matches to NC_005088 (Delftia acidovorans B plasmid pUO1, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

165. spacer 2.4|2728134|27|NC_014934|CRT matches to NC_008385 (Burkholderia ambifaria AMMD plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

166. spacer 2.4|2728134|27|NC_014934|CRT matches to DQ222855 (Bacillus anthracis phage Gamma isolate 53, complete genome) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
gatccaaggagttcaaggacttcaagg	Protospacer
 ...***************  ******

167. spacer 2.4|2728134|27|NC_014934|CRT matches to DQ289555 (Bacillus anthracis phage W Beta, complete genome) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
gatccaaggagttcaaggacttcaagg	Protospacer
 ...***************  ******

168. spacer 2.4|2728134|27|NC_014934|CRT matches to NC_007734 (Bacillus phage WBeta, complete genome) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
gatccaaggagttcaaggacttcaagg	Protospacer
 ...***************  ******

169. spacer 2.4|2728134|27|NC_014934|CRT matches to NC_048144 (Microbacterium phage Schubert, complete genome) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tcctcaaggagctcaaggagatcgcta	Protospacer
* *********.***********.  .

170. spacer 2.4|2728134|27|NC_014934|CRT matches to DQ222854 (Bacillus anthracis phage Gamma collagen region, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
gatccaaggagttcaaggacttcaagg	Protospacer
 ...***************  ******

171. spacer 2.5|2728206|27|NC_014934|CRT matches to NZ_KJ588780 (Achromobacter xylosoxidans strain A22732 plasmid pA22732-IMP, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

172. spacer 2.5|2728206|27|NC_014934|CRT matches to NZ_KP289281 (Pseudomonas sp. EGD-AKN5 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

173. spacer 2.5|2728206|27|NC_014934|CRT matches to NZ_MN366359 (Bacterium plasmid pALTS31, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

174. spacer 2.5|2728206|27|NC_014934|CRT matches to NC_001735 (Enterobacter aerogenes plasmid R751, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

175. spacer 2.5|2728206|27|NC_014934|CRT matches to NZ_CP015373 (Pandoraea pnomenusa strain MCB032 plasmid unnamed 2, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

176. spacer 2.5|2728206|27|NC_014934|CRT matches to AGRM01000006 (Salmonella enterica subsp. houtenae str. ATCC BAA-1581 plasmid pSEHO0A1, complete sequence, whole genome shotgun sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

177. spacer 2.5|2728206|27|NC_014934|CRT matches to NC_017908 (Mycobacterium abscessus subsp. bolletii F1725 plasmid BRA100, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

178. spacer 2.5|2728206|27|NC_014934|CRT matches to AJ863570 (Uncultured bacterium IncP-1beta multiresistance plasmid pB8) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

179. spacer 2.5|2728206|27|NC_014934|CRT matches to NC_008459 (Bordetella pertussis plasmid pBP136 DNA, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

180. spacer 2.5|2728206|27|NC_014934|CRT matches to KU238092 (Uncultured bacterium plasmid pDTC28, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

181. spacer 2.5|2728206|27|NC_014934|CRT matches to JX469834 (Uncultured bacterium plasmid pDS3, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

182. spacer 2.5|2728206|27|NC_014934|CRT matches to JX469831 (Uncultured bacterium plasmid pKSP212, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

183. spacer 2.5|2728206|27|NC_014934|CRT matches to JN106172 (Uncultured bacterium plasmid pAKD29, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

184. spacer 2.5|2728206|27|NC_014934|CRT matches to JN106173 (Uncultured bacterium plasmid pAKD31, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

185. spacer 2.5|2728206|27|NC_014934|CRT matches to JN106174 (Uncultured bacterium plasmid pAKD33, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

186. spacer 2.5|2728206|27|NC_014934|CRT matches to NC_004956 (Pseudomonas sp. ADP atrazine catabolic plasmid pADP-1, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

187. spacer 2.5|2728206|27|NC_014934|CRT matches to JN106164 (Uncultured bacterium plasmid pAKD1, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

188. spacer 2.5|2728206|27|NC_014934|CRT matches to JN106165 (Uncultured bacterium plasmid pAKD14, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

189. spacer 2.5|2728206|27|NC_014934|CRT matches to JN106166 (Uncultured bacterium plasmid pAKD15, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

190. spacer 2.5|2728206|27|NC_014934|CRT matches to JN106168 (Uncultured bacterium plasmid pAKD17, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

191. spacer 2.5|2728206|27|NC_014934|CRT matches to JN106169 (Uncultured bacterium plasmid pAKD18, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

192. spacer 2.5|2728206|27|NC_014934|CRT matches to NC_014911 (Alicycliphilus denitrificans BC plasmid pALIDE02, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

193. spacer 2.5|2728206|27|NC_014934|CRT matches to MN386974 (Pseudomonas aeruginosa strain 1943 plasmid pPaeBURNS1, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

194. spacer 2.5|2728206|27|NC_014934|CRT matches to MG879028 (Uncultured bacterium plasmid pEG1-1, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

195. spacer 2.5|2728206|27|NC_014934|CRT matches to NZ_CP021650 (Acidovorax sp. T1 plasmid p2-T1, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

196. spacer 2.5|2728206|27|NC_014934|CRT matches to KF743817 (Proteus mirabilis plasmid R772, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

197. spacer 2.5|2728206|27|NC_014934|CRT matches to KF743818 (Bordetella bronchiseptica plasmid R906, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

198. spacer 2.5|2728206|27|NC_014934|CRT matches to NZ_CP054613 (Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggcgttcaaggagaaggacc	Protospacer
********* ***********  .*

199. spacer 2.5|2728206|27|NC_014934|CRT matches to JX486125 (Uncultured bacterium plasmid pRWC72a, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

200. spacer 2.5|2728206|27|NC_014934|CRT matches to NZ_CP019238 (Rhodoferax koreense strain DCY-110 plasmid unnamed2) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

201. spacer 2.5|2728206|27|NC_014934|CRT matches to NZ_CP038640 (Cupriavidus oxalaticus strain X32 plasmid unnamed5, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

202. spacer 2.5|2728206|27|NC_014934|CRT matches to KC170279 (Uncultured bacterium plasmid pMBUI8, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

203. spacer 2.5|2728206|27|NC_014934|CRT matches to KU356987 (Variovorax paradoxus plasmid pBS64, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

204. spacer 2.5|2728206|27|NC_014934|CRT matches to KU356988 (Variovorax paradoxus plasmid pHB44, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

205. spacer 2.5|2728206|27|NC_014934|CRT matches to NZ_CP009797 (Burkholderia ambifaria AMMD plasmid pBII_1, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

206. spacer 2.5|2728206|27|NC_014934|CRT matches to NC_013176 (Pseudomonas putida plasmid pW2, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

207. spacer 2.5|2728206|27|NC_014934|CRT matches to NC_019312 (Delftia sp. KV29 plasmid pKV29, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

208. spacer 2.5|2728206|27|NC_014934|CRT matches to NC_019320 (Variovorax sp. DB1 plasmid pDB1, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

209. spacer 2.5|2728206|27|NC_014934|CRT matches to NZ_CP017455 (Dickeya solani strain PPO 9019 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

210. spacer 2.5|2728206|27|NC_014934|CRT matches to NC_021077 (Comamonas sp. 7D-2 plasmid pBHB, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

211. spacer 2.5|2728206|27|NC_014934|CRT matches to NC_007337 (Cupriavidus pinatubonensis JMP134 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

212. spacer 2.5|2728206|27|NC_014934|CRT matches to NC_024998 (Acidovorax avenae subsp. avenae plasmid pAAA83 DNA, complete sequence, strain: 83) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

213. spacer 2.5|2728206|27|NC_014934|CRT matches to NZ_MH053445 (Pseudomonas aeruginosa strain PA1280 plasmid pICP-4GES, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

214. spacer 2.5|2728206|27|NC_014934|CRT matches to NC_005088 (Delftia acidovorans B plasmid pUO1, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

215. spacer 2.5|2728206|27|NC_014934|CRT matches to NC_008385 (Burkholderia ambifaria AMMD plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tgctcaaggaggccaaggagatcgtca	Protospacer
*********** .**********.  .

216. spacer 2.5|2728206|27|NC_014934|CRT matches to DQ222855 (Bacillus anthracis phage Gamma isolate 53, complete genome) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
gatccaaggagttcaaggacttcaagg	Protospacer
 ...***************  ******

217. spacer 2.5|2728206|27|NC_014934|CRT matches to DQ289555 (Bacillus anthracis phage W Beta, complete genome) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
gatccaaggagttcaaggacttcaagg	Protospacer
 ...***************  ******

218. spacer 2.5|2728206|27|NC_014934|CRT matches to NC_007734 (Bacillus phage WBeta, complete genome) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
gatccaaggagttcaaggacttcaagg	Protospacer
 ...***************  ******

219. spacer 2.5|2728206|27|NC_014934|CRT matches to NC_048144 (Microbacterium phage Schubert, complete genome) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
tcctcaaggagctcaaggagatcgcta	Protospacer
* *********.***********.  .

220. spacer 2.5|2728206|27|NC_014934|CRT matches to DQ222854 (Bacillus anthracis phage Gamma collagen region, complete sequence) position: , mismatch: 6, identity: 0.778

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
gatccaaggagttcaaggacttcaagg	Protospacer
 ...***************  ******

221. spacer 2.4|2728134|27|NC_014934|CRT matches to MK448927 (Streptococcus phage Javan394, complete genome) position: , mismatch: 7, identity: 0.741

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
agctcaaggagttcaaggagttgggat	Protospacer
 ******************* * ...

222. spacer 2.5|2728206|27|NC_014934|CRT matches to MK448927 (Streptococcus phage Javan394, complete genome) position: , mismatch: 7, identity: 0.741

tgctcaaggagttcaaggagatcaagg	CRISPR spacer
agctcaaggagttcaaggagttgggat	Protospacer
 ******************* * ...

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

899091 : 931294

Hokovirus(16.67%)

protease,transposase,tRNA

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013549610.1\|899091_900783_+\|tRNA	lysine--tRNA ligase	A0A1V0SFI4	Hokovirus	3.7e-90	38.4
WP_013549611.1\|901167_903666_+\|protease	zinc-dependent metalloprotease	NA	NA	NA	NA
WP_169311396.1\|903782_903938_+	hypothetical protein	NA	NA	NA	NA
WP_013549613.1\|904130_904307_+	hypothetical protein	NA	NA	NA	NA
WP_013549614.1\|904444_904900_+	hypothetical protein	NA	NA	NA	NA
WP_013549615.1\|904961_906326_-	beta-glucosidase	A0A0B5JD41	Pandoravirus	3.0e-45	27.4
WP_013549616.1\|906328_907327_-	glycosyl transferase	NA	NA	NA	NA
WP_013549617.1\|907572_908862_-	glutamate-1-semialdehyde 2,1-aminomutase	NA	NA	NA	NA
WP_013549618.1\|908870_909707_-	glucosaminidase domain-containing protein	A0A0A7RU71	Clostridium_phage	6.9e-21	38.2
WP_041557933.1\|909703_910609_-	1-aminocyclopropane-1-carboxylate deaminase/D-cysteine desulfhydrase	NA	NA	NA	NA
WP_013549621.1\|911134_911296_+	hypothetical protein	NA	NA	NA	NA
WP_013549622.1\|911371_911926_+	DUF4136 domain-containing protein	NA	NA	NA	NA
WP_013549623.1\|912058_913810_+	aromatic amino acid hydroxylase	NA	NA	NA	NA
WP_013549624.1\|913811_914423_-	DUF4230 domain-containing protein	NA	NA	NA	NA
WP_013549625.1\|914419_915376_-	GSCFA domain-containing protein	NA	NA	NA	NA
WP_013549626.1\|915481_918097_-\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	1.6e-92	40.9
WP_013549627.1\|918289_919267_+	M23 family metallopeptidase	A0A075BS18	Microcystis_phage	5.3e-20	50.5
WP_013549628.1\|919266_919596_+	MerR family transcriptional regulator	NA	NA	NA	NA
WP_013549629.1\|919619_920219_+	LemA family protein	A0A0C5K8T5	Enterococcus_phage	8.2e-08	26.6
WP_013549630.1\|920225_920663_+	TPM domain-containing protein	NA	NA	NA	NA
WP_013549631.1\|920643_921441_+	TPM domain-containing protein	NA	NA	NA	NA
WP_013549632.1\|921502_921970_+	hypothetical protein	NA	NA	NA	NA
WP_013549633.1\|922053_923361_-	ribosome biogenesis GTPase Der	NA	NA	NA	NA
WP_013549634.1\|923527_924022_+	hypothetical protein	NA	NA	NA	NA
WP_013549635.1\|924110_924998_-	GTPase Era	NA	NA	NA	NA
WP_013549636.1\|924984_926349_-	alanine:cation symporter family protein	NA	NA	NA	NA
WP_083807778.1\|926770_926968_-\|transposase	transposase	NA	NA	NA	NA
WP_041557499.1\|926977_927964_-\|transposase	transposase	NA	NA	NA	NA
WP_041557501.1\|928188_929124_-\|transposase	transposase	NA	NA	NA	NA
WP_013548878.1\|929167_929509_-	hypothetical protein	NA	NA	NA	NA
WP_041557503.1\|929723_930077_-\|transposase	transposase family protein	NA	NA	NA	NA
WP_013549637.1\|930213_930771_-	thermonuclease family protein	NA	NA	NA	NA
WP_013549638.1\|930763_931294_-\|protease	retroviral-like aspartic protease family protein	NA	NA	NA	NA

DBSCAN-SWA_2

3607271 : 3615374

Tupanvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013551880.1\|3607271_3608552_-	nucleotide sugar dehydrogenase	M1HYW7	Paramecium_bursaria_Chlorella_virus	3.0e-23	27.5
WP_013551881.1\|3608556_3609555_-	SDR family oxidoreductase	A0A2K9L0I7	Tupanvirus	3.1e-92	53.7
WP_013551882.1\|3609560_3610601_-	NAD-dependent epimerase	A0A2K9KZK0	Tupanvirus	1.4e-15	24.9
WP_041557766.1\|3610663_3612061_-	nucleotide sugar dehydrogenase	A0A127AXI2	Bacillus_phage	2.2e-59	33.8
WP_148229693.1\|3612300_3613425_+	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	A0A0P0YLZ6	Yellowstone_lake_phycodnavirus	1.1e-16	24.8
WP_013551885.1\|3613421_3615374_+	polysaccharide biosynthesis protein	A0A1V0SAI8	Catovirus	2.8e-33	31.4

DBSCAN-SWA_3

3791217 : 3844108

Bacillus_phage(18.18%)

transposase,tRNA,integrase

attL 3794791:3794806|attR 3824267:3824282

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085951520.1\|3791217_3792379_+\|transposase	IS3 family transposase	Q6J1X2	Lactobacillus_phage	1.2e-31	35.8
WP_013552024.1\|3792399_3792612_-	hypothetical protein	NA	NA	NA	NA
WP_013552025.1\|3792855_3793515_-	hypothetical protein	NA	NA	NA	NA
WP_041558267.1\|3793746_3794037_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_013552027.1\|3794038_3794383_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_013552028.1\|3794767_3795481_-	M48 family metallopeptidase	NA	NA	NA	NA
3794791:3794806	attL	NA	NA	NA	NA
WP_013552029.1\|3795480_3798585_-	HsdR family type I site-specific deoxyribonuclease	A0A220A398	Liberibacter_phage	3.3e-52	29.2
WP_013552030.1\|3798581_3799757_-	restriction endonuclease subunit S	NA	NA	NA	NA
WP_013552031.1\|3799747_3802465_-	type I restriction-modification system subunit M	A0A2H4PQP4	Staphylococcus_phage	1.5e-69	35.0
WP_013552032.1\|3802468_3802669_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_013552033.1\|3803817_3804306_-	hypothetical protein	NA	NA	NA	NA
WP_013552034.1\|3804573_3805164_-	TPM domain-containing protein	NA	NA	NA	NA
WP_148229700.1\|3805329_3805851_-	hypothetical protein	NA	NA	NA	NA
WP_013552036.1\|3806116_3806935_-	hypothetical protein	NA	NA	NA	NA
WP_169311409.1\|3806935_3808000_-	serine hydrolase	A0A1D8EXR7	Mycobacterium_phage	3.8e-16	24.5
WP_013552038.1\|3808141_3809278_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_013552039.1\|3809540_3809840_-	hypothetical protein	NA	NA	NA	NA
WP_013552040.1\|3809844_3810195_-	hypothetical protein	NA	NA	NA	NA
WP_148229701.1\|3811573_3812194_-	hypothetical protein	NA	NA	NA	NA
WP_013552042.1\|3812427_3812835_-	hypothetical protein	NA	NA	NA	NA
WP_013552007.1\|3813891_3814362_-	hypothetical protein	NA	NA	NA	NA
WP_013552043.1\|3814595_3815129_-	hypothetical protein	NA	NA	NA	NA
WP_013549058.1\|3815499_3815766_-	hypothetical protein	NA	NA	NA	NA
WP_013552025.1\|3816027_3816687_-	hypothetical protein	NA	NA	NA	NA
WP_013552007.1\|3816914_3817385_-	hypothetical protein	NA	NA	NA	NA
WP_013552044.1\|3817615_3818242_-	hypothetical protein	NA	NA	NA	NA
WP_013552045.1\|3818396_3818621_-	hypothetical protein	NA	NA	NA	NA
WP_013552046.1\|3818620_3818980_-	hypothetical protein	NA	NA	NA	NA
WP_013552047.1\|3819205_3819751_-	hypothetical protein	NA	NA	NA	NA
WP_013552048.1\|3819758_3820265_-	hypothetical protein	NA	NA	NA	NA
WP_013552049.1\|3820446_3821172_-	hypothetical protein	NA	NA	NA	NA
WP_013552050.1\|3821241_3822369_-\|integrase	tyrosine-type recombinase/integrase	S5W9T9	Leptospira_phage	4.5e-31	31.0
WP_013552051.1\|3822454_3822835_+	hypothetical protein	NA	NA	NA	NA
WP_013552052.1\|3823277_3823661_+	hypothetical protein	NA	NA	NA	NA
WP_013552053.1\|3823716_3824562_+	aminotransferase class IV	NA	NA	NA	NA
3824267:3824282	attR	NA	NA	NA	NA
WP_013552054.1\|3824638_3825199_-	YqgE/AlgH family protein	NA	NA	NA	NA
WP_013552055.1\|3825314_3825587_-	HU family DNA-binding protein	A0A249Y2G7	Serratia_phage	7.0e-15	48.9
WP_013552056.1\|3825759_3826707_-\|tRNA	methionyl-tRNA formyltransferase	Q58MV3	Prochlorococcus_phage	4.9e-07	28.9
WP_013552057.1\|3826703_3828605_-	RecQ family ATP-dependent DNA helicase	M1PGQ0	Moumouvirus	4.4e-63	39.6
WP_013552058.1\|3828604_3829147_-	ATP-binding protein	NA	NA	NA	NA
WP_013552059.1\|3829337_3829625_+	DUF493 family protein	NA	NA	NA	NA
WP_013552060.1\|3829712_3830387_+	DUF4290 domain-containing protein	NA	NA	NA	NA
WP_013552061.1\|3830403_3831714_+	UDP-N-acetylglucosamine 1-carboxyvinyltransferase	NA	NA	NA	NA
WP_013552062.1\|3831809_3831998_+	hypothetical protein	NA	NA	NA	NA
WP_013552063.1\|3831979_3832267_-	hypothetical protein	NA	NA	NA	NA
WP_148229702.1\|3832295_3833255_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	5.5e-14	24.7
WP_013552065.1\|3833191_3833503_-\|transposase	transposase	NA	NA	NA	NA
WP_013552066.1\|3833562_3833877_-	hypothetical protein	NA	NA	NA	NA
WP_013552067.1\|3834037_3835882_-	hypothetical protein	NA	NA	NA	NA
WP_013552068.1\|3836063_3836900_-	peptidylprolyl isomerase	NA	NA	NA	NA
WP_013549103.1\|3837211_3838105_-\|transposase	IS1595-like element ISCal1 family transposase	NA	NA	NA	NA
WP_083807802.1\|3838154_3838847_-	SDR family oxidoreductase	W8CYX9	Bacillus_phage	2.8e-07	39.5
WP_041557782.1\|3838909_3839464_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_148229776.1\|3839550_3840099_-	PAS domain-containing protein	NA	NA	NA	NA
WP_013552071.1\|3840149_3841256_-	DUF695 domain-containing protein	NA	NA	NA	NA
WP_013552072.1\|3841267_3842263_-	pirin family protein	NA	NA	NA	NA
WP_013552073.1\|3842268_3842712_-	VOC family protein	NA	NA	NA	NA
WP_085951521.1\|3842880_3844108_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	2.3e-25	33.8

DBSCAN-SWA_4

3898773 : 3956951

Pike_perch_iridovirus(11.11%)

protease,transposase,integrase

attL 3914855:3914870|attR 3958962:3958977

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013552127.1\|3898773_3899733_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_013552128.1\|3899716_3900790_+	AMP-binding protein	NA	NA	NA	NA
WP_013552129.1\|3900792_3901398_-	zinc-ribbon domain-containing protein	NA	NA	NA	NA
WP_013552130.1\|3901723_3903835_+	VWA domain-containing protein	NA	NA	NA	NA
WP_013552131.1\|3903924_3905271_+	aminopeptidase P family protein	NA	NA	NA	NA
WP_013552132.1\|3905267_3906896_-	methylcrotonoyl-CoA carboxylase	A0A1B2ITV7	Pike_perch_iridovirus	8.8e-12	50.7
WP_013552133.1\|3906973_3907957_+	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_013552134.1\|3908036_3908219_+	hypothetical protein	NA	NA	NA	NA
WP_013552135.1\|3908265_3909957_+	energy-dependent translational throttle protein EttA	A0A2K9L3Z8	Tupanvirus	2.6e-43	25.9
WP_041557787.1\|3910096_3910891_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_013552137.1\|3910900_3911365_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_013552138.1\|3911518_3912406_+	hypothetical protein	NA	NA	NA	NA
WP_013552139.1\|3913100_3914498_-	class II fumarate hydratase	NA	NA	NA	NA
WP_013552140.1\|3914642_3914825_+	hypothetical protein	NA	NA	NA	NA
3914855:3914870	attL	NA	NA	NA	NA
WP_013552141.1\|3914921_3917399_-	TonB-dependent receptor	NA	NA	NA	NA
WP_013552142.1\|3917411_3917876_-	hypothetical protein	NA	NA	NA	NA
WP_013552143.1\|3917981_3918323_-	arsenate reductase (glutaredoxin)	A0A2H4J8T1	uncultured_Caudovirales_phage	4.2e-09	35.4
WP_083807803.1\|3918353_3919394_-	peptide chain release factor 2	NA	NA	NA	NA
WP_013552145.1\|3919524_3920379_-	transglutaminase family protein	NA	NA	NA	NA
WP_013552146.1\|3920421_3921369_-	alpha-E domain-containing protein	NA	NA	NA	NA
WP_013552147.1\|3921372_3922839_-	circularly permuted type 2 ATP-grasp protein	NA	NA	NA	NA
WP_013552148.1\|3923036_3925433_+\|protease	zinc-dependent metalloprotease	NA	NA	NA	NA
WP_013552149.1\|3925521_3926544_+	threonine aldolase	NA	NA	NA	NA
WP_013552150.1\|3926545_3926866_-	YegP family protein	NA	NA	NA	NA
WP_013552151.1\|3927082_3928183_+	OmpA family protein	NA	NA	NA	NA
WP_013552152.1\|3928602_3929055_-	thioredoxin family protein	NA	NA	NA	NA
WP_013552153.1\|3929069_3929396_-	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_013552154.1\|3929459_3931598_+	oligopeptidase B	NA	NA	NA	NA
WP_013552155.1\|3931687_3932728_+	cysteine synthase family protein	A0A1X9I5K7	Streptococcus_phage	2.8e-48	36.5
WP_013552156.1\|3932851_3934111_+	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_013552157.1\|3934191_3935310_-	hypothetical protein	NA	NA	NA	NA
WP_013552158.1\|3935413_3936469_-	transporter	NA	NA	NA	NA
WP_013552159.1\|3936581_3936848_+	DUF4834 family protein	NA	NA	NA	NA
WP_013552160.1\|3936947_3939380_+	membrane protein	NA	NA	NA	NA
WP_013552161.1\|3939379_3940651_+	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_013552162.1\|3940650_3942105_+	oligosaccharide flippase family protein	NA	NA	NA	NA
WP_013552163.1\|3942167_3943391_-	hypothetical protein	NA	NA	NA	NA
WP_013552164.1\|3943588_3946366_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	1.0e-230	46.3
WP_013552165.1\|3946627_3947209_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_013552166.1\|3948040_3948622_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_013552168.1\|3948858_3949521_-	endonuclease III	G3CB03	Aeropyrum_pernix_spindle-shaped_virus	4.4e-10	28.4
WP_013552169.1\|3949625_3950087_+	thioredoxin-dependent thiol peroxidase	NA	NA	NA	NA
WP_083807804.1\|3950117_3950357_-\|transposase	transposase	NA	NA	NA	NA
WP_013552170.1\|3950456_3951095_-\|integrase	tyrosine-type recombinase/integrase	A0A2L1IV36	Escherichia_phage	2.6e-36	44.0
WP_013552171.1\|3951220_3951679_-	hypothetical protein	NA	NA	NA	NA
WP_169311410.1\|3951632_3952379_-	hypothetical protein	NA	NA	NA	NA
WP_013552173.1\|3952311_3953136_-	hypothetical protein	NA	NA	NA	NA
WP_013552174.1\|3953290_3956371_+\|transposase	Tn3 family transposase	A0A125RQ78	Bacillus_phage	1.6e-51	27.4
WP_013552175.1\|3956399_3956951_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	A0A0P0I4A4	Acinetobacter_phage	2.4e-14	32.4
3958962:3958977	attR	NA	NA	NA	NA

DBSCAN-SWA_5

4215950 : 4285571

uncultured_Caudovirales_phage(57.14%)

protease,transposase,plate,integrase

attL 4242384:4242400|attR 4269405:4269421

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013548995.1\|4215950_4216844_-\|transposase	IS1595-like element ISCal1 family transposase	NA	NA	NA	NA
WP_148229785.1\|4216911_4218417_-	hypothetical protein	NA	NA	NA	NA
WP_013552389.1\|4218435_4218828_-	acyl-CoA thioesterase	NA	NA	NA	NA
WP_013552390.1\|4218827_4219871_-	glutaminyl-peptide cyclotransferase	NA	NA	NA	NA
WP_013552391.1\|4220207_4221017_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_013552392.1\|4221063_4221717_+	fructose-6-phosphate aldolase	M1PR54	Cyanophage	5.4e-45	45.6
WP_013552393.1\|4222061_4223441_-	transaldolase	NA	NA	NA	NA
WP_013552394.1\|4223611_4225240_+	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	3.1e-49	27.5
WP_013552395.1\|4225313_4226369_-	3-isopropylmalate dehydrogenase	NA	NA	NA	NA
WP_013552396.1\|4226503_4228021_-	2-isopropylmalate synthase	NA	NA	NA	NA
WP_013552397.1\|4228075_4228672_-	3-isopropylmalate dehydratase small subunit	NA	NA	NA	NA
WP_013552398.1\|4228715_4229063_-	four helix bundle protein	NA	NA	NA	NA
WP_013552399.1\|4229091_4230498_-	3-isopropylmalate dehydratase large subunit	NA	NA	NA	NA
WP_013552400.1\|4230873_4231926_+	DUF4138 domain-containing protein	NA	NA	NA	NA
WP_052304020.1\|4231969_4233058_-	TPM domain-containing protein	NA	NA	NA	NA
WP_013552402.1\|4233543_4234707_-	TPM domain-containing protein	NA	NA	NA	NA
WP_013552403.1\|4234691_4235627_-	hypothetical protein	NA	NA	NA	NA
WP_148229707.1\|4235630_4236572_-	hypothetical protein	NA	NA	NA	NA
WP_013552405.1\|4236632_4237550_-	hypothetical protein	NA	NA	NA	NA
WP_041557803.1\|4237608_4237974_-	hypothetical protein	NA	NA	NA	NA
WP_013552407.1\|4237954_4238515_-	LemA family protein	NA	NA	NA	NA
WP_013552408.1\|4238525_4239575_-	hypothetical protein	NA	NA	NA	NA
WP_013552409.1\|4239742_4240792_-	hypothetical protein	NA	NA	NA	NA
WP_013552410.1\|4241032_4241926_+\|transposase	IS1595-like element ISCal1 family transposase	NA	NA	NA	NA
WP_013552411.1\|4241922_4242927_-	hypothetical protein	NA	NA	NA	NA
4242384:4242400	attL	NA	NA	NA	NA
WP_013552412.1\|4243347_4244250_-	hypothetical protein	NA	NA	NA	NA
WP_013552413.1\|4244334_4245378_-	hypothetical protein	NA	NA	NA	NA
WP_013552414.1\|4245449_4246478_-	hypothetical protein	NA	NA	NA	NA
WP_041557808.1\|4246549_4247602_-	hypothetical protein	NA	NA	NA	NA
WP_013552416.1\|4247931_4248843_-	hypothetical protein	NA	NA	NA	NA
WP_013552417.1\|4248903_4249812_-	hypothetical protein	NA	NA	NA	NA
WP_013552418.1\|4249872_4250772_-	hypothetical protein	NA	NA	NA	NA
WP_041557810.1\|4250856_4251909_-	hypothetical protein	NA	NA	NA	NA
WP_013552420.1\|4252638_4253529_+	hypothetical protein	NA	NA	NA	NA
WP_013552421.1\|4253623_4255264_+	DUF4280 domain-containing protein	NA	NA	NA	NA
WP_169311412.1\|4255380_4255650_+	hypothetical protein	NA	NA	NA	NA
WP_013552423.1\|4255710_4258560_+	hypothetical protein	NA	NA	NA	NA
WP_013552424.1\|4258561_4259545_+	hypothetical protein	NA	NA	NA	NA
WP_083807808.1\|4259941_4260163_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_148229708.1\|4260518_4260695_-\|transposase	transposase	NA	NA	NA	NA
WP_013552425.1\|4261248_4263060_-	type IV secretion protein Rhs	NA	NA	NA	NA
WP_013552426.1\|4263905_4264259_-	hypothetical protein	NA	NA	NA	NA
WP_013552427.1\|4265252_4265393_-	hypothetical protein	NA	NA	NA	NA
WP_013552428.1\|4265410_4266040_-	hypothetical protein	NA	NA	NA	NA
WP_148229709.1\|4266132_4266915_-	hypothetical protein	NA	NA	NA	NA
WP_041557812.1\|4266911_4267454_-	hypothetical protein	A0A2H4JFP5	uncultured_Caudovirales_phage	4.1e-06	42.9
WP_013552430.1\|4267784_4268216_-	hypothetical protein	NA	NA	NA	NA
WP_174260387.1\|4268226_4268604_-	hypothetical protein	NA	NA	NA	NA
WP_148229786.1\|4268910_4269495_-	hypothetical protein	NA	NA	NA	NA
4269405:4269421	attR	NA	NA	NA	NA
WP_148229711.1\|4269500_4270418_-	RHS domain-containing protein	A0A2H4JFP5	uncultured_Caudovirales_phage	9.9e-21	32.3
WP_013552433.1\|4270693_4271080_-	hypothetical protein	NA	NA	NA	NA
WP_083807819.1\|4271051_4271468_-	hypothetical protein	A0A2H4JHK7	uncultured_Caudovirales_phage	8.2e-07	53.8
WP_169311413.1\|4271862_4272411_-	DUF4303 domain-containing protein	NA	NA	NA	NA
WP_013552435.1\|4273181_4273442_-	hypothetical protein	NA	NA	NA	NA
WP_013552436.1\|4273432_4277521_-	RHS domain-containing protein	A0A2H4JHK7	uncultured_Caudovirales_phage	4.4e-20	48.6
WP_013552437.1\|4277565_4278900_-	hypothetical protein	NA	NA	NA	NA
WP_013552439.1\|4280785_4282648_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_013552440.1\|4282662_4283094_-	GPW/gp25 family protein	NA	NA	NA	NA
WP_013552441.1\|4283105_4285571_-\|protease	ATP-dependent Clp protease ATP-binding subunit	K4FB40	Cronobacter_phage	2.5e-82	30.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_014934

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection