CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NC_014965	Vibrio vulnificus MO6-24/O chromosome I, complete sequence	0 crisprs	DEDDh,WYL,csx1,cas3,DinG,csa3	0	0	3	0
NC_014966	Vibrio vulnificus MO6-24/O chromosome II, complete sequence	1 crisprs	WYL,cas3,csa3,DEDDh	0	0	3	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

545087 : 560472

uncultured_Mediterranean_phage(22.22%)

tRNA

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013571121.1\|545087_546389_+	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	4.7e-133	58.9
WP_011079514.1\|546776_547058_+	cell division protein FtsB	NA	NA	NA	NA
WP_013571123.1\|547057_547771_+	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	NA	NA	NA	NA
WP_011151152.1\|547767_548244_+	2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase	NA	NA	NA	NA
WP_013571124.1\|548279_549323_+\|tRNA	tRNA pseudouridine(13) synthase TruD	NA	NA	NA	NA
WP_013571125.1\|549328_550096_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	1.1e-68	51.4
WP_011079519.1\|550098_550725_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	2.1e-38	53.6
WP_013571126.1\|550768_551665_+	peptidoglycan DD-metalloendopeptidase family protein	I3PV79	Clostridium_phage	1.1e-13	34.1
WP_011079521.1\|551745_552738_+	RNA polymerase sigma factor RpoS	F4YCU2	Synechococcus_phage	1.2e-35	34.8
WP_013571127.1\|552813_555375_-	DNA mismatch repair protein MutS	A0A1V0SC35	Catovirus	6.0e-31	22.2
WP_013571128.1\|555458_555962_+	nicotinamide-nucleotide amidase	B5TK85	Pseudomonas_phage	2.1e-25	43.9
WP_011079524.1\|556095_557145_+	recombinase RecA	A0A2D1GPX2	Mycobacterium_phage	1.4e-111	60.1
WP_013571129.1\|557248_557710_+	recombination regulator RecX	NA	NA	NA	NA
WP_013571130.1\|557889_560472_+\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	2.9e-78	37.9

DBSCAN-SWA_2

1616142 : 1691510

Vibrio_phage(30.43%)

tail,terminase,capsid,tRNA,head,protease,portal

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011150276.1\|1616142_1617075_-\|tRNA	tRNA 2-thiocytidine(32) synthetase TtcA	A0A0U2S5Z2	Escherichia_phage	3.5e-122	82.9
WP_011080457.1\|1617189_1618137_-	universal stress protein UspE	NA	NA	NA	NA
WP_011080458.1\|1618268_1619015_-	FNR family transcription factor	NA	NA	NA	NA
WP_013571775.1\|1619101_1619779_-	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
WP_011080460.1\|1619778_1619949_-	cbb3-type cytochrome oxidase assembly protein CcoS	NA	NA	NA	NA
WP_013571776.1\|1619952_1622322_-	cadmium-translocating P-type ATPase	A0A218MNH6	uncultured_virus	9.3e-79	31.2
WP_011080462.1\|1622326_1622803_-	FixH family protein	NA	NA	NA	NA
WP_011080463.1\|1622889_1623867_-	cytochrome-c oxidase, cbb3-type subunit III	NA	NA	NA	NA
WP_011080464.1\|1623866_1624040_-	CcoQ/FixQ family Cbb3-type cytochrome c oxidase assembly chaperone	NA	NA	NA	NA
WP_011080465.1\|1624051_1624672_-	cytochrome-c oxidase, cbb3-type subunit II	NA	NA	NA	NA
WP_011080466.1\|1624684_1626118_-	cytochrome-c oxidase, cbb3-type subunit I	NA	NA	NA	NA
WP_044023876.1\|1626368_1626725_+	hypothetical protein	NA	NA	NA	NA
WP_011080467.1\|1626840_1628040_+	FIST C-terminal domain-containing protein	NA	NA	NA	NA
WP_011080468.1\|1628026_1629751_+	response regulator	A0A1V0SGX0	Hokovirus	1.7e-45	31.9
WP_115178442.1\|1629899_1629995_-	hypothetical protein	NA	NA	NA	NA
WP_011150269.1\|1629996_1631214_-	HDOD domain-containing protein	NA	NA	NA	NA
WP_013571780.1\|1631416_1631743_-	hypothetical protein	NA	NA	NA	NA
WP_011080471.1\|1631847_1632159_-	DUF3634 family protein	NA	NA	NA	NA
WP_011150268.1\|1632174_1632624_-	macrodomain Ter protein MatP	NA	NA	NA	NA
WP_011080473.1\|1632812_1634456_+\|protease	Lon protease family protein	NA	NA	NA	NA
WP_011080474.1\|1634527_1635046_+	bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase	NA	NA	NA	NA
WP_011080475.1\|1635189_1635363_-	ribosome modulation factor	NA	NA	NA	NA
WP_044023877.1\|1635528_1637235_-	DUF3466 family protein	NA	NA	NA	NA
WP_013571782.1\|1637242_1639162_-	ABC transporter ATP-binding protein	A0A2K9L3Z8	Tupanvirus	1.7e-54	29.0
WP_026050687.1\|1639139_1639382_-	glutaredoxin family protein	NA	NA	NA	NA
WP_013571784.1\|1639393_1641517_-	bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL	NA	NA	NA	NA
WP_013571785.1\|1642010_1642553_-	cell division protein ZapC	NA	NA	NA	NA
WP_013571786.1\|1642708_1643719_-	quinone-dependent dihydroorotate dehydrogenase	NA	NA	NA	NA
WP_013571788.1\|1644016_1648858_-	NAD-glutamate dehydrogenase	NA	NA	NA	NA
WP_011080483.1\|1649065_1649284_-	DUF2835 domain-containing protein	NA	NA	NA	NA
WP_013571789.1\|1649332_1651960_-	aminopeptidase N	NA	NA	NA	NA
WP_042769936.1\|1652033_1652270_-	ArsR family transcriptional regulator	NA	NA	NA	NA
WP_013571790.1\|1653220_1653733_+	hypothetical protein	NA	NA	NA	NA
WP_013571791.1\|1653729_1654494_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_074000090.1\|1654531_1654897_-	peptidase M15	A0A2I7RAT1	Vibrio_phage	3.9e-37	60.3
WP_013571793.1\|1654880_1655438_-	hypothetical protein	NA	NA	NA	NA
WP_013571794.1\|1655437_1656445_-	radical SAM protein	NA	NA	NA	NA
WP_013571795.1\|1656461_1656827_-	hypothetical protein	Q6TM47	Pseudomonas_phage	3.0e-05	50.0
WP_042770299.1\|1663578_1663974_-	hypothetical protein	NA	NA	NA	NA
WP_013571797.1\|1663976_1664516_-	hypothetical protein	M4MD40	Vibrio_phage	4.5e-21	35.1
WP_013571798.1\|1664526_1665108_-	hypothetical protein	NA	NA	NA	NA
WP_013571799.1\|1665109_1667422_-	hypothetical protein	A0A1Q1PW43	Pseudoalteromonas_phage	4.0e-10	23.1
WP_013571800.1\|1667438_1667729_-	hypothetical protein	NA	NA	NA	NA
WP_013571801.1\|1667773_1668109_-	hypothetical protein	NA	NA	NA	NA
WP_000907300.1\|1668162_1668633_-	hypothetical protein	NA	NA	NA	NA
WP_013571802.1\|1668646_1668970_-	hypothetical protein	NA	NA	NA	NA
WP_013571803.1\|1669017_1669629_-	hypothetical protein	NA	NA	NA	NA
WP_074000098.1\|1669615_1669963_-\|head,tail	head-tail adaptor protein	NA	NA	NA	NA
WP_013571805.1\|1669974_1670526_-	hypothetical protein	A0A2I7QU98	Vibrio_phage	1.5e-08	28.0
WP_013571806.1\|1670540_1671731_-\|capsid	phage major capsid protein	A0A2I7S7N4	Vibrio_phage	8.9e-38	33.8
WP_044023880.1\|1671829_1672693_-\|head,protease	HK97 family phage prohead protease	Q6JIM8	Burkholderia_virus	7.1e-29	39.1
WP_013571808.1\|1672655_1673981_-\|portal	phage portal protein	M4MHV5	Vibrio_phage	1.4e-76	39.2
WP_013571809.1\|1673990_1675751_-\|terminase	terminase large subunit	A0A0K1LKI4	Staphylococcus_phage	1.1e-81	35.9
WP_013571810.1\|1675759_1675942_-	hypothetical protein	NA	NA	NA	NA
WP_013571811.1\|1675941_1676148_-	hypothetical protein	NA	NA	NA	NA
WP_013571812.1\|1676158_1676647_-\|terminase	phage terminase small subunit P27 family	K7PHI2	Enterobacteria_phage	9.0e-05	25.3
WP_013571813.1\|1676676_1677357_-	hypothetical protein	NA	NA	NA	NA
WP_029808128.1\|1677353_1677797_-	hypothetical protein	NA	NA	NA	NA
WP_141105857.1\|1677954_1678551_-	hypothetical protein	NA	NA	NA	NA
WP_000243876.1\|1678805_1678994_-	hypothetical protein	NA	NA	NA	NA
WP_013571816.1\|1679204_1679846_+	antirestriction protein ArdA	G0YPX7	Erwinia_phage	2.0e-12	30.8
WP_013571817.1\|1679901_1680114_+	hypothetical protein	NA	NA	NA	NA
WP_013571818.1\|1680209_1680416_+	hypothetical protein	NA	NA	NA	NA
WP_029824398.1\|1681155_1681572_-	HNH endonuclease	A0A2H4J3B4	uncultured_Caudovirales_phage	5.5e-11	32.5
WP_013571819.1\|1681619_1681790_-	hypothetical protein	NA	NA	NA	NA
WP_013571820.1\|1681826_1682090_-	hypothetical protein	NA	NA	NA	NA
WP_013571821.1\|1682239_1682827_-	deoxynucleoside kinase	F2NYY4	Diadromus_pulchellus_ascovirus	4.3e-09	33.1
WP_013571822.1\|1682835_1683081_-	hypothetical protein	NA	NA	NA	NA
WP_013571823.1\|1683080_1683353_-	hypothetical protein	NA	NA	NA	NA
WP_013571825.1\|1683557_1684151_-	deoxynucleoside kinase	A0A249Y6S3	Cherax_quadricarinatus_iridovirus	9.6e-09	30.0
WP_013571826.1\|1684282_1684540_-	hypothetical protein	NA	NA	NA	NA
WP_029808054.1\|1684536_1684821_-	hypothetical protein	A0A142K9B6	Gordonia_phage	3.9e-08	51.9
WP_052299110.1\|1685018_1685840_-	exonuclease	F1D0G7	Vibrio_phage	2.0e-57	45.1
WP_013571829.1\|1685875_1686148_-	hypothetical protein	NA	NA	NA	NA
WP_013571830.1\|1686160_1686358_-	hypothetical protein	NA	NA	NA	NA
WP_013571831.1\|1686430_1686667_-	hypothetical protein	NA	NA	NA	NA
WP_042770284.1\|1686647_1686842_-	DUF1382 family protein	NA	NA	NA	NA
WP_013571833.1\|1686858_1687806_-	hypothetical protein	A0A1C9LW71	Vibrio_phage	2.6e-48	44.4
WP_013571834.1\|1687821_1689876_-	DNA primase/helicase	A0A0F7DD46	Delftia_phage	2.9e-145	41.3
WP_013571835.1\|1689875_1691510_-	toprim domain-containing protein	L7TLT7	Rhizobium_phage	5.2e-121	48.5

DBSCAN-SWA_3

2614271 : 2621326

Powai_lake_megavirus(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011078529.1\|2614271_2614697_-	nucleoside-diphosphate kinase	A0A167REB2	Powai_lake_megavirus	5.1e-20	41.4
WP_011078530.1\|2614760_2616059_-	aminopeptidase PepB	Q6GYZ8	Mycoplasma_phage	6.5e-34	32.8
WP_011078531.1\|2616211_2616406_-	Fe-S cluster assembly protein IscX	NA	NA	NA	NA
WP_011078532.1\|2616487_2616826_-	ISC system 2Fe-2S type ferredoxin	NA	NA	NA	NA
WP_013572349.1\|2616837_2618691_-	Fe-S protein assembly chaperone HscA	A0A0N9QXN8	Chrysochromulina_ericina_virus	1.1e-106	39.0
WP_011078534.1\|2618712_2619228_-	co-chaperone HscB	NA	NA	NA	NA
WP_011078535.1\|2619288_2619612_-	iron-sulfur cluster assembly protein IscA	A0A2H4N7N5	Lake_Baikal_phage	1.4e-25	53.3
WP_011078536.1\|2619684_2620068_-	Fe-S cluster assembly scaffold IscU	A0A218MKD1	uncultured_virus	2.0e-52	77.4
WP_013572350.1\|2620111_2621326_-	IscS subfamily cysteine desulfurase	A0A1X7C038	Faustovirus	2.2e-31	32.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NC_014966

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_014966_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_014966_1

663917-663990

Orphan

Consensus_repeat	Method
GAATAAACCCTGATTATAAGAGAC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_014966_1

>merge|NC_014966|1|663917-663990|CRISPRCasFinder
GAATAAACCCTGATTATAAGAGACTTAAAGACACGCTCTAGGTCAGTTCTGAATAAACCCTGATTATAAGAGAC

>NC_014966|1|1|663917-663990|CRISPRCasFinder
GAATAAACCCTGATTATAAGAGAC	TTAAAGACACGCTCTAGGTCAGTTCT
GAATAAACCCTGATTATAAGAGAC

Protein	Signature genes	Signature genes Name	Protein_function
NC_014966.1\|WP_015727747.1\|665045_665399_+\|N-acetylmuramoyl-L-alanine-amidase	unknown	unknown	gnl\|CDD\|177282
NC_014966.1\|WP_015727748.1\|665436_665760_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379462
NC_014966.1\|WP_158305940.1\|665923_667432_+\|toprim-domain-containing-protein	unknown	unknown	gnl\|CDD\|238542
NC_014966.1\|WP_015727739.1\|655952_656480_+\|pilus-assembly-protein	unknown	unknown	gnl\|CDD\|377921
NC_014966.1\|WP_015727754.1\|671216_672062_+\|exonuclease	unknown	unknown	gnl\|CDD\|222794
NC_014966.1\|WP_015727751.1\|669650_669896_+\|hypothetical-protein	unknown	unknown	unknown
NC_014966.1\|WP_015727736.1\|653022_653940_+\|type-II-secretion-system-F-family-protein	unknown	unknown	gnl\|CDD\|227300
NC_014966.1\|WP_015727737.1\|653936_654815_+\|type-II-secretion-system-F-family-protein	unknown	unknown	gnl\|CDD\|224975
NC_014966.1\|WP_015727745.1\|661067_663851_+\|DNA-dependent-RNA-polymerase	unknown	unknown	gnl\|CDD\|222797
NC_014966.1\|WP_015727741.1\|657004_658333_+\|VWA-domain-containing-protein	unknown	unknown	gnl\|CDD\|238119
NC_014966.1\|WP_011151958.1\|659139_659520_-\|pyruvate-dehydrogenase	unknown	unknown	gnl\|CDD\|238002
NC_014966.1\|WP_015727752.1\|669885_670590_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|153443
NC_014966.1\|WP_044024036.1\|654807_655956_+\|tetratricopeptide-repeat-protein	unknown	unknown	gnl\|CDD\|276809
NC_014966.1\|WP_015727750.1\|667431_669495_+\|DNA-polymerase	unknown	unknown	gnl\|CDD\|176480
NC_014966.1\|WP_015727753.1\|670700_671132_+\|tellurite-resistance-protein	unknown	unknown	gnl\|CDD\|226316
NC_014966.1\|WP_015727746.1\|664033_664699_+\|phage-single-stranded-DNA-binding-protein	unknown	unknown	gnl\|CDD\|222800
NC_014966.1\|WP_017790788.1\|658304_658901_+\|OmpA-family-protein	unknown	unknown	gnl\|CDD\|143586
NC_014966.1\|WP_148228962.1\|664734_665121_+\|RusA-family-crossover-junction-endodeoxyribonuclease	unknown	unknown	gnl\|CDD\|377564
NC_014966.1\|WP_015727744.1\|659684_660611_+\|endonuclease/exonuclease/phosphatase-family-protein	unknown	unknown	gnl\|CDD\|377028
NC_014966.1\|WP_017790786.1\|656469_657051_+\|pilus-assembly-protein-TadF	unknown	unknown	gnl\|CDD\|374906

Protein	Function_ID	Function_description	E-value
NC_014966.1\|WP_015727747.1\|665045_665399_+\|N-acetylmuramoyl-L-alanine-amidase	gnl\|CDD\|177282	PHA00447, PHA00447, lysozyme.	4.00689e-06
NC_014966.1\|WP_015727748.1\|665436_665760_+\|hypothetical-protein	gnl\|CDD\|379462	pfam14090, HTH_39, Helix-turn-helix domain. This helix-turn-helix domain is often found in phage proteins and is likely to be DNA-binding.	3.43698e-06
NC_014966.1\|WP_158305940.1\|665923_667432_+\|toprim-domain-containing-protein	gnl\|CDD\|238542	cd01122, GP4d_helicase, GP4d_helicase is a homohexameric 5'-3' helicases. Helicases couple NTP hydrolysis to the unwinding of nucleic acid duplexes into their component strands.	6.58623e-51
NC_014966.1\|WP_015727739.1\|655952_656480_+\|pilus-assembly-protein	gnl\|CDD\|377921	pfam07811, TadE, TadE-like protein. The members of this family are similar to a region of the protein product of the bacterial tadE locus. In various bacterial species, the tad locus is closely linked to flp-like genes, which encode proteins required for the production of pili involved in adherence to surfaces. It is thought that the tad loci encode proteins that act to assemble or export an Flp pilus in various bacteria. All tad loci but TadA have putative transmembrane regions, and in fact the region in question is this family has a high proportion of hydrophobic amino acid residues.	5.5542e-05
NC_014966.1\|WP_015727754.1\|671216_672062_+\|exonuclease	gnl\|CDD\|222794	PHA00439, PHA00439, exonuclease.	1.40687e-54
NC_014966.1\|WP_015727736.1\|653022_653940_+\|type-II-secretion-system-F-family-protein	gnl\|CDD\|227300	COG4965, TadB, Flp pilus assembly protein TadB [Intracellular trafficking and secretion].	3.15834e-44
NC_014966.1\|WP_015727737.1\|653936_654815_+\|type-II-secretion-system-F-family-protein	gnl\|CDD\|224975	COG2064, TadC, Flp pilus assembly protein TadC [Cell motility and secretion / Intracellular trafficking and secretion].	1.92449e-12
NC_014966.1\|WP_015727745.1\|661067_663851_+\|DNA-dependent-RNA-polymerase	gnl\|CDD\|222797	PHA00452, PHA00452, T3/T7-like RNA polymerase.	2.12316e-178
NC_014966.1\|WP_015727741.1\|657004_658333_+\|VWA-domain-containing-protein	gnl\|CDD\|238119	cd00198, vWFA, Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF). Typically, the vWA domain is made up of approximately 200 amino acid residues folded into a classic a/b para-rossmann type of fold. The vWA domain, since its discovery, has drawn great interest because of its widespread occurrence and its involvement in a wide variety of important cellular functions. These include basal membrane formation, cell migration, cell differentiation, adhesion, haemostasis, signaling, chromosomal stability, malignant transformation and in immune defenses In integrins these domains form heterodimers while in vWF it forms multimers. There are different interaction surfaces of this domain as seen by the various molecules it complexes with. Ligand binding in most cases is mediated by the presence of a metal ion dependent adhesion site termed as the MIDAS motif that is a characteristic feature of most, if not all A domains.	3.03235e-08
NC_014966.1\|WP_011151958.1\|659139_659520_-\|pyruvate-dehydrogenase	gnl\|CDD\|238002	cd00042, CY, Cystatin-like domain; Cystatins are a family of cysteine protease inhibitors that occur mainly as single domain proteins. However some extracellular proteins such as kininogen, His-rich glycoprotein and fetuin also contain these domains.	2.07503e-08
NC_014966.1\|WP_015727752.1\|669885_670590_+\|hypothetical-protein	gnl\|CDD\|153443	cd08041, OBF_kDNA_ligase_like, The Oligonucleotide/oligosaccharide binding (OB)-fold domain of kDNA ligase-like ATP-dependent DNA ligases is a DNA-binding module that is part of the catalytic core unit. ATP-dependent polynucleotide ligases catalyze phosphodiester bond formation using nicked nucleic acid substrates with the high energy nucleotide of ATP as a cofactor in a three step reaction mechanism. DNA ligases play a vital role in the diverse processes of DNA replication, recombination and repair. ATP-dependent ligases are present in many organisms such as viruses, bacteriohages, eukarya, archaea and bacteria. The mitochondrial DNA of parasitic protozoan is highly unusual. It is termed the kinetoplast DNA (kDNA) and consists of circular DNA molecules (maxicircles) and several thousand smaller circular molecules (minicircles). This group is composed of kDNA ligase, Chlorella virus DNA ligase, and similar proteins. kDNA ligase and Chlorella virus DNA ligase are the smallest known ATP-dependent ligases. They are involved in DNA replication or repair. ATP dependent DNA ligases have a highly modular architecture consisting of a unique arrangement of two or more discrete domains. The adenylation and oligonucleotide/oligosaccharide binding (OB)-fold domains comprise a catalytic core unit that is common to most members of the ATP-dependent DNA ligase family. The catalytic core unit contains six conserved sequence motifs (I, III, IIIa, IV, V and VI) that define this family of related nucleotidyltransferases. The OB-fold domain contacts the nicked DNA substrate and is required for the ATP-dependent DNA ligase nucleotidylation step. The RxDK motif (motif VI), which is essential for ATP hydrolysis, is located in the OB-fold domain.	5.05989e-17
NC_014966.1\|WP_044024036.1\|654807_655956_+\|tetratricopeptide-repeat-protein	gnl\|CDD\|276809	sd00006, TPR, Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.	6.07689e-09
NC_014966.1\|WP_015727750.1\|667431_669495_+\|DNA-polymerase	gnl\|CDD\|176480	cd08643, DNA_pol_A_pol_I_B, Polymerase I functions primarily to fill DNA gaps that arise during DNA repair, recombination and replication. Family A polymerase functions primarily to fill DNA gaps that arise during DNA repair, recombination and replication. DNA-dependent DNA polymerases can be classified in six main groups based upon phylogenetic relationships with E. coli polymerase I (classA), E. coli polymerase II (class B), E.coli polymerase III (class C), euryarchaaeota polymerase II (class D), human polymerase beta (class x), E. coli UmuC/DinB and eukaryotic RAP 30/Xeroderma pigmentosum variant (class Y). Family A polymerase are found primarily in organisms related to prokaryotes and include prokaryotic DNA polymerase I ,mitochondrial polymerase delta, and several bacteriphage polymerases including those from odd-numbered phage (T3, T5, and T7). Prokaryotic Pol Is have two functional domains located on the same polypeptide; a 5'-3' polymerase and 5'-3' exonuclease. Pol I uses its 5' nuclease activity to remove the ribonucleotide portion of newly synthesized Okazaki fragments and DNA polymerase activity to fill in the resulting gap. A combination of phylogenomic and signature sequence-based (or phonetic) approaches is used to understand the evolutionary relationships among bacteria. DNA polymerase I is one of the conserved proteins that is used to search for protein signatures. The structure of these polymerases resembles in overall morphology a cupped human right hand, with fingers (which bind an incoming nucleotide and interact with the single-stranded template), palm (which harbors the catalytic amino acid residues and also binds an incoming dNTP) and thumb (which binds double-stranded DNA) subdomains.	0
NC_014966.1\|WP_015727753.1\|670700_671132_+\|tellurite-resistance-protein	gnl\|CDD\|226316	COG3793, TerB, Tellurite resistance protein [Inorganic ion transport and metabolism].	3.03789e-22
NC_014966.1\|WP_015727746.1\|664033_664699_+\|phage-single-stranded-DNA-binding-protein	gnl\|CDD\|222800	PHA00458, PHA00458, single-stranded DNA-binding protein.	1.33342e-08
NC_014966.1\|WP_017790788.1\|658304_658901_+\|OmpA-family-protein	gnl\|CDD\|143586	cd07185, OmpA_C-like, Peptidoglycan binding domains similar to the C-terminal domain of outer-membrane protein OmpA. OmpA-like domains (named after the C-terminal domain of Escherichia coli OmpA protein) have been shown to non-covalently associate with peptidoglycan, a network of glycan chains composed of disaccharides, which are crosslinked via short peptide bridges. Well-studied members of this family include the Escherichia coli outer membrane protein OmpA, the Escherichia coli lipoprotein PAL, Neisseria meningitdis RmpM, which interact with the outer membrane, as well as the Escherichia coli motor protein MotB, and the Vibrio flagellar motor proteins PomB and MotY, which interact with the inner membrane.	3.02313e-23
NC_014966.1\|WP_148228962.1\|664734_665121_+\|RusA-family-crossover-junction-endodeoxyribonuclease	gnl\|CDD\|377564	pfam05866, RusA, Endodeoxyribonuclease RusA. This family consists of several bacterial and phage Holliday junction resolvase (RusA) like proteins. The RusA protein of Escherichia coli is an endonuclease that can resolve Holliday intermediates and correct the defects in genetic recombination and DNA repair associated with inactivation of RuvAB or RuvC.	0.00391642
NC_014966.1\|WP_015727744.1\|659684_660611_+\|endonuclease/exonuclease/phosphatase-family-protein	gnl\|CDD\|377028	pfam03372, Exo_endo_phos, Endonuclease/Exonuclease/phosphatase family. This large family of proteins includes magnesium dependent endonucleases and a large number of phosphatases involved in intracellular signalling. This family includes: AP endonuclease proteins EC:4.2.99.18, DNase I proteins EC:3.1.21.1, Synaptojanin an inositol-1,4,5-trisphosphate phosphatase EC:3.1.3.56, Sphingomyelinase EC:3.1.4.12, and Nocturnin.	1.70455e-16
NC_014966.1\|WP_017790786.1\|656469_657051_+\|pilus-assembly-protein-TadF	gnl\|CDD\|374906	pfam16964, TadF, Putative tight adherence pilin protein F. TadF is a family of proteins from the tad locus that is part of the type IV bacterial secretory system.	2.9704e-26

>NC_014966.1|WP_015727745.1|661067_663851_+|DNA-dependent-RNA-polymerase
MNLSTFKDTYTATAHEIRYERPEPEVIGVKFAEGFSRQDYVDQINLEYEAREKAYAREMLRFHKSMSEGTEHETTLGKGLIGQNIATLANALRAEHGRTTRGRQNALKRLMEHYANYEHLAVHTLEACVRGITEVRPLVEIAISLVTSIEDELNFSILERQHGNIARNVKARIQTKRDIKHRRETLKWAVKYQAEQDWVRFTTDERVHFGHALIALAATTLGWFKAEQRIEGGHKRIYLIAQDNFMWLLEETQREIARLARPTYAPMVVPPRKWSPETVRRGAYLTPAGRPLSMIKTRNKSYLRELQTAGMEKVYDALNRIQETPVRINKTIYNWLDTFLMQQLPWAMDIGLPAMHKLDIKDYTPTQPEGLPDSDYRVKEYQKACREFYLMEASERSKLSAMLGMMEMAKSYLDRDRFFVPWQGDTRMRVYPVSKLNFQGADYVKALCQFADGVALGKHGLKWLMIHMANLMGVDKVTFEERVKWVKEHKAQIIALAKDPRECRDFLMSADKPMQAIACATELAEAWSMKNHEEFVSYIPIALDGSCSGLQILGAALRCEKTGEHVNLIPAGRVADIYRVVADIVTNEFKSMVGECKSKEDAEALAAQKALEVFTAAHDGDATNFDAALALAKEHAVREDKEKGTEKEASFITEMRKVYRAYTEAYAWLQFGINRGTVKRNVMTYCYGSAQFGFKEQCMEDIIYPAYMEYKQKKNRGEDAEWHFHGNGSAAAALMAKHAYAAVKRTVLRAAQAMDWMQKAAYLIAQDNAPVRWTTPLGFPVLQEYRVTKEVTVDCVIFGKRRQLNIREESLDYDKNKAKNSIAPNVVHSLDSCHLQSLVNLAYEKHGIKHFALIHDSFGTHAGNTEVFFKVIREAMVEMFENTDVFAELEQEFKAQCNPEKHDQFLKLPEYGNLDLHGILESDFAFA
>NC_014966.1|WP_015727744.1|659684_660611_+|endonuclease/exonuclease/phosphatase-family-protein
MLKSYGLWFIIILCTLFYWGVKAQTHLWWAENISAYPALFIVPLVIVAFISFGIRAWTPMLASIGLIIYFAVIGVPKGMVSKGECRNSVRLFQYNMLFSNQHVDQLIDYLSRVQPDLVLLQEVTAPHLEQLKVLDDVYRYRFGGQPKVGLPSHQLIFSRQPLYGMDVFYIEGYQNLIRGIWQVDEEHPVFLLTAHPPSPRNKEMWLRRNALIQALEYQATQSPTKDILIMGDMNLSANSERFDTLFSGMQTAPIASWPNLPTLTLPSWLQISIDHLWLNSDFAICKRESIDEVIGSDHRAIMTYLNIQ
>NC_014966.1|WP_011151958.1|659139_659520_-|pyruvate-dehydrogenase
MKAKLAVAAATLFLLAGCQQEPQENSTLNERHTAICSSTESMPGGWHNAEIDHQVMQALDMVLEQMNTNSPLKEVLSAHTQVVSGVNYAIEFQLENGSSWNTIVYRNLKGEYQITQTAKLGLFCQQ
>NC_014966.1|WP_017790788.1|658304_658901_+|OmpA-family-protein
MKRQVDLRIKMKKTLPILLLVLLSNYAQANCVNTSEEQIITKTLLSTHYKTTQSEGSIVVDEGQTEARVLNRDVQKVKAQNSSEHCFFDEKKMSLVLNYQHNKFGLTDIHQDAIRSYIGIVDPNRKISVEGHADSTGSDTYNKQLSARRANTVARFLKKDLGLGNRIVEKAFGETTPICAAEENQQNGCNRRVVLTLE
>NC_014966.1|WP_015727741.1|657004_658333_+|VWA-domain-containing-protein
MSLKRYPRHFRLRGSSMSIKKQQGVAGIIFMGMLPVLVIIMVFSMQMTQRHMAHAKITEAAEVASLALIASPKEGDEKNQEYAQKIVDHYIPDNKGEVVARVFNRRCEYKDGCVQRSGELAPFTDFVVSAKTKHDSWISYNDGEMGLTKDFEVMGTSTSRKFLPQPLDIYFIIDMSGSMVNPWGGSGKTKYDVVADTINRIVDDLREFKTDRKSRVAVIGFHHTAVKKVGRQRTAFDYSSYRTPSATVNNMFTAPKIHSRNDSSNIKTFEDIPLTEDYDAFLTKFNSSNYYASRYGLTESWQGIIGAAQMAEQATDLNPEQVFILLSDGRDGDFVRYYLEGRQWREVRYNKYLNRLVKAGLCEKLKTRISQKRNVFQSENPSDKASKTKVTMGVIGVNYVVDKSDGIGDCFGHDNIYHAKEGNDVYKYILNLINEETGRLKD
>NC_014966.1|WP_017790786.1|656469_657051_+|pilus-assembly-protein-TadF
MKAKQQGAFMVELALVLMFISGLFVVMANYVVAINTKGQLDRAVYSLATIMAERKQFFNGDLDICGRADPYCSETKRAVNYLSKASLKRMMPGFEESKFGVFVEQLAVEGDKPSNFRKRYKKFSSGATDGCNLPNLDSLTKEEALELLPITSRNRRLPMYQITLCYETPFNIFGLAEGNVVKAVSTSFSFARV
>NC_014966.1|WP_015727739.1|655952_656480_+|pilus-assembly-protein
MKKRQKGALTVEVAMGLPIFLIMVFSWIELCMLSYSMSISDHALTLSVIKTKKAGTSNATTPQDYQKLLEKTINESAGVAWKYLAKEESVNITVDYFKNYQDFVTCNVGYDDIETCPERKDEPKDMAIAMYRMQYTYNTILDGILPDFQVKRELMAIQEYERCAFKIGGGSGCES
>NC_014966.1|WP_044024036.1|654807_655956_+|tetratricopeptide-repeat-protein
MAKWIIKLIILFWIVGCSSISSELQTKERLLLSSGENQQLVEFYKGNLAEVPSYKVKLVNLYLDMGDIKSAELYTNTYTAKDLDEPDYIYSLANLNYKKKRYDSALQESEKFLDEGGDEAAYHLLVGKIYAQRKEYETAIQHFEESRKSGASDREAGNNIAVVYLLQNRYVEATEILYDLYVAMPSDAKVRSNLIISSVQSNRPDIALEVLKHEKGEEDARKQLAALMKTVNKGKNKGKKAVQPQVAQINKDTTRATVVQTAQVTPKAQEETKKVEQAKPVNNVVTANNVVPVSKLDVNNLKPKAPSLYRIQVLASYKAVPNDYLNFLKANYGTVYSYTHGLWKRYCIGEFTDIEEAKAFLNSLNIKGAFVVDYTKKRYVEL
>NC_014966.1|WP_015727737.1|653936_654815_+|type-II-secretion-system-F-family-protein
MTFSLPSAIFILVALIVSVVVAIFALKMWDETRAEISVRKIIGSTKEQQKRDDLFLSFFKRFSFNKDETKKKLVAAGIYSDFIAQTYYLFKIVPLFLTIGGGLLAVSQEVIDFNEMILIGAFALIIFVAGPDLYLSSRTNTITRHVSSRLPFLLDLMNVCVHTGMTIEATLEYLAKELQTVDKYLAFTVNVTVQRSKVIGIEKALEEFYEMVPSSEAQSFVMTLVQSLQFGSSVGQVLGTLATDIRQINMMELEEKIGKLGAKMSIPMIVFIMVPIIILIIAPGIMRMLTDG
>NC_014966.1|WP_015727736.1|653022_653940_+|type-II-secretion-system-F-family-protein
MMWLMVLSWVLLGGYFLTHKRKQEKAIQRIIELEQDFDGVKGQRTVIDAQKFEVSFRAKVRRHFKAFVTILMPNPIKKIGLFLLVTAIALYFINDFVLQMDFLTLLMYAQPPLFVVFVIKLQQAKAAKFKEDFPDALNILSGALSSGQSIVHAFEYVGNQLQNEVGKQFKLMAERLLMGEDPDDVLSRSAASFPYVEYFFFAATIRINLSRGGQLKEVISRINRIMFEARAIDKKKNALTSEARMSAKIIACLPVVFLLILKFTSPENYNYVMFEEGGKPIFYYVLTSEIIGFICIWFILRGVKS
>NC_014966.1|WP_015727746.1|664033_664699_+|phage-single-stranded-DNA-binding-protein
MAKQTTKRPLVTLPVGIAQFPWLNKPDTHYDKNGAYKTDLVVNPEDSDVKETVEKLEDILRDYWQNEKGGKGEMVDVLMEKDGKFFFRVKQSAFEYKGELVLPKPVFYDARGRRMVKEPAIYGGSEIALSVEVWPYSRTETVREGGKRVTIETHGLTLKPKAVQVISLAAKGEAGAPSADYYGFGAHDGGYEYDEDDAQHFPEDGADEQHDAADGSDDGNF
>NC_014966.1|WP_148228962.1|664734_665121_+|RusA-family-crossover-junction-endodeoxyribonuclease
MSTNDMYQGVKVKSAAYRRWEMQVARGLPDIELPSDKRLAVRAIVRYSNKASDLDNCCKSMLDVLQKRYKFDDKNVYVLKLYKVIVPKGQEGLTLKITELEETKWRKFVNAKLLPILQSFLPKLAVKF
>NC_014966.1|WP_015727747.1|665045_665399_+|N-acetylmuramoyl-L-alanine-amidase
MAKVRKRETTAHIAVIFTKTGRQVLSDWDVVLADRKRGVLGHGAHHLILRDGENYPTRDHAVYGNVELECDSYNDDSVFIRVVGDRDTMTDAQCDALEDVIADLQEAYPDAEVVYPN
>NC_014966.1|WP_015727748.1|665436_665760_+|hypothetical-protein
MSKVTQAKQVSEHVAKYGSINSIEAIRHYGITRLSAVVYSLKNTQHALKEGTRDGKFTVYVPDHDARLSALKAAQEVELREAKTGADAARITAHYTALFMKVHQQMK
>NC_014966.1|WP_158305940.1|665923_667432_+|toprim-domain-containing-protein
MSSSASNAVTSDFKPLRGEFRALPKRGLSEETAKRFSYRVGEAWHPENKRLEMAHICDVKTEDGKLVAQKCRFADKAFSVNGKIPKGTLIGMHLFSGGRRLVVSEGEVDMLSVSQMQGNKYPVVSLPNGVQSAKSHLLACIDYLKKFDEVVLAFDMDDVGQDSAQKAAEALAGVVNVKIAKYELKDANDMLRAGKTSEMVQALWNAEVYTPDGLLDVDDVLESLFEGDDESGLPWKHEGMNKTSNGRFYGEVHTLGAGTGLGKTTLLLEQADYDVTVLKQKVGLFMVENDPKEVLRSICGKHDGRLYHVRNTDDYMMQDAIRQTAQLYRGNLYIYDNWGLCEWDSIKAKIVYLVSLGFRVFYVDHLTALATGSDKDEKAEIERIMADIASLAQRHQILIHLVSHLSTPEKGSHEEGARVAIKHFKGSRSIGFWSHAMYGFERNQQAESLEERLITTVRQLKRRGFGSGVGGVTRLRYVAEQDKSYEMHGAEPDFKDYEKEHF
>NC_014966.1|WP_015727750.1|667431_669495_+|DNA-polymerase
MAFKLREYQALKTLWDYVKYGKTKARILAFDIETNGLLMTVSRFHTAVCEDLVTGEVREYRPHEHHELLKDLYEADVLVAHNGINYDVPALKKLFPFWDIQPTKVIDTLVLSRLLFADIKDRDMSGVRRWRLREEGHEVTGWVLPPKLLGSHSLKAWGYRLQEYKGDYGEQEDAWAEFSEDMLIYCRQDVTVTCKLIRRLMKEFPDASFKAMQLEHEIQWLMSQQERNGFKFDVAKAEQLYFKLLGDRETIRQKLVDKFGTWYASNGVTTPKRSMNRMGMSYTAGAPYTKLKEVTFNPASRDHCAKVLQEAGVIFTEFTDGNKPKIDEEVLSHIKLPEAEMLNEFFMLNKRIGQIAEGNQAWLRLVTPEGFIHGSINPNGAVTGRALHSHPNIAQVPSGRAPYGQECRECFTVPDGWVLLGSDASGLELRCLGNRMFPWDKGAYNKVILEGDIHWENAQAAGFVDYGVIRDKHNPDHELRRGKAKTFIYAFLYGGGDELIGMQVGYTHEEYLAWKEAGAHIPIIKQLERRGERWTRERVCYILKGKEVKKKFLEGLPALDKLIKKCKKAAKDDGYVIGLDGRKVFCRSQHSALNTQLQSDGALICKMWCVVVNLMMQERGYKHGFDGDYAFCAWVHDEVQVACRSEAIAQEMGQICKDAMHFVERYYSVDCPLDAEFDIGSSWFETH
>NC_014966.1|WP_015727751.1|669650_669896_+|hypothetical-protein
MKVIYKQLISERIRAELYKAKSLNRVIDRIELTHSEFDDLIDELTPGHFVAVPLRRNPSNVRKMRYMDIDIVAVEEGGDEF
>NC_014966.1|WP_015727752.1|669885_670590_+|hypothetical-protein
MSFKPKKAHGWNGKSLKGEYRLTTKIDGVRLTRNEQGEMVSRSNKPLYNLPPIPEHIQDAEVYLHNWDTTVSAVRTHDGTQLPQSCIYELRPNLDPRLDLGMVKDPTAEQIQGWLEQSLSYGHEGLVLERMRDGRWIKVKNKETYDVLVTGFQAGTGKHEGRMGALITAYGKVGTGFTDAQRQEWQDLHDQGLAIGMLIEVECMEVTKDGKFRHPRFIRVRMDKLEESPPRKPE
>NC_014966.1|WP_015727753.1|670700_671132_+|tellurite-resistance-protein
MFNLFKKKAKAAQVTLHKVEKRDLMEAIVAGAVLVAYADGDCSSAELEKLDSIISANDNLAHFGSEIGKTIDKYSSMMEAGARLAKMKLMKELRDVEGDEEQKEEAFIITIEVADADGNIDDKEMAILREIGKALGLNPDNYI
>NC_014966.1|WP_015727754.1|671216_672062_+|exonuclease
MKTIGLFDADWIAFQMAAACQKRHRWPDGIWTLEVDENEVAKAIDDRIEYLRKEISCRKENAYMCISGDNNWRKVIMPSYKSNRESINMWISRPMILDYALQYIRDNYKFIQHDMLEADDLMGIYATDPEWHGDDRKVIVSIDKDLKSIPTWHYTPDKDFAPWEQSVEEADALYRKQWLMGDRTDGYEGCRGIGEKTAIDLATNPVLLVATEHEFKSGARKGQSEVRWKKTPTHSHAACIESHYAKAGQSSEECYQNGMVARILRHGEFCFKTNTIQFKPH

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

661067 : 686415

Rhizobium_phage(22.22%)

capsid,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015727745.1\|661067_663851_+	DNA-dependent RNA polymerase	A0A2R2ZGE5	Ralstonia_phage	2.2e-119	33.0
WP_015727746.1\|664033_664699_+	phage single-stranded DNA-binding protein	L7TLT1	Rhizobium_phage	3.7e-09	29.7
WP_148228962.1\|664734_665121_+	RusA family crossover junction endodeoxyribonuclease	A8HP85	Thalassomonas_phage	7.4e-10	36.6
WP_015727747.1\|665045_665399_+	N-acetylmuramoyl-L-alanine amidase	NA	NA	NA	NA
WP_015727748.1\|665436_665760_+	hypothetical protein	NA	NA	NA	NA
WP_158305940.1\|665923_667432_+	toprim domain-containing protein	L7TLT7	Rhizobium_phage	1.6e-108	46.1
WP_015727750.1\|667431_669495_+	DNA polymerase	A0A0U1ZAH8	Ralstonia_phage	1.9e-152	44.3
WP_015727751.1\|669650_669896_+	hypothetical protein	NA	NA	NA	NA
WP_015727752.1\|669885_670590_+	hypothetical protein	A0A2D0YMU1	Vibrio_phage	7.5e-53	50.2
WP_015727753.1\|670700_671132_+	tellurite resistance protein	Q1MVI3	Enterobacteria_phage	1.5e-27	42.9
WP_015727754.1\|671216_672062_+	exonuclease	H9YAH3	Vibrio_phage	3.7e-38	35.0
WP_015727755.1\|672077_672281_+	hypothetical protein	NA	NA	NA	NA
WP_015727756.1\|672372_672663_+	hypothetical protein	NA	NA	NA	NA
WP_015727757.1\|672672_673146_+	DUF3310 domain-containing protein	M4SQK7	Pseudoalteromonas_phage	7.9e-14	51.4
WP_044024037.1\|673145_673358_+	hypothetical protein	NA	NA	NA	NA
WP_015727759.1\|673362_674004_+	FAD-dependent thymidylate synthase	A0A291I996	Pseudomonas_phage	1.2e-84	66.5
WP_015727760.1\|674003_674828_+	radical SAM protein	NA	NA	NA	NA
WP_015727761.1\|674839_675166_+	hypothetical protein	NA	NA	NA	NA
WP_015727762.1\|675158_677009_+	anaerobic ribonucleoside-triphosphate reductase	A0A2I7R0M2	Vibrio_phage	2.6e-209	59.9
WP_044024038.1\|676989_677199_+	hypothetical protein	NA	NA	NA	NA
WP_015727763.1\|677270_677450_+	hypothetical protein	NA	NA	NA	NA
WP_044024039.1\|677449_677920_+	anaerobic ribonucleoside-triphosphate reductase activating protein	A0A0N7GFM7	Escherichia_phage	1.5e-36	49.0
WP_015727765.1\|677913_678525_+	deoxynucleoside kinase	NA	NA	NA	NA
WP_015727766.1\|678607_678772_+	hypothetical protein	NA	NA	NA	NA
WP_015727767.1\|678775_678982_+	hypothetical protein	NA	NA	NA	NA
WP_044024040.1\|678984_680502_+	hypothetical protein	A0A0F7L8L5	uncultured_marine_virus	5.9e-103	40.7
WP_015727769.1\|680510_681209_+	hypothetical protein	G8EXK7	Cyanophage	1.3e-07	31.5
WP_015727770.1\|681314_682412_+\|capsid	minor capsid protein 10	L7TJ83	Rhizobium_phage	8.4e-51	39.1
WP_015727771.1\|682586_683174_+\|tail	tail tubular protein A	A0A0P0UWD6	Pectobacterium_phage	9.5e-17	31.1
WP_015727772.1\|683179_685975_+	hypothetical protein	L7TLW2	Rhizobium_phage	5.4e-70	27.6
WP_015727773.1\|685974_686415_+	DUF2833 domain-containing protein	A0A1B1IW17	uncultured_Mediterranean_phage	9.3e-09	28.9

DBSCAN-SWA_2

692668 : 702969

Cronobacter_phage(16.67%)

terminase,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015727777.1\|692668_695581_+\|tail	tail fiber protein	A0A096XUT7	Cronobacter_phage	6.1e-24	40.3
WP_015727778.1\|695801_696158_+	peptidase M15	A0A2I7QYT6	Vibrio_phage	5.0e-13	37.9
WP_015727779.1\|696168_696441_+	hypothetical protein	NA	NA	NA	NA
WP_015727780.1\|696421_696565_+	hypothetical protein	NA	NA	NA	NA
WP_015727781.1\|696564_696810_+	HNH endonuclease	A0A0R6CMK3	Citrobacter_phage	4.5e-05	47.9
WP_015727782.1\|696810_697047_+	hypothetical protein	NA	NA	NA	NA
WP_158305941.1\|697171_698890_+\|terminase	phage terminase large subunit	A0A2R2ZGE7	Ralstonia_phage	1.6e-184	59.0
WP_015727785.1\|700336_701122_+	antirestriction protein ArdA	S0A5R5	Cellulophaga_phage	7.5e-09	31.6
WP_015727787.1\|701331_701526_+	hypothetical protein	NA	NA	NA	NA
WP_015727788.1\|701583_702969_+	DGQHR domain-containing protein	T1SBJ4	Salmonella_phage	2.5e-36	33.8

DBSCAN-SWA_3

918631 : 925014

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044024062.1\|918631_919000_-	antirepressor	Q9MCC3	Vibrio_phage	1.4e-45	76.9
WP_015727927.1\|919202_919439_+	hypothetical protein	A0A2I7RNI2	Vibrio_phage	2.3e-06	57.1
WP_015727928.1\|919441_919633_+	hypothetical protein	NA	NA	NA	NA
WP_015727929.1\|919635_919836_+	hypothetical protein	C3W4P3	Vibrio_phage	1.8e-20	69.2
WP_015727930.1\|919825_920893_+	replication initiation factor domain-containing protein	Q64EV8	Vibrio_phage	9.7e-153	71.8
WP_015727931.1\|920894_921245_+	DUF1293 domain-containing protein	Q858R2	Vibrio_phage	6.2e-40	69.1
WP_015727932.1\|921247_921478_+	hypothetical protein	G8IRU7	Vibrio_phage	2.8e-25	69.3
WP_015727933.1\|921508_921715_+	hypothetical protein	R9TRU5	Vibrio_phage	3.1e-07	54.7
WP_015727934.1\|921845_923300_+	hypothetical protein	G8IRU9	Vibrio_phage	3.6e-25	30.9
WP_015727935.1\|923299_923644_+	DUF2523 domain-containing protein	Q64EV1	Vibrio_phage	1.1e-36	66.7
WP_015727936.1\|923646_925014_+	toxin	Q64EV0	Vibrio_phage	3.7e-181	69.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_014965

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NC_014966

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection