CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NC_014975	Thermus scotoductus SA-01 plasmid pTSC8, complete sequence	0 crisprs	NA	0	0	0	0
NC_014974	Thermus scotoductus SA-01, complete sequence	5 crisprs	csa3,cas3,DEDDh,cas2,cas1,cas6e,cas5,cas7,cse2gr11,cas8e,WYL,Cas9_archaeal	0	62	3	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_014974_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_014974_1

318764-318862

Orphan

Consensus_repeat	Method
CCAGGCGCGCCCGCCTTAAGGGGA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_014974_1

>merge|NC_014974|1|318764-318862|CRISPRCasFinder
CCAGGCGCGCCCGCCTTAAGGGGAAGTCCCCCCTTAAGGCGGTGAAGTCCATGCCTCCAGTTTAGCCCTAGGTATCCAGGCGCGCCCGCCTTAAGAGGA

>NC_014974|1|1|318764-318862|CRISPRCasFinder
CCAGGCGCGCCCGCCTTAAGGGGA	AGTCCCCCCTTAAGGCGGTGAAGTCCATGCCTCCAGTTTAGCCCTAGGTAT
CCAGGCGCGCCCGCCTTAAGAGGA

Protein	Signature genes	Signature genes Name	Protein_function
NC_014974.1\|WP_049775611.1\|323498_323735_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225993
NC_014974.1\|WP_015716299.1\|323854_324664_+\|cytochrome-c-biogenesis-protein	unknown	unknown	gnl\|CDD\|372587
NC_014974.1\|WP_015716290.1\|316186_316897_-\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|131480
NC_014974.1\|WP_015716289.1\|315659_316190_+\|Uma2-family-endonuclease	unknown	unknown	gnl\|CDD\|99749
NC_014974.1\|WP_015716304.1\|327700_328378_-\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|223816
NC_014974.1\|WP_015716295.1\|320854_322261_-\|multicopper-oxidase-family-protein	unknown	unknown	gnl\|CDD\|225043
NC_014974.1\|WP_015716292.1\|317097_317514_-\|SUF-system-NifU-family-Fe-S-cluster-assembly-protein	unknown	unknown	gnl\|CDD\|273918
NC_014974.1\|WP_015716284.1\|310953_312168_-\|S8-family-peptidase	unknown	unknown	gnl\|CDD\|173803
NC_014974.1\|WP_015716300.1\|324680_325301_+\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|369777
NC_014974.1\|WP_015716303.1\|326595_327717_-\|HAMP-domain-containing-protein	unknown	unknown	gnl\|CDD\|380161
NC_014974.1\|WP_015716302.1\|326069_326585_-\|hypothetical-protein	unknown	unknown	unknown
NC_014974.1\|WP_015716287.1\|313575_314580_+\|hypothetical-protein	unknown	unknown	unknown
NC_014974.1\|WP_015716288.1\|314576_315545_+\|NAD(P)H-dependent-glycerol-3-phosphate-dehydrogenase	unknown	unknown	gnl\|CDD\|237770
NC_014974.1\|WP_015716301.1\|325304_326063_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|374209
NC_014974.1\|WP_015716291.1\|316897_317101_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|236583
NC_014974.1\|WP_015716286.1\|313019_313571_+\|orotate-phosphoribosyltransferase	unknown	unknown	gnl\|CDD\|273579
NC_014974.1\|WP_015716296.1\|322318_322708_-\|DUF302-domain-containing-protein	unknown	unknown	gnl\|CDD\|269820
NC_014974.1\|WP_038032552.1\|312240_313014_+\|orotidine-5'-phosphate-decarboxylase	unknown	unknown	gnl\|CDD\|273987
NC_014974.1\|WP_015716297.1\|322848_323502_-\|hypothetical-protein	unknown	unknown	unknown
NC_014974.1\|WP_015716293.1\|317525_318740_-\|cysteine-desulfurase	unknown	unknown	gnl\|CDD\|131034

Protein	Function_ID	Function_description	E-value
NC_014974.1\|WP_049775611.1\|323498_323735_-\|hypothetical-protein	gnl\|CDD\|225993	COG3462, COG3462, Predicted membrane protein [Function unknown].	3.31321e-07
NC_014974.1\|WP_015716299.1\|323854_324664_+\|cytochrome-c-biogenesis-protein	gnl\|CDD\|372587	pfam13386, DsbD_2, Cytochrome C biogenesis protein transmembrane region.	0.00106155
NC_014974.1\|WP_015716290.1\|316186_316897_-\|alpha/beta-fold-hydrolase	gnl\|CDD\|131480	TIGR02427, b-ketoadipate_enol-lactone_hydrolase, 3-oxoadipate enol-lactonase. Members of this family are 3-oxoadipate enol-lactonase. Note that the substrate is known as 3-oxoadipate enol-lactone, 2-oxo-2,3-dihydrofuran-5-acetate, 4,5-Dihydro-5-oxofuran-2-acetate, and 5-oxo-4,5-dihydrofuran-2-acetate. The enzyme the catalyzes the fourth step in the protocatechuate degradation to beta-ketoadipate and then to succinyl-CoA and acetyl-CoA. 4-hydroxybenzoate, 3-hydroxybenzoate, and vanillate all can be converted in one step to protocatechuate. This enzyme also acts in catechol degradation. In genomes that catabolize both catechol and protocatechuate, two forms of this enzyme may be found. All members of the seed alignment for this model were chosen from within protocatechuate degradation operons of at least three genes of the pathway, from genomes with the complete pathway through beta-ketoadipate. [Energy metabolism, Other].	9.83063e-31
NC_014974.1\|WP_015716289.1\|315659_316190_+\|Uma2-family-endonuclease	gnl\|CDD\|99749	cd06260, DUF820, Domain of unknown function (DUF820). This family consists of hypothetical proteins that are greatly expanded in cyanobacteria. The proteins are found sporadically in other bacteria. They have been predicted to belong to the PD-(D/E)xK superfamily of nucleases.	4.22166e-35
NC_014974.1\|WP_015716295.1\|320854_322261_-\|multicopper-oxidase-family-protein	gnl\|CDD\|225043	COG2132, SufI, Putative multicopper oxidases [Secondary metabolites biosynthesis, transport, and catabolism].	3.46824e-97
NC_014974.1\|WP_015716292.1\|317097_317514_-\|SUF-system-NifU-family-Fe-S-cluster-assembly-protein	gnl\|CDD\|273918	TIGR01994, Iron-sulfur_cluster_assembly_scaffold_protein_IscU, SUF system FeS assembly protein, NifU family. Three iron-sulfur cluster assembly systems are known so far. ISC is broadly distributed while NIF tends to be associated with nitrogenase in nitrogen-fixing bacteria. The most recently described is SUF, believed to be important to maintain the function during aerobic stress of enzymes with labile Fe-S clusters. It is fairly widely distributed. This family represents one of two different proteins proposed to act as a scaffold on which the Fe-S cluster is built and from which it is transferred. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other].	2.45938e-63
NC_014974.1\|WP_015716284.1\|310953_312168_-\|S8-family-peptidase	gnl\|CDD\|173803	cd07477, Peptidases_S8_Subtilisin_subset, Peptidase S8 family domain in Subtilisin proteins. This group is composed of many different subtilisins: Pro-TK-subtilisin, subtilisin Carlsberg, serine protease Pb92 subtilisin, and BPN subtilisins just to name a few. Pro-TK-subtilisin is a serine protease from the hyperthermophilic archaeon Thermococcus kodakaraensis and consists of a signal peptide, a propeptide, and a mature domain. TK-subtilisin is matured from pro-TK-subtilisin upon autoprocessing and degradation of the propeptide. Unlike other subtilisins though, the folding of the unprocessed form of pro-TK-subtilisin is induced by Ca2+ binding which is almost completed prior to autoprocessing. Ca2+ is required for activity unlike the bacterial subtilisins. The propeptide is not required for folding of the mature domain unlike the bacterial subtilases because of the stability produced from Ca2+ binding. Subtilisin Carlsberg is extremely similar in structure to subtilisin BPN'/Novo thought it has a 30% difference in amino acid sequence. The substrate binding regions are also similar and 2 possible Ca2+ binding sites have been identified recently. Subtilisin Carlsberg possesses the highest commercial importance as a proteolytic additive for detergents. Serine protease Pb92, the serine protease from the alkalophilic Bacillus strain PB92, also contains two calcium ions and the overall folding of the polypeptide chain closely resembles that of the subtilisins. Members of the peptidases S8 and S35 clan include endopeptidases, exopeptidases and also a tripeptidyl-peptidase. The S8 family has an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. The S53 family contains a catalytic triad Glu/Asp/Ser. The stability of these enzymes may be enhanced by calcium, some members have been shown to bind up to 4 ions via binding sites with different affinity. Some members of this clan contain disulfide bonds. These enzymes can be intra- and extracellular, some function at extreme temperatures and pH values.	2.42838e-87
NC_014974.1\|WP_015716300.1\|324680_325301_+\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|369777	pfam08241, Methyltransf_11, Methyltransferase domain. Members of this family are SAM dependent methyltransferases.	8.38814e-21
NC_014974.1\|WP_015716303.1\|326595_327717_-\|HAMP-domain-containing-protein	gnl\|CDD\|380161	NF033092, HK_WalK, cell wall metabolism sensor histidine kinase WalK. This model describes WalK as found in Staphylococcus aureus (sp\|Q2G2U4.1\|WALK_STAA8). A shorter version, as found in Streptococcus pneumoniae, called WalK(Spn) or VicK, is not included. WalK is part of a two-component system and works with partner protein WalR.	2.02822e-71
NC_014974.1\|WP_015716288.1\|314576_315545_+\|NAD(P)H-dependent-glycerol-3-phosphate-dehydrogenase	gnl\|CDD\|237770	PRK14618, PRK14618, NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional.	2.88254e-154
NC_014974.1\|WP_015716301.1\|325304_326063_-\|hypothetical-protein	gnl\|CDD\|374209	pfam15902, Sortilin-Vps10, Sortilin, neurotensin receptor 3,. Sortilin, also known in mammals as neurotensin receptor-3, is the archetypical member of a Vps10-domain (Vps10-D) that binds neurotrophic factors and neuropeptides. This domain constitutes the entire luminal part of Sortilin and is activated in the trans-Golgi network by enzymatic propeptide cleavage. The structure of the domain has been determined as a ten-bladed propeller, with up to 9 BNR or beta-hairpin turns in it. The mature receptor binds various ligands, including its own propeptide (Sort-pro), neurotensin, the pro-forms of nerve growth factor-beta (NGF)6 and brain-derived neurotrophic factor (BDNF)7, lipoprotein lipase (LpL), apo lipoprotein AV14 and the receptor-associated protein (RAP)1.	0.000585802
NC_014974.1\|WP_015716291.1\|316897_317101_-\|hypothetical-protein	gnl\|CDD\|236583	PRK09601, PRK09601, redox-regulated ATPase YchF.	0.00919119
NC_014974.1\|WP_015716286.1\|313019_313571_+\|orotate-phosphoribosyltransferase	gnl\|CDD\|273579	TIGR01367, Orotate_phosphoribosyltransferase, orotate phosphoribosyltransferase, Thermus family. This model represents a distinct clade of orotate phosphoribosyltransferases. Members include the experimentally determined example from Thermus aquaticus and additional examples from Caulobacter crescentus, Helicobacter pylori, Mesorhizobium loti, and related species. [Purines, pyrimidines, nucleosides, and nucleotides, Pyrimidine ribonucleotide biosynthesis].	1.06628e-70
NC_014974.1\|WP_015716296.1\|322318_322708_-\|DUF302-domain-containing-protein	gnl\|CDD\|269820	cd14797, DUF302, Uncharacterized domain family DUF302. These domains are mostly found in bacterial single-domain proteins and have been shown to form homodimers; they may also bind zinc. Also characterized as COG3439.	1.59618e-37
NC_014974.1\|WP_038032552.1\|312240_313014_+\|orotidine-5'-phosphate-decarboxylase	gnl\|CDD\|273987	TIGR02127, Orotidine_5'-phosphate_decarboxylase, orotidine 5'-phosphate decarboxylase, subfamily 2. This model represents orotidine 5'-monophosphate decarboxylase, the PyrF protein of pyrimidine nucleotide biosynthesis. See TIGR01740 for a related but distinct subfamily of the same enzyme. [Purines, pyrimidines, nucleosides, and nucleotides, Pyrimidine ribonucleotide biosynthesis].	2.64514e-71
NC_014974.1\|WP_015716304.1\|327700_328378_-\|response-regulator-transcription-factor	gnl\|CDD\|223816	COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription].	1.16714e-85
NC_014974.1\|WP_015716293.1\|317525_318740_-\|cysteine-desulfurase	gnl\|CDD\|131034	TIGR01979, Probable_cysteine_desulfurase, cysteine desulfurases, SufSfamily. This model represents a subfamily of NifS-related cysteine desulfurases involved in FeS cluster formation needed for nitrogen fixation among other vital functions. Many cysteine desulfurases are also active as selenocysteine lyase and/or cysteine sulfinate desulfinase. This subfamily is associated with the six-gene SUF system described in E. coli and Erwinia as an FeS cluster formation system during oxidative stress. The active site Cys is this subfamily resembles GHHC with one or both His conserved. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other].	0

>NC_014974.1|WP_015716293.1|317525_318740_-|cysteine-desulfurase
MDFTSLREAFPLIAGRPDLVYLDSAATSQKPKRVLEALDRYYKELNANVHRGAYRLSVAATEAYEEARRRMARFLGAEEREIIFVRNTTEAMNLVAYAWGLRNLKEGDEILVTEMEHHAGLVPWHLVAGLTGARIRAIPLTEEGRLDLSALDTLLTERVKVVSVVHMSNVLGTINPVAEIARRAKEVGALVVVDGAQSAPHLPVDVKALGADFFALSGHKMLGPTGAGVLWGRYEVLEGMGPFLGGGEMIREVHVDRSTYAPPPQRFEAGTPPIAEAIALGEAASYLMEIGMERVYAHDRALLEYALKRLAEVPDLKVYGPKGEDRGGVIPFTLGRLHPHDLATFLDQEGIAVRAGHHCAQPLHRKLGLAATARASFYLYNTFEEVDRFVEALLRIHTRYRAWL
>NC_014974.1|WP_015716292.1|317097_317514_-|SUF-system-NifU-family-Fe-S-cluster-assembly-protein
MSVLDELYREIILKHYQSPKNFGVLPQATKTAGGMNPSCGDQVEVMVRLEGDTIADIRFQGQGCAISTASASMMTELVKGKKVAEALELSRKFQAMVVEGAPPDPALGDLLALQGVAKLPARVKCATLAWHALEEALR
>NC_014974.1|WP_015716291.1|316897_317101_-|hypothetical-protein
MRRYPAHKVTPLLVQYPDLMEAWKEAAKAGLLRAESQDGRNYVVVEDPSLIARLKALGLEGEPVKEA
>NC_014974.1|WP_015716290.1|316186_316897_-|alpha/beta-fold-hydrolase
MRGVVFLHAFPYNPRMWEEEMGYFRGRLPVLAPHYLGLSLSQAADRVLGEMDEAGLEEAVFVGLSMGGYLIFELWRRAPERFLGLVLADTRAGADTEEGRKNRYALRERVLAEGVGFLPEALLPNHLGKTTQEEKPEVVARAKALILEASPEAVAGSLLALAERPDSTPLLPGMRRPALVLVGEEDTLTPPEEAKRMAKALPDARLLILPEAGHLANLENPKAFRTALLGFLAEVL
>NC_014974.1|WP_015716289.1|315659_316190_+|Uma2-family-endonuclease
MLAPKLPKALEAYLEEEAQSPVKREYLRGRLYAMAGASALHNRVALNIAARFLEAARPRGCRVYMSDMKLRIRDEAVYYPDVMVVCQPGPPHPYYEEAPCAVVEVLSPATEVQDRREKRALYETLDSLEVYLLVDPEARRFTLYRRTPEGFAEEEGEEALIPCLDLVLRAEEAFRL
>NC_014974.1|WP_015716288.1|314576_315545_+|NAD(P)H-dependent-glycerol-3-phosphate-dehydrogenase
MKVAILGAGAWGTALAVLLASKGIPTALWARRKEQAEALRASRENKDYLPGVALPAYLYPTADPEEALEGAELAVVALPSKALEDTLRALPLAPWYLSATKGLFFQEGRLRTPSEVVEGLTGRPVAVLSGPNHAEEVARFLPTASVAAGPLELAKRVQELFSGPTFRVYTSQDRRGVELGGALKNILALAAGMVDGLRLGDNAKAALLTRGLREMVRFGTAQGGEEATFYGLSGLGDLLATAYSLHSRNRGAGERLVRGEALERLEDRGVVEGLYAVKALMAWRERTGLELPIAEAVYQVVYEGLDPLKALSALMAREPKAE
>NC_014974.1|WP_015716287.1|313575_314580_+|hypothetical-protein
MRPLAFLLVLFPWAMASSAVELARQAAEAWLAGKLSPSLEEVLRASPEEAPKLLERYALFPPPPRGLSLNLDSPRVEGNRVLFPAAVGEEVGEVVVVLEGREVKRVYFRPEGLSLPGYLLTPAAGWGFLLLSVFWIFLLFQPSPFRAWLLEALVLLRGYRGLYLFTNLFLYGLFGLGALLAYGMPEMAKAVQALFGGALEAIGLEEAMGRGILVLAGVIFHWNFSQGLFLTGLIPALLLGIPAFLLNALRYLVFGFALSPALLGSLFLVHLPTLVLELQAYILVTFGGLVLLAKTAGGEGYRKGLRALLLTFYLGALFLLLAAWYEAWEVSVLL
>NC_014974.1|WP_015716286.1|313019_313571_+|orotate-phosphoribosyltransferase
MDVLELYRRTGALLEGHFLLRSGLHSPIFLQSAALLQHPLYAEAVGEALGKLFEDEKVDFVIGPALGGVVLSFVVAKALGARALFAEKDGQGGMTLRRGLTVNPGDRFLAVEDVVTTGESVRKAIRAAEARGGVLVGVGAIVDRSRGEADFGVPFRALLKLEVPQYLPEACPLCRDGVPLEEV
>NC_014974.1|WP_038032552.1|312240_313014_+|orotidine-5'-phosphate-decarboxylase
MDFLLALSRPPLVLGVDPRPELHGREPVAHLKRYTVELLEALAPRLAAVKFQLAFFEALGPEGLGLLFELASAARVMGLPVIFDGKRGDIGSTAEAYARAYLLRFPGSALTVNPYLGLDTLTPFFQAARESQGAVFVLVKTSNPGSGFLQDLLVEGRPLYLHLAEALAREGEGYREGEWSRVGMVVGATYPEVVLTVREKAPRAPFLLPGIGAQGGRPLKGPGLLNTASRALFYPGGRPDLEGALQAAEDFHRALVE
>NC_014974.1|WP_015716284.1|310953_312168_-|S8-family-peptidase
MKKLILALSLLVLAACQQQATVQPQALREAGQTYIAILEPTASPTLPARFSERLAALERAHGLSIPAEDRLEALGAVILRNLTPTQAQRLAQDPRVYALTPDQEVKAYAQTIPWGVDRIGAPTTTAKGANVSVYVVDTGIKVGHEDLTNLMGGYAVVKCRGKCRTAYDDDNGHGTHVAGTVAAVNNSVGVLGVAPAAELWAVKVLSGSGSGSTSGIVQGINWVIGHNNGGKPKVINMSLGGSGTDDQDGQYCPSTRSTNAFHNVIQKAVCDYRITVVVAAGNEGDNAANHTPAAYDEVITVSATNSQDDWPSWSNYGPDVDLAAPGVSILSTWNSSTTSYNTISGTSMASPHVAGAAALVLSRYPSYTPAQVKQALLQNAESTATWQNTSGNPHPEPFLNVRGF
>NC_014974.1|WP_015716295.1|320854_322261_-|multicopper-oxidase-family-protein
MNTDRRTLLKLTAGLLLSPLARGQAPFPEPPVLKSRDGLLQVRLKVAPTPLSLVGREARLWTYGGSFPGPTLRVRPGDAVRLELENLLPESTNLHWHGLPISPKVDDALLEIPSKETWRYEFTVPQDLAGTFWYHPHLHGRVAPQLFAGLAGGLVVEGPLDGIPELREAEEHLLVLKDLELASGRPAAHTPMDWINGKEGNLLLVNGASRPTLRATKATLRLRLLNASNARFYRLQLEGNPLYLIASDGGFLEEPYEVPELLLAPGERAEVLVRFQKEGAFRLLALPYDRGVHMMGGMEHMGHGGMSMGTSPSGPQTLLTLVAPPRPKPLPLPKALAKLPALNPNQARVTRRITFTEDMMAGKFFINGQAFDHLRVDFQGRAGDLEVWEVDNQGDMDHPFHLHTHPFQVLSVNGKPLPYRALKDVVNLKAKEVVRLLVPLRNLPGKTVFHCHIVEHEDRGMMGILEVS
>NC_014974.1|WP_015716296.1|322318_322708_-|DUF302-domain-containing-protein
MTDLRKTLKTSLAEARARLEAALKEEGFGILTEIDVAATLKARLGLERPPYLILGACNPNLAARALEAEPDIGLLLPCNAVLREGGEGVEILLQDPKGMFQVLPPEKQEALKPVVEEARSRLEKALAKL
>NC_014974.1|WP_015716297.1|322848_323502_-|hypothetical-protein
MKRYGMVLGVLGLLLLGLALTQGMMGNFGPGMMGYGPQYGPGMMGYGMMGGHGMMGMMAVYPPEARPIPQAEAKARMEAYAKRLYPGARLKDFMAFSQNYYAQVVDEKGQGLFELIADRYTGVVSPEPGPNMMWNTRYSMMGGPVQTPVRFPLEEAKKLAETFLKGYLPGAQVMEAGAFPGYYTFDFGRKEVEGMLSVNAYTGEVWVHTWHGFFLGE
>NC_014974.1|WP_049775611.1|323498_323735_-|hypothetical-protein
MMGWGGMGFGWFFGLLNMLLVLALLGLLLYLGLRAWGGGGGPKKDEALEALRLRYARGELDEESYRRLRKELERGGEA
>NC_014974.1|WP_015716299.1|323854_324664_+|cytochrome-c-biogenesis-protein
MGLGFAFLVLIGLALGSGLLKEVSWELYRVANSLYALLAPWVDGLRREVGVPWLSAFLLGVLAAFAPCQITTGASALAYLAPSALEGRVWPRFLAFLLGKAFTYLALAGVVLFFLGGVLDNPGAVFRPVRLALGPFMVLVGLGLLGVVRWPLAWAAPEGWVARVGAWGGLLGPLALGGVYGLAFCPTLFWLFFGLLLPLALASSFGFLFPLLFALGTGFPLGFLLLLFTRMGRGQALKGMRLVGSHLLRGAGAVFVALGMLDTVLYWNL
>NC_014974.1|WP_015716300.1|324680_325301_+|class-I-SAM-dependent-methyltransferase
MKKGLRARFFATLLPVLSRGHVGLSEPWRKKLLGSLAGKVLEIGPGTGVNLAYLPDGVHWIGLELNPYFHPHLKQALSLRGLSGEVLLGQAEAIPLPEESVEAVVATLVLCSVEDPRGALAEILRVLKPGGRLVFLEHVAAPRGSSLRRFQDLLCPLWSFLGDGCHPNRETLALIREAGFARVEAEAFELPLPLVAPHVAGVAWKG
>NC_014974.1|WP_015716301.1|325304_326063_-|hypothetical-protein
MRPFTFFTLFLGLALAQTPLGPVPTRDVHALLWHPSGVLLLGHHDGIVAWSNSTSQDLVRRRDWDAMNLAWGGERLIAAGHWILAESRDLKRFRDLRPKGLPALDLHAYAIDPRKPEVHYTLEATYGYFRSQDGGQTWAKLPARGLPKAGMAFFLVDQKGRLWASLMERGLFLSEDGGESFRPIPSPDPAPGPLALSPSGTLYLGGKLGLWRRTEAGWRRIWQGAVLALTAHPQEEGWLAWVDERGTLWQGR
>NC_014974.1|WP_015716302.1|326069_326585_-|hypothetical-protein
MKKLLALALGVALGLAQTPSPEALKGLKPEEALALAKRWREEGQRVVSYVTPEAFFFEFPDGRKAQVALKDRFLLAIAPYVSRTHPCQVHYFSSCTGELQEEVFEVRVLEGEKEVLKTQVRSGKDGFFELWLPRNRRYTLEIRWGNLAATSSVTTFSQSPTCLTGFRLASR
>NC_014974.1|WP_015716303.1|326595_327717_-|HAMP-domain-containing-protein
MRLFAKLFLSHLLVALLALFLFFLLAETLAPSFYRGHVERMYHALSMMGGLMMGEALRRDLEEGLRSTLTTALLAALPLSVAGAALSASFASLRFSRTARLLAEGSRRMAQGEYRVRLPPLERDEFGEVALHFNRLAEALERVEQSRVELIGTVAHELRTPLSALQAYAEALADGVMEPEKAAERIQQEVRAMSRLVRDLSLVSQVESGAVELHPGPLDPKELLEQAAERFRPAFQAKGVALEVAAPSFLPRVWADAERTLQVLANLLSNALRHTPEGGRVRLGAERTGQAVVFSVEDTGPGIPEEHLPRIFERFYRIDPSRSRQDGGTGVGLTIAKSLVEAMGGRIWVESQLGRGSVFRFTLPLYTGLTGKA
>NC_014974.1|WP_015716304.1|327700_328378_-|response-regulator-transcription-factor
MRVLLVDDDPALLEVLGAYLRGAGFEVLEAKDGEKALELFPRADLIILDLMLPKLDGFKVLEEVRRERPELPILMLTARGEEEERVKGLELGADDYVVKPFSPKEVVARVKALLRRAGLKEELCYGPLRLLPKERQAYLEGKPLPLSQLEFDLLLTLAQHPGMVFTRERLLEKVWGPDFPGIDRVVDVHIAALRKKLMDDPENPRFIETVRGVGYRFREGDAPLR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_014974_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_014974_2

575014-575590

Orphan

I-B,III-A,III-B

Consensus_repeat	Method
AGTAGTCCCCACGCACGTGGGGATGGCCCG	CRISPRCasFinder
GTAGTCCCCACGCACGTGGGGATGGCCCG	PILER-CR
GTAGTCCCCACGCACGTGGGGATGGCCCG	CRT

9 spacers

The CRISPR arrays of NC_014974_2

>merge|NC_014974|2|575014-575590|CRISPRCasFinder,PILER-CR,CRT
TGTAGTCCCCACGCACGTGGGGATGGCCCGTGCTCCATGTACGCACCGGCCCCTTTAGGCCAGTAGTCCCCACGCACGTGGGGATGGCCCGTCACCGCGGCCAGGACGATGACGGTAGTCATAGTAGTCCCCACGCACGTGGGGATGGCCCGCGGCACCAGCCAGCGCCGTCCCAAGCGCACCCGTAGTCCCCACGCACGTGGGGATGGCCCGGACTCATGCCATCACCCCCCAGGGCTTGCTAGTAGTCCCCACGCACGTGGGGATGGCCCGGCATTCCCGGCATTCCCGGGCCGGGACCTCCCGTAGTCCCCACGCACGTGGGGATGGCCCTTTTGGCGTTCCTTTCCTCCTTCCGGGCCGCGAGTAGTCCCCACGCACGTGGGGATGGCCCGCCCTCGTCCCGCAGGGCGTGGATGCCCGCCCAGTAGTCCCCACGCACGTGGGGATGGCCCGATGCCGCATCCATAGCCAGATACGGTCGGAGAGTAGTCCCCACGCACGTGGGGATGGCCCGCTCCCGCCATAGTGTCAAGGGGGGTACCGGAGTAGTCCCCACGCACGTGGGGATGGCCCG

>NC_014974|2|2|575014-575590|CRISPRCasFinder
TGTAGTCCCCACGCACGTGGGGATGGCCCG	TGCTCCATGTACGCACCGGCCCCTTTAGGCC
AGTAGTCCCCACGCACGTGGGGATGGCCCG	TCACCGCGGCCAGGACGATGACGGTAGTCAT
AGTAGTCCCCACGCACGTGGGGATGGCCCG	CGGCACCAGCCAGCGCCGTCCCAAGCGCACC
CGTAGTCCCCACGCACGTGGGGATGGCCCG	GACTCATGCCATCACCCCCCAGGGCTTGCT
AGTAGTCCCCACGCACGTGGGGATGGCCCG	GCATTCCCGGCATTCCCGGGCCGGGACCTCC
CGTAGTCCCCACGCACGTGGGGATGGCCCT	TTTGGCGTTCCTTTCCTCCTTCCGGGCCGCG
AGTAGTCCCCACGCACGTGGGGATGGCCCG	CCCTCGTCCCGCAGGGCGTGGATGCCCGCCC
AGTAGTCCCCACGCACGTGGGGATGGCCCG	ATGCCGCATCCATAGCCAGATACGGTCGGAG
AGTAGTCCCCACGCACGTGGGGATGGCCCG	CTCCCGCCATAGTGTCAAGGGGGGTACCGG
AGTAGTCCCCACGCACGTGGGGATGGCCCG

>NC_014974|2|1|575015-575590|PILER-CR
GTAGTCCCCACGCACGTGGGGATGGCCCG	TGCTCCATGTACGCACCGGCCCCTTTAGGCCA
GTAGTCCCCACGCACGTGGGGATGGCCCG	TCACCGCGGCCAGGACGATGACGGTAGTCATA
GTAGTCCCCACGCACGTGGGGATGGCCCG	CGGCACCAGCCAGCGCCGTCCCAAGCGCACCC
GTAGTCCCCACGCACGTGGGGATGGCCCG	GACTCATGCCATCACCCCCCAGGGCTTGCTA
GTAGTCCCCACGCACGTGGGGATGGCCCG	GCATTCCCGGCATTCCCGGGCCGGGACCTCCC
GTAGTCCCCACGCACGTGGGGATGGCCCT	TTTGGCGTTCCTTTCCTCCTTCCGGGCCGCGA
GTAGTCCCCACGCACGTGGGGATGGCCCG	CCCTCGTCCCGCAGGGCGTGGATGCCCGCCCA
GTAGTCCCCACGCACGTGGGGATGGCCCG	ATGCCGCATCCATAGCCAGATACGGTCGGAGA
GTAGTCCCCACGCACGTGGGGATGGCCCG	CTCCCGCCATAGTGTCAAGGGGGGTACCGGA
GTAGTCCCCACGCACGTGGGGATGGCCCG

>NC_014974|2|1|575015-575590|CRT
GTAGTCCCCACGCACGTGGGGATGGCCCG	TGCTCCATGTACGCACCGGCCCCTTTAGGCCA
GTAGTCCCCACGCACGTGGGGATGGCCCG	TCACCGCGGCCAGGACGATGACGGTAGTCATA
GTAGTCCCCACGCACGTGGGGATGGCCCG	CGGCACCAGCCAGCGCCGTCCCAAGCGCACCC
GTAGTCCCCACGCACGTGGGGATGGCCCG	GACTCATGCCATCACCCCCCAGGGCTTGCTA
GTAGTCCCCACGCACGTGGGGATGGCCCG	GCATTCCCGGCATTCCCGGGCCGGGACCTCCC
GTAGTCCCCACGCACGTGGGGATGGCCCT	TTTGGCGTTCCTTTCCTCCTTCCGGGCCGCGA
GTAGTCCCCACGCACGTGGGGATGGCCCG	CCCTCGTCCCGCAGGGCGTGGATGCCCGCCCA
GTAGTCCCCACGCACGTGGGGATGGCCCG	ATGCCGCATCCATAGCCAGATACGGTCGGAGA
GTAGTCCCCACGCACGTGGGGATGGCCCG	CTCCCGCCATAGTGTCAAGGGGGGTACCGGA
GTAGTCCCCACGCACGTGGGGATGGCCCG

Protein	Signature genes	Signature genes Name	Protein_function
NC_014974.1\|WP_049775658.1\|574472_574829_+\|metal-sulfur-cluster-assembly-factor	unknown	unknown	gnl\|CDD\|225062
NC_014974.1\|WP_015716538.1\|573499_574195_-\|membrane-protein	unknown	unknown	gnl\|CDD\|274742
NC_014974.1\|WP_015716548.1\|582308_583310_+\|DNA-protecting-protein-DprA	unknown	unknown	gnl\|CDD\|223829
NC_014974.1\|WP_015716537.1\|572967_573498_-\|alkaline-phosphatase	unknown	unknown	gnl\|CDD\|223659
NC_014974.1\|WP_015716547.1\|581281_582187_-\|GTPase-Era	unknown	unknown	gnl\|CDD\|234624
NC_014974.1\|WP_015716529.1\|566545_567130_+\|imidazoleglycerol-phosphate-dehydratase-HisB	unknown	unknown	gnl\|CDD\|153419
NC_014974.1\|WP_015716546.1\|580355_581237_-\|acyltransferase	unknown	unknown	gnl\|CDD\|100053
NC_014974.1\|WP_019551239.1\|575717_576155_-\|RDD-family-protein	unknown	unknown	gnl\|CDD\|377640
NC_014974.1\|WP_015716536.1\|572668_572971_+\|hypothetical-protein	unknown	unknown	unknown
NC_014974.1\|WP_015716543.1\|577114_578260_+\|class-I-SAM-dependent-rRNA-methyltransferase	unknown	unknown	gnl\|CDD\|224017
NC_014974.1\|WP_015716550.1\|584360_585257_+\|hydrogen-peroxide-inducible-genes-activator	unknown	unknown	gnl\|CDD\|176103
NC_014974.1\|WP_015716533.1\|570066_571170_-\|5-(carboxyamino)imidazole-ribonucleotide-synthase	unknown	unknown	gnl\|CDD\|235674
NC_014974.1\|WP_015716542.1\|576148_577081_-\|signal-peptide-peptidase-SppA	unknown	unknown	gnl\|CDD\|132934
NC_014974.1\|WP_015716545.1\|579543_580353_-\|molybdopterin-synthase-adenylyltransferase-MoeB	unknown	unknown	gnl\|CDD\|236337
NC_014974.1\|WP_041438080.1\|571166_571661_-\|5-(carboxyamino)imidazole-ribonucleotide-mutase	unknown	unknown	gnl\|CDD\|376377
NC_014974.1\|WP_015716549.1\|583349_584258_-\|manganese-catalase-family-protein	unknown	unknown	gnl\|CDD\|226076
NC_014974.1\|WP_015716532.1\|568891_570028_-\|AMP-binding-protein	unknown	unknown	gnl\|CDD\|341239
NC_014974.1\|WP_015716544.1\|578341_579475_+\|citrate-synthase/methylcitrate-synthase	unknown	unknown	gnl\|CDD\|99871
NC_014974.1\|WP_015716535.1\|571708_572665_+\|sodium-dependent-bicarbonate-transport-family-permease	unknown	unknown	gnl\|CDD\|377582
NC_014974.1\|WP_015716531.1\|567695_568622_-\|carbohydrate-kinase-family-protein	unknown	unknown	gnl\|CDD\|223598

Protein	Function_ID	Function_description	E-value
NC_014974.1\|WP_049775658.1\|574472_574829_+\|metal-sulfur-cluster-assembly-factor	gnl\|CDD\|225062	COG2151, PaaD, Predicted metal-sulfur cluster biosynthetic enzyme [General function prediction only].	9.53895e-40
NC_014974.1\|WP_015716538.1\|573499_574195_-\|membrane-protein	gnl\|CDD\|274742	TIGR03716, R_switched_YkoY, integral membrane protein, YkoY family. Rfam model RF00080 describes a structured RNA element called the yybP-ykoY leader, or SraF, which may precede one or several genes in a genome. Members of this highly hydrophobic protein family often are preceded by a yybP-ykoY leader, which may serve as a riboswitch. From the larger group of TerC homologs (pfam03741), this subfamily contains proteins YceF and YkoY from Bacillus subtilis. A transport function is proposed.	6.75045e-64
NC_014974.1\|WP_015716548.1\|582308_583310_+\|DNA-protecting-protein-DprA	gnl\|CDD\|223829	COG0758, Smf, Predicted Rossmann fold nucleotide-binding protein involved in DNA uptake [DNA replication, recombination, and repair / Intracellular trafficking and secretion].	3.84938e-99
NC_014974.1\|WP_015716537.1\|572967_573498_-\|alkaline-phosphatase	gnl\|CDD\|223659	COG0586, DedA, Uncharacterized membrane-associated protein [Function unknown].	1.36506e-23
NC_014974.1\|WP_015716547.1\|581281_582187_-\|GTPase-Era	gnl\|CDD\|234624	PRK00089, era, GTPase Era; Reviewed.	4.17022e-147
NC_014974.1\|WP_015716529.1\|566545_567130_+\|imidazoleglycerol-phosphate-dehydratase-HisB	gnl\|CDD\|153419	cd07914, IGPD, Imidazoleglycerol-phosphate dehydratase. Imidazoleglycerol-phosphate dehydratase (IGPD; EC 4.2.1.19) catalyzes the dehydration of imidazole glycerol phosphate to imidazole acetol phosphate, the sixth step of histidine biosynthesis in plants and microorganisms where the histidine is synthesized de novo. There is an internal repeat in the protein domain that is related by pseudo-dyad symmetry, perhaps as a result of an ancient gene duplication. The apo-form of IGPD exists as a catalytically inactive trimer which, in the presence of specific divalent metal cations such as manganese (Mn2+), cobalt (Co2+), cadmium (Cd2+), nickel (Ni2+), iron (Fe2+) and zinc (Zn2+), assembles to form a biologically active high molecular weight metalloenzyme; a 24-mer with 4-3-2 symmetry. Each 24-mer has 24 active sites, and contains around 1.5 metal ions per monomer, each monomer contributing residues to three separate active sites. IGPD enzymes are monofunctional in fungi, plants, archaea and some eubacteria while they are encoded as bifunctional enzymes in other eubacteria, such that the enzyme is fused to histidinol-phosphate phosphatase, the penultimate enzyme of the histidine biosynthesis pathway. The histidine biosynthesis pathway is a potential target for development of herbicides, and IGPD is a target for the triazole phosphonate herbicides.	7.6825e-99
NC_014974.1\|WP_015716546.1\|580355_581237_-\|acyltransferase	gnl\|CDD\|100053	cd04647, LbH_MAT_like, Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins. MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates. MAT acetylates maltose and glucose exclusively while GAT specifically acetylates galactopyranosides. XAT catalyzes the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others. XATs are implicated in inactivating xenobiotics leading to xenobiotic resistance in patients. Members of this family contain a a left-handed parallel beta-helix (LbH) domain with at least 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X). They are trimeric in their active form.	4.59481e-36
NC_014974.1\|WP_019551239.1\|575717_576155_-\|RDD-family-protein	gnl\|CDD\|377640	pfam06271, RDD, RDD family. This family of proteins contain three highly conserved amino acids: one arginine and two aspartates, hence the name of RDD family. This region contains two predicted transmembrane regions. The arginine occurs at the N-terminus of the first helix and the first aspartate occurs in the middle of this helix. The molecular function of this region is unknown. However this region may be involved in transport of an as yet unknown set of ligands (Bateman A pers. obs.).	2.00613e-25
NC_014974.1\|WP_015716535.1\|571708_572665_+\|sodium-dependent-bicarbonate-transport-family-permease	gnl\|CDD\|377582	pfam05982, Sbt_1, Na+-dependent bicarbonate transporter superfamily. Family of bacterial proteins that are likely to be part of the Na(+)-dependent bicarbonate transporter (sbt) family. Members carry 10TMS in a 5+5 duplicated structure. The loop between helices 5 and 6 in Synechocystis PCC6803 is likely to be the location for regulatory mechanisms governing the activation of the transporter.	4.58111e-126
NC_014974.1\|WP_015716543.1\|577114_578260_+\|class-I-SAM-dependent-rRNA-methyltransferase	gnl\|CDD\|224017	COG1092, COG1092, Predicted SAM-dependent methyltransferases [General function prediction only].	1.99452e-97
NC_014974.1\|WP_015716550.1\|584360_585257_+\|hydrogen-peroxide-inducible-genes-activator	gnl\|CDD\|176103	cd08411, PBP2_OxyR, The C-terminal substrate-binding domain of the LysR-type transcriptional regulator OxyR, a member of the type 2 periplasmic binding fold protein superfamily. OxyR senses hydrogen peroxide and is activated through the formation of an intramolecular disulfide bond. The OxyR activation induces the transcription of genes necessary for the bacterial defense against oxidative stress. The OxyR of LysR-type transcriptional regulator family is composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal substrate-binding domain, which is structurally homologous to the type 2 periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcriptional repressor undergoes a conformational change upon substrate binding which in turn changes the DNA binding affinity of the repressor. The C-terminal domain also contains the redox-active cysteines that mediate the redox-dependent conformational switch. Thus, the interaction between the OxyR-tetramer and DNA is notably different between the oxidized and reduced forms. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.03801e-67
NC_014974.1\|WP_015716533.1\|570066_571170_-\|5-(carboxyamino)imidazole-ribonucleotide-synthase	gnl\|CDD\|235674	PRK06019, PRK06019, phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed.	0
NC_014974.1\|WP_015716545.1\|579543_580353_-\|molybdopterin-synthase-adenylyltransferase-MoeB	gnl\|CDD\|236337	PRK08762, PRK08762, molybdopterin-synthase adenylyltransferase MoeB.	3.78677e-134
NC_014974.1\|WP_041438080.1\|571166_571661_-\|5-(carboxyamino)imidazole-ribonucleotide-mutase	gnl\|CDD\|376377	pfam00731, AIRC, AIR carboxylase. Members of this family catalyze the decarboxylation of 1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR). This family catalyze the sixth step of de novo purine biosynthesis. Some members of this family contain two copies of this domain.	1.03396e-88
NC_014974.1\|WP_015716549.1\|583349_584258_-\|manganese-catalase-family-protein	gnl\|CDD\|226076	COG3546, COG3546, Mn-containing catalase [Inorganic ion transport and metabolism].	8.06886e-93
NC_014974.1\|WP_015716532.1\|568891_570028_-\|AMP-binding-protein	gnl\|CDD\|341239	cd05913, PaaK, Phenylacetate-CoA ligase (also known as PaaK). PaaK catalyzes the first step in the aromatic degradation pathway, by converting phenylacetic acid (PA) into phenylacetyl-CoA (PA-CoA). Phenylacetate-CoA ligase has been found in proteobacteria as well as gram positive prokaryotes. The enzyme is specifically induced after aerobic growth in a chemically defined medium containing PA or phenylalanine (Phe) as the sole carbon source. PaaKs are members of the adenylate-forming enzyme (AFE) family. However, sequence comparison reveals divergent features of PaaK with respect to the superfamily, including a novel N-terminal sequence.	2.10738e-66
NC_014974.1\|WP_015716544.1\|578341_579475_+\|citrate-synthase/methylcitrate-synthase	gnl\|CDD\|99871	cd06118, citrate_synt_like_1, Citrate synthase (CS) catalyzes the condensation of acetyl coenzyme A (AcCoA) and oxalacetate (OAA) to form citrate and coenzyme A (CoA), the first step in the oxidative citric acid cycle (TCA or Krebs cycle). Peroxisomal CS is involved in the glyoxylate cycle. This group also includes CS proteins which functions as a 2-methylcitrate synthase (2MCS). 2MCS catalyzes the condensation of propionyl-CoA (PrCoA) and OAA to form 2-methylcitrate and CoA during propionate metabolism. This group contains proteins which functions exclusively as either a CS or a 2MCS, as well as those with relaxed specificity which have dual functions as both a CS and a 2MCS. The overall CS reaction is thought to proceed through three partial reactions and involves both closed and open conformational forms of the enzyme: a) the carbanion or equivalent is generated from AcCoA by base abstraction of a proton, b) the nucleophilic attack of this carbanion on OAA to generate citryl-CoA, and c) the hydrolysis of citryl-CoA to produce citrate and CoA. There are two types of CSs: type I CS and type II CSs. Type I CSs are found in eukarya, gram-positive bacteria, archaea, and in some gram-negative bacteria and are homodimers with both subunits participating in the active site. Type II CSs are unique to gram-negative bacteria and are homohexamers of identical subunits (approximated as a trimer of dimers). Some type II CSs are strongly and specifically inhibited by NADH through an allosteric mechanism.	0
NC_014974.1\|WP_015716542.1\|576148_577081_-\|signal-peptide-peptidase-SppA	gnl\|CDD\|132934	cd07023, S49_Sppa_N_C, Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad. Signal peptide peptidase A (SppA; Peptidase S49; Protease IV): SppA is found in all three domains of life and is involved in the cleavage of signal peptides after their removal from the precursor proteins by signal peptidases. This subfamily contains members with either a single domain (sometimes referred to as 36K type), such as sohB peptidase, protein C and archaeal signal peptide peptidase, or an amino-terminal domain in addition to the carboxyl-terminal protease domain that is conserved in all the S49 family members (sometimes referred to as 67K type), similar to E. coli and Arabidopsis thaliana SppA peptidases. Site-directed mutagenesis and sequence analysis have shown these SppAs to be serine proteases. The predicted active site serine for members in this family occurs in a transmembrane domain. Mutagenesis studies also suggest that the catalytic center comprises a Ser-Lys dyad and not the usual Ser-His-Asp catalytic triad found in the majority of serine proteases. Interestingly, the single membrane spanning E. coli SppA carries out catalysis using a Ser-Lys dyad with the serine located in the conserved carboxy-terminal protease domain and the lysine in the non-conserved amino-terminal domain.	2.02398e-81
NC_014974.1\|WP_015716531.1\|567695_568622_-\|carbohydrate-kinase-family-protein	gnl\|CDD\|223598	COG0524, RbsK, Sugar kinases, ribokinase family [Carbohydrate transport and metabolism].	6.36913e-59

>NC_014974.1|WP_049775658.1|574472_574829_+|metal-sulfur-cluster-assembly-factor
MQEGNANQAGGKEGLPTKEQVLEALKVVYDPEIPVNIVDLGLVYDVEIHENGVVDLTMTLTAIGCPAQDMVKADAEMAVMRLPGVQGVNVEFVWTPPWTPARMTEEGKRMMRMFGFNV
>NC_014974.1|WP_015716538.1|573499_574195_-|membrane-protein
METGVLSVILILVALEVILSADNALILGVIVQRLPVHLRRRALFYGILGAYVLRGLALLFAALVIKLWWVQVLGAAYLLYVALKHFLRAEGAHAAPPLEVSAAQFWKTVAQVELMDLAFAVDSVLVAVALSDKLWVIYTGVFLGILALRMLASLVVTLLDRYPRFKHLAYVVVGLAGVKLLVGGWDKLTKEVLHRPELAVGLDKEAFSLLILAVLLLGSLWALRKPAAQPS
>NC_014974.1|WP_015716537.1|572967_573498_-|alkaline-phosphatase
MSLWTYFLPALLLFLEVGFPFGLLVPGGDTLLLALGALAGEGRLSLFPLLPLLFLGSYLGHAVGYGLGRTLGQRLLERFPEHLRERAIKLLSRFGPSALLLAPFVPGMRTVVPFLLGTLGFPWLHYLLLAALGSLLWTQGLVLFAYFLGERLPAWLLWPILLLLALLPLLRRKPKA
>NC_014974.1|WP_015716536.1|572668_572971_+|hypothetical-protein
MDLVPLKLVTIVAESILEKKLVEEIKRLGAKGYTIVPARGEGSRGMRSLDWEGQNIRLETIVPEEVALRILARLQEAYFPHYAVIAYVENVWVVRGEKYI
>NC_014974.1|WP_015716535.1|571708_572665_+|sodium-dependent-bicarbonate-transport-family-permease
MDALELLRLNLLSPMVLAFALGMAARLLRSDLAFPEAMYTALSIYLLFAIGFKGGVELSKTPLATVLIPALATLGLGLFRPLSSYVLARRFLALGRVDAGALAAHYGSVSAVTFLAALTFAQAVGHRPEGFLPTLVALLEVPGIVVALLLAKRGGGNLGEAFQEVLTGKSVVLLVGGLLIGALSGEAGMERVKPFFVDPFYGALTLFLMDLGMVAASRFATLRQVGFRLILYGTLLPLFHGAVGVYVGHLVGFSVGGATVLGAMAASSSYIAAPAAVRIALPEANPSLYLAASLAVTFPFNLVLGIPIYHALAQWMGG
>NC_014974.1|WP_041438080.1|571166_571661_-|5-(carboxyamino)imidazole-ribonucleotide-mutase
MRPLVGVIMGSKSDWETLRHAAETLETLGIPYEVRVVSAHRTPDLMADYAKTAKERGLMVIIAGAGGAAHLPGMTAAHTPLPVLGVPVESKALKGLDSLLSIVQMPAGIPVGTLAIGKAGAVNAALLAASIVGLSHPEVMERLEAYRKAQTEAVLAHPDPREEG
>NC_014974.1|WP_015716533.1|570066_571170_-|5-(carboxyamino)imidazole-ribonucleotide-synthase
MRLGILGGGQLGRMLALAGYPLGLSFRFLDPSPEACAGQVGELVVGDFLDEEALRRFAEGLELVTYEFENVPVEAARFLEARLPVLPPPKALEVAQDRLAEKTFMHSLGIPTPPFRRVDGLRELREGLEALGFPALLKTRRGGYDGKGQALLTSWEEAERAFHALGGGGLILEGYVPFQRELSILGVRSRTGEVAFYPLVENRHQGGILRLSLAPAPQIPPTLQEKAEEYARKAMEALGYVGVVALELFQVREELLFNEMAPRVHNSGHWTLEGAETSQFENHLRALLGLPLGSTLPRGHSAMANLIGVKPDFPQVLALFGAHLHWYGKEVRPGRKVGHITLRRDTWEDLARDLPHLLALAQAPKPV
>NC_014974.1|WP_015716532.1|568891_570028_-|AMP-binding-protein
MDRNARLKEVVRAAKEHPVYREKFKQVHPEEVTLENLGELPLTTREEWVAYLKENPRPPEGASLMHLTPSPLMGWMPEYLSQEDLRYQTEALAEHYRRLGLTGKKVLVAFSYHVFAGGWLFHQALWRAGNLVFPHGPGEASRIAEIGHTYGFDVLVTNPSFALKVGQAGGRFALLLAGGEPFTSVPGFREKVEALLGCTALDAYGTSELGIVAGERLSKDGLWEIPEMAVLEVLDPETLKPVPDGEKGELVVTALSRTLMPMVRFRTGDLAVAERREGLTVLPRGVFGRTDQMVKVKGVKLYPTELAPILGGFSLDPRGFQVVVERKLEGTDKLVLRLKAEKVPAGLLEAITKATGLKVDEVELVGELEGGLVVDRRF
>NC_014974.1|WP_015716531.1|567695_568622_-|carbohydrate-kinase-family-protein
MRFFVVGDVSVDLLFFVERIPEPGEEVPSRRALMKPGGAGATLAAQLSSLGHRVYLAGRVGQDPFAELALSRVREVGVDLRHLQEDPDHTTSSVLILLVPGGERAMVSAEGASRYLDPSLFKPRFLDQADAVVLSAYALVGGPSRSYAVEVLEAARKREMPIFADLGTGAVRAAGRELLRYLRGVNWLLMNQTELLALTEASSLSEGVARLREEGFHHLAIKVGAMGSIVVTPEGEELIEPFPVEDIVDSTGSGDAYTATFAHAILSGKSPLEAGRLANLAGALAATAIGAQGRLIRLEDLEVAVGQG
>NC_014974.1|WP_015716529.1|566545_567130_+|imidazoleglycerol-phosphate-dehydratase-HisB
MREASVERATAETWVRVRLGLDGPPGGKVATGLPFLDHMLLQLQRHGRFLLEVEARGDLEVDVHHLVEDVGITLGQALREALGEGRGVERYAEAFAPMDETLVLCVLDLSGRPHLEYRPEEWPVVGEAGGVNHYHLREFLRGLVNHGRLTLHLRLLSGREAHHVVEASFKALARALHRATRITGEELPSTKGVL
>NC_014974.1|WP_019551239.1|575717_576155_-|RDD-family-protein
MVIASPWSRLVASLIDGLILVPLSFLLMALAGINPLAQTTTFVQDLLFNWIPSWAYYVIFTALYGATPGKMALGLKVVRTDGQPVDWLTAFMREVVGKTLSTLPLLLGYLWAFFHPKRQAWHDLIADTLVVRSGPASARSEEGAP
>NC_014974.1|WP_015716542.1|576148_577081_-|signal-peptide-peptidase-SppA
MNRKRWLALLLFVAVALLVVGLGRLIQSRETGHPWREATLYGRGEKVVLLEVVGSIPMGKDLEDLLSKIRQAREDQDIRAAVLFVDSPGGSVTETEAIHRALKDLAREKPLVAAFGTVAASGGYYVATAAREIFTPATAVTGSIGVIATLPQVQGLLAKLGVQVEVLKEGRLKDMGSGLRPLTPEERTLIQGYMREAYELFVARVAEGRHLPKDKVRQLADGRIYSGTQAIALGLADREGYLEDAAKRAAELAGLEEFRLVRYEKPKGLLEGLLGEGFPLGLSSETEQLVSLLGQNRFRLEYRYLGGGLW
>NC_014974.1|WP_015716543.1|577114_578260_+|class-I-SAM-dependent-rRNA-methyltransferase
MLRVVVKPGKEKKVRNFYPNLYRDELEEIPEQAGVAEAVAADGSFLAVGYLDPGSRIPFRAYRFDPGPLDRAFFLARFERALRKREGMGQSYRLVHGEADGLPGLVVDRFGEVLVLQVRTRGMEALREVWFPALLEAVGPKGVYERSDVEARRQEGLPERVGAVYGEVPEVLAVEEDGLVFPIPLALAQKTGFYLDQRENRRLFEGMVRPGERVLDVFSYVGGFALRAARKGAHALAVDKDLEALAILDQVALRMGLKVDIRQGEALEVLRGLQGLFDHILLDPPTLVKRPEEIPPMKRHLVDLLREALRLLAPEGYLWLSTCSYYLKAEDLLEVARRAAADRGMRLRVHGLTYQPKDHPWSLHVPESLYLKTLILQEDAL
>NC_014974.1|WP_015716544.1|578341_579475_+|citrate-synthase/methylcitrate-synthase
MEVARGLEGVLFTESRMCFIDGEAGRLYYYGIPIQELAEKSTFEETTFLLLHGRLPKREELEGFKKELARRRALPEHLLESFRRYPLSAHPMSFLRTAVSELGMLDPTEGDISQEALYQKGLDLIAKFATIVAANKRLREGKEPLAPREDLSHAANFLYMANGVEPSKEQERLMDAALILHAEHGFNASTFTAIAAFSTETDLYSAITAAVASLKGPRHGGANEAVMKMIREIGTPERAREWVREKLAKKERIMGMGHRVYKAFDPRAGVLEKLARIVAETHGHSTEYQILKIVEEEAGKVLNPRGIYPNVDFYSGVVYSDLGFGLEFFTPIFAVARISGWVGHILEYKALDNRLLRPDAKYTGELDVPYVPLEARA
>NC_014974.1|WP_015716545.1|579543_580353_-|molybdopterin-synthase-adenylyltransferase-MoeB
MWTKEELDRYHRQMILPQVGPEGQERLKRSSVVVVGAGGLGVPVLQYLVAAGVGRIGIVEMDRVEVSNLHRQVLYTTEDVGRPKALVAKERLQALNPLVQLDIYPVRLSSENALEILKPYDLVIDASDNFPTRYLVNDACVLLGKPLVYGAIYQFDGQIAVFHHKTPEGEMGPCYRCLFSKPPSPGSVPSCAEAGVFGVLPAVVGSLMAAEALKVLLGIGKPLAGSLLLYDALEGQFRKLALRRNPVCPVCGDHPTQRELIDYEAFCGL
>NC_014974.1|WP_015716546.1|580355_581237_-|acyltransferase
MPWLLPRGIAPLHEKALDRFIGALVEKLSDPSVDRNALVREELARLLYGRPYAELLELNPLAAMGLDPEGITFEAEYYAATDQEKFQKVKPLLWFWKVLDLTPIGQSVHSGVAIRRALAPFIFKRVGKNPKFFQNVEFSVGYNLELGDDVVVHRYVLLDDIGGIKIGDRTSLSDYVNVYSHTHHVLASPDVTLKETIIGSGVRITYHATILAGVRIGDDAMVGTGAIVTKDVPPHAIALGIPARPTRYKVRHDCPYCRKGEPHPSDLIPKAPDRKGNPDFPDFLPPGFGTREA
>NC_014974.1|WP_015716547.1|581281_582187_-|GTPase-Era
MEEKTYSGFVAIVGKPNVGKSTLLNNLLGVKVAPISPRPQTTRKRLRGILTEGNRQIVFVDTPGLHKPMDALGEFMDQEVYEALSDVNAVVWVVDLRHPPTPEDELVAKALKPLVGKVPILLVGNKLDAAKYPEEALKAYHALLPEAEARMLSALDERQVAELKAELLALLPEGPFFYPEDFAKSDQDFGEWVAEIIREEAMKRLWHEVPYAVAVKTEEVAERENGILYIKAVLYVERPSQKAIVIGEGGRKIKEIGQAARKQLEVFLNRQVYLDLEVKVYPDWRKDPEALRELGYRSSIG
>NC_014974.1|WP_015716548.1|582308_583310_+|DNA-protecting-protein-DprA
MDPLALALLPGIGPKRLLELLAEENPLLSLKERFPQVATQLPQAEGEARRERERAEALGVRILGLWEEAFPEGLRRLPQPPTHLYVQGDLPEEGKAVAIVGTRKASAWALSFTRKLARELSEAGLCVVSGLARGVDREAHLGALEGGGSTLGVLGSALDRIYPPEHRELARKVALVSEFPFGTGPKPEFFPRRNRIIAGLVRAVIVVEAPMESGALITARYALELGKEVLAVPGRPTDANSLGTNRLIQDGAYPVLSAEDVLSYLGFSGKPKKAVELSQEEEGLYALLRQGEALPEDLAQALGVPAEKVLSLLTLLELKGLAQALPGGRYGAL
>NC_014974.1|WP_015716549.1|583349_584258_-|manganese-catalase-family-protein
MFLRIDRLQIELPMPKEQDPNAAAAVQALLGGRFGEMSTLMNYMYQSFNFRGKKALKPYYDLIANIATEELGHIELVAATINSLLAKNPGKDLEESVDPVAAPLGFAKDARNAAHFIAGGANSLVMGAMGEHWHGEYVFTSGNLILDLLHNFFLEVAARTHKLRVYEMTDNPVAREMIGYLLVRGGVHAAAYGKALESLTGVEMTRMLPIPRIDNSKIPEAKKYMDLGFHRNLYRFSPSDYQDLGLIWSGPSPEDGSEVRVVDGPPEGGPVFDAGHDAAEFAPEFHPGELYEIAKKLYEKAK
>NC_014974.1|WP_015716550.1|584360_585257_+|hydrogen-peroxide-inducible-genes-activator
MTLEQMRYLVALVEERSFTRAAERVYLTQPALSVQIRKLEEELGVKLFDRRQGKPTEVGERVAAQARRVLEEVARVMAIARGEEGVFQGPFRVGVIPTLAPYLLPRLLPRLLERYPGLEVSVEEELTPAILQGLVEGRLDAGLVGTEERAPGVQSLPLFSEEFLAYISPGHPLYAKESLHPLEIPLEDTWILSEGHCFRDQVLSVCRPSLERRRVEFQSGDLETLILLVEEVGGLTLLPEVALWTLPRAKRLHLRPLSPPGAGRTVYLLVREGSLKAPVARALGEEAKGVFRELRLKG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_014974_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_014974_3

1182085-1184314

TypeI-E

I-E,II-B

Consensus_repeat	Method
CGGGCCATCCCCACGCGTGTGGGGACTAC	CRISPRCasFinder
CGGGCCATCCCCACGCGTGTGGGGACTAC	CRT
GGGCCATCCCCACGCGTGTGGGGACTAC	PILER-CR
CGGGCCATCCCCACGCGTGTGGGGACTAC	PILER-CR

36 spacers

cas2,cas1,cas6e,cas5,cas7,cse2gr11,cas8e,cas3,WYL

The CRISPR arrays of NC_014974_3

>merge|NC_014974|3|1182085-1184314|CRISPRCasFinder,CRT,PILER-CR,PILER-CR
CGGGCCATCGCCGCCCGTATCGGGACTACGCTGGATTATTGAGCGTTAAGCGGTCCCAACTCGGGCCATCCCCACGCGTGTGGGGACTACACCACCCCTTCGCTTGCGAGTTGCGTCAGTTGCGGGCCATCCCCACGCGTGTGGGGACTACGTGGAGGAGCCCCAGGTCCCTCCCGACCCGACCGGGCCATCCCCACGCGTGTGGGGACTACGCTGCCCTCCAGGGCTTGACCAGCTCCCCTATCGGGCCATCCCCACGCGTGTGGGGACTACATCCGGTTGAACGCCTCCTGCATCTTTGCCTCCGGGCCATCCCCACGCGTGTGGGGACTACCGTGTCCCCGTGCCGGGCGGCGTCGGTCATGACGGGCCATCCCCACGCGTGTGGGGACTACGGAGATGGCTCCCTGGACTGCCTTGGGGGTTAACGGGCCATCCCCACGCGTGTGGGGACTACCCATTCGGCTACCTGCCCCTACGAGGCCGCAGCGGGCCATCCCCACGCGTGTGGGGACTACTAGCTCAAACCGCCACTGCCTTCTTCGGGTGGCGGGCCATCCCCACGCGTGTGGGGACTACGCTGCCCCTCAAGTCCTGGATGCCACCGCCGTAGGGCCATCCCCACGCGTGTGGGGACTACCTGGCGTCGTACCAGGCGAAAGCCTTGCGGTACGGGCCATCCCCACGCGTGTGGGGACTACTCGTGGGCGTCCAGAATCCACCCGTCGCCCGTCGGGCCATCCCCACGCGTGTGGGGACTACTGTGAGTGACGATCAGTACGGCTGATCCCTGCCGGGCCATCCCCACGCGTGTGGGGACTACGGCAGGTATGCCCGACGGGTGGTAGGATCCCGCTGGGCCATCCCCACGCGTGTGGGGACTACATGCTCCGGGGGGTCGTAGATGACGATGCCAAACGGGCCATCCCCACGCGTGTGGGGACTACGATAGACTAGGAGAGGGTAGATGAACTGGTACCGGGCCATCCCCACGCGTGTGGGGACTACTGGACCTCCACGGTGTAGCTGGGCACCGTGGCCGGGCCATCCCCACGCGTGTGGGGACTACGGACCGGCCTCCCACGCCCCGTGGAGGTAACGCGGGCCATCCCCACGCGTGTGGGGACTACGGCTCCGGCATTGGGGCCGCCGGGGAGAACGAAGGGCCATCCCCACGCGTGTGGGGACTACGATAAGCCCCGGGCGGCCGAGGGACACATTCTCCGGGCCATCCCCACGCGTGTGGGGACTACCTACACCAGTTTACCGAGTGCGGGTGTGGGATCGGGCCATCCCCACGCGTGTGGGGACTACGGTTGCGGGCCGCTTCCTCGGCGATGCGGGCGGCGGGCCATCCCCACGCGTGTGGGGACTACCAGGACGTGGCCGAGGGTGTCCCCCACCTGGACGGGCCATCCCCACGCGTGTGGGGACTACTCCCCGGTCGCCATTTCCCACAGGACGGCCTCTGGGCCATCCCCACGCGTGTGGGGACTACCAGAGGTCTGCAGTCTCGTTCACCCGACGCACCGGGCCATCCCCACGCGTGTGGGGACTACGGACGCCCGCCCAGAGAAGACGCTCCACCTCGTCGGGCCATCCCCACGCGTGTGGGGACTACGCCTCGTCTTCCACGCCCGGTGGCAGGGAGACCCGGGCCATCCCCACGCGTGTGGGGACTACTGCGTTCCGCCATCTCAGCGTAAAACGGAACAAGGGCCATCCCCACGCGTGTGGGGACTACGTAGCCCGGGGATGGTCAGGGGTTATCCCCGTCGGGCCATCCCCACGCGTGTGGGGACTACGCCGGAGCATGGTCTACCTCCGAGAGCGCTTCGGGCCATCCCCACGCGTGTGGGGACTACGAGCTTCCGCCGGCGGAGCCTCCCGTGATCCCGGGCCATCCCCACGCGTGTGGGGACTACGGGCTCGGGCCGAGCTGGGGCGGCGGTTTCCGCGGGCCATCCCCACGCGTGTGGGGACTACGCGTGCCCCACCAGCCGGGGGATGTGGGTGAGCGGGCCATCCCCACGCGTGTGGGGACTACTGATATCCACCCTCAAACTCTCCACATCGCCACGGGCCATCCCCACGCGTGTGGGGACTACCCGTAATCCCAGAGTGGCTGAGCAAAAACTTGCGGGCCATCCCCACGCGTGTGGGGACTACTCAATGTAGTTCCGCTCGATCACCTCCCTTCTCGGGCCATCCCCACGCGTGTGGGGACTAC

>NC_014974|3|3|1182085-1184314|CRISPRCasFinder
CGGGCCATCGCCGCCCGTATCGGGACTAC	GCTGGATTATTGAGCGTTAAGCGGTCCCAACT
CGGGCCATCCCCACGCGTGTGGGGACTAC	ACCACCCCTTCGCTTGCGAGTTGCGTCAGTTG
CGGGCCATCCCCACGCGTGTGGGGACTAC	GTGGAGGAGCCCCAGGTCCCTCCCGACCCGAC
CGGGCCATCCCCACGCGTGTGGGGACTAC	GCTGCCCTCCAGGGCTTGACCAGCTCCCCTAT
CGGGCCATCCCCACGCGTGTGGGGACTAC	ATCCGGTTGAACGCCTCCTGCATCTTTGCCTC
CGGGCCATCCCCACGCGTGTGGGGACTAC	CGTGTCCCCGTGCCGGGCGGCGTCGGTCATGA
CGGGCCATCCCCACGCGTGTGGGGACTAC	GGAGATGGCTCCCTGGACTGCCTTGGGGGTTAA
CGGGCCATCCCCACGCGTGTGGGGACTAC	CCATTCGGCTACCTGCCCCTACGAGGCCGCAG
CGGGCCATCCCCACGCGTGTGGGGACTAC	TAGCTCAAACCGCCACTGCCTTCTTCGGGTGG
CGGGCCATCCCCACGCGTGTGGGGACTAC	GCTGCCCCTCAAGTCCTGGATGCCACCGCCGT
AGGGCCATCCCCACGCGTGTGGGGACTAC	CTGGCGTCGTACCAGGCGAAAGCCTTGCGGTA
CGGGCCATCCCCACGCGTGTGGGGACTAC	TCGTGGGCGTCCAGAATCCACCCGTCGCCCGT
CGGGCCATCCCCACGCGTGTGGGGACTAC	TGTGAGTGACGATCAGTACGGCTGATCCCTGC
CGGGCCATCCCCACGCGTGTGGGGACTAC	GGCAGGTATGCCCGACGGGTGGTAGGATCCCGC
TGGGCCATCCCCACGCGTGTGGGGACTAC	ATGCTCCGGGGGGTCGTAGATGACGATGCCAAA
CGGGCCATCCCCACGCGTGTGGGGACTAC	GATAGACTAGGAGAGGGTAGATGAACTGGTAC
CGGGCCATCCCCACGCGTGTGGGGACTAC	TGGACCTCCACGGTGTAGCTGGGCACCGTGGC
CGGGCCATCCCCACGCGTGTGGGGACTAC	GGACCGGCCTCCCACGCCCCGTGGAGGTAACG
CGGGCCATCCCCACGCGTGTGGGGACTAC	GGCTCCGGCATTGGGGCCGCCGGGGAGAACGA
AGGGCCATCCCCACGCGTGTGGGGACTAC	GATAAGCCCCGGGCGGCCGAGGGACACATTCTC
CGGGCCATCCCCACGCGTGTGGGGACTAC	CTACACCAGTTTACCGAGTGCGGGTGTGGGAT
CGGGCCATCCCCACGCGTGTGGGGACTAC	GGTTGCGGGCCGCTTCCTCGGCGATGCGGGCGG
CGGGCCATCCCCACGCGTGTGGGGACTAC	CAGGACGTGGCCGAGGGTGTCCCCCACCTGGA
CGGGCCATCCCCACGCGTGTGGGGACTAC	TCCCCGGTCGCCATTTCCCACAGGACGGCCTC
TGGGCCATCCCCACGCGTGTGGGGACTAC	CAGAGGTCTGCAGTCTCGTTCACCCGACGCAC
CGGGCCATCCCCACGCGTGTGGGGACTAC	GGACGCCCGCCCAGAGAAGACGCTCCACCTCGT
CGGGCCATCCCCACGCGTGTGGGGACTAC	GCCTCGTCTTCCACGCCCGGTGGCAGGGAGACC
CGGGCCATCCCCACGCGTGTGGGGACTAC	TGCGTTCCGCCATCTCAGCGTAAAACGGAACA
AGGGCCATCCCCACGCGTGTGGGGACTAC	GTAGCCCGGGGATGGTCAGGGGTTATCCCCGT
CGGGCCATCCCCACGCGTGTGGGGACTAC	GCCGGAGCATGGTCTACCTCCGAGAGCGCTT
CGGGCCATCCCCACGCGTGTGGGGACTAC	GAGCTTCCGCCGGCGGAGCCTCCCGTGATCC
CGGGCCATCCCCACGCGTGTGGGGACTAC	GGGCTCGGGCCGAGCTGGGGCGGCGGTTTCCG
CGGGCCATCCCCACGCGTGTGGGGACTAC	GCGTGCCCCACCAGCCGGGGGATGTGGGTGAG
CGGGCCATCCCCACGCGTGTGGGGACTAC	TGATATCCACCCTCAAACTCTCCACATCGCCA
CGGGCCATCCCCACGCGTGTGGGGACTAC	CCGTAATCCCAGAGTGGCTGAGCAAAAACTTG
CGGGCCATCCCCACGCGTGTGGGGACTAC	TCAATGTAGTTCCGCTCGATCACCTCCCTTCT
CGGGCCATCCCCACGCGTGTGGGGACTAC

>NC_014974|3|2|1182085-1184314|CRT
CGGGCCATCGCCGCCCGTATCGGGACTAC	GCTGGATTATTGAGCGTTAAGCGGTCCCAACT
CGGGCCATCCCCACGCGTGTGGGGACTAC	ACCACCCCTTCGCTTGCGAGTTGCGTCAGTTG
CGGGCCATCCCCACGCGTGTGGGGACTAC	GTGGAGGAGCCCCAGGTCCCTCCCGACCCGAC
CGGGCCATCCCCACGCGTGTGGGGACTAC	GCTGCCCTCCAGGGCTTGACCAGCTCCCCTAT
CGGGCCATCCCCACGCGTGTGGGGACTAC	ATCCGGTTGAACGCCTCCTGCATCTTTGCCTC
CGGGCCATCCCCACGCGTGTGGGGACTAC	CGTGTCCCCGTGCCGGGCGGCGTCGGTCATGA
CGGGCCATCCCCACGCGTGTGGGGACTAC	GGAGATGGCTCCCTGGACTGCCTTGGGGGTTAA
CGGGCCATCCCCACGCGTGTGGGGACTAC	CCATTCGGCTACCTGCCCCTACGAGGCCGCAG
CGGGCCATCCCCACGCGTGTGGGGACTAC	TAGCTCAAACCGCCACTGCCTTCTTCGGGTGG
CGGGCCATCCCCACGCGTGTGGGGACTAC	GCTGCCCCTCAAGTCCTGGATGCCACCGCCGT
AGGGCCATCCCCACGCGTGTGGGGACTAC	CTGGCGTCGTACCAGGCGAAAGCCTTGCGGTA
CGGGCCATCCCCACGCGTGTGGGGACTAC	TCGTGGGCGTCCAGAATCCACCCGTCGCCCGT
CGGGCCATCCCCACGCGTGTGGGGACTAC	TGTGAGTGACGATCAGTACGGCTGATCCCTGC
CGGGCCATCCCCACGCGTGTGGGGACTAC	GGCAGGTATGCCCGACGGGTGGTAGGATCCCGC
TGGGCCATCCCCACGCGTGTGGGGACTAC	ATGCTCCGGGGGGTCGTAGATGACGATGCCAAA
CGGGCCATCCCCACGCGTGTGGGGACTAC	GATAGACTAGGAGAGGGTAGATGAACTGGTAC
CGGGCCATCCCCACGCGTGTGGGGACTAC	TGGACCTCCACGGTGTAGCTGGGCACCGTGGC
CGGGCCATCCCCACGCGTGTGGGGACTAC	GGACCGGCCTCCCACGCCCCGTGGAGGTAACG
CGGGCCATCCCCACGCGTGTGGGGACTAC	GGCTCCGGCATTGGGGCCGCCGGGGAGAACGA
AGGGCCATCCCCACGCGTGTGGGGACTAC	GATAAGCCCCGGGCGGCCGAGGGACACATTCTC
CGGGCCATCCCCACGCGTGTGGGGACTAC	CTACACCAGTTTACCGAGTGCGGGTGTGGGAT
CGGGCCATCCCCACGCGTGTGGGGACTAC	GGTTGCGGGCCGCTTCCTCGGCGATGCGGGCGG
CGGGCCATCCCCACGCGTGTGGGGACTAC	CAGGACGTGGCCGAGGGTGTCCCCCACCTGGA
CGGGCCATCCCCACGCGTGTGGGGACTAC	TCCCCGGTCGCCATTTCCCACAGGACGGCCTC
TGGGCCATCCCCACGCGTGTGGGGACTAC	CAGAGGTCTGCAGTCTCGTTCACCCGACGCAC
CGGGCCATCCCCACGCGTGTGGGGACTAC	GGACGCCCGCCCAGAGAAGACGCTCCACCTCGT
CGGGCCATCCCCACGCGTGTGGGGACTAC	GCCTCGTCTTCCACGCCCGGTGGCAGGGAGACC
CGGGCCATCCCCACGCGTGTGGGGACTAC	TGCGTTCCGCCATCTCAGCGTAAAACGGAACA
AGGGCCATCCCCACGCGTGTGGGGACTAC	GTAGCCCGGGGATGGTCAGGGGTTATCCCCGT
CGGGCCATCCCCACGCGTGTGGGGACTAC	GCCGGAGCATGGTCTACCTCCGAGAGCGCTT
CGGGCCATCCCCACGCGTGTGGGGACTAC	GAGCTTCCGCCGGCGGAGCCTCCCGTGATCC
CGGGCCATCCCCACGCGTGTGGGGACTAC	GGGCTCGGGCCGAGCTGGGGCGGCGGTTTCCG
CGGGCCATCCCCACGCGTGTGGGGACTAC	GCGTGCCCCACCAGCCGGGGGATGTGGGTGAG
CGGGCCATCCCCACGCGTGTGGGGACTAC	TGATATCCACCCTCAAACTCTCCACATCGCCA
CGGGCCATCCCCACGCGTGTGGGGACTAC	CCGTAATCCCAGAGTGGCTGAGCAAAAACTTG
CGGGCCATCCCCACGCGTGTGGGGACTAC	TCAATGTAGTTCCGCTCGATCACCTCCCTTCT
CGGGCCATCCCCACGCGTGTGGGGACTAC

>NC_014974|3|2|1182147-1184314|PILER-CR
GGGCCATCCCCACGCGTGTGGGGACTAC	ACCACCCCTTCGCTTGCGAGTTGCGTCAGTTGC
GGGCCATCCCCACGCGTGTGGGGACTAC	GTGGAGGAGCCCCAGGTCCCTCCCGACCCGACC
GGGCCATCCCCACGCGTGTGGGGACTAC	GCTGCCCTCCAGGGCTTGACCAGCTCCCCTATC
GGGCCATCCCCACGCGTGTGGGGACTAC	ATCCGGTTGAACGCCTCCTGCATCTTTGCCTCC
GGGCCATCCCCACGCGTGTGGGGACTAC	CGTGTCCCCGTGCCGGGCGGCGTCGGTCATGAC
GGGCCATCCCCACGCGTGTGGGGACTAC	GGAGATGGCTCCCTGGACTGCCTTGGGGGTTAAC
GGGCCATCCCCACGCGTGTGGGGACTAC	CCATTCGGCTACCTGCCCCTACGAGGCCGCAGC
GGGCCATCCCCACGCGTGTGGGGACTAC	TAGCTCAAACCGCCACTGCCTTCTTCGGGTGGC
GGGCCATCCCCACGCGTGTGGGGACTAC	GCTGCCCCTCAAGTCCTGGATGCCACCGCCGTA
GGGCCATCCCCACGCGTGTGGGGACTAC	CTGGCGTCGTACCAGGCGAAAGCCTTGCGGTAC
GGGCCATCCCCACGCGTGTGGGGACTAC	TCGTGGGCGTCCAGAATCCACCCGTCGCCCGTC
GGGCCATCCCCACGCGTGTGGGGACTAC	TGTGAGTGACGATCAGTACGGCTGATCCCTGCC
GGGCCATCCCCACGCGTGTGGGGACTAC	GGCAGGTATGCCCGACGGGTGGTAGGATCCCGCT
GGGCCATCCCCACGCGTGTGGGGACTAC	ATGCTCCGGGGGGTCGTAGATGACGATGCCAAAC
GGGCCATCCCCACGCGTGTGGGGACTAC	GATAGACTAGGAGAGGGTAGATGAACTGGTACC
GGGCCATCCCCACGCGTGTGGGGACTAC	TGGACCTCCACGGTGTAGCTGGGCACCGTGGCC
GGGCCATCCCCACGCGTGTGGGGACTAC	GGACCGGCCTCCCACGCCCCGTGGAGGTAACGC
GGGCCATCCCCACGCGTGTGGGGACTAC	GGCTCCGGCATTGGGGCCGCCGGGGAGAACGAA
GGGCCATCCCCACGCGTGTGGGGACTAC	GATAAGCCCCGGGCGGCCGAGGGACACATTCTCC
GGGCCATCCCCACGCGTGTGGGGACTAC	CTACACCAGTTTACCGAGTGCGGGTGTGGGATC
GGGCCATCCCCACGCGTGTGGGGACTAC	GGTTGCGGGCCGCTTCCTCGGCGATGCGGGCGGC
GGGCCATCCCCACGCGTGTGGGGACTAC	CAGGACGTGGCCGAGGGTGTCCCCCACCTGGAC
GGGCCATCCCCACGCGTGTGGGGACTAC	TCCCCGGTCGCCATTTCCCACAGGACGGCCTCT
GGGCCATCCCCACGCGTGTGGGGACTAC	CAGAGGTCTGCAGTCTCGTTCACCCGACGCACC
GGGCCATCCCCACGCGTGTGGGGACTAC	GGACGCCCGCCCAGAGAAGACGCTCCACCTCGTCGGGCCATCCCCACGCGTGTGGGGACTACGCCTCGTCTTCCACGCCCGGTGGCAGGGAGACCCGGGCCATCCCCACGCGTGTGGGGACTACTGCGTTCCGCCATCTCAGCGTAAAACGGAACAAGGGCCATCCCCACGCGTGTGGGGACTACGTAGCCCGGGGATGGTCAGGGGTTATCCCCGTCGGGCCATCCCCACGCGTGTGGGGACTACGCCGGAGCATGGTCTACCTCCGAGAGCGCTTCGGGCCATCCCCACGCGTGTGGGGACTACGAGCTTCCGCCGGCGGAGCCTCCCGTGATCCCGGGCCATCCCCACGCGTGTGGGGACTACGGGCTCGGGCCGAGCTGGGGCGGCGGTTTCCGCGGGCCATCCCCACGCGTGTGGGGACTACGCGTGCCCCACCAGCCGGGGGATGTGGGTGAGCGGGCCATCCCCACGCGTGTGGGGACTACTGATATCCACCCTCAAACTCTCCACATCGCCACGGGCCATCCCCACGCGTGTGGGGACTACCCGTAATCCCAGAGTGGCTGAGCAAAAACTTGCGGGCCATCCCCACGCGTGTGGGGACTACTCAATGTAGTTCCGCTCGATCACCTCCCTTCTC
	GCCTCGTCTTCCACGCCCGGTGGCAGGGAGACC
CGGGCCATCCCCACGCGTGTGGGGACTAC	TGCGTTCCGCCATCTCAGCGTAAAACGGAACA
AGGGCCATCCCCACGCGTGTGGGGACTAC	GTAGCCCGGGGATGGTCAGGGGTTATCCCCGT
CGGGCCATCCCCACGCGTGTGGGGACTAC	GCCGGAGCATGGTCTACCTCCGAGAGCGCTT
CGGGCCATCCCCACGCGTGTGGGGACTAC	GAGCTTCCGCCGGCGGAGCCTCCCGTGATCC
CGGGCCATCCCCACGCGTGTGGGGACTAC	GGGCTCGGGCCGAGCTGGGGCGGCGGTTTCCG
CGGGCCATCCCCACGCGTGTGGGGACTAC	GCGTGCCCCACCAGCCGGGGGATGTGGGTGAG
CGGGCCATCCCCACGCGTGTGGGGACTAC	TGATATCCACCCTCAAACTCTCCACATCGCCA
CGGGCCATCCCCACGCGTGTGGGGACTAC	CCGTAATCCCAGAGTGGCTGAGCAAAAACTTG
CGGGCCATCCCCACGCGTGTGGGGACTAC	TCAATGTAGTTCCGCTCGATCACCTCCCTTCT
CGGGCCATCCCCACGCGTGTGGGGACTAC

>NC_014974|3|3|1183677-1184314|PILER-CR
	ACCACCCCTTCGCTTGCGAGTTGCGTCAGTTGC
GGGCCATCCCCACGCGTGTGGGGACTAC	GTGGAGGAGCCCCAGGTCCCTCCCGACCCGACC
GGGCCATCCCCACGCGTGTGGGGACTAC	GCTGCCCTCCAGGGCTTGACCAGCTCCCCTATC
GGGCCATCCCCACGCGTGTGGGGACTAC	ATCCGGTTGAACGCCTCCTGCATCTTTGCCTCC
GGGCCATCCCCACGCGTGTGGGGACTAC	CGTGTCCCCGTGCCGGGCGGCGTCGGTCATGAC
GGGCCATCCCCACGCGTGTGGGGACTAC	GGAGATGGCTCCCTGGACTGCCTTGGGGGTTAAC
GGGCCATCCCCACGCGTGTGGGGACTAC	CCATTCGGCTACCTGCCCCTACGAGGCCGCAGC
GGGCCATCCCCACGCGTGTGGGGACTAC	TAGCTCAAACCGCCACTGCCTTCTTCGGGTGGC
GGGCCATCCCCACGCGTGTGGGGACTAC	GCTGCCCCTCAAGTCCTGGATGCCACCGCCGTA
GGGCCATCCCCACGCGTGTGGGGACTAC	CTGGCGTCGTACCAGGCGAAAGCCTTGCGGTAC
GGGCCATCCCCACGCGTGTGGGGACTAC	TCGTGGGCGTCCAGAATCCACCCGTCGCCCGTC
GGGCCATCCCCACGCGTGTGGGGACTAC	TGTGAGTGACGATCAGTACGGCTGATCCCTGCC
GGGCCATCCCCACGCGTGTGGGGACTAC	GGCAGGTATGCCCGACGGGTGGTAGGATCCCGCT
GGGCCATCCCCACGCGTGTGGGGACTAC	ATGCTCCGGGGGGTCGTAGATGACGATGCCAAAC
GGGCCATCCCCACGCGTGTGGGGACTAC	GATAGACTAGGAGAGGGTAGATGAACTGGTACC
GGGCCATCCCCACGCGTGTGGGGACTAC	TGGACCTCCACGGTGTAGCTGGGCACCGTGGCC
GGGCCATCCCCACGCGTGTGGGGACTAC	GGACCGGCCTCCCACGCCCCGTGGAGGTAACGC
GGGCCATCCCCACGCGTGTGGGGACTAC	GGCTCCGGCATTGGGGCCGCCGGGGAGAACGAA
GGGCCATCCCCACGCGTGTGGGGACTAC	GATAAGCCCCGGGCGGCCGAGGGACACATTCTCC
GGGCCATCCCCACGCGTGTGGGGACTAC	CTACACCAGTTTACCGAGTGCGGGTGTGGGATC
GGGCCATCCCCACGCGTGTGGGGACTAC	GGTTGCGGGCCGCTTCCTCGGCGATGCGGGCGGC
GGGCCATCCCCACGCGTGTGGGGACTAC	CAGGACGTGGCCGAGGGTGTCCCCCACCTGGAC
GGGCCATCCCCACGCGTGTGGGGACTAC	TCCCCGGTCGCCATTTCCCACAGGACGGCCTCT
GGGCCATCCCCACGCGTGTGGGGACTAC	CAGAGGTCTGCAGTCTCGTTCACCCGACGCACC
GGGCCATCCCCACGCGTGTGGGGACTAC	GGACGCCCGCCCAGAGAAGACGCTCCACCTCGTCGGGCCATCCCCACGCGTGTGGGGACTACGCCTCGTCTTCCACGCCCGGTGGCAGGGAGACCCGGGCCATCCCCACGCGTGTGGGGACTACTGCGTTCCGCCATCTCAGCGTAAAACGGAACAAGGGCCATCCCCACGCGTGTGGGGACTACGTAGCCCGGGGATGGTCAGGGGTTATCCCCGTCGGGCCATCCCCACGCGTGTGGGGACTACGCCGGAGCATGGTCTACCTCCGAGAGCGCTTCGGGCCATCCCCACGCGTGTGGGGACTACGAGCTTCCGCCGGCGGAGCCTCCCGTGATCCCGGGCCATCCCCACGCGTGTGGGGACTACGGGCTCGGGCCGAGCTGGGGCGGCGGTTTCCGCGGGCCATCCCCACGCGTGTGGGGACTACGCGTGCCCCACCAGCCGGGGGATGTGGGTGAGCGGGCCATCCCCACGCGTGTGGGGACTACTGATATCCACCCTCAAACTCTCCACATCGCCACGGGCCATCCCCACGCGTGTGGGGACTACCCGTAATCCCAGAGTGGCTGAGCAAAAACTTGCGGGCCATCCCCACGCGTGTGGGGACTACTCAATGTAGTTCCGCTCGATCACCTCCCTTCTC
	GCCTCGTCTTCCACGCCCGGTGGCAGGGAGACC
CGGGCCATCCCCACGCGTGTGGGGACTAC	TGCGTTCCGCCATCTCAGCGTAAAACGGAACA
AGGGCCATCCCCACGCGTGTGGGGACTAC	GTAGCCCGGGGATGGTCAGGGGTTATCCCCGT
CGGGCCATCCCCACGCGTGTGGGGACTAC	GCCGGAGCATGGTCTACCTCCGAGAGCGCTT
CGGGCCATCCCCACGCGTGTGGGGACTAC	GAGCTTCCGCCGGCGGAGCCTCCCGTGATCC
CGGGCCATCCCCACGCGTGTGGGGACTAC	GGGCTCGGGCCGAGCTGGGGCGGCGGTTTCCG
CGGGCCATCCCCACGCGTGTGGGGACTAC	GCGTGCCCCACCAGCCGGGGGATGTGGGTGAG
CGGGCCATCCCCACGCGTGTGGGGACTAC	TGATATCCACCCTCAAACTCTCCACATCGCCA
CGGGCCATCCCCACGCGTGTGGGGACTAC	CCGTAATCCCAGAGTGGCTGAGCAAAAACTTG
CGGGCCATCCCCACGCGTGTGGGGACTAC	TCAATGTAGTTCCGCTCGATCACCTCCCTTCT
CGGGCCATCCCCACGCGTGTGGGGACTAC

Protein	Signature genes	Signature genes Name	Protein_function
NC_014974.1\|WP_015717128.1\|1168109_1170374_+\|EAL-domain-containing-protein	unknown	unknown	gnl\|CDD\|227334
NC_014974.1\|WP_015717147.1\|1188599_1190054_-\|type-I-E-CRISPR-associated-protein-Cse1/CasA	cas8e	pfam09481_cas8e_CAS-I-E	gnl\|CDD\|187860
NC_014974.1\|WP_015717144.1\|1186271_1186946_-\|type-I-E-CRISPR-associated-protein-Cas5/CasD	cas5	cd09756_cas5_CAS-I-E	gnl\|CDD\|378243
NC_014974.1\|WP_015717139.1\|1180915_1181209_-\|nucleotidyltransferase-family-protein	unknown	unknown	gnl\|CDD\|224583
NC_014974.1\|WP_015717140.1\|1181257_1181638_-\|hypothetical-protein	unknown	unknown	unknown
NC_014974.1\|WP_081454916.1\|1170491_1173377_+\|type-I-restriction-endonuclease-subunit-R	unknown	unknown	gnl\|CDD\|223683
NC_014974.1\|WP_015717123.1\|1164819_1165680_-\|carboxylating-nicotinate-nucleotide-diphosphorylase	unknown	unknown	gnl\|CDD\|238806
NC_014974.1\|WP_015717153.1\|1197314_1197608_+\|nucleotidyltransferase-family-protein	unknown	unknown	gnl\|CDD\|224583
NC_014974.1\|WP_148228690.1\|1174597_1175713_-\|hypothetical-protein	unknown	unknown	unknown
NC_014974.1\|WP_015717130.1\|1174005_1174587_-\|hypothetical-protein	unknown	unknown	unknown
NC_014974.1\|WP_015717145.1\|1186947_1188072_-\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	cas7	pfam09344_cas7_CAS-I-E	gnl\|CDD\|378153
NC_014974.1\|WP_015717141.1\|1184384_1184729_-\|type-I-E-CRISPR-associated-endoribonuclease-Cas2	cas2	pfam09707_cas2_CAS-I-E	gnl\|CDD\|378244
NC_014974.1\|WP_015717143.1\|1185664_1186282_-\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	cas6e	pfam08798_cas6e_CAS-I-E:CAS-IV	gnl\|CDD\|187858
NC_014974.1\|WP_015717146.1\|1188087_1188603_-\|type-I-E-CRISPR-associated-protein-Cse2/CasB	cse2gr11	cd09670_cse2gr11_CAS-I-E	gnl\|CDD\|237559
NC_014974.1\|WP_015717142.1\|1184682_1185657_-\|type-I-E-CRISPR-associated-endonuclease-Cas1	cas1	cd09719_cas1_CAS-I-E	gnl\|CDD\|274693
NC_014974.1\|WP_148228653.1\|1180230_1180566_+\|hypothetical-protein	unknown	unknown	unknown
NC_014974.1\|WP_041438342.1\|1180575_1180893_-\|DUF86-domain-containing-protein	unknown	unknown	gnl\|CDD\|225236
NC_014974.1\|WP_015717148.1\|1190483_1193267_-\|CRISPR-associated-helicase/endonuclease-Cas3	cas3	cd09639_cas3_CAS-I	gnl\|CDD\|182031
NC_014974.1\|WP_015717149.1\|1193276_1194245_-\|WYL-domain-containing-protein	WYL	pfam13280_WYL_CAS-I:CAS-III	gnl\|CDD\|379100
NC_014974.1\|WP_148228652.1\|1176096_1178220_-\|argonaute-PAZ-domain-containing-protein	unknown	unknown	gnl\|CDD\|240017

Protein	Function_ID	Function_description	E-value
NC_014974.1\|WP_015717144.1\|1186271_1186946_-\|type-I-E-CRISPR-associated-protein-Cas5/CasD	gnl\|CDD\|378243	pfam09704, Cas_Cas5d, CRISPR-associated protein (Cas_Cas5). CRISPR is a term for Clustered, Regularly Interspaced Short Palindromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This small Cas family is represented by CT1134 of Chlorobium tepidum.	4.09071e-53
NC_014974.1\|WP_015717147.1\|1188599_1190054_-\|type-I-E-CRISPR-associated-protein-Cse1/CasA	gnl\|CDD\|187860	cd09729, Cse1_I-E, CRISPR/Cas system-associated protein Cse1. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Large proteins, some contain Zn-finger domain; subunit of the Cascade complex; signature gene for I-E subtype; also known as Cse1/CasA/YgcL family.	2.89393e-99
NC_014974.1\|WP_015717153.1\|1197314_1197608_+\|nucleotidyltransferase-family-protein	gnl\|CDD\|224583	COG1669, COG1669, Predicted nucleotidyltransferases [General function prediction only].	1.34748e-26
NC_014974.1\|WP_015717139.1\|1180915_1181209_-\|nucleotidyltransferase-family-protein	gnl\|CDD\|224583	COG1669, COG1669, Predicted nucleotidyltransferases [General function prediction only].	2.76952e-27
NC_014974.1\|WP_081454916.1\|1170491_1173377_+\|type-I-restriction-endonuclease-subunit-R	gnl\|CDD\|223683	COG0610, COG0610, Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms].	0
NC_014974.1\|WP_015717123.1\|1164819_1165680_-\|carboxylating-nicotinate-nucleotide-diphosphorylase	gnl\|CDD\|238806	cd01572, QPRTase, Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase), also called nicotinate-nucleotide pyrophosphorylase, is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes. It catalyses the reaction of quinolinic acid (QA) with 5-phosphoribosyl-1-pyrophosphate (PRPP) in the presence of Mg2+ to produce nicotinic acid mononucleotide (NAMN), pyrophosphate and carbon dioxide. QPRTase functions as a homodimer with two active sites, each formed by the C-terminal region of one subunit and the N-terminal region of the other.	4.72963e-152
NC_014974.1\|WP_015717142.1\|1184682_1185657_-\|type-I-E-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|274693	TIGR03638, cas1_ECOLI, CRISPR-associated endonuclease Cas1, subtype I-E/ECOLI. The CRISPR-associated protein Cas1 is virtually universal to CRISPR systems. CRISPR, an acronym for Clustered Regularly Interspaced Short Palindromic Repeats, is prokaryotic immunity system for foreign DNA, mostly from phage. CRISPR systems belong to different subtypes, distinguished by both nature of the repeats, the makeup of the cohort of associated Cas proteins, and by molecular phylogeny within the more universal Cas proteins such as this one. This model is of type EXCEPTION and provides more specific information than the EQUIVALOG model TIGR00287. It describes the Cas1 protein particular to the ECOLI subtype of CRISPR/Cas system.	2.72007e-133
NC_014974.1\|WP_015717145.1\|1186947_1188072_-\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	gnl\|CDD\|378153	pfam09344, Cas_CT1975, CT1975-like protein. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family is represented by CT1975 of Chlorobium tepidum.	5.77055e-148
NC_014974.1\|WP_015717141.1\|1184384_1184729_-\|type-I-E-CRISPR-associated-endoribonuclease-Cas2	gnl\|CDD\|378244	pfam09707, Cas_Cas2CT1978, CRISPR-associated protein (Cas_Cas2CT1978). This entry represents a minor branch of the Cas2 family of CRISPR-associated protein which are found in IPR003799. Cas proteins are found adjacent to a characteristic short, palindromic repeat cluster termed CRISPR, a probable mobile DNA element.	1.79549e-40
NC_014974.1\|WP_015717143.1\|1185664_1186282_-\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	gnl\|CDD\|187858	cd09727, Cas6_I-E, CRISPR/Cas system-associated RAMP superfamily protein Cas6e. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas6e is an endoribonuclease that generates crRNA; This family is specific for CRISPR/Cas system I-E subtype; Homologous to Cas6 (RAMP superfamily protein); Possesses double RRM/ferredoxin fold; also known as Cse3 family.	7.49803e-61
NC_014974.1\|WP_015717146.1\|1188087_1188603_-\|type-I-E-CRISPR-associated-protein-Cse2/CasB	gnl\|CDD\|237559	PRK13921, PRK13921, CRISPR-associated Cse2 family protein; Provisional.	1.24351e-54
NC_014974.1\|WP_015717128.1\|1168109_1170374_+\|EAL-domain-containing-protein	gnl\|CDD\|227334	COG5001, COG5001, Predicted signal transduction protein containing a membrane domain, an EAL and a GGDEF domain [Signal transduction mechanisms].	3.71733e-99
NC_014974.1\|WP_041438342.1\|1180575_1180893_-\|DUF86-domain-containing-protein	gnl\|CDD\|225236	COG2361, COG2361, Uncharacterized conserved protein [Function unknown].	1.35229e-35
NC_014974.1\|WP_015717148.1\|1190483_1193267_-\|CRISPR-associated-helicase/endonuclease-Cas3	gnl\|CDD\|182031	PRK09694, PRK09694, CRISPR-associated helicase/endonuclease Cas3.	2.45614e-104
NC_014974.1\|WP_015717149.1\|1193276_1194245_-\|WYL-domain-containing-protein	gnl\|CDD\|379100	pfam13280, WYL, WYL domain. WYL is a Sm-like SH3 beta-barrel fold containing domain. It is a member of the WYL-like superfamily, named for three conserved amino acids found in a subset of the superfamily. However, these residues are not strongly conserved throughout the family. Rather, the conservation pattern includes four basic residues and a position often occupied by a cysteine, which are predicted to line a ligand-binding groove typical of the Sm-like SH3 beta-barrels. A WYL domain protein (sll7009) is a negative regulator of the I-D CRISPR-Cas system in Synechocystis sp. It is predicted to be a ligand-sensing domain that could bind negatively charged ligands, such as nucleotides or nucleic acid fragments, to regulate CRISPR-Cas and other defense systems such as the abortive infection AbiG system.	1.50985e-33
NC_014974.1\|WP_148228652.1\|1176096_1178220_-\|argonaute-PAZ-domain-containing-protein	gnl\|CDD\|240017	cd04659, Piwi_piwi-like_ProArk, Piwi_piwi-like_ProArk: PIWI domain, Piwi-like subfamily found in Archaea and Bacteria. RNA silencing refers to a group of related gene-silencing mechanisms mediated by short RNA molecules, including siRNAs, miRNAs, and heterochromatin-related guide RNAs. The central component of the RNA-induced silencing complex (RISC) and related complexes is Argonaute. The PIWI domain is the C-terminal portion of Argonaute and consists of two subdomains, one of which provides the 5' anchoring of the guide RNA and the other, the catalytic site for slicing. This domain is also found in closely related proteins, including the Piwi subfamily, where it is believed to perform a crucial role in germline cells, via a similar mechanism.	6.73248e-36

>NC_014974.1|WP_015717140.1|1181257_1181638_-|hypothetical-protein
MDHFDHLYLTLPRRLEVLIQEIHHLEARMAEERKALEAMVPVPVHWRKVKCGKDRCKRCPHGPYPYLRVKKEGKWRWKYLGKDWQPPEGFTRAGEFQERLGRYRRIVERLVELREKLRELERGLEP
>NC_014974.1|WP_015717139.1|1180915_1181209_-|nucleotidyltransferase-family-protein
MGPEEVKARIGPYRAELRERFGVEALYLFGSSARGEAREGSDVDLLVRFSRPPGFLGYMGLKLFLEDLLGRPVDLVMEHTLRPEVRPFVEREALKVA
>NC_014974.1|WP_041438342.1|1180575_1180893_-|DUF86-domain-containing-protein
MREFASRALRYRQGLEREAVFTDPMRLDAILRNLELLGEAAKRIPPAFRERYPEVPWREIAGLRDVLAHDYFGLDQDILWEVLTEHLPRLLVQLEQILAEEEGSV
>NC_014974.1|WP_148228653.1|1180230_1180566_+|hypothetical-protein
MIEPKSRDELAEAIKACVKADRELLDNLRREIAPLRHNVRKIIPRRATAVSLVATDGGNNQLRFDPFLIQVVRVVDSNNNEHYLDAVTPNTPIALLEERHLELRVGLVFTP
>NC_014974.1|WP_148228652.1|1176096_1178220_-|argonaute-PAZ-domain-containing-protein
MQGRKPGEDSGVPVYLNRFLLDHLTSPLSLPAFRVELDPPPSKDEVHPLLALVGREAGGLVRFQNRLIGWEAPRALEGQVRRGKQSYRLVPLGRQALNLRKPEERQALENLYRIRLENILKALAKRHRARVERRGNGLFLWRPENPREEKEGWHLYRGSLYRIHLYPDGEVILEVDVQHRFQPTLHLEEWLQRGYPLPRRVTNAYEDEKEWALLGIEEGKDPRSFLLDGGESLLDYHRKKGRLAEGQDPGRVVWVARGKERERIPHLSVLLKPVITMELLAEVAEVTQEALPALQLEPEERLKDIRRFAEPVLQAFGKRETAKPLEGRAQRLPRPSLLARGKKRVGKVADVLEKGALSPGETRLALLAWEGDGKAKGGLAYLEERLQGVGSASGIKLELKRRFLPRGDNLEMAQVFEELSQEGVGAGLLLTPRLTEGERRELKNTAASHGLALQLLNPFDPGDIYRVNNALLGFLAKAGWLFLRLEGTYPADLVVAYDAGGESLRFGGACFAHLTDGTHLGFSLPAAQGGERMAEEVAWELLRPLLLRYRKAKGQTPGRIFLLRDGKIQKEEFRKVEEELRKRNIPYALFSVRKTGAPRLFSKNGPLGDGLFLRLPEEEGGFLLLSAEGGKGTPRPVKYVLEAGEVDLNLEEAARQLYHLSRIYPGSGYRFPRLPAPLHMVDRMVREVARLGGSHNLRLKEEQLFFL
>NC_014974.1|WP_148228690.1|1174597_1175713_-|hypothetical-protein
MALPLFPETSPVTYFTDRKAFKEKFDLLSFYDQLSHPDAFLFNPARSPDEVVFTVRGDGITLTDGQGKPLVLDFRAGTGGKTSSLLPSPLLRLPLASEAGFRLGLGYLQGVDGVAVETSPELQEALKGNPSVCQQNPSPCALRGRGSFTAGLALDLAYATPLPEIPGAGRLHLGVRGLGFYGLAHLEAQAEARPVYQGDQISGTEYEVKSFLSYPGQGQGYGAMADLGLAWTYENLTLGLGVRNLLGFVRWSGQEEVYQNGQLISSTPAVRERAGLAPAAFLNGAYRLPLEEGSLLLAGDWALAEGSFHLGAEYAWSAFRLRAGFGREGGWRLGLGGGLRLPGLQLDAALTTHEAPLVGGLVYGLALSLGF
>NC_014974.1|WP_015717130.1|1174005_1174587_-|hypothetical-protein
MKRLAWLGLLFLLAACSGHTVTTLRLELHTFVPEANRSGSLDVVSGTLRFPDDDGDNTFGNDPDGYLFSLSDTRGVWEHASLSARIRLTHQGGGPVTISLEVHVAPEGNSNIYDGNGDYKVLEKSASLNPGEAAELAPSATLAPGDPAFDLLQSGRFRAGVLLSVTGSGSVQYTLEEAVLALSGKVFRLIPDE
>NC_014974.1|WP_081454916.1|1170491_1173377_+|type-I-restriction-endonuclease-subunit-R
MHPEGADLIQRNRAVHRMLVDGVTVEYRTSEGAIRGAQARVIDFDDPENNDWLAVNQFTVVENRHRRRPDVVLFVNGLPLAVIEFKNPTDKKATIWSAYRQLQTYKAEIPSLLVYNEALVISDGLEARIGTLTADRDRFMPWRTITGEDVAPAEMPQLEVLLKGVFERRRFLELVRGFVVFEDEGGGKLAKKMAGYHQFHAVRVAVEETLRAAARYEAGRQPGGKPGDRRIGVVWHTQGSGKSLTMVFYAGRIIRHPRMENPTIVVLTDRNDLDGQLFGVFSRCRELLGQDPIQAESRAHLRELLQGRQSGGVIFTTIQKFLPEEKGDRYPQLSDRRNIVVIADEAHRSQYDFIDGFARHMRDALPNASFIGFTGTPLELDDRNTRSVFGDYISIYDIQRAVLDGATVPIYYESRLAKLDLPEELKPKVDEEFEEVTESEEVERKERLKTKWAQLEAVVGAEKRLRLVAQDIVTHFEQRLEALDGKAMIVCMSRRICVELYNEIVRLRPAWHNDGDDKGVIKVVMTGSASDPVEWQSHIRNKQRREFLAKKRFRDPADPFKLVIVRDMWLTGFDCPSLHTMYLDKPMRAHGLMQAIARVNRVFRDKPGGLVVDYLGLAHELKAALATYTESGGTGRTAIDQSEAVAVMEEKYEICRNLFHGFDWSLWKTGRPEERLALLPAAQEHILAQENGKERLLQAVSELSRAFALALPHEKALAIRDDVAFFQAVRAALAKRASSEERTEEDLDHAIRQIVSRALMPEGVVDLFAAAGLKKPDISILSEEFLAEVRGMPQRNLAVELLRKLLEGEIKTRRKKNVVQARSFAEMLEQAIRRYQNRAVEAAQVIEELIALAREMREADRRGQALGLSEEELAFYDALETNDSAVKVLGEPTLREIARELVDTVRRNVTIDWTERENVRAHLRRLVKRVLRKYGYPPDKQERATQTVLEQAEVLSEQWAA
>NC_014974.1|WP_015717128.1|1168109_1170374_+|EAL-domain-containing-protein
MAEHLSHLTELDQVLETGLDLLMQLTGFSVGWVSLREGDGFRLAAARNLPPGLEAGAMQFTPCRCQRLVLEGVLLEAEEVGECERLRRLREELEGLPLEAVEQQTGGLSSHVVVPLRAGVEVLGVVNLARPGAEPLDPERRKALTLAGEVLGVAVRRALLHAELHRTQLHLWQALLDLAQRLLGVASLEDLVEALRQGLPALTALGEAPVRVLIQVPGAQAPVGLEGRVLELPLGEAPGPSPNLGEVWEVLRAQEGSPKPFWRGQLGVFPFPTGRDRGSRPSGHPPGALVVALERSPKDPKTATWVWNLAAEIVAQAIERVLAQEKALYLAYHDPLTDLPNRRAFLERLEEHLLLAQREGWSLVVGLLDLDGFKQVNDRYGHAVGDWLLAQVARRLRSAVRASDGVARLGGDEFAFLLPHLDPVSAAVVAERLLAAVRRPHNPPGLERRLSVRASLGLALYPQDAQDPSGLLQAADLALYQAKVHGDRYALFGRELQENFKHQIWLEEELRKALQRPRSLGLTLHYQPRMDLETGRITALEALLRFQHPLGPLSPKEVIPLAERTGLIRPLTRFALERAARTARRLGLPVGVNLSPAYLHEELVEWLAGMLRRLEVPGELLEVEITESVLMEAVEQRSGLLEALRRLGLRVALDDFGTGYSSLAYLAHLPLDLLKIDRSFVRGLQPGTKEARVIEAVASLGRILGKRVVAEGVETQDELLAVRQAGCHEVQGFLISPPVPAEEALARWGPPRRS
>NC_014974.1|WP_015717123.1|1164819_1165680_-|carboxylating-nicotinate-nucleotide-diphosphorylase
MEPPASPRIGPMVPLETLKAWLLEDLGHGDLTTALTVPEDLMGEAVILAKEEGVLAGLPVAREVFTLVDHRIAFTPLVEEGTKVDPGHEVARLEGPLRGILAGERLALNLLQRLSGIATLTRAYVEALKGTKAQVLDTRKTTPGLRALEKYAVRVGEGKNHRFGLFDGILIKENHIRAAGGVAQAVRKAKAKAPHYLKVEVEVTRLAELEEALEAGADLILLDNFSLEEMREAVRRVGGRVPLEASGNMTLERARAAAEAGVDYVSVGALTHSAKALDLSLLVVQP
>NC_014974.1|WP_015717141.1|1184384_1184729_-|type-I-E-CRISPR-associated-endoribonuclease-Cas2
MVVMILERVPRSLRGELTRWLVEVDTGVFVGRVSAAVRELLWEKVVEKAGEGRCAMAWRTNNEQGFALRLHGYQDRVLRDFDGIVLVAVRNAEAMRKADKLNGIARFARGDLDS
>NC_014974.1|WP_015717142.1|1184682_1185657_-|type-I-E-CRISPR-associated-endonuclease-Cas1
MPPVPSARNLKELPKFRDGLTYLYVEHAFIEQEAQGIGIYDQQGLTLVPVAALGVLFLGPGTRITHAAIRTLAANGCTVAWVGEGLARFYAQGLGDTRSALRLQRQARAWADPKLHLEVVFRLYQKRFQEPLPRDFSLEQVRGLEGVRVRAAYTRWSRETGVPWQGRSYDRRNWAASDPVNRALSSGAAYLYGLAHAAIVSSGFSPALGFIHTGKLLSFVYDVADLYKTEVLVPAAFLTVAEGDHQVERRVRQKLREAILEARLLERMVEDLLDLFAGLGLPEEEVDEEDPTRPGGLWDPEGVVEGGVAYGGDDPGEGAEEPEG
>NC_014974.1|WP_015717143.1|1185664_1186282_-|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE
MWISKLKLDLRSKAVRRDLASPYEMHRTLSRAVSQALKEGKERLLWRLEPTRGTEPPVVLVQTLTLPDWDALEKGYAEVYPPKPFQPALREGQILRFRLRANPSKRARDRGERIALKTREEKLVWLVRKFEEGGFRLREEGGQYLAAIRQDTFLEIPKAGHLIQVQAVLFEGVLVVVDPAKALETLKRGIGPGKALGLGLLSLHP
>NC_014974.1|WP_015717144.1|1186271_1186946_-|type-I-E-CRISPR-associated-protein-Cas5/CasD
MPTLLLRLQGPMQSWGTRSRFDHRDTWPYPTKSGVLGLLAAALGRDREEDISDLAALRMGVRVDRKGVLRVDYQTAQEIIAASLKAKVNVQSWRHYLSDAAFLVGLEGPAFLLEEAHQALLNPRYVLYLGRKGYVPSPPVYLADGVREEPLEVALRNYPYLLREKPKEDLLLVLEAQAGRLVYDQPIAPFAQRRFGARYVREEVLSKDQIQVKGEDSLGEDHVD
>NC_014974.1|WP_015717145.1|1186947_1188072_-|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC
MKLLEVHVIQTVAPSNLNRDDTGSPKDALFGGYRRARISSQAQKRAVRVAFKDWPLLSEEERAVRTRRLMDALLGKLSDIPEDQARLAVENALNALGFGVKEGRTEYLLFLGNYELSRLAELIRNNLEKLSAGPAKGKKGAEVDADLKKALERVLDGGKAVDLALFGRMLADRPELGVDAAAQVAHALSTHKVDREFDFYTAVDDLNPKEDTGAGMMGDVEFYSATMYRYAVVNLDQLAANLQGDVELALRGALVFLEAFALTLPSGKQNSFAAHNPPLFLAFRAGVGLPRNLATAFERPVWSKDGKALSALSVEALVQEWNKFDRAYGPLEPEWKGALNLTEAEVVNLPVVESLGSLKQEAEKALRELLALGG
>NC_014974.1|WP_015717146.1|1188087_1188603_-|type-I-E-CRISPR-associated-protein-Cse2/CasB
MSGKRFVEWLSELKSRQGWTPARAVLRRSLAFDPGGYPPAMPYVEPLLQNLGDDGWRREAYYLVAGLFALKDGEHQEGRTLARALWEARQTRQSDSLEKRFLALLDADRDQIAHRLRQAVGLVEGALDFAQLLEDLLRWFDPKRRVQARWAREFYGAQEFGQEALAEGQGS
>NC_014974.1|WP_015717147.1|1188599_1190054_-|type-I-E-CRISPR-associated-protein-Cse1/CasA
MSKFNLLLEPWIPVLRNDKVEEVGVREALVNAHTITRIETPFPLEEAALHRLLLAVLYRALPPVKGKYDALDLLDRGEFDRGSLEGYLDKYWDRFYLFHDTAPFLQIPDLPQEDLLPWSKLLPQLANGNNPTLFDHTVDENPPLASYAEAARALVVHQSFAPGGLLRRLGVTSAKDAPLARPAAFLVMGANLFETLVLNLVPQGDPGMPVWEREPLRVKDVEKHATKWSLSGVSLVYVWPSRGVRLVDEGQGVRWMDYGPGVEPQEVAWRDPMVAYRQDKKGSILPLRLSMEKSFWRDFGAMLPAAGGTWPAVLVHAGELEEEGVSFTLRVLGQVSDQAKILDIRREVYPIPKDLLTPKGEGLLDRGLKVAEEVARGLKQVAWRVAQGVLGNRDASELQNFANSLPLLSLYWAQLDLDFPDFLGRLPEQGALDLWRERIQKAARGAWEETRRFVGTEARHLKALAEAERAFRGLLAGMKEEVKG
>NC_014974.1|WP_015717148.1|1190483_1193267_-|CRISPR-associated-helicase/endonuclease-Cas3
MEVQTQALTLWAKSGDPFHPLLAHMLDTAAVAWAILEREPGRTRKLYATDWNLGEKEALPWVAFLAGLHDLGKASPVFQAAWDEGAKQVWDAGLTWDEELVREQWVAHGVFTELYVKDVLKRHGLPLRLADPLAKGLGAHHGFLAQGEELKTARLHVKSEASTWQEVRDHLALRLAQSLGLNLPLVLPVEDAEAPAILRVMALASFADWIASDPRFFPYGRDPEALEYWQDALELARKALEDLPWPRVSPRGVRRFEELFPFSPNPLQSSVPELLEKTPGDSVLLLVEAPMGLGKTEAALYASHLLRERLDHRGLYVALPTQATANGLFNRIREFLERLSGGERWELQLQHGAALLNPQYAELLERARPMEVYDIELERNPGQESGGVAASTWFSAKKRAMLAGHGVGTLDQALLGVLKVKHHFIRLWGLMNRVVVLDEVHAYDTYTSGLLKSLLLWLRALGSSVILMTATLPKKKREELLSAWGVGGVELPPYPRVAAFSGGGLLGARHVPLEEKTLHLQGAPTEVSQVAEALKEQLPGALGALVNTVDRAQALYQALGEGERLTLDELLDSFGAGPNQGAWPGLWEIREEKGRWVVGKRLKDGTLVFLLHARFPAEERALREAVTLALFGKHGPRPEKAILVATQVAEQSLDLDFDLLYSDLAPVDLLFQRAGRLHRHTRKRPEGHQTPVLLVGGLTDEPEFGRELHWNRVYEDYVLLSTWLALQGRETVKVPADLEGLLEEVYERLPEGFPDSLRDRARKSYQNLIDRLQKDASMAGNLSLAELDRLLSQLDASALASDFRLDDEEENASTQRFLTRLGEPSVSVVPLYRRGEEWFLDADGRRPAKMKGDLGKEDVLALWSRAVRLSRFPIPQTLLGEKPPSAWAKSGLLRGLRPLEVERVFAREDSVLKVVVDEELGVVYVDV
>NC_014974.1|WP_015717149.1|1193276_1194245_-|WYL-domain-containing-protein
MDPKSKAERFLSLVERLSLRPHRVSELAQLYGVSVRTVERDLEALSHAGYRIEQLGRGLYRIPDRPPTLHPVEALALFAAGRLLYHQAPTRQYENALEKLAKMLPEPLRSLLLKSTQGLEERRGDSRTLEMVARALLERRVLAFEYRSGGSKNWRPKEVLVYFLEANRTNLGLYAIGYERTYHRQILTFKLNRMRNARLLEETYEFPEDFDPNVYLRQAWGVVGAREETVEVRLRFAPEAAWRALEGDYPGLTVDKELPDGSLLARLKAVPFKGGVPWEVLSWVQSFGPRVEVLSPPELRSLWLEEARQVLAKATESVGIRG
>NC_014974.1|WP_015717153.1|1197314_1197608_+|nucleotidyltransferase-family-protein
MGPEEVKARIGPYRAELRERFGVEALYLFGSSARGEAGEGSDVDLLVRFSRPPGFLGCMGLKLFLEDLLGRPVDLVMEHTLRPEVQPFVEREALKVA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_014974_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_014974_4

1194463-1197065

TypeI-E

I-B,III-A,III-B

Consensus_repeat	Method
GTAGTCCCCACGCATGTGGGGATGGCCC	PILER-CR
GTAGTCCCCACGCATGTGGGGATGGCCCG	CRISPRCasFinder
GTAGTCCCCACGCATGTGGGGATGGCCCG	CRT

42 spacers

WYL,cas3,cas8e,cse2gr11,cas7,cas5,cas6e,cas1,cas2

The CRISPR arrays of NC_014974_4

>merge|NC_014974|4|1194463-1197065|PILER-CR,CRISPRCasFinder,CRT
GTAGTCCCCACGCATGTGGGGATGGCCCAGGGACTCTGGCAGGTATCCTGGCGGTTCTGGCGTAGTCCCCACGCATGTGGGGATGGCCCGCGCAAGAAGTGAGCCCACCGGGGCCAGGAGCCCGTAGTCCCCACGCATGTGGGGATGGCCCGGGCCCCCGCATCACAAACTGCTGGATCACGGGAGTAGTCCCCACGCATGTGGGGATGGCCCGCGCACCACCTGGTTGTCCATAAGCCCCCCGGCGTAGTCCCCACGCATGTGGGGATGGCCCGCTCCGAAACCTCCTTGAGCCGCAAAAGCCGCAGTAGTCCCCACGCATGTGGGGATGGCCCGGCTCCCAGGCGTCCCGGGAAAAAATCCGGGTCGTAGTCCCCACGCATGTGGGGATGGCCCGGTGAGGTCTAGGGCGGCGGCGGGCATGAGCACGTAGTCCCCACGCATGTGGGGATGGCCCGAGCTTGAACCCATGCGGATCACCGCCGTGGAAGTAGTCCCCACGCATGTGGGGATGGCCCGGTGGTGGCGGCCAGGTTGCGCCACAAGGATGTAGTAGTCCCCACGCATGTGGGGATGGCCCGCGCACCCCTCCCCCCACCCGGGCCTGGTACTCCGTAGTCCCCACGCATGTGGGGATGGCCCGGATGACCCTATCGTCCTCGCGGTAGGGCCACACGTAGTCCCCACGCATGTGGGGATGGCCCGGCCGCCTTCCTCCAGCGACCGGATCGCCCGCCGTAGTCCCCACGCATGTGGGGATGGCCCGCCCCACCCTGAGGGCCCCACGTCTAGCCGTCCGTAGTCCCCACGCATGTGGGGATGGCCCGCGGAGGGCCCTTTCCGCGATTAGCCCCTGGACCGTAGTCCCCACGCATGTGGGGATGGCCCGCGCGCCTGGCGCTCCACGTGCGGGACGAAGCCGTAGTCCCCACGCATGTGGGGATGGCCCGTGGTGACGGCGGTGACGCTGGTGTCCGGGGGAGTAGTCCCCACGCATGTGGGGATGGCCCGCGGTAATCCGGGGCGCTGTGGTGAAGGGCGCGTAGTCCCCACGCATGTGGGGATGGCCCGGATTGGAACGCCAGGGTACCGGACACCTGGCAGTAGTCCCCACGCATGTGGGGATGGCCCGGAAAAATCCACGCCGCATATTCCTTTTTGGGCGTAGTCCCCACGCATGTGGGGATGGCCCGCGGGCGTTTGGGGACGTGGCCGCCAAGTTCGGGTAGTCCCCACGCATGTGGGGATGGCCCGCTACGCCCCCATCCCCAAGAAGGCTAAAGCGGGTAGTCCCCACGCATGTGGGGATGGCCCGAGCCAACCGCCAGTGCAAGCCCCATCGCCATCGTAGTCCCCACGCATGTGGGGATGGCCCGGCCCTGCTGACCTCCTCCAGCAGGGCCCCCTCGTAGTCCCCACGCATGTGGGGATGGCCCGTGGAACATGACGGGCACTGTTACAGGCCGATTCGTAGTCCCCACGCATGTGGGGATGGCCCGGTCCGGGTGAACGAGGCTATGCTGGAGACCCTGTAGTCCCCACGCATGTGGGGATGGCCCGGCTCTGGATGAGGCCAGAGTGCCCCAGAGCGGGTAGTCCCCACGCATGTGGGGATGGCCCGTACCGCCCCCCACGGCGCTGGCAAGGCGCTCCGTAGTCCCCACGCATGTGGGGATGGCCCGCTATTCATCAGGACGAGGGGGGAAGAAAAATGGTAGTCCCCACGCATGTGGGGATGGCCCGGGTTGCGCCCTACAGCGTGTTCCCGGTGCCCCGTAGTCCCCACGCATGTGGGGATGGCCCTTTCCTCGTTGTCGGTCATCGCCTCCTCAGCCCGTAGTCCCCACGCATGTGGGGATGGCCCGGGAAGAGGGCGGTTCTAACTCGAGCCAGGCTCGTAGTCCCCACGCATGTGGGGATGGCCCGGATGAGGACGGGGTTTGGACATGCAGGGGCGGCCCGTAGTCCCCACGCATGTGGGGATGGCCCGTATTTGACGGGGTCGTGGTTAGTGTTGCGTGAGTAGTCCCCACGCATGTGGGGATGGCCCGGCAGGTGGTGGCGGTGTCCCAGGTTTTCCCTCGTAGTCCCCACGCATGTGGGGATGGCCCGAAAGGGGAGGAGGTGGCCTAATGCGCCGGATCCGTAGTCCCCACGCATGTGGGGATGGCCCGCCCCATCTCCCGTCCGATATCCACAGCAATGGGTAGTCCCCACGCATGTGGGGATGGCCCGACGCCCGGCGGGCGGAGCTTCTCGGGAAGAAAGTAGTCCCCACGCATGTGGGGATGGCCCGCGAGTAGCTTCCCGGCGCAAGGTCGTCCCCGCGTAGTCCCCACGCATGTGGGGATGGCCCGGCCACCCCGCTCGCTCCCAGGCGCTGGATGCGCGTAGTCCCCACGCATGTGGGGATGGCCCGGAGGTGAGTGCTGTGGGCTTTGAACCGGGTGAGTAGTCCCCACGCATGTGGGGATGGCCCAGTCGTATTTAATGATGTATTGGGCGTTCCAGGCGTAGTCCCCACGCATGTGGGGATGGCCCGCATCGGAGGAGGTGGGATGATGCGCAGGGCAAGTAGTCCCCACGCACGTGGGGATGGCCTG

>NC_014974|4|4|1194463-1197064|PILER-CR
GTAGTCCCCACGCATGTGGGGATGGCCC	AGGGACTCTGGCAGGTATCCTGGCGGTTCTGGC
GTAGTCCCCACGCATGTGGGGATGGCCC	GCGCAAGAAGTGAGCCCACCGGGGCCAGGAGCCC
GTAGTCCCCACGCATGTGGGGATGGCCC	GGGCCCCCGCATCACAAACTGCTGGATCACGGGA
GTAGTCCCCACGCATGTGGGGATGGCCC	GCGCACCACCTGGTTGTCCATAAGCCCCCCGGC
GTAGTCCCCACGCATGTGGGGATGGCCC	GCTCCGAAACCTCCTTGAGCCGCAAAAGCCGCA
GTAGTCCCCACGCATGTGGGGATGGCCC	GGCTCCCAGGCGTCCCGGGAAAAAATCCGGGTC
GTAGTCCCCACGCATGTGGGGATGGCCC	GGTGAGGTCTAGGGCGGCGGCGGGCATGAGCAC
GTAGTCCCCACGCATGTGGGGATGGCCC	GAGCTTGAACCCATGCGGATCACCGCCGTGGAA
GTAGTCCCCACGCATGTGGGGATGGCCC	GGTGGTGGCGGCCAGGTTGCGCCACAAGGATGTA
GTAGTCCCCACGCATGTGGGGATGGCCC	GCGCACCCCTCCCCCCACCCGGGCCTGGTACTCC
GTAGTCCCCACGCATGTGGGGATGGCCC	GGATGACCCTATCGTCCTCGCGGTAGGGCCACAC
GTAGTCCCCACGCATGTGGGGATGGCCC	GGCCGCCTTCCTCCAGCGACCGGATCGCCCGCC
GTAGTCCCCACGCATGTGGGGATGGCCC	GCCCCACCCTGAGGGCCCCACGTCTAGCCGTCC
GTAGTCCCCACGCATGTGGGGATGGCCC	GCGGAGGGCCCTTTCCGCGATTAGCCCCTGGACC
GTAGTCCCCACGCATGTGGGGATGGCCC	GCGCGCCTGGCGCTCCACGTGCGGGACGAAGCC
GTAGTCCCCACGCATGTGGGGATGGCCC	GTGGTGACGGCGGTGACGCTGGTGTCCGGGGGA
GTAGTCCCCACGCATGTGGGGATGGCCC	GCGGTAATCCGGGGCGCTGTGGTGAAGGGCGC
GTAGTCCCCACGCATGTGGGGATGGCCC	GGATTGGAACGCCAGGGTACCGGACACCTGGCA
GTAGTCCCCACGCATGTGGGGATGGCCC	GGAAAAATCCACGCCGCATATTCCTTTTTGGGC
GTAGTCCCCACGCATGTGGGGATGGCCC	GCGGGCGTTTGGGGACGTGGCCGCCAAGTTCGG
GTAGTCCCCACGCATGTGGGGATGGCCC	GCTACGCCCCCATCCCCAAGAAGGCTAAAGCGG
GTAGTCCCCACGCATGTGGGGATGGCCC	GAGCCAACCGCCAGTGCAAGCCCCATCGCCATC
GTAGTCCCCACGCATGTGGGGATGGCCC	GGCCCTGCTGACCTCCTCCAGCAGGGCCCCCTC
GTAGTCCCCACGCATGTGGGGATGGCCC	GTGGAACATGACGGGCACTGTTACAGGCCGATTC
GTAGTCCCCACGCATGTGGGGATGGCCC	GGTCCGGGTGAACGAGGCTATGCTGGAGACCCT
GTAGTCCCCACGCATGTGGGGATGGCCC	GGCTCTGGATGAGGCCAGAGTGCCCCAGAGCGG
GTAGTCCCCACGCATGTGGGGATGGCCC	GTACCGCCCCCCACGGCGCTGGCAAGGCGCTCC
GTAGTCCCCACGCATGTGGGGATGGCCC	GCTATTCATCAGGACGAGGGGGGAAGAAAAATG
GTAGTCCCCACGCATGTGGGGATGGCCC	GGGTTGCGCCCTACAGCGTGTTCCCGGTGCCCC
GTAGTCCCCACGCATGTGGGGATGGCCC	TTTCCTCGTTGTCGGTCATCGCCTCCTCAGCCC
GTAGTCCCCACGCATGTGGGGATGGCCC	GGGAAGAGGGCGGTTCTAACTCGAGCCAGGCTC
GTAGTCCCCACGCATGTGGGGATGGCCC	GGATGAGGACGGGGTTTGGACATGCAGGGGCGGCCC
GTAGTCCCCACGCATGTGGGGATGGCCC	GTATTTGACGGGGTCGTGGTTAGTGTTGCGTGA
GTAGTCCCCACGCATGTGGGGATGGCCC	GGCAGGTGGTGGCGGTGTCCCAGGTTTTCCCTC
GTAGTCCCCACGCATGTGGGGATGGCCC	GAAAGGGGAGGAGGTGGCCTAATGCGCCGGATCC
GTAGTCCCCACGCATGTGGGGATGGCCC	GCCCCATCTCCCGTCCGATATCCACAGCAATGG
GTAGTCCCCACGCATGTGGGGATGGCCC	GACGCCCGGCGGGCGGAGCTTCTCGGGAAGAAA
GTAGTCCCCACGCATGTGGGGATGGCCC	GCGAGTAGCTTCCCGGCGCAAGGTCGTCCCCGC
GTAGTCCCCACGCATGTGGGGATGGCCC	GGCCACCCCGCTCGCTCCCAGGCGCTGGATGCGC
GTAGTCCCCACGCATGTGGGGATGGCCC	GGAGGTGAGTGCTGTGGGCTTTGAACCGGGTGA
GTAGTCCCCACGCATGTGGGGATGGCCC	AGTCGTATTTAATGATGTATTGGGCGTTCCAGGC
GTAGTCCCCACGCATGTGGGGATGGCCC	GCATCGGAGGAGGTGGGATGATGCGCAGGGCAA
GTAGTCCCCACGCACGTGGGGATGGCCT

>NC_014974|4|4|1194463-1197065|CRISPRCasFinder
GTAGTCCCCACGCATGTGGGGATGGCCCA	GGGACTCTGGCAGGTATCCTGGCGGTTCTGGC
GTAGTCCCCACGCATGTGGGGATGGCCCG	CGCAAGAAGTGAGCCCACCGGGGCCAGGAGCCC
GTAGTCCCCACGCATGTGGGGATGGCCCG	GGCCCCCGCATCACAAACTGCTGGATCACGGGA
GTAGTCCCCACGCATGTGGGGATGGCCCG	CGCACCACCTGGTTGTCCATAAGCCCCCCGGC
GTAGTCCCCACGCATGTGGGGATGGCCCG	CTCCGAAACCTCCTTGAGCCGCAAAAGCCGCA
GTAGTCCCCACGCATGTGGGGATGGCCCG	GCTCCCAGGCGTCCCGGGAAAAAATCCGGGTC
GTAGTCCCCACGCATGTGGGGATGGCCCG	GTGAGGTCTAGGGCGGCGGCGGGCATGAGCAC
GTAGTCCCCACGCATGTGGGGATGGCCCG	AGCTTGAACCCATGCGGATCACCGCCGTGGAA
GTAGTCCCCACGCATGTGGGGATGGCCCG	GTGGTGGCGGCCAGGTTGCGCCACAAGGATGTA
GTAGTCCCCACGCATGTGGGGATGGCCCG	CGCACCCCTCCCCCCACCCGGGCCTGGTACTCC
GTAGTCCCCACGCATGTGGGGATGGCCCG	GATGACCCTATCGTCCTCGCGGTAGGGCCACAC
GTAGTCCCCACGCATGTGGGGATGGCCCG	GCCGCCTTCCTCCAGCGACCGGATCGCCCGCC
GTAGTCCCCACGCATGTGGGGATGGCCCG	CCCCACCCTGAGGGCCCCACGTCTAGCCGTCC
GTAGTCCCCACGCATGTGGGGATGGCCCG	CGGAGGGCCCTTTCCGCGATTAGCCCCTGGACC
GTAGTCCCCACGCATGTGGGGATGGCCCG	CGCGCCTGGCGCTCCACGTGCGGGACGAAGCC
GTAGTCCCCACGCATGTGGGGATGGCCCG	TGGTGACGGCGGTGACGCTGGTGTCCGGGGGA
GTAGTCCCCACGCATGTGGGGATGGCCCG	CGGTAATCCGGGGCGCTGTGGTGAAGGGCGC
GTAGTCCCCACGCATGTGGGGATGGCCCG	GATTGGAACGCCAGGGTACCGGACACCTGGCA
GTAGTCCCCACGCATGTGGGGATGGCCCG	GAAAAATCCACGCCGCATATTCCTTTTTGGGC
GTAGTCCCCACGCATGTGGGGATGGCCCG	CGGGCGTTTGGGGACGTGGCCGCCAAGTTCGG
GTAGTCCCCACGCATGTGGGGATGGCCCG	CTACGCCCCCATCCCCAAGAAGGCTAAAGCGG
GTAGTCCCCACGCATGTGGGGATGGCCCG	AGCCAACCGCCAGTGCAAGCCCCATCGCCATC
GTAGTCCCCACGCATGTGGGGATGGCCCG	GCCCTGCTGACCTCCTCCAGCAGGGCCCCCTC
GTAGTCCCCACGCATGTGGGGATGGCCCG	TGGAACATGACGGGCACTGTTACAGGCCGATTC
GTAGTCCCCACGCATGTGGGGATGGCCCG	GTCCGGGTGAACGAGGCTATGCTGGAGACCCT
GTAGTCCCCACGCATGTGGGGATGGCCCG	GCTCTGGATGAGGCCAGAGTGCCCCAGAGCGG
GTAGTCCCCACGCATGTGGGGATGGCCCG	TACCGCCCCCCACGGCGCTGGCAAGGCGCTCC
GTAGTCCCCACGCATGTGGGGATGGCCCG	CTATTCATCAGGACGAGGGGGGAAGAAAAATG
GTAGTCCCCACGCATGTGGGGATGGCCCG	GGTTGCGCCCTACAGCGTGTTCCCGGTGCCCC
GTAGTCCCCACGCATGTGGGGATGGCCCT	TTCCTCGTTGTCGGTCATCGCCTCCTCAGCCC
GTAGTCCCCACGCATGTGGGGATGGCCCG	GGAAGAGGGCGGTTCTAACTCGAGCCAGGCTC
GTAGTCCCCACGCATGTGGGGATGGCCCG	GATGAGGACGGGGTTTGGACATGCAGGGGCGGCCC
GTAGTCCCCACGCATGTGGGGATGGCCCG	TATTTGACGGGGTCGTGGTTAGTGTTGCGTGA
GTAGTCCCCACGCATGTGGGGATGGCCCG	GCAGGTGGTGGCGGTGTCCCAGGTTTTCCCTC
GTAGTCCCCACGCATGTGGGGATGGCCCG	AAAGGGGAGGAGGTGGCCTAATGCGCCGGATCC
GTAGTCCCCACGCATGTGGGGATGGCCCG	CCCCATCTCCCGTCCGATATCCACAGCAATGG
GTAGTCCCCACGCATGTGGGGATGGCCCG	ACGCCCGGCGGGCGGAGCTTCTCGGGAAGAAA
GTAGTCCCCACGCATGTGGGGATGGCCCG	CGAGTAGCTTCCCGGCGCAAGGTCGTCCCCGC
GTAGTCCCCACGCATGTGGGGATGGCCCG	GCCACCCCGCTCGCTCCCAGGCGCTGGATGCGC
GTAGTCCCCACGCATGTGGGGATGGCCCG	GAGGTGAGTGCTGTGGGCTTTGAACCGGGTGA
GTAGTCCCCACGCATGTGGGGATGGCCCA	GTCGTATTTAATGATGTATTGGGCGTTCCAGGC
GTAGTCCCCACGCATGTGGGGATGGCCCG	CATCGGAGGAGGTGGGATGATGCGCAGGGCAA
GTAGTCCCCACGCACGTGGGGATGGCCTG

>NC_014974|4|3|1194463-1197065|CRT
GTAGTCCCCACGCATGTGGGGATGGCCCA	GGGACTCTGGCAGGTATCCTGGCGGTTCTGGC
GTAGTCCCCACGCATGTGGGGATGGCCCG	CGCAAGAAGTGAGCCCACCGGGGCCAGGAGCCC
GTAGTCCCCACGCATGTGGGGATGGCCCG	GGCCCCCGCATCACAAACTGCTGGATCACGGGA
GTAGTCCCCACGCATGTGGGGATGGCCCG	CGCACCACCTGGTTGTCCATAAGCCCCCCGGC
GTAGTCCCCACGCATGTGGGGATGGCCCG	CTCCGAAACCTCCTTGAGCCGCAAAAGCCGCA
GTAGTCCCCACGCATGTGGGGATGGCCCG	GCTCCCAGGCGTCCCGGGAAAAAATCCGGGTC
GTAGTCCCCACGCATGTGGGGATGGCCCG	GTGAGGTCTAGGGCGGCGGCGGGCATGAGCAC
GTAGTCCCCACGCATGTGGGGATGGCCCG	AGCTTGAACCCATGCGGATCACCGCCGTGGAA
GTAGTCCCCACGCATGTGGGGATGGCCCG	GTGGTGGCGGCCAGGTTGCGCCACAAGGATGTA
GTAGTCCCCACGCATGTGGGGATGGCCCG	CGCACCCCTCCCCCCACCCGGGCCTGGTACTCC
GTAGTCCCCACGCATGTGGGGATGGCCCG	GATGACCCTATCGTCCTCGCGGTAGGGCCACAC
GTAGTCCCCACGCATGTGGGGATGGCCCG	GCCGCCTTCCTCCAGCGACCGGATCGCCCGCC
GTAGTCCCCACGCATGTGGGGATGGCCCG	CCCCACCCTGAGGGCCCCACGTCTAGCCGTCC
GTAGTCCCCACGCATGTGGGGATGGCCCG	CGGAGGGCCCTTTCCGCGATTAGCCCCTGGACC
GTAGTCCCCACGCATGTGGGGATGGCCCG	CGCGCCTGGCGCTCCACGTGCGGGACGAAGCC
GTAGTCCCCACGCATGTGGGGATGGCCCG	TGGTGACGGCGGTGACGCTGGTGTCCGGGGGA
GTAGTCCCCACGCATGTGGGGATGGCCCG	CGGTAATCCGGGGCGCTGTGGTGAAGGGCGC
GTAGTCCCCACGCATGTGGGGATGGCCCG	GATTGGAACGCCAGGGTACCGGACACCTGGCA
GTAGTCCCCACGCATGTGGGGATGGCCCG	GAAAAATCCACGCCGCATATTCCTTTTTGGGC
GTAGTCCCCACGCATGTGGGGATGGCCCG	CGGGCGTTTGGGGACGTGGCCGCCAAGTTCGG
GTAGTCCCCACGCATGTGGGGATGGCCCG	CTACGCCCCCATCCCCAAGAAGGCTAAAGCGG
GTAGTCCCCACGCATGTGGGGATGGCCCG	AGCCAACCGCCAGTGCAAGCCCCATCGCCATC
GTAGTCCCCACGCATGTGGGGATGGCCCG	GCCCTGCTGACCTCCTCCAGCAGGGCCCCCTC
GTAGTCCCCACGCATGTGGGGATGGCCCG	TGGAACATGACGGGCACTGTTACAGGCCGATTC
GTAGTCCCCACGCATGTGGGGATGGCCCG	GTCCGGGTGAACGAGGCTATGCTGGAGACCCT
GTAGTCCCCACGCATGTGGGGATGGCCCG	GCTCTGGATGAGGCCAGAGTGCCCCAGAGCGG
GTAGTCCCCACGCATGTGGGGATGGCCCG	TACCGCCCCCCACGGCGCTGGCAAGGCGCTCC
GTAGTCCCCACGCATGTGGGGATGGCCCG	CTATTCATCAGGACGAGGGGGGAAGAAAAATG
GTAGTCCCCACGCATGTGGGGATGGCCCG	GGTTGCGCCCTACAGCGTGTTCCCGGTGCCCC
GTAGTCCCCACGCATGTGGGGATGGCCCT	TTCCTCGTTGTCGGTCATCGCCTCCTCAGCCC
GTAGTCCCCACGCATGTGGGGATGGCCCG	GGAAGAGGGCGGTTCTAACTCGAGCCAGGCTC
GTAGTCCCCACGCATGTGGGGATGGCCCG	GATGAGGACGGGGTTTGGACATGCAGGGGCGGCCC
GTAGTCCCCACGCATGTGGGGATGGCCCG	TATTTGACGGGGTCGTGGTTAGTGTTGCGTGA
GTAGTCCCCACGCATGTGGGGATGGCCCG	GCAGGTGGTGGCGGTGTCCCAGGTTTTCCCTC
GTAGTCCCCACGCATGTGGGGATGGCCCG	AAAGGGGAGGAGGTGGCCTAATGCGCCGGATCC
GTAGTCCCCACGCATGTGGGGATGGCCCG	CCCCATCTCCCGTCCGATATCCACAGCAATGG
GTAGTCCCCACGCATGTGGGGATGGCCCG	ACGCCCGGCGGGCGGAGCTTCTCGGGAAGAAA
GTAGTCCCCACGCATGTGGGGATGGCCCG	CGAGTAGCTTCCCGGCGCAAGGTCGTCCCCGC
GTAGTCCCCACGCATGTGGGGATGGCCCG	GCCACCCCGCTCGCTCCCAGGCGCTGGATGCGC
GTAGTCCCCACGCATGTGGGGATGGCCCG	GAGGTGAGTGCTGTGGGCTTTGAACCGGGTGA
GTAGTCCCCACGCATGTGGGGATGGCCCA	GTCGTATTTAATGATGTATTGGGCGTTCCAGGC
GTAGTCCCCACGCATGTGGGGATGGCCCG	CATCGGAGGAGGTGGGATGATGCGCAGGGCAA
GTAGTCCCCACGCACGTGGGGATGGCCTG

Protein	Signature genes	Signature genes Name	Protein_function
NC_014974.1\|WP_015717167.1\|1212809_1213211_-\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197670
NC_014974.1\|WP_015717144.1\|1186271_1186946_-\|type-I-E-CRISPR-associated-protein-Cas5/CasD	cas5	cd09756_cas5_CAS-I-E	gnl\|CDD\|378243
NC_014974.1\|WP_015717165.1\|1209236_1210775_-\|5-oxoprolinase-subunit-PxpB	unknown	unknown	gnl\|CDD\|376868
NC_014974.1\|WP_015717140.1\|1181257_1181638_-\|hypothetical-protein	unknown	unknown	unknown
NC_014974.1\|WP_015717159.1\|1201283_1202606_+\|hypothetical-protein	unknown	unknown	unknown
NC_014974.1\|WP_015717164.1\|1208025_1209228_+\|acetyl-CoA-C-acyltransferase	unknown	unknown	gnl\|CDD\|238383
NC_014974.1\|WP_015717155.1\|1197902_1199132_-\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|224292
NC_014974.1\|WP_015717147.1\|1188599_1190054_-\|type-I-E-CRISPR-associated-protein-Cse1/CasA	cas8e	pfam09481_cas8e_CAS-I-E	gnl\|CDD\|187860
NC_014974.1\|WP_015717156.1\|1199258_1199567_-\|hypothetical-protein	unknown	unknown	unknown
NC_014974.1\|WP_015717166.1\|1210779_1212813_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|129794
NC_014974.1\|WP_015717142.1\|1184682_1185657_-\|type-I-E-CRISPR-associated-endonuclease-Cas1	cas1	cd09719_cas1_CAS-I-E	gnl\|CDD\|274693
NC_014974.1\|WP_015717145.1\|1186947_1188072_-\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	cas7	pfam09344_cas7_CAS-I-E	gnl\|CDD\|378153
NC_014974.1\|WP_015717141.1\|1184384_1184729_-\|type-I-E-CRISPR-associated-endoribonuclease-Cas2	cas2	pfam09707_cas2_CAS-I-E	gnl\|CDD\|378244
NC_014974.1\|WP_015717143.1\|1185664_1186282_-\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	cas6e	pfam08798_cas6e_CAS-I-E:CAS-IV	gnl\|CDD\|187858
NC_014974.1\|WP_015717146.1\|1188087_1188603_-\|type-I-E-CRISPR-associated-protein-Cse2/CasB	cse2gr11	cd09670_cse2gr11_CAS-I-E	gnl\|CDD\|237559
NC_014974.1\|WP_015717153.1\|1197314_1197608_+\|nucleotidyltransferase-family-protein	unknown	unknown	gnl\|CDD\|224583
NC_014974.1\|WP_015717160.1\|1202874_1204308_+\|NAD-dependent-succinate-semialdehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|143421
NC_014974.1\|WP_015717163.1\|1205912_1207904_+\|thioredoxin-domain-containing-protein	unknown	unknown	gnl\|CDD\|224250
NC_014974.1\|WP_015717148.1\|1190483_1193267_-\|CRISPR-associated-helicase/endonuclease-Cas3	cas3	cd09639_cas3_CAS-I	gnl\|CDD\|182031
NC_014974.1\|WP_015717149.1\|1193276_1194245_-\|WYL-domain-containing-protein	WYL	pfam13280_WYL_CAS-I:CAS-III	gnl\|CDD\|379100

Protein	Function_ID	Function_description	E-value
NC_014974.1\|WP_015717167.1\|1212809_1213211_-\|MarR-family-transcriptional-regulator	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	1.26318e-13
NC_014974.1\|WP_015717144.1\|1186271_1186946_-\|type-I-E-CRISPR-associated-protein-Cas5/CasD	gnl\|CDD\|378243	pfam09704, Cas_Cas5d, CRISPR-associated protein (Cas_Cas5). CRISPR is a term for Clustered, Regularly Interspaced Short Palindromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This small Cas family is represented by CT1134 of Chlorobium tepidum.	4.09071e-53
NC_014974.1\|WP_015717165.1\|1209236_1210775_-\|5-oxoprolinase-subunit-PxpB	gnl\|CDD\|376868	pfam02626, CT_A_B, Carboxyltransferase domain, subdomain A and B. Urea carboxylase (UC) catalyzes a two-step, ATP- and biotin-dependent carboxylation reaction of urea. It is composed of biotin carboxylase (BC), carboxyltransferase (CT), and biotin carboxyl carrier protein (BCCP) domains. The CT domain of UC consists of four subdomains, named A, B, C and D. This domain covers the A and B subdomains of the CT domain. This domain covers the whole length of KipA (kinase A) from Bacillus subtilis. It can also be found in S. cerevisiae urea amidolyase Dur1,2, which is a multifunctional biotin-dependent enzyme with domains for urea carboxylase and allophanate (urea carboxylate) hydrolase activity.	1.73789e-79
NC_014974.1\|WP_015717164.1\|1208025_1209228_+\|acetyl-CoA-C-acyltransferase	gnl\|CDD\|238383	cd00751, thiolase, Thiolase are ubiquitous enzymes that catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine. They are found in prokaryotes and eukaryotes (cytosol, microbodies and mitochondria). There are 2 functional different classes: thiolase-I (3-ketoacyl-CoA thiolase) and thiolase-II (acetoacetyl-CoA thiolase). Thiolase-I can cleave longer fatty acid molecules and plays an important role in the beta-oxidative degradation of fatty acids. Thiolase-II has a high substrate specificity. Although it can cleave acetoacyl-CoA, its main function is the synthesis of acetoacyl-CoA from two molecules of acetyl-CoA, which gives it importance in several biosynthetic pathways.	0
NC_014974.1\|WP_015717155.1\|1197902_1199132_-\|ATP-binding-protein	gnl\|CDD\|224292	COG1373, COG1373, Predicted ATPase (AAA+ superfamily) [General function prediction only].	7.54837e-58
NC_014974.1\|WP_015717147.1\|1188599_1190054_-\|type-I-E-CRISPR-associated-protein-Cse1/CasA	gnl\|CDD\|187860	cd09729, Cse1_I-E, CRISPR/Cas system-associated protein Cse1. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Large proteins, some contain Zn-finger domain; subunit of the Cascade complex; signature gene for I-E subtype; also known as Cse1/CasA/YgcL family.	2.89393e-99
NC_014974.1\|WP_015717166.1\|1210779_1212813_-\|MFS-transporter	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	9.18363e-78
NC_014974.1\|WP_015717142.1\|1184682_1185657_-\|type-I-E-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|274693	TIGR03638, cas1_ECOLI, CRISPR-associated endonuclease Cas1, subtype I-E/ECOLI. The CRISPR-associated protein Cas1 is virtually universal to CRISPR systems. CRISPR, an acronym for Clustered Regularly Interspaced Short Palindromic Repeats, is prokaryotic immunity system for foreign DNA, mostly from phage. CRISPR systems belong to different subtypes, distinguished by both nature of the repeats, the makeup of the cohort of associated Cas proteins, and by molecular phylogeny within the more universal Cas proteins such as this one. This model is of type EXCEPTION and provides more specific information than the EQUIVALOG model TIGR00287. It describes the Cas1 protein particular to the ECOLI subtype of CRISPR/Cas system.	2.72007e-133
NC_014974.1\|WP_015717145.1\|1186947_1188072_-\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	gnl\|CDD\|378153	pfam09344, Cas_CT1975, CT1975-like protein. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family is represented by CT1975 of Chlorobium tepidum.	5.77055e-148
NC_014974.1\|WP_015717141.1\|1184384_1184729_-\|type-I-E-CRISPR-associated-endoribonuclease-Cas2	gnl\|CDD\|378244	pfam09707, Cas_Cas2CT1978, CRISPR-associated protein (Cas_Cas2CT1978). This entry represents a minor branch of the Cas2 family of CRISPR-associated protein which are found in IPR003799. Cas proteins are found adjacent to a characteristic short, palindromic repeat cluster termed CRISPR, a probable mobile DNA element.	1.79549e-40
NC_014974.1\|WP_015717143.1\|1185664_1186282_-\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	gnl\|CDD\|187858	cd09727, Cas6_I-E, CRISPR/Cas system-associated RAMP superfamily protein Cas6e. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas6e is an endoribonuclease that generates crRNA; This family is specific for CRISPR/Cas system I-E subtype; Homologous to Cas6 (RAMP superfamily protein); Possesses double RRM/ferredoxin fold; also known as Cse3 family.	7.49803e-61
NC_014974.1\|WP_015717146.1\|1188087_1188603_-\|type-I-E-CRISPR-associated-protein-Cse2/CasB	gnl\|CDD\|237559	PRK13921, PRK13921, CRISPR-associated Cse2 family protein; Provisional.	1.24351e-54
NC_014974.1\|WP_015717153.1\|1197314_1197608_+\|nucleotidyltransferase-family-protein	gnl\|CDD\|224583	COG1669, COG1669, Predicted nucleotidyltransferases [General function prediction only].	1.34748e-26
NC_014974.1\|WP_015717160.1\|1202874_1204308_+\|NAD-dependent-succinate-semialdehyde-dehydrogenase	gnl\|CDD\|143421	cd07103, ALDH_F5_SSADH_GabD, Mitochondrial succinate-semialdehyde dehydrogenase and ALDH family members 5A1 and 5F1-like. Succinate-semialdehyde dehydrogenase, mitochondrial (SSADH, GabD, EC=1.2.1.24) catalyzes the NAD+-dependent oxidation of succinate semialdehyde (SSA) to succinate. This group includes the human aldehyde dehydrogenase family 5 member A1 (ALDH5A1) which is a mitochondrial homotetramer that converts SSA to succinate in the last step of 4-aminobutyric acid (GABA) catabolism. This CD also includes the Arabidopsis SSADH gene product ALDH5F1. Mutations in this gene result in the accumulation of H2O2, suggesting a role in plant defense against the environmental stress of elevated reactive oxygen species.	0
NC_014974.1\|WP_015717163.1\|1205912_1207904_+\|thioredoxin-domain-containing-protein	gnl\|CDD\|224250	COG1331, COG1331, Highly conserved protein containing a thioredoxin domain [Posttranslational modification, protein turnover, chaperones].	0
NC_014974.1\|WP_015717148.1\|1190483_1193267_-\|CRISPR-associated-helicase/endonuclease-Cas3	gnl\|CDD\|182031	PRK09694, PRK09694, CRISPR-associated helicase/endonuclease Cas3.	2.45614e-104
NC_014974.1\|WP_015717149.1\|1193276_1194245_-\|WYL-domain-containing-protein	gnl\|CDD\|379100	pfam13280, WYL, WYL domain. WYL is a Sm-like SH3 beta-barrel fold containing domain. It is a member of the WYL-like superfamily, named for three conserved amino acids found in a subset of the superfamily. However, these residues are not strongly conserved throughout the family. Rather, the conservation pattern includes four basic residues and a position often occupied by a cysteine, which are predicted to line a ligand-binding groove typical of the Sm-like SH3 beta-barrels. A WYL domain protein (sll7009) is a negative regulator of the I-D CRISPR-Cas system in Synechocystis sp. It is predicted to be a ligand-sensing domain that could bind negatively charged ligands, such as nucleotides or nucleic acid fragments, to regulate CRISPR-Cas and other defense systems such as the abortive infection AbiG system.	1.50985e-33

>NC_014974.1|WP_015717149.1|1193276_1194245_-|WYL-domain-containing-protein
MDPKSKAERFLSLVERLSLRPHRVSELAQLYGVSVRTVERDLEALSHAGYRIEQLGRGLYRIPDRPPTLHPVEALALFAAGRLLYHQAPTRQYENALEKLAKMLPEPLRSLLLKSTQGLEERRGDSRTLEMVARALLERRVLAFEYRSGGSKNWRPKEVLVYFLEANRTNLGLYAIGYERTYHRQILTFKLNRMRNARLLEETYEFPEDFDPNVYLRQAWGVVGAREETVEVRLRFAPEAAWRALEGDYPGLTVDKELPDGSLLARLKAVPFKGGVPWEVLSWVQSFGPRVEVLSPPELRSLWLEEARQVLAKATESVGIRG
>NC_014974.1|WP_015717148.1|1190483_1193267_-|CRISPR-associated-helicase/endonuclease-Cas3
MEVQTQALTLWAKSGDPFHPLLAHMLDTAAVAWAILEREPGRTRKLYATDWNLGEKEALPWVAFLAGLHDLGKASPVFQAAWDEGAKQVWDAGLTWDEELVREQWVAHGVFTELYVKDVLKRHGLPLRLADPLAKGLGAHHGFLAQGEELKTARLHVKSEASTWQEVRDHLALRLAQSLGLNLPLVLPVEDAEAPAILRVMALASFADWIASDPRFFPYGRDPEALEYWQDALELARKALEDLPWPRVSPRGVRRFEELFPFSPNPLQSSVPELLEKTPGDSVLLLVEAPMGLGKTEAALYASHLLRERLDHRGLYVALPTQATANGLFNRIREFLERLSGGERWELQLQHGAALLNPQYAELLERARPMEVYDIELERNPGQESGGVAASTWFSAKKRAMLAGHGVGTLDQALLGVLKVKHHFIRLWGLMNRVVVLDEVHAYDTYTSGLLKSLLLWLRALGSSVILMTATLPKKKREELLSAWGVGGVELPPYPRVAAFSGGGLLGARHVPLEEKTLHLQGAPTEVSQVAEALKEQLPGALGALVNTVDRAQALYQALGEGERLTLDELLDSFGAGPNQGAWPGLWEIREEKGRWVVGKRLKDGTLVFLLHARFPAEERALREAVTLALFGKHGPRPEKAILVATQVAEQSLDLDFDLLYSDLAPVDLLFQRAGRLHRHTRKRPEGHQTPVLLVGGLTDEPEFGRELHWNRVYEDYVLLSTWLALQGRETVKVPADLEGLLEEVYERLPEGFPDSLRDRARKSYQNLIDRLQKDASMAGNLSLAELDRLLSQLDASALASDFRLDDEEENASTQRFLTRLGEPSVSVVPLYRRGEEWFLDADGRRPAKMKGDLGKEDVLALWSRAVRLSRFPIPQTLLGEKPPSAWAKSGLLRGLRPLEVERVFAREDSVLKVVVDEELGVVYVDV
>NC_014974.1|WP_015717147.1|1188599_1190054_-|type-I-E-CRISPR-associated-protein-Cse1/CasA
MSKFNLLLEPWIPVLRNDKVEEVGVREALVNAHTITRIETPFPLEEAALHRLLLAVLYRALPPVKGKYDALDLLDRGEFDRGSLEGYLDKYWDRFYLFHDTAPFLQIPDLPQEDLLPWSKLLPQLANGNNPTLFDHTVDENPPLASYAEAARALVVHQSFAPGGLLRRLGVTSAKDAPLARPAAFLVMGANLFETLVLNLVPQGDPGMPVWEREPLRVKDVEKHATKWSLSGVSLVYVWPSRGVRLVDEGQGVRWMDYGPGVEPQEVAWRDPMVAYRQDKKGSILPLRLSMEKSFWRDFGAMLPAAGGTWPAVLVHAGELEEEGVSFTLRVLGQVSDQAKILDIRREVYPIPKDLLTPKGEGLLDRGLKVAEEVARGLKQVAWRVAQGVLGNRDASELQNFANSLPLLSLYWAQLDLDFPDFLGRLPEQGALDLWRERIQKAARGAWEETRRFVGTEARHLKALAEAERAFRGLLAGMKEEVKG
>NC_014974.1|WP_015717146.1|1188087_1188603_-|type-I-E-CRISPR-associated-protein-Cse2/CasB
MSGKRFVEWLSELKSRQGWTPARAVLRRSLAFDPGGYPPAMPYVEPLLQNLGDDGWRREAYYLVAGLFALKDGEHQEGRTLARALWEARQTRQSDSLEKRFLALLDADRDQIAHRLRQAVGLVEGALDFAQLLEDLLRWFDPKRRVQARWAREFYGAQEFGQEALAEGQGS
>NC_014974.1|WP_015717145.1|1186947_1188072_-|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC
MKLLEVHVIQTVAPSNLNRDDTGSPKDALFGGYRRARISSQAQKRAVRVAFKDWPLLSEEERAVRTRRLMDALLGKLSDIPEDQARLAVENALNALGFGVKEGRTEYLLFLGNYELSRLAELIRNNLEKLSAGPAKGKKGAEVDADLKKALERVLDGGKAVDLALFGRMLADRPELGVDAAAQVAHALSTHKVDREFDFYTAVDDLNPKEDTGAGMMGDVEFYSATMYRYAVVNLDQLAANLQGDVELALRGALVFLEAFALTLPSGKQNSFAAHNPPLFLAFRAGVGLPRNLATAFERPVWSKDGKALSALSVEALVQEWNKFDRAYGPLEPEWKGALNLTEAEVVNLPVVESLGSLKQEAEKALRELLALGG
>NC_014974.1|WP_015717144.1|1186271_1186946_-|type-I-E-CRISPR-associated-protein-Cas5/CasD
MPTLLLRLQGPMQSWGTRSRFDHRDTWPYPTKSGVLGLLAAALGRDREEDISDLAALRMGVRVDRKGVLRVDYQTAQEIIAASLKAKVNVQSWRHYLSDAAFLVGLEGPAFLLEEAHQALLNPRYVLYLGRKGYVPSPPVYLADGVREEPLEVALRNYPYLLREKPKEDLLLVLEAQAGRLVYDQPIAPFAQRRFGARYVREEVLSKDQIQVKGEDSLGEDHVD
>NC_014974.1|WP_015717143.1|1185664_1186282_-|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE
MWISKLKLDLRSKAVRRDLASPYEMHRTLSRAVSQALKEGKERLLWRLEPTRGTEPPVVLVQTLTLPDWDALEKGYAEVYPPKPFQPALREGQILRFRLRANPSKRARDRGERIALKTREEKLVWLVRKFEEGGFRLREEGGQYLAAIRQDTFLEIPKAGHLIQVQAVLFEGVLVVVDPAKALETLKRGIGPGKALGLGLLSLHP
>NC_014974.1|WP_015717142.1|1184682_1185657_-|type-I-E-CRISPR-associated-endonuclease-Cas1
MPPVPSARNLKELPKFRDGLTYLYVEHAFIEQEAQGIGIYDQQGLTLVPVAALGVLFLGPGTRITHAAIRTLAANGCTVAWVGEGLARFYAQGLGDTRSALRLQRQARAWADPKLHLEVVFRLYQKRFQEPLPRDFSLEQVRGLEGVRVRAAYTRWSRETGVPWQGRSYDRRNWAASDPVNRALSSGAAYLYGLAHAAIVSSGFSPALGFIHTGKLLSFVYDVADLYKTEVLVPAAFLTVAEGDHQVERRVRQKLREAILEARLLERMVEDLLDLFAGLGLPEEEVDEEDPTRPGGLWDPEGVVEGGVAYGGDDPGEGAEEPEG
>NC_014974.1|WP_015717141.1|1184384_1184729_-|type-I-E-CRISPR-associated-endoribonuclease-Cas2
MVVMILERVPRSLRGELTRWLVEVDTGVFVGRVSAAVRELLWEKVVEKAGEGRCAMAWRTNNEQGFALRLHGYQDRVLRDFDGIVLVAVRNAEAMRKADKLNGIARFARGDLDS
>NC_014974.1|WP_015717140.1|1181257_1181638_-|hypothetical-protein
MDHFDHLYLTLPRRLEVLIQEIHHLEARMAEERKALEAMVPVPVHWRKVKCGKDRCKRCPHGPYPYLRVKKEGKWRWKYLGKDWQPPEGFTRAGEFQERLGRYRRIVERLVELREKLRELERGLEP
>NC_014974.1|WP_015717153.1|1197314_1197608_+|nucleotidyltransferase-family-protein
MGPEEVKARIGPYRAELRERFGVEALYLFGSSARGEAGEGSDVDLLVRFSRPPGFLGCMGLKLFLEDLLGRPVDLVMEHTLRPEVQPFVEREALKVA
>NC_014974.1|WP_015717155.1|1197902_1199132_-|ATP-binding-protein
MYNPPMYPRFLTPRLLEALQDTPVVFLAGARQVGKSTLVRSLGYGRYLTLDDPLVLASAQHDPLGFLQAQEGPLVLDEVQRAPGLLRAIKLLVDEDRRPGRFLLTGSANVLVLPQASGELVGRMEVLTLWPLSQGELEGKEEKFLDLLFSPRFPSAGRLEAVSLEERVFRGGFPEAVTRKGRRRQAWFEAYLKALLERDLRDLSRIHRLLEVPKVLGLLALRLGSPMNQSEVARGAGLPLSTLRDYLALLEALFLVVRVPAWTPGGEGRLVKAPKLYFVDSGLAASLLRYGGLALDQASSFGPLLENFVVLEILKGLGWSQVAPNLYHFRTHTGQEVDLVLEWEGRVVGLEVKASRTLGLRDFSGLKALRSLAKDRFLRGVVLYGGEEILAVERDLLAVPIQALWRLTP
>NC_014974.1|WP_015717156.1|1199258_1199567_-|hypothetical-protein
MQVNIRKGGKWLLFEANALIAQQALGRMMEALEILPLRLDDLEAIQILLLGMQGWRGTLEDASVALLALRLKAPVWTLNYRDPEALKGLSFWARVTIPWSWV
>NC_014974.1|WP_015717159.1|1201283_1202606_+|hypothetical-protein
MASASRKRLTWSLPLELGLGLLLALPAGMAALGLTQEGYLSDLHAAYLAKVYLALDRGRLEFLNFSYPPLPLLLLFPWPSPWAPPVLGTVLLGLGFALVLAEAKRRAGILPLVLLGGFLLSPWPIHLLAQDFAQVLGLVLLWWAWTLYLRWLEEGLSFFLFASGLVLSLAVYATPFALPLGVLFALGIGLLRRVEPRAWAAASLVLLFPLLFTTLAWAYLGWLFTGGGIFLYRALPQETPPLGEVFLASPAYLAGGLFLLARLRPGLLLYLAPLLVLLALPPLGFGYTLPMATALLLLFALGGLPPLAPKPHLLGAALLVALLQALAGWALLKPLNPPPDPMERAIGQTLAQAPPRSTLADDRESYRLLAWAGTARPFVLPADAGFLLALSAPQAYVSRLLVCQGSGALQPRYGQGTPPGFREEWRYKGCRLLRRPGEPP
>NC_014974.1|WP_015717160.1|1202874_1204308_+|NAD-dependent-succinate-semialdehyde-dehydrogenase
MRHALGEVPVEALIGGTWRPLKERFPVVSPATGERVAEVADCGEEEAKEALEEAVAAFPLWSGATAYERARVLRRWYERILEHQEPLARLMALEMGKPLKEGRAEVAYAAGFVEWYAEEAKRIYGEAVPSQFPHKRLLVRYEPVGPVYGITPWNFPAAMVTRKVAPALAAGCTFVLKPAEESPLTALYLAWLFLEAGGPPGVLQVLPTSRPEEVSRPFLEDERIRKLTFTGSTEVGVRLYEKAARTLKRVSMELGGGAPVLVFADADLERAVEETLRAKFRNAGESCVAANRVFVEAPIAEAFAEAYARRASALKVGDPLSEETDIGPLVNEAALRKVHAHVEDALSRGARLVAGGEAKGLFFAPTVLLDVKPESLLFREETFGPVAPLTVFQEEAEAVRWANGFPVGLAAYVFTRDLSRAFRVAEALEYGIVGVNDGVPSTPQAPFGGRKQSGLGREGGKWGLEEYLEVKYISLGL
>NC_014974.1|WP_015717163.1|1205912_1207904_+|thioredoxin-domain-containing-protein
MANRLRGSRSPYLLQHAEDPVDWYPFGEEAFSAALQEDKPIFLSVGYSACHWCHVMHRESFKDPEVAGILNRYFIPVKVDREERPDVDAAYMQALISLTGQGGWPMSLFLTPEGKPFFGGTYFPKEDRGSLPSFRRVLLAVAQAWREEREAITREAERLSRALWRSLTPAPGPVPQDVEEKALSFLARSFDPEWGGFLPAPKFPQGNLLLYLLSLAWRGKEEARRILHKTLRAMALGGVYDQVGGGFHRYAVDRFWYLPHFEKMLYDNALLARVYLGAYRVFADPLFLRVARETLDWLLSMQSPGQGGFYTALDAESEGEEGRYYTWTPDELRAALGEDYPLAHRYFALGKAPPVEGGNSPRYVLTAWGEEEVKRELGEGFAAWREGLRARLLALRRRRTPPNLDDKVLADWSALAVRALAEAGRLLRDDRYLMAARRGAHFLVETMGKDGLVRHVWRAGALGEEAFLQDQSFTALALLELYTATGEWPYLEKARSLAEAAWEVFRGEGFEGPSTPPAQKALPLPAKEVEETTLPSDKSALAEAFWRLQAAFGGDYRRRAELLLEEGALWLERHPHALPGLLLVHRLLKEGTELALPTPTPILESVRELYLPLTQLVVGPADALPGLLGREPGRAYLCREGACRLPVEEVNSLVEEVRAVYGG
>NC_014974.1|WP_015717164.1|1208025_1209228_+|acetyl-CoA-C-acyltransferase
MPEAWIVEALRTPIGKHGGALASVRPDDLLALALSVLMERSGVPKEEVEDVYAGCANQAGEDNRNVARMALLLAGFPVEVAGCTVNRLCGSGLEAVAQAVRAIWAGEGQVYIGSGVESMSRAPFVVPKAERPFPTGNQVMYDTTLGWRLINPKMQALYGTESMGETAENLAEMYQIPREEQDRFALLSHQKAIRAWDEGRFAKEVVPVPVKRGKEEVRVEVDEGPRRDTSLEKLAQLRPVFREGGTVTAGNSSPLNDGAAAVLLVSDAYGKAHGLTPLARVRSIAVAGVPPRIMGIGPVPATKKALERAGLTLKDIGLIELNEAFAAQSLAVLREWGLDMEDPRLNPNGGAIAIGHPLGASGARILTTLLHEMQRRKVQFGLATMCIGVGQGIAMVVEAV
>NC_014974.1|WP_015717165.1|1209236_1210775_-|5-oxoprolinase-subunit-PxpB
MDGFYLAFGEGLSEEANRMAQALAGLLLKAPPEGLWEAVPAYGTLYLEYDARRLSRKRLLGLVSRLATTLAETGEESRLVEIPVRYDGEDLLEVAGRTGLPLEEVKRLHQAPLYRVYALGFTPGFPFLAPVEPALRLPRRPHPRPRVPAHAVAMAGPQTGIYPLPSPGGWHLLGTALVAVYDPHREEPFLLRPGDRVRFREAEGSTPPEPSPLALLPEEPRITALRVEEPGLLDLVVDGGRFLAGHLGLARSGPLDPYSASLANRLVGNPPGAPLLEVAYRGPVLTALRDLVAAVAGYGLTALLEGEEIPPGQSFFWPRGKTLSFRPKGRGVRVYLAVAGALEGRSFMGSVSPDLRGRIGRPLEAGDVLGLGEERAVRPGLAFRQRPLPETFRLRLLPGPQFSWEARRALASASFRVVRADRMGVELLGPEVPGGEGLSEATPLGGIQVPPSGRPLVLLVDKGSLGGYAKPARVHPGDLWLFGQVWPGVELAFTCEYHRERQHIVPILAWEG
>NC_014974.1|WP_015717166.1|1210779_1212813_-|MFS-transporter
MNPTPQEVRFTMIGVLLGVLLAALDQTIVSTAMPRIVGELRGAEYYAWVTTSYLLTSTVSAPIFGRLTELFSRKGVLLWAVSLFLLGSALSGLSQNMTQLILFRGLQGVGGGALFALALTTIAVLFPPRQRGKLAGAFGAIFGLSSAVGPWLGGLLTDHLSWRWVFYINMPVGAVALGFILRYMPRLRPGGREPFDFLGAMLLVLWTVPLMLAFSWGGSTYPWGSPAILGLLTLAFLGLLLWIWAEIRLPYPLFDLSVFRGRVFSLSAVAAFFYGPAFLGAVAFLPLYLQVVKGVSASQSGITVLPLTLGVVVGSLGGGQLLARFGRYKALLLTSAGFLLALFLVLHFTLTVGTPLAEVVGLFFLLGLGLGPAQSVLNIVAQSGLPRERMGSGTSMVQFMRQIGSTMGIALLGTILAQSLTDHLQGAFPSGTSTPALSRAGEGMALDLDREFARLEDLLIRALKGEEEAYQALMADPFLPGDFKRSLRPGGIPTQFAEVREQVARALRGDEGARKALLANSTLPPEIKVVLLPGRVAQGTLALLERIWSGDVTAREALFQLPWGKSLEGFLAAPPSPALRARVMSQLKTLEERVVAQAQASLKRAEAQALSQVPAQVVSRLEAVRLKLKEALQEGIVEALRRIFLLSALFIALSLVTLVFLPDLELSGGLGPRPSLE
>NC_014974.1|WP_015717167.1|1212809_1213211_-|MarR-family-transcriptional-regulator
MVWEVMGRIWRLQRALREEMEEGLEALDLSGLEAWLLRVVDTHPYPSDAARHMGLPPPTVSHMLRRLEEKNFLERSLDNKDLRRFSFRLTEKGRNALRQAEALMEAALRRRLARLKPEEIAHLLELLGRLEEA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_014974_5

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_014974_5

1583361-1583467

Orphan

Consensus_repeat	Method
TCTGCGGTGGTTGCGGTGGTTTGCGGTGGTTG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_014974_5

>merge|NC_014974|5|1583361-1583467|CRISPRCasFinder
TCTGCGGTGGTTGCGGTGGTTTGCGGTGGTTGGGAGGACAAACCACCGCACAAGAAAATCTCGTCCAGGACATCGTCTGCGGTGGTTGCGGTGGTTGCGGTGGTTGC

>NC_014974|5|5|1583361-1583467|CRISPRCasFinder
TCTGCGGTGGTTGCGGTGGTTTGCGGTGGTTG	GGAGGACAAACCACCGCACAAGAAAATCTCGTCCAGGACATCG
TCTGCGGTGGTTGCGGTGGTTGCGGTGGTTGC

Protein	Signature genes	Signature genes Name	Protein_function
NC_014974.1\|WP_015717542.1\|1580004_1580508_-\|hypothetical-protein	unknown	unknown	unknown
NC_014974.1\|WP_015717553.1\|1589233_1589656_+\|Fis-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225794
NC_014974.1\|WP_008632315.1\|1588036_1589161_+\|transposase	unknown	unknown	gnl\|CDD\|376573
NC_014974.1\|WP_015717546.1\|1581810_1582305_-\|thioredoxin-family-protein	unknown	unknown	gnl\|CDD\|379034
NC_014974.1\|WP_015717544.1\|1580967_1581312_-\|hypothetical-protein	unknown	unknown	unknown
NC_014974.1\|WP_015717556.1\|1591599_1593081_+\|aldehyde-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|143410
NC_014974.1\|WP_015717555.1\|1590700_1591600_+\|R2-like-ligand-binding-oxidase	unknown	unknown	gnl\|CDD\|236242
NC_014974.1\|WP_015716433.1\|1594216_1594732_-\|hypothetical-protein	unknown	unknown	unknown
NC_014974.1\|WP_041438553.1\|1586201_1586654_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|376540
NC_014974.1\|WP_015716434.1\|1594752_1595307_-\|DDE-transposase-family-protein	unknown	unknown	gnl\|CDD\|379382
NC_014974.1\|WP_015717545.1\|1581308_1581833_-\|hypothetical-protein	unknown	unknown	unknown
NC_014974.1\|WP_041438542.1\|1579709_1579898_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|239264
NC_014974.1\|WP_015717540.1\|1577672_1578977_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|368731
NC_014974.1\|WP_015717554.1\|1589655_1590696_+\|alcohol-dehydrogenase-catalytic-domain-containing-protein	unknown	unknown	gnl\|CDD\|176244
NC_014974.1\|WP_015717543.1\|1580482_1580971_-\|hypothetical-protein	unknown	unknown	unknown
NC_014974.1\|WP_015717541.1\|1578973_1579687_-\|peptidase	unknown	unknown	gnl\|CDD\|100078
NC_014974.1\|WP_015717550.1\|1585106_1586009_-\|bifunctional-DNA-primase/polymerase	unknown	unknown	gnl\|CDD\|214927
NC_014974.1\|WP_015717548.1\|1582667_1583111_-\|hypothetical-protein	unknown	unknown	unknown
NC_014974.1\|WP_081454926.1\|1586793_1587552_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|119397
NC_014974.1\|WP_126203346.1\|1582306_1582618_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NC_014974.1\|WP_008632315.1\|1588036_1589161_+\|transposase	gnl\|CDD\|376573	pfam01609, DDE_Tnp_1, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction. This family contains transposases for IS4, IS421, IS5377, IS427, IS402, IS1355, IS5, which was original isolated in bacteriophage lambda.	7.44046e-07
NC_014974.1\|WP_015717553.1\|1589233_1589656_+\|Fis-family-transcriptional-regulator	gnl\|CDD\|225794	COG3255, COG3255, Putative sterol carrier protein [Lipid metabolism].	1.42246e-18
NC_014974.1\|WP_015717546.1\|1581810_1582305_-\|thioredoxin-family-protein	gnl\|CDD\|379034	pfam13098, Thioredoxin_2, Thioredoxin-like domain.	1.32704e-09
NC_014974.1\|WP_015717556.1\|1591599_1593081_+\|aldehyde-dehydrogenase-family-protein	gnl\|CDD\|143410	cd07091, ALDH_F1-2_Ald2-like, ALDH subfamily: ALDH families 1and 2, including 10-formyltetrahydrofolate dehydrogenase, NAD+-dependent retinal dehydrogenase 1 and related proteins. ALDH subfamily which includes the NAD+-dependent retinal dehydrogenase 1 (RALDH 1, ALDH1, EC=1.2.1.36), also known as aldehyde dehydrogenase family 1 member A1 (ALDH1A1), in humans, a homotetrameric, cytosolic enzyme that catalyzes the oxidation of retinaldehyde to retinoic acid. Human ALDH1B1 and ALDH2 are also in this cluster; both are mitochrondrial homotetramers which play important roles in acetaldehyde oxidation; ALDH1B1 in response to UV light exposure and ALDH2 during ethanol metabolism. 10-formyltetrahydrofolate dehydrogenase (FTHFDH, EC=1.5.1.6), also known as aldehyde dehydrogenase family 1 member L1 (ALDH1L1), in humans, a multi-domain homotetramer with an N-terminal formyl transferase domain and a C-terminal ALDH domain. FTHFDH catalyzes an NADP+-dependent dehydrogenase reaction resulting in the conversion of 10-formyltetrahydrofolate to tetrahydrofolate and CO2. Also included in this subfamily is the Arabidosis aldehyde dehydrogenase family 2 members B4 and B7 (EC=1.2.1.3), which are mitochondrial, homotetramers that oxidize acetaldehyde and glycolaldehyde, as well as, the Arabidosis cytosolic, homotetramer ALDH2C4 (EC=1.2.1.3), an enzyme involved in the oxidation of sinapalehyde and coniferaldehyde. Also included is the AldA aldehyde dehydrogenase of Aspergillus nidulans (locus AN0554), the aldehyde dehydrogenase 2 (YMR170c, ALD5, EC=1.2.1.5) of Saccharomyces cerevisiae, and other similar sequences.	0
NC_014974.1\|WP_015717555.1\|1590700_1591600_+\|R2-like-ligand-binding-oxidase	gnl\|CDD\|236242	PRK08326, PRK08326, R2-like ligand-binding oxidase.	1.74816e-123
NC_014974.1\|WP_041438553.1\|1586201_1586654_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|376540	pfam01381, HTH_3, Helix-turn-helix. This large family of DNA binding helix-turn helix proteins includes Cro and CI. Within Neisseria gonorrhoeae NGO_0477, the full protein fold incorporates a helix-turn-helix motif, but the function of this member is unlikely to be that of a DNA-binding regulator, the function of most other members, so is not necessarily characteristic of the whole family.	3.4706e-08
NC_014974.1\|WP_041438542.1\|1579709_1579898_-\|hypothetical-protein	gnl\|CDD\|239264	cd02966, TlpA_like_family, TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins. TlpA, ResA and DsbE are bacterial protein disulfide reductases with important roles in cytochrome maturation. They are membrane-anchored proteins with a soluble TRX domain containing a CXXC motif located in the periplasm. The TRX domains of this family contain an insert, approximately 25 residues in length, which correspond to an extra alpha helix and a beta strand when compared with TRX. TlpA catalyzes an essential reaction in the biogenesis of cytochrome aa3, while ResA and DsbE are essential proteins in cytochrome c maturation. Also included in this family are proteins containing a TlpA-like TRX domain with domain architectures similar to E. coli DipZ protein, and the N-terminal TRX domain of PilB protein from Neisseria which acts as a disulfide reductase that can recylce methionine sulfoxide reductases.	0.00390605
NC_014974.1\|WP_015717540.1\|1577672_1578977_-\|hypothetical-protein	gnl\|CDD\|368731	pfam06074, DUF935, Protein of unknown function (DUF935). This family consists of several bacterial proteins of unknown function as well as the Bacteriophage Mu gp29 protein.	0.00899859
NC_014974.1\|WP_015717554.1\|1589655_1590696_+\|alcohol-dehydrogenase-catalytic-domain-containing-protein	gnl\|CDD\|176244	cd08284, FDH_like_2, Glutathione-dependent formaldehyde dehydrogenase related proteins, child 2. Glutathione-dependent formaldehyde dehydrogenases (FDHs) are members of the zinc-dependent/medium chain alcohol dehydrogenase family. Formaldehyde dehydrogenase (FDH) is a member of the zinc-dependent/medium chain alcohol dehydrogenase family. FDH converts formaldehyde and NAD to formate and NADH. The initial step in this process the spontaneous formation of a S-(hydroxymethyl)glutathione adduct from formaldehyde and glutathione, followed by FDH-mediated oxidation (and detoxification) of the adduct to S-formylglutathione. These tetrameric FDHs have a catalytic zinc that resides between the catalytic and NAD(H)binding domains and a structural zinc in a lobe of the catalytic domain. The medium chain alcohol dehydrogenase family (MDR) has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit.	5.46546e-154
NC_014974.1\|WP_015717541.1\|1578973_1579687_-\|peptidase	gnl\|CDD\|100078	cd05709, S2P-M50, Site-2 protease (S2P) class of zinc metalloproteases (MEROPS family M50) cleaves transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms. Members of this family use proteolytic activity within the membrane to transfer information across membranes to integrate gene expression with physiologic stresses occurring in another cellular compartment. The domain core structure appears to contain at least three transmembrane helices with a catalytic zinc atom coordinated by three conserved residues contained within the consensus sequence HExxH, together with a conserved aspartate residue. The S2P/M50 family of RIP proteases is widely distributed; in eukaryotic cells, they regulate such processes as sterol and lipid metabolism, and endoplasmic reticulum (ER) stress responses. In sterol-depleted mammalian cells, a two-step proteolytic process releases the N-terminal domains of sterol regulatory element-binding proteins (SREBPs) from membranes of the ER. These domains translocate into the nucleus, where they activate genes of cholesterol and fatty acid biosynthesis. It is the second proteolytic step that is carried out by the SREBP Site-2 protease (S2P) which is present in this CD superfamily. Prokaryotic S2P/M50 homologs have been shown to regulate stress responses, sporulation, cell division, and cell differentiation. In Escherichia coli, the S2P homolog RseP is involved in the sigmaE pathway of extracytoplasmic stress responses, and in Bacillus subtilis, the S2P homolog SpoIVFB is involved in the pro-sigmaK pathway of spore formation. Some of the subfamilies within this hierarchy contain one or two PDZ domain insertions, with putative regulatory roles, such as the inhibition of substrate cleavage as seen by the RseP PDZ domain.	5.11771e-16
NC_014974.1\|WP_015717550.1\|1585106_1586009_-\|bifunctional-DNA-primase/polymerase	gnl\|CDD\|214927	smart00943, Prim-Pol, Bifunctional DNA primase/polymerase, N-terminal. Members of this family adopt a structure consisting of a core of antiparallel beta sheets. They are found in various bacterial hypothetical proteins, and have been shown to harbour both primase and polymerase activities.	9.04222e-33
NC_014974.1\|WP_081454926.1\|1586793_1587552_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|119397	cd06529, S24_LexA-like, Peptidase S24 LexA-like proteins are involved in the SOS response leading to the repair of single-stranded DNA within the bacterial cell. This family includes: the lambda repressor CI/C2 family and related bacterial prophage repressor proteins; LexA (EC 3.4.21.88), the repressor of genes in the cellular SOS response to DNA damage; MucA and the related UmuD proteins, which are lesion-bypass DNA polymerases, induced in response to mitogenic DNA damage; RulA, a component of the rulAB locus that confers resistance to UV, and RuvA, which is a component of the RuvABC resolvasome that catalyzes the resolution of Holliday junctions that arise during genetic recombination and DNA repair. The LexA-like proteins contain two-domains: an N-terminal DNA binding domain and a C-terminal domain (CTD) that provides LexA dimerization as well as cleavage activity. They undergo autolysis, cleaving at an Ala-Gly or a Cys-Gly bond, separating the DNA-binding domain from the rest of the protein. In the presence of single-stranded DNA, the LexA, UmuD and MucA proteins interact with RecA, activating self cleavage, thus either derepressing transcription in the case of LexA or activating the lesion-bypass polymerase in the case of UmuD and MucA. The LexA proteins are serine proteases that carry out catalysis using a serine/lysine dyad instead of the prototypical serine/histidine/aspartic acid triad found in most serine proteases. LexA sequence homologs are found in almost all of the bacterial genomes sequenced to date, covering a large number of phyla, suggesting both, an ancient origin and a widespread distribution of lexA and the SOS response.	4.84104e-20
NC_014974.1\|WP_015716434.1\|1594752_1595307_-\|DDE-transposase-family-protein	gnl\|CDD\|379382	pfam13808, DDE_Tnp_1_assoc, DDE_Tnp_1-associated. This domain is frequently found N-terminal to the transposase, IS family DDE_Tnp_1, pfam01609 and its relatives.	1.7683e-18

>NC_014974.1|WP_015717548.1|1582667_1583111_-|hypothetical-protein
MALLQALEERERVQALRFLEEPYRLVCLAVHTFPLEIPVVLTLAYGDAGKHLEDVRRYLAPVGNLSGYLLWAGRNLPPPHRMHFSPTTGKWALEWRKGWEVIIEAQVRGRRYLLFYPEKDARSWESSVEDGEVRLLRLHEQSPVVGM
>NC_014974.1|WP_126203346.1|1582306_1582618_-|hypothetical-protein
MWLEMVRWGQRGNSLEVRGVELAVLPEGFFVSRVLEGEEEETLRHLVLLAGGVLTDRELVALGKVGMAWGRKAAEEVARSLGVLRKYGVKWELERRVPQGVLN
>NC_014974.1|WP_015717546.1|1581810_1582305_-|thioredoxin-family-protein
MRDRIVKGLVLGVGIVFAGLLWAVLEYKGAGEVTVSPVMHAHAWPKREKPYVLLFYDPLCPVCQKLEGDLEGDGELRAYVRYLPAFLHQGSYEAWLSLLLRWGWDEAEARAWLELLKPEVEASGLTMTPTAYVADAVGRGKVIVGYPGYERWRQEVLSALGVGR
>NC_014974.1|WP_015717545.1|1581308_1581833_-|hypothetical-protein
MPSVLAVDPGVHLGYALVGKEFTLGVLVLSGDYREAVGEAVRRLRPLLLKADRVYVEEWGYQGRRLGKEQMVPLALAGAFLALGAEPVDPGWKWRMTRGLLLGSAEKMGVKFPSGLDRKDRALWFRLHLEGYGPALSRIRELPKKLRPHALDALALAIYARSYEKIGGKEVAPG
>NC_014974.1|WP_015717544.1|1580967_1581312_-|hypothetical-protein
MTGFTEADFLRVVVPFLAGLVLGVWLKKPVEGVLTLAAIVAVGWGWVHQEEAERLLEDLNAKLQLWLAYGIKEATLWVSEVLSGRVDPLGVLAFVKAIEPKWVFLAGFLGGLRA
>NC_014974.1|WP_015717543.1|1580482_1580971_-|hypothetical-protein
MKPKERLALEILEAMRREERFTVAALLQGMLAFRREQKAIVDLLGRNPKEGVALAVLISLSPWFFKEEGGGDRKRLLAPVYEALRGVPLEKEERESVVRFFQEATWPEIRFLRQLTKRLGVEVEVRDLVYAMSWLTRHRTALTRLGVGQFVGVERAEAKEAS
>NC_014974.1|WP_015717542.1|1580004_1580508_-|hypothetical-protein
MLKPRKRPEVVKRIAEVYLENPFLGKALALGYKVLTDRRYPRFESLILSGRYGEAGVYALAMAKSPAVLKFGNWGPPKGGFRELSKVAEALVPQGDIGALEWAVRLKTEADEAEALLLMEFAEVGAPEVLAKLVRAVGEHLPIDRRLQASVPVSPLVGEKQKEEVRV
>NC_014974.1|WP_041438542.1|1579709_1579898_-|hypothetical-protein
MAVKDKPERVRDFLRERGIRPSRWMRFFLGDEPLIRAVYTVGLPTTLFFGSDGKVRRLTRRR
>NC_014974.1|WP_015717541.1|1578973_1579687_-|peptidase
MILAGVLALLFLGYLAIVVHELGHYLAYRRYGVPVEGVYIGGPPWILRWRRGGTEYRLGLLPLFGAVASKWEEVDRLPPGRVLGLFLSGPLFSFLAGVLGFFALGVMRGDLIAVGKVLLLILGFPLILLQNLYQALFFDLSEVGVVPLVQASGQVLVSHGLEGLLVLWGVFNIVLFWFNLLPVPPLDGGQAVFLLFRHRAWFHRVYPYVLGFGFAVLFALFELALLKDAVRLLGGER
>NC_014974.1|WP_015717540.1|1577672_1578977_-|hypothetical-protein
MNRVGFLGLLGVLVLSACAPTVTGDPFGEADLARILPGSGTYQPPRGVYEPVPTVSEERLTHPDPRVREEAFALLRRQKASGDGGPEFHYLYGRYYEASGDYKTAAFYYNLGLKALYPYAFDRQGRDIWEYGYRRAEAYLRFAPEKAARDARILAEKAAPAERGRLSQKTRAYALLVRAEEARGNAEGVLEAADLFYKSIGDTTWLGGLPKLFWEVTLSRAKALEALGRVEEARKVYAEIASTRDLLVPREVRAEAEKALSRLGAPVPKEAPKVPEPPQAPPPPASEKPSVPPPAAFQEQAVEVVRGFLEALKSLDLAKVNQALSQPLYDVLRERELQRRVTPEMRERAAKLRYEIARVTPPSPTAPLPKVEVVYDLGEGERLLVLYLVSNQDGRLVVLSGDLPPALAAFLGSADTKAVVRFLEEFHAFVGLPL
>NC_014974.1|WP_015717550.1|1585106_1586009_-|bifunctional-DNA-primase/polymerase
MRFPKANCTTLLAVLQRYVRLGYAVLPLVPGEKRPHFRLVPHGLKEASQDPATLEAWWRSCPEAGVGILAPEGVLVLDVDQGEAWEALRRDFPALEAAPRQKTPKGGVHLFLRLPEGVKLSASVRAIPGVDLRGMGRAYVVAAPTRLKDGRTYAWEVPLVRPEALPPVPDALLARLLPPPPPPREVWTPVEGASPKRLRALLEAYADRVAATPPGQRHNTLIRYAVAAGGLIPHGLDPREAEEALVAAAMSTGLPEKEARAAVEWGLEKGRQRPLVLPSPRLVLSIRRRLREGGKRHGRA
>NC_014974.1|WP_041438553.1|1586201_1586654_-|helix-turn-helix-domain-containing-protein
MRGLRELRGMVGMTIAELARVTGLSRSYLWRLERGERKPGVKAVFPIMRVFSERLGIPETAVLEILMGKRVAEAFSYKSLSGREPAPRYLTVDQAARYLGVSRSYIKNAVRSGLLRPRPVPGPRGQMVFSIEELQSFAKRHLENAGVTAE
>NC_014974.1|WP_081454926.1|1586793_1587552_+|helix-turn-helix-domain-containing-protein
MAWAWDDTKTRNIDWDLVAQYSAKEFGRFLRSLRERARLTQSDIGYRAGVDQTYVSMIETGKRDIRHVSAERMLRLLQAYGLTKEDIDHLLKAWSTPKEKRTHYTETPQNASEVRPYRLPVVEGGAGSPSFEDAREFMLFWLPPMKGKKETSLFAVKITGNSMEPLLYEGDYAIVDTETPPLTGAIVAVGIPGDGIVVKKLAERNKQLYLESVNPLYEDIPLPEDAKIWGPVISVVRNFHQGFPSKKLKALP
>NC_014974.1|WP_008632315.1|1588036_1589161_+|transposase
MRGALAAGSARVSEMVASLPSPLQNRFHQAKALYRFLSNPRVEAEALLDRVYQESATALEGEEVLVLLDLSPVAKPYARALEGIARVGKDRRPGYELLTALGLDPAGRLALGYAHLVAYGERGFASLPKEVEGAIEAARERLGGVGRRLVYVADRGFDDRKVFGQVLALGEEFVVRVYRDRKLGEGGSLAKVASSLALPCGEEVELRVGGRYQRVRLHFGWREVEVEGRRLHLVVCRVPALGRRGEWWLLTSLPVRGREEAAQVVEAYRRRWEVERFFRLLKTGLGLETFQVRGLARIRKVVAVLLGLAVFLWEVERLGDPFKGFLLQLGGKLGLPSERDGPYLLLRGLVRLLNYEVTQELLKQAKGGRGRSFG
>NC_014974.1|WP_015717553.1|1589233_1589656_+|Fis-family-transcriptional-regulator
MYEPFSEEWAKAYGEALNANEAYRQAAATWEGALILAVEADPALGLPEKRGIYLDLYHGQCREARMATPQDYEQAPYVISADARTWKEITEGILDPISALMRGKLKLEKGDMAALAGYMMAALELTNTAKKVPTQYPEGL
>NC_014974.1|WP_015717554.1|1589655_1590696_+|alcohol-dehydrogenase-catalytic-domain-containing-protein
MRAILFQGKGQVAVGEVPKPTLKDPGDVLVRITLAAICGSDLHIYHGAIPMLPGSSLGHEFVGVVEAVGEGVQSLKPGDRVVGPFHVACGACRACRRGEFNLCEKRGVYGYGPLMGNLPGAQAEWLLVPYGDVNLRKLPEKLSEERAIFAGDILSTAFGGLVQGGLRPGERVAVIGAGPVGLMAVESALALGASKVLVLDRVKDRLEMAEAIGAIPIHVERENPKRRVLEETQDEGADLVVEAVGGEATVALAFELVRPGGRISALGVTTTTTFPFPLNSALVRDLTFRIGLANVHHYIDQVLALLEADRLKPERVISHVLPLEEAPRGYELFDRKEARKVLLKVG
>NC_014974.1|WP_015717555.1|1590700_1591600_+|R2-like-ligand-binding-oxidase
MVRESFKTVRKGLEESFPLKLYHKAKRYFWDPQTIDLEEDQKTFQKLSPEQKEASLHLASLFVAGEEAVTLDLLPLVQVIAREGRLEEEMFLTTFLVDEAKHVEFFSLLLQATAGEANLERFHGSNYRKIFYEELPQAMGRLLNDPSPEAQVEAAVTYNMIVEGVLAETGYYAYYRSAELLNAQGFALPGTLEGIRHIQRDESRHIAYGIYLIARHVAANPELFPVVERRMSTLLPYALGVVQDIFQAYPEGFPLKLDMNEFIQYAMGQFQKRYRRLELAQKKGLKEIEAEAEAFGEEA
>NC_014974.1|WP_015717556.1|1591599_1593081_+|aldehyde-dehydrogenase-family-protein
MRLPLPEKAEAFLKRVGPLYLGGTFRKAATGEVFPVLNPATGEVLARVARGGKEDVDQAVALARKALEGSWGRTSPDERGRLLFRLSELIEAHADTLAALEALNVGKPYAEARTADIPLVAQHFRYFAGWATKWGGEVLPVSFPGEYLAYTRREPVGVVGAITPWNFPLLIASWKLAPALAVGCTVILKPSELTPLTALYLAELMEEAGFPKGTVSVIPGYGEEAGAALVAHPGVDKISFTGSVEVGKGILKQAAETLKRVTLELGGKSPVILLEDADPKRVLKGALFASFFNQGEVCAAGSRLFVPKSKLDYFLENLVTGAQAIQQGHPLDPRTQMGPLISREHMERVLGYVQRGLEEGATLLTGGEPNPGAGPGFFVKPTIFLAEDGQTIAREEIFGPVLSVLPYEDPEEVARRANATPYGLAAGIFGQDMRRAIRLAHALKAGTVWINGYLLLDAASPWGGYKESGIGREMGRYALEHYTEVKSVWLNLT
>NC_014974.1|WP_015716433.1|1594216_1594732_-|hypothetical-protein
MEWALEVFKGMEERRLPGETEAVWNLVRDGEVWTYRVWASPYLPEEVRAFPGARQVVRMEREVRHKGTGEVRRTVSYALTSLGPEVAEARRLGELLLYRWEVENRSFWVRDVLLHEDACQVRGVGAQVLAALRAFLVSMLHRQGVREKKAALEAFSFNPLSALRFLGLYAV
>NC_014974.1|WP_015716434.1|1594752_1595307_-|DDE-transposase-family-protein
MTLREALSQIPDPRARNRQYPLWGLLALILVAFLSRVDSLRGVERFARTNPHLLPHLGLRKAPGHTAITLLLHRLDPEKLQAALLQVFPEADLGEVLVVDGKHLRGSGKGKSPQVRLVEVLALHLHTTLAQARAEGREDQALLELLDRLGAEGLKGKVVVGDAGYLYPELAGKVVQKGGRTSLS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_014974_3	3.31\|1183950\|31\|NC_014974\|CRISPRCasFinder,CRT,PILER-CR	1183950-1183980	31	NC_004462	Thermus thermophilus phage IN93, complete genome	3471-3501	0	1.0
NC_014974_3	3.31\|1183950\|31\|NC_014974\|CRISPRCasFinder,CRT,PILER-CR	1183950-1183980	31	AB063393	Thermus thermophilus phage IN93 DNA, complete genome	3471-3501	0	1.0
NC_014974_4	4.7\|1194859\|33\|NC_014974\|PILER-CR	1194859-1194891	33	NC_004462	Thermus thermophilus phage IN93, complete genome	10622-10654	0	1.0
NC_014974_4	4.7\|1194859\|33\|NC_014974\|PILER-CR	1194859-1194891	33	AB063393	Thermus thermophilus phage IN93 DNA, complete genome	10622-10654	0	1.0
NC_014974_4	4.8\|1194920\|33\|NC_014974\|PILER-CR	1194920-1194952	33	NC_004462	Thermus thermophilus phage IN93, complete genome	15864-15896	0	1.0
NC_014974_4	4.8\|1194920\|33\|NC_014974\|PILER-CR	1194920-1194952	33	AB063393	Thermus thermophilus phage IN93 DNA, complete genome	15864-15896	0	1.0
NC_014974_4	4.34\|1196513\|33\|NC_014974\|PILER-CR	1196513-1196545	33	NC_010878	Thermus sp. 4C plasmid pL4C, complete sequence	1130-1162	0	1.0
NC_014974_4	4.49\|1194860\|32\|NC_014974\|CRISPRCasFinder,CRT	1194860-1194891	32	NC_004462	Thermus thermophilus phage IN93, complete genome	10622-10653	0	1.0
NC_014974_4	4.49\|1194860\|32\|NC_014974\|CRISPRCasFinder,CRT	1194860-1194891	32	AB063393	Thermus thermophilus phage IN93 DNA, complete genome	10622-10653	0	1.0
NC_014974_4	4.50\|1194921\|32\|NC_014974\|CRISPRCasFinder,CRT	1194921-1194952	32	NC_004462	Thermus thermophilus phage IN93, complete genome	15864-15895	0	1.0
NC_014974_4	4.50\|1194921\|32\|NC_014974\|CRISPRCasFinder,CRT	1194921-1194952	32	AB063393	Thermus thermophilus phage IN93 DNA, complete genome	15864-15895	0	1.0
NC_014974_4	4.76\|1196514\|32\|NC_014974\|CRISPRCasFinder,CRT	1196514-1196545	32	NC_010878	Thermus sp. 4C plasmid pL4C, complete sequence	1130-1161	0	1.0
NC_014974_3	3.12\|1182786\|32\|NC_014974\|CRISPRCasFinder,CRT	1182786-1182817	32	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	1253870-1253901	5	0.844
NC_014974_2	2.7\|575409\|31\|NC_014974\|CRISPRCasFinder	575409-575439	31	NC_015952	Streptomyces violaceusniger Tu 4113 plasmid pSTRVI02, complete sequence	135257-135287	6	0.806
NC_014974_3	3.6\|1182419\|32\|NC_014974\|CRISPRCasFinder,CRT	1182419-1182450	32	NZ_CP022317	Brachybacterium avium strain VR2415 plasmid unnamed1	13556-13587	6	0.812
NC_014974_3	3.17\|1183093\|32\|NC_014974\|CRISPRCasFinder,CRT	1183093-1183124	32	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	2349626-2349657	6	0.812
NC_014974_3	3.22\|1183399\|33\|NC_014974\|CRISPRCasFinder,CRT	1183399-1183431	33	NZ_CP049317	Caballeronia sp. SBC2 plasmid pSBC2-1, complete sequence	437326-437358	6	0.818
NC_014974_3	3.22\|1183399\|33\|NC_014974\|CRISPRCasFinder,CRT	1183399-1183431	33	NZ_CP049157	Caballeronia sp. SBC1 plasmid pSBC1_1, complete sequence	1207084-1207116	6	0.818
NC_014974_3	3.22\|1183399\|33\|NC_014974\|CRISPRCasFinder,CRT	1183399-1183431	33	LN997843	Streptomyces reticuli genome assembly TUE45, plasmid : II	579326-579358	6	0.818
NC_014974_3	3.23\|1183461\|32\|NC_014974\|CRISPRCasFinder,CRT	1183461-1183492	32	NC_015727	Cupriavidus necator N-1 plasmid pBB1, complete sequence	1467827-1467858	6	0.812
NC_014974_3	3.31\|1183950\|31\|NC_014974\|CRISPRCasFinder,CRT,PILER-CR	1183950-1183980	31	NZ_CP032346	Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence	1384229-1384259	6	0.806
NC_014974_3	3.52\|1183093\|33\|NC_014974\|PILER-CR	1183093-1183125	33	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	2349626-2349658	6	0.818
NC_014974_3	3.57\|1183399\|34\|NC_014974\|PILER-CR	1183399-1183432	34	NZ_CP049317	Caballeronia sp. SBC2 plasmid pSBC2-1, complete sequence	437325-437358	6	0.824
NC_014974_3	3.57\|1183399\|34\|NC_014974\|PILER-CR	1183399-1183432	34	NZ_CP049157	Caballeronia sp. SBC1 plasmid pSBC1_1, complete sequence	1207084-1207117	6	0.824
NC_014974_3	3.58\|1183461\|33\|NC_014974\|PILER-CR	1183461-1183493	33	NC_015727	Cupriavidus necator N-1 plasmid pBB1, complete sequence	1467826-1467858	6	0.818
NC_014974_4	4.37\|1196697\|33\|NC_014974\|PILER-CR	1196697-1196729	33	NC_002679	Mesorhizobium japonicum MAFF 303099 plasmid pMLa, complete sequence	288321-288353	6	0.818
NC_014974_4	4.76\|1196514\|32\|NC_014974\|CRISPRCasFinder,CRT	1196514-1196545	32	NZ_CP049359	Deinococcus wulumuqiensis R12 plasmid unnamed2, complete sequence	155465-155496	6	0.812
NC_014974_2	2.2\|575105\|31\|NC_014974\|CRISPRCasFinder	575105-575135	31	NZ_CP042916	Rhodococcus qingshengii strain RL1 plasmid unnamed1, complete sequence	61136-61166	7	0.774
NC_014974_2	2.2\|575105\|31\|NC_014974\|CRISPRCasFinder	575105-575135	31	MN586022	Gordonia phage Chidiebere, complete genome	43798-43828	7	0.774
NC_014974_2	2.2\|575105\|31\|NC_014974\|CRISPRCasFinder	575105-575135	31	NZ_CP012916	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence	381995-382025	7	0.774
NC_014974_2	2.2\|575105\|31\|NC_014974\|CRISPRCasFinder	575105-575135	31	NZ_CP022367	Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence	429571-429601	7	0.774
NC_014974_2	2.2\|575105\|31\|NC_014974\|CRISPRCasFinder	575105-575135	31	NZ_CP032341	Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence	666611-666641	7	0.774
NC_014974_2	2.2\|575105\|31\|NC_014974\|CRISPRCasFinder	575105-575135	31	NZ_CP033321	Azospirillum brasilense strain Cd plasmid p3, complete sequence	664097-664127	7	0.774
NC_014974_2	2.2\|575105\|31\|NC_014974\|CRISPRCasFinder	575105-575135	31	NZ_CP033315	Azospirillum brasilense strain Sp 7 plasmid p3, complete sequence	662285-662315	7	0.774
NC_014974_2	2.3\|575166\|31\|NC_014974\|CRISPRCasFinder	575166-575196	31	NZ_CP032322	Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence	1687435-1687465	7	0.774
NC_014974_2	2.3\|575166\|31\|NC_014974\|CRISPRCasFinder	575166-575196	31	NZ_CP007794	Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence	1360243-1360273	7	0.774
NC_014974_2	2.3\|575166\|31\|NC_014974\|CRISPRCasFinder	575166-575196	31	NZ_CP032340	Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence	600437-600467	7	0.774
NC_014974_2	2.3\|575166\|31\|NC_014974\|CRISPRCasFinder	575166-575196	31	NZ_CP032346	Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence	1127322-1127352	7	0.774
NC_014974_2	2.3\|575166\|31\|NC_014974\|CRISPRCasFinder	575166-575196	31	NZ_CP012915	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence	1531950-1531980	7	0.774
NC_014974_2	2.3\|575166\|31\|NC_014974\|CRISPRCasFinder	575166-575196	31	NZ_CP016452	Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence	857684-857714	7	0.774
NC_014974_2	2.4\|575227\|30\|NC_014974\|CRISPRCasFinder	575227-575256	30	NZ_CP017589	Pantoea stewartii subsp. stewartii DC283 plasmid pDSJ08, complete sequence	91345-91374	7	0.767
NC_014974_2	2.4\|575227\|30\|NC_014974\|CRISPRCasFinder	575227-575256	30	CP054911	Pantoea ananatis strain FDAARGOS_680 plasmid unnamed3, complete sequence	54201-54230	7	0.767
NC_014974_2	2.6\|575348\|31\|NC_014974\|CRISPRCasFinder	575348-575378	31	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	60673-60703	7	0.774
NC_014974_2	2.7\|575409\|31\|NC_014974\|CRISPRCasFinder	575409-575439	31	NZ_CP012944	Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence	1027249-1027279	7	0.774
NC_014974_2	2.7\|575409\|31\|NC_014974\|CRISPRCasFinder	575409-575439	31	NZ_CP021653	Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence	1118587-1118617	7	0.774
NC_014974_2	2.7\|575409\|31\|NC_014974\|CRISPRCasFinder	575409-575439	31	NZ_CP012688	Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence	1118594-1118624	7	0.774
NC_014974_2	2.7\|575409\|31\|NC_014974\|CRISPRCasFinder	575409-575439	31	CP047139	Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence	1046152-1046182	7	0.774
NC_014974_2	2.7\|575409\|31\|NC_014974\|CRISPRCasFinder	575409-575439	31	CP047137	Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence	1003354-1003384	7	0.774
NC_014974_2	2.7\|575409\|31\|NC_014974\|CRISPRCasFinder	575409-575439	31	NZ_CP026518	Deinococcus sp. NW-56 plasmid unnamed2, complete sequence	132590-132620	7	0.774
NC_014974_2	2.16\|575409\|32\|NC_014974\|PILER-CR,CRT	575409-575440	32	NC_015952	Streptomyces violaceusniger Tu 4113 plasmid pSTRVI02, complete sequence	135257-135288	7	0.781
NC_014974_3	3.5\|1182358\|32\|NC_014974\|CRISPRCasFinder,CRT	1182358-1182389	32	MH271302	Gordonia phage Margaret, complete genome	45916-45947	7	0.781
NC_014974_3	3.6\|1182419\|32\|NC_014974\|CRISPRCasFinder,CRT	1182419-1182450	32	NZ_CP020371	Candidatus Thiodictyon syntrophicum strain Cad16T plasmid pTs417, complete sequence	80177-80208	7	0.781
NC_014974_3	3.17\|1183093\|32\|NC_014974\|CRISPRCasFinder,CRT	1183093-1183124	32	NZ_CP032322	Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence	176964-176995	7	0.781
NC_014974_3	3.22\|1183399\|33\|NC_014974\|CRISPRCasFinder,CRT	1183399-1183431	33	NZ_CP032323	Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence	405506-405538	7	0.788
NC_014974_3	3.22\|1183399\|33\|NC_014974\|CRISPRCasFinder,CRT	1183399-1183431	33	NZ_CP007795	Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence	691093-691125	7	0.788
NC_014974_3	3.22\|1183399\|33\|NC_014974\|CRISPRCasFinder,CRT	1183399-1183431	33	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	401948-401980	7	0.788
NC_014974_3	3.41\|1182419\|33\|NC_014974\|PILER-CR	1182419-1182451	33	NZ_CP022317	Brachybacterium avium strain VR2415 plasmid unnamed1	13556-13588	7	0.788
NC_014974_3	3.52\|1183093\|33\|NC_014974\|PILER-CR	1183093-1183125	33	NZ_CP032322	Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence	176963-176995	7	0.788
NC_014974_3	3.57\|1183399\|34\|NC_014974\|PILER-CR	1183399-1183432	34	NZ_CP032323	Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence	405505-405538	7	0.794
NC_014974_3	3.57\|1183399\|34\|NC_014974\|PILER-CR	1183399-1183432	34	NZ_CP007795	Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence	691093-691126	7	0.794
NC_014974_4	4.16\|1195412\|33\|NC_014974\|PILER-CR	1195412-1195444	33	NZ_CP035092	Paracoccus denitrificans strain ATCC 19367 plasmid unnamed1, complete sequence	347331-347363	7	0.788
NC_014974_4	4.16\|1195412\|33\|NC_014974\|PILER-CR	1195412-1195444	33	NC_008688	Paracoccus denitrificans PD1222 plasmid 1, complete sequence	594679-594711	7	0.788
NC_014974_4	4.34\|1196513\|33\|NC_014974\|PILER-CR	1196513-1196545	33	NZ_CP049359	Deinococcus wulumuqiensis R12 plasmid unnamed2, complete sequence	155465-155497	7	0.788
NC_014974_4	4.49\|1194860\|32\|NC_014974\|CRISPRCasFinder,CRT	1194860-1194891	32	NZ_LR134463	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 21, complete sequence	26074-26105	7	0.781
NC_014974_4	4.54\|1195168\|32\|NC_014974\|CRISPRCasFinder,CRT	1195168-1195199	32	NZ_CP020040	Streptomyces sp. 3211 isolate 3 plasmid p3211-1, complete sequence	349347-349378	7	0.781
NC_014974_4	4.54\|1195168\|32\|NC_014974\|CRISPRCasFinder,CRT	1195168-1195199	32	NZ_CP050953	Rhodococcus sp. DMU1 plasmid unnamed	476358-476389	7	0.781
NC_014974_4	4.54\|1195168\|32\|NC_014974\|CRISPRCasFinder,CRT	1195168-1195199	32	NZ_CP042998	Aquisphaera giovannonii strain OJF2 plasmid pOJF2_1, complete sequence	29741-29772	7	0.781
NC_014974_4	4.58\|1195413\|32\|NC_014974\|CRISPRCasFinder,CRT	1195413-1195444	32	NZ_CP035092	Paracoccus denitrificans strain ATCC 19367 plasmid unnamed1, complete sequence	347331-347362	7	0.781
NC_014974_4	4.58\|1195413\|32\|NC_014974\|CRISPRCasFinder,CRT	1195413-1195444	32	NC_008688	Paracoccus denitrificans PD1222 plasmid 1, complete sequence	594679-594710	7	0.781
NC_014974_4	4.58\|1195413\|32\|NC_014974\|CRISPRCasFinder,CRT	1195413-1195444	32	NZ_CP022195	Yangia pacifica strain YSBP01 plasmid unnamed5, complete sequence	115132-115163	7	0.781
NC_014974_4	4.64\|1195778\|32\|NC_014974\|CRISPRCasFinder,CRT	1195778-1195809	32	NC_047749	Enterobacteria phage DT571/2, complete genome	25349-25380	7	0.781
NC_014974_4	4.64\|1195778\|32\|NC_014974\|CRISPRCasFinder,CRT	1195778-1195809	32	KM979354	Enterobacteria phage DT57C, complete genome	26041-26072	7	0.781
NC_014974_4	4.64\|1195778\|32\|NC_014974\|CRISPRCasFinder,CRT	1195778-1195809	32	NC_047979	Escherichia phage Gostya9, complete genome	26423-26454	7	0.781
NC_014974_4	4.69\|1196084\|32\|NC_014974\|CRISPRCasFinder,CRT	1196084-1196115	32	NZ_CP054606	Sulfitobacter pseudonitzschiae strain H46 plasmid unnamed7, complete sequence	61115-61146	7	0.781
NC_014974_2	2.2\|575105\|31\|NC_014974\|CRISPRCasFinder	575105-575135	31	NZ_CP011665	Streptomyces sp. Mg1 plasmid pSMg1-1, complete sequence	386038-386068	8	0.742
NC_014974_2	2.2\|575105\|31\|NC_014974\|CRISPRCasFinder	575105-575135	31	MK279853	Gordonia phage Gray, complete genome	43799-43829	8	0.742
NC_014974_2	2.2\|575105\|31\|NC_014974\|CRISPRCasFinder	575105-575135	31	NZ_CP007130	Gemmatirosa kalamazoonesis strain KBS708 plasmid 2, complete sequence	525526-525556	8	0.742
NC_014974_2	2.2\|575105\|31\|NC_014974\|CRISPRCasFinder	575105-575135	31	NC_016586	Azospirillum lipoferum 4B plasmid AZO_p2, complete sequence	265530-265560	8	0.742
NC_014974_2	2.2\|575105\|31\|NC_014974\|CRISPRCasFinder	575105-575135	31	NZ_CP029832	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence	293584-293614	8	0.742
NC_014974_2	2.3\|575166\|31\|NC_014974\|CRISPRCasFinder	575166-575196	31	LC549807	Klebsiella pneumoniae VNCKp115 plasmid pVNCKp115 DNA, complete sequence	170751-170781	8	0.742
NC_014974_2	2.3\|575166\|31\|NC_014974\|CRISPRCasFinder	575166-575196	31	NZ_CP031818	Klebsiella pneumoniae strain INF235-sc-2280127 plasmid unnamed1, complete sequence	288648-288678	8	0.742
NC_014974_2	2.3\|575166\|31\|NC_014974\|CRISPRCasFinder	575166-575196	31	NZ_CP042482	Klebsiella pneumoniae strain C51 plasmid pC51_001, complete sequence	117002-117032	8	0.742
NC_014974_2	2.3\|575166\|31\|NC_014974\|CRISPRCasFinder	575166-575196	31	AP021850	Deinococcus grandis ATCC 43672 plasmid: pDEGR-1 DNA, complete genome	104443-104473	8	0.742
NC_014974_2	2.3\|575166\|31\|NC_014974\|CRISPRCasFinder	575166-575196	31	NZ_AP019689	Klebsiella quasipneumoniae strain SNI47 plasmid pTMSNI47-2, complete sequence	142443-142473	8	0.742
NC_014974_2	2.3\|575166\|31\|NC_014974\|CRISPRCasFinder	575166-575196	31	NZ_CP031809	Klebsiella pneumoniae strain INF206-sc-2280074 plasmid unnamed, complete sequence	182090-182120	8	0.742
NC_014974_2	2.3\|575166\|31\|NC_014974\|CRISPRCasFinder	575166-575196	31	NZ_CP014763	Klebsiella pneumoniae strain KPNIH39 plasmid pKPN-332, complete sequence	221949-221979	8	0.742
NC_014974_2	2.3\|575166\|31\|NC_014974\|CRISPRCasFinder	575166-575196	31	NZ_CP014778	Pluralibacter gergoviae strain FB2 plasmid pFB2.3, complete sequence	110695-110725	8	0.742
NC_014974_2	2.5\|575287\|31\|NC_014974\|CRISPRCasFinder	575287-575317	31	NC_022534	Plautia stali symbiont plasmid pPstS2 DNA, complete genome	2583-2613	8	0.742
NC_014974_2	2.7\|575409\|31\|NC_014974\|CRISPRCasFinder	575409-575439	31	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	38821-38851	8	0.742
NC_014974_2	2.7\|575409\|31\|NC_014974\|CRISPRCasFinder	575409-575439	31	NZ_CP014142	Thermus parvatiensis strain RL plasmid pTP143, complete sequence	71534-71564	8	0.742
NC_014974_2	2.7\|575409\|31\|NC_014974\|CRISPRCasFinder	575409-575439	31	NC_005838	Thermus thermophilus HB27 plasmid pTT27, complete sequence	2630-2660	8	0.742
NC_014974_2	2.7\|575409\|31\|NC_014974\|CRISPRCasFinder	575409-575439	31	NC_017588	Thermus thermophilus JL-18 plasmid pTTJL1801, complete sequence	157622-157652	8	0.742
NC_014974_2	2.7\|575409\|31\|NC_014974\|CRISPRCasFinder	575409-575439	31	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	726842-726872	8	0.742
NC_014974_2	2.7\|575409\|31\|NC_014974\|CRISPRCasFinder	575409-575439	31	NZ_LR027520	Thermus thermophilus isolate TTHNAR1 plasmid 4, complete sequence	243895-243925	8	0.742
NC_014974_2	2.7\|575409\|31\|NC_014974\|CRISPRCasFinder	575409-575439	31	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	1086284-1086314	8	0.742
NC_014974_2	2.7\|575409\|31\|NC_014974\|CRISPRCasFinder	575409-575439	31	NZ_AP019795	Thermus thermophilus strain AA2-29 plasmid pAA229, complete sequence	187647-187677	8	0.742
NC_014974_2	2.7\|575409\|31\|NC_014974\|CRISPRCasFinder	575409-575439	31	NZ_AP019793	Thermus thermophilus strain AA2-20 plasmid pAA220, complete sequence	217061-217091	8	0.742
NC_014974_2	2.11\|575105\|32\|NC_014974\|PILER-CR,CRT	575105-575136	32	NZ_CP042916	Rhodococcus qingshengii strain RL1 plasmid unnamed1, complete sequence	61135-61166	8	0.75
NC_014974_2	2.11\|575105\|32\|NC_014974\|PILER-CR,CRT	575105-575136	32	NZ_CP022367	Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence	429570-429601	8	0.75
NC_014974_2	2.11\|575105\|32\|NC_014974\|PILER-CR,CRT	575105-575136	32	NZ_CP032341	Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence	666610-666641	8	0.75
NC_014974_2	2.11\|575105\|32\|NC_014974\|PILER-CR,CRT	575105-575136	32	NZ_CP033321	Azospirillum brasilense strain Cd plasmid p3, complete sequence	664096-664127	8	0.75
NC_014974_2	2.11\|575105\|32\|NC_014974\|PILER-CR,CRT	575105-575136	32	NZ_CP033315	Azospirillum brasilense strain Sp 7 plasmid p3, complete sequence	662284-662315	8	0.75
NC_014974_2	2.11\|575105\|32\|NC_014974\|PILER-CR,CRT	575105-575136	32	NZ_CP012916	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence	381995-382026	8	0.75
NC_014974_2	2.12\|575166\|32\|NC_014974\|PILER-CR,CRT	575166-575197	32	AP021850	Deinococcus grandis ATCC 43672 plasmid: pDEGR-1 DNA, complete genome	104442-104473	8	0.75
NC_014974_2	2.12\|575166\|32\|NC_014974\|PILER-CR,CRT	575166-575197	32	NZ_CP016452	Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence	857683-857714	8	0.75
NC_014974_2	2.13\|575227\|31\|NC_014974\|PILER-CR,CRT	575227-575257	31	NZ_CP017589	Pantoea stewartii subsp. stewartii DC283 plasmid pDSJ08, complete sequence	91344-91374	8	0.742
NC_014974_2	2.13\|575227\|31\|NC_014974\|PILER-CR,CRT	575227-575257	31	CP054911	Pantoea ananatis strain FDAARGOS_680 plasmid unnamed3, complete sequence	54200-54230	8	0.742
NC_014974_2	2.15\|575348\|32\|NC_014974\|PILER-CR,CRT	575348-575379	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	60672-60703	8	0.75
NC_014974_2	2.16\|575409\|32\|NC_014974\|PILER-CR,CRT	575409-575440	32	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	38821-38852	8	0.75
NC_014974_2	2.16\|575409\|32\|NC_014974\|PILER-CR,CRT	575409-575440	32	NZ_CP014142	Thermus parvatiensis strain RL plasmid pTP143, complete sequence	71534-71565	8	0.75
NC_014974_2	2.16\|575409\|32\|NC_014974\|PILER-CR,CRT	575409-575440	32	NC_005838	Thermus thermophilus HB27 plasmid pTT27, complete sequence	2630-2661	8	0.75
NC_014974_2	2.16\|575409\|32\|NC_014974\|PILER-CR,CRT	575409-575440	32	NC_017588	Thermus thermophilus JL-18 plasmid pTTJL1801, complete sequence	157622-157653	8	0.75
NC_014974_2	2.16\|575409\|32\|NC_014974\|PILER-CR,CRT	575409-575440	32	NZ_AP019795	Thermus thermophilus strain AA2-29 plasmid pAA229, complete sequence	187646-187677	8	0.75
NC_014974_2	2.16\|575409\|32\|NC_014974\|PILER-CR,CRT	575409-575440	32	NZ_LR027520	Thermus thermophilus isolate TTHNAR1 plasmid 4, complete sequence	243895-243926	8	0.75
NC_014974_2	2.16\|575409\|32\|NC_014974\|PILER-CR,CRT	575409-575440	32	NZ_AP019793	Thermus thermophilus strain AA2-20 plasmid pAA220, complete sequence	217060-217091	8	0.75
NC_014974_2	2.16\|575409\|32\|NC_014974\|PILER-CR,CRT	575409-575440	32	NZ_CP021653	Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence	1118586-1118617	8	0.75
NC_014974_2	2.16\|575409\|32\|NC_014974\|PILER-CR,CRT	575409-575440	32	NZ_CP012944	Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence	1027249-1027280	8	0.75
NC_014974_2	2.16\|575409\|32\|NC_014974\|PILER-CR,CRT	575409-575440	32	NZ_CP012688	Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence	1118593-1118624	8	0.75
NC_014974_2	2.16\|575409\|32\|NC_014974\|PILER-CR,CRT	575409-575440	32	CP047139	Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence	1046151-1046182	8	0.75
NC_014974_2	2.16\|575409\|32\|NC_014974\|PILER-CR,CRT	575409-575440	32	CP047137	Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence	1003353-1003384	8	0.75
NC_014974_2	2.16\|575409\|32\|NC_014974\|PILER-CR,CRT	575409-575440	32	NZ_CP026518	Deinococcus sp. NW-56 plasmid unnamed2, complete sequence	132589-132620	8	0.75
NC_014974_3	3.5\|1182358\|32\|NC_014974\|CRISPRCasFinder,CRT	1182358-1182389	32	KY053532	Siphovirus 29632, complete genome	1673-1704	8	0.75
NC_014974_3	3.6\|1182419\|32\|NC_014974\|CRISPRCasFinder,CRT	1182419-1182450	32	NZ_CP023549	Rhodobacter sp. CZR27 plasmid unnamed1, complete sequence	104792-104823	8	0.75
NC_014974_3	3.22\|1183399\|33\|NC_014974\|CRISPRCasFinder,CRT	1183399-1183431	33	NZ_CP026518	Deinococcus sp. NW-56 plasmid unnamed2, complete sequence	127041-127073	8	0.758
NC_014974_3	3.22\|1183399\|33\|NC_014974\|CRISPRCasFinder,CRT	1183399-1183431	33	NZ_CP015739	Shinella sp. HZN7 plasmid pShin-03, complete sequence	390233-390265	8	0.758
NC_014974_3	3.22\|1183399\|33\|NC_014974\|CRISPRCasFinder,CRT	1183399-1183431	33	NC_016587	Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence	187027-187059	8	0.758
NC_014974_3	3.22\|1183399\|33\|NC_014974\|CRISPRCasFinder,CRT	1183399-1183431	33	NZ_CP032324	Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence	379008-379040	8	0.758
NC_014974_3	3.22\|1183399\|33\|NC_014974\|CRISPRCasFinder,CRT	1183399-1183431	33	NZ_CP007797	Azospirillum brasilense strain Az39 plasmid AbAZ39_p4, complete sequence	528993-529025	8	0.758
NC_014974_3	3.22\|1183399\|33\|NC_014974\|CRISPRCasFinder,CRT	1183399-1183431	33	NZ_CP029833	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed3, complete sequence	415057-415089	8	0.758
NC_014974_3	3.22\|1183399\|33\|NC_014974\|CRISPRCasFinder,CRT	1183399-1183431	33	NZ_CP032349	Azospirillum brasilense strain MTCC4039 plasmid p3, complete sequence	382334-382366	8	0.758
NC_014974_3	3.23\|1183461\|32\|NC_014974\|CRISPRCasFinder,CRT	1183461-1183492	32	NZ_KJ940992	Pseudomonas sp. ZM1 plasmid pZM1P1, complete sequence	2460-2491	8	0.75
NC_014974_3	3.29\|1183829\|32\|NC_014974\|CRISPRCasFinder,CRT,PILER-CR	1183829-1183860	32	NZ_CP021082	Deinococcus ficus strain CC-FR2-10 plasmid pDFI1, complete sequence	319806-319837	8	0.75
NC_014974_3	3.32\|1184010\|32\|NC_014974\|CRISPRCasFinder,CRT,PILER-CR	1184010-1184041	32	LN997843	Streptomyces reticuli genome assembly TUE45, plasmid : II	781482-781513	8	0.75
NC_014974_3	3.57\|1183399\|34\|NC_014974\|PILER-CR	1183399-1183432	34	NZ_CP026518	Deinococcus sp. NW-56 plasmid unnamed2, complete sequence	127041-127074	8	0.765
NC_014974_3	3.57\|1183399\|34\|NC_014974\|PILER-CR	1183399-1183432	34	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	401948-401981	8	0.765
NC_014974_3	3.58\|1183461\|33\|NC_014974\|PILER-CR	1183461-1183493	33	NZ_KJ940992	Pseudomonas sp. ZM1 plasmid pZM1P1, complete sequence	2459-2491	8	0.758
NC_014974_4	4.16\|1195412\|33\|NC_014974\|PILER-CR	1195412-1195444	33	NZ_CP049158	Caballeronia sp. SBC1 plasmid pSBC1_2, complete sequence	1201535-1201567	8	0.758
NC_014974_4	4.16\|1195412\|33\|NC_014974\|PILER-CR	1195412-1195444	33	NZ_CP049318	Caballeronia sp. SBC2 plasmid pSBC2-2, complete sequence	1206216-1206248	8	0.758
NC_014974_4	4.16\|1195412\|33\|NC_014974\|PILER-CR	1195412-1195444	33	NC_017385	Ketogulonicigenium vulgare WSH-001 plasmid 2, complete sequence	112402-112434	8	0.758
NC_014974_4	4.16\|1195412\|33\|NC_014974\|PILER-CR	1195412-1195444	33	NZ_CP012910	Ketogulonicigenium vulgare strain Hbe602 plasmid 2, complete sequence	132581-132613	8	0.758
NC_014974_4	4.16\|1195412\|33\|NC_014974\|PILER-CR	1195412-1195444	33	NC_014626	Ketogulonicigenium vulgare Y25 plasmid pYP12, complete sequence	163840-163872	8	0.758
NC_014974_4	4.16\|1195412\|33\|NC_014974\|PILER-CR	1195412-1195444	33	NZ_LR594669	Variovorax sp. SRS16 plasmid 4	110143-110175	8	0.758
NC_014974_4	4.16\|1195412\|33\|NC_014974\|PILER-CR	1195412-1195444	33	NZ_CP034470	Pantoea agglomerans strain CFSAN047153 plasmid pCFSAN047153_1, complete sequence	145355-145387	8	0.758
NC_014974_4	4.16\|1195412\|33\|NC_014974\|PILER-CR	1195412-1195444	33	NZ_CP034475	Pantoea agglomerans strain CFSAN047154 plasmid pCFSAN047154_1, complete sequence	48377-48409	8	0.758
NC_014974_4	4.16\|1195412\|33\|NC_014974\|PILER-CR	1195412-1195444	33	NZ_LR594673	Variovorax sp. PBL-E5 plasmid 3	108430-108462	8	0.758
NC_014974_4	4.36\|1196636\|33\|NC_014974\|PILER-CR	1196636-1196668	33	KJ000058	Salmonella phage STP4-a, complete genome	61257-61289	8	0.758
NC_014974_4	4.43\|1194492\|32\|NC_014974\|CRISPRCasFinder,CRT	1194492-1194523	32	KJ019089	Synechococcus phage ACG-2014j isolate Syn7803US23, complete genome	32871-32902	8	0.75
NC_014974_4	4.49\|1194860\|32\|NC_014974\|CRISPRCasFinder,CRT	1194860-1194891	32	NZ_CP032323	Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence	572453-572484	8	0.75
NC_014974_4	4.49\|1194860\|32\|NC_014974\|CRISPRCasFinder,CRT	1194860-1194891	32	NZ_CP022363	Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence	260847-260878	8	0.75
NC_014974_4	4.49\|1194860\|32\|NC_014974\|CRISPRCasFinder,CRT	1194860-1194891	32	NZ_CP007795	Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence	532299-532330	8	0.75
NC_014974_4	4.49\|1194860\|32\|NC_014974\|CRISPRCasFinder,CRT	1194860-1194891	32	NZ_CP032347	Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence	545426-545457	8	0.75
NC_014974_4	4.54\|1195168\|32\|NC_014974\|CRISPRCasFinder,CRT	1195168-1195199	32	NZ_CP033873	Caulobacter sp. FWC26 plasmid p1, complete sequence	253183-253214	8	0.75
NC_014974_4	4.58\|1195413\|32\|NC_014974\|CRISPRCasFinder,CRT	1195413-1195444	32	NC_017385	Ketogulonicigenium vulgare WSH-001 plasmid 2, complete sequence	112403-112434	8	0.75
NC_014974_4	4.58\|1195413\|32\|NC_014974\|CRISPRCasFinder,CRT	1195413-1195444	32	NZ_CP012910	Ketogulonicigenium vulgare strain Hbe602 plasmid 2, complete sequence	132581-132612	8	0.75
NC_014974_4	4.58\|1195413\|32\|NC_014974\|CRISPRCasFinder,CRT	1195413-1195444	32	NZ_CP049158	Caballeronia sp. SBC1 plasmid pSBC1_2, complete sequence	1201535-1201566	8	0.75
NC_014974_4	4.58\|1195413\|32\|NC_014974\|CRISPRCasFinder,CRT	1195413-1195444	32	NZ_CP049318	Caballeronia sp. SBC2 plasmid pSBC2-2, complete sequence	1206216-1206247	8	0.75
NC_014974_4	4.58\|1195413\|32\|NC_014974\|CRISPRCasFinder,CRT	1195413-1195444	32	NC_014626	Ketogulonicigenium vulgare Y25 plasmid pYP12, complete sequence	163841-163872	8	0.75
NC_014974_4	4.58\|1195413\|32\|NC_014974\|CRISPRCasFinder,CRT	1195413-1195444	32	NZ_LR594669	Variovorax sp. SRS16 plasmid 4	110144-110175	8	0.75
NC_014974_4	4.58\|1195413\|32\|NC_014974\|CRISPRCasFinder,CRT	1195413-1195444	32	NZ_LR594673	Variovorax sp. PBL-E5 plasmid 3	108431-108462	8	0.75
NC_014974_4	4.58\|1195413\|32\|NC_014974\|CRISPRCasFinder,CRT	1195413-1195444	32	NZ_CP032346	Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence	1480516-1480547	8	0.75
NC_014974_4	4.58\|1195413\|32\|NC_014974\|CRISPRCasFinder,CRT	1195413-1195444	32	NC_018022	Mycolicibacterium chubuense NBB4 plasmid pMYCCH.01, complete sequence	352504-352535	8	0.75
NC_014974_4	4.58\|1195413\|32\|NC_014974\|CRISPRCasFinder,CRT	1195413-1195444	32	NZ_CP034470	Pantoea agglomerans strain CFSAN047153 plasmid pCFSAN047153_1, complete sequence	145356-145387	8	0.75
NC_014974_4	4.58\|1195413\|32\|NC_014974\|CRISPRCasFinder,CRT	1195413-1195444	32	NZ_CP034475	Pantoea agglomerans strain CFSAN047154 plasmid pCFSAN047154_1, complete sequence	48377-48408	8	0.75
NC_014974_4	4.58\|1195413\|32\|NC_014974\|CRISPRCasFinder,CRT	1195413-1195444	32	KT997863	Uncultured Mediterranean phage uvDeep-CGR2-KM21-C338, complete genome	10585-10616	8	0.75
NC_014974_4	4.58\|1195413\|32\|NC_014974\|CRISPRCasFinder,CRT	1195413-1195444	32	NC_047804	Ralstonia phage RS-PII-1, complete genome	5420-5451	8	0.75
NC_014974_4	4.61\|1195595\|32\|NC_014974\|CRISPRCasFinder,CRT	1195595-1195626	32	MH067970	Arthrobacter sp. strain ANT_H40 plasmid pA40H1, complete sequence	11737-11768	8	0.75
NC_014974_4	4.62\|1195656\|32\|NC_014974\|CRISPRCasFinder,CRT	1195656-1195687	32	NZ_CP028971	Aminobacter sp. MSH1 plasmid pUSP3, complete sequence	7160-7191	8	0.75
NC_014974_4	4.65\|1195839\|32\|NC_014974\|CRISPRCasFinder,CRT	1195839-1195870	32	NZ_CP020372	Candidatus Thiodictyon syntrophicum strain Cad16T plasmid pTs485, complete sequence	121522-121553	8	0.75
NC_014974_4	4.72\|1196267\|32\|NC_014974\|CRISPRCasFinder,CRT	1196267-1196298	32	NZ_CP030833	Neorhizobium sp. NCHU2750 plasmid pNCHU2750e, complete sequence	1568-1599	8	0.75
NC_014974_4	4.78\|1196637\|32\|NC_014974\|CRISPRCasFinder,CRT	1196637-1196668	32	KJ000058	Salmonella phage STP4-a, complete genome	61257-61288	8	0.75
NC_014974_2	2.2\|575105\|31\|NC_014974\|CRISPRCasFinder	575105-575135	31	NZ_CP012915	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence	920499-920529	9	0.71
NC_014974_2	2.2\|575105\|31\|NC_014974\|CRISPRCasFinder	575105-575135	31	NZ_CP022367	Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence	1831405-1831435	9	0.71
NC_014974_2	2.2\|575105\|31\|NC_014974\|CRISPRCasFinder	575105-575135	31	NZ_CP032340	Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence	1211876-1211906	9	0.71
NC_014974_2	2.2\|575105\|31\|NC_014974\|CRISPRCasFinder	575105-575135	31	NZ_MK851048	Morganella morganii strain MM1L5 plasmid pMM1L5, complete sequence	58574-58604	9	0.71
NC_014974_2	2.2\|575105\|31\|NC_014974\|CRISPRCasFinder	575105-575135	31	NZ_MK851047	Actinobacillus pleuropneumoniae strain APP1L5 plasmid pAPP1L5, complete sequence	10403-10433	9	0.71
NC_014974_2	2.3\|575166\|31\|NC_014974\|CRISPRCasFinder	575166-575196	31	CP008701	Klebsiella variicola strain Kp5-1 plasmid pKp5-1, complete sequence	42902-42932	9	0.71
NC_014974_2	2.3\|575166\|31\|NC_014974\|CRISPRCasFinder	575166-575196	31	NZ_CP029140	Klebsiella michiganensis strain AR375 plasmid unnamed1, complete sequence	13544-13574	9	0.71
NC_014974_2	2.5\|575287\|31\|NC_014974\|CRISPRCasFinder	575287-575317	31	NZ_CP014310	Burkholderia sp. PAMC 26561 plasmid unnamed3, complete sequence	276821-276851	9	0.71
NC_014974_2	2.7\|575409\|31\|NC_014974\|CRISPRCasFinder	575409-575439	31	NZ_CP029832	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence	64546-64576	9	0.71
NC_014974_2	2.11\|575105\|32\|NC_014974\|PILER-CR,CRT	575105-575136	32	NZ_CP011665	Streptomyces sp. Mg1 plasmid pSMg1-1, complete sequence	386037-386068	9	0.719
NC_014974_2	2.11\|575105\|32\|NC_014974\|PILER-CR,CRT	575105-575136	32	NZ_CP007130	Gemmatirosa kalamazoonesis strain KBS708 plasmid 2, complete sequence	525526-525557	9	0.719
NC_014974_2	2.11\|575105\|32\|NC_014974\|PILER-CR,CRT	575105-575136	32	NZ_CP029832	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence	293583-293614	9	0.719
NC_014974_2	2.11\|575105\|32\|NC_014974\|PILER-CR,CRT	575105-575136	32	NC_016586	Azospirillum lipoferum 4B plasmid AZO_p2, complete sequence	265530-265561	9	0.719
NC_014974_2	2.14\|575287\|32\|NC_014974\|PILER-CR,CRT	575287-575318	32	NC_022534	Plautia stali symbiont plasmid pPstS2 DNA, complete genome	2582-2613	9	0.719
NC_014974_2	2.16\|575409\|32\|NC_014974\|PILER-CR,CRT	575409-575440	32	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	1086283-1086314	9	0.719
NC_014974_2	2.16\|575409\|32\|NC_014974\|PILER-CR,CRT	575409-575440	32	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	726842-726873	9	0.719
NC_014974_2	2.16\|575409\|32\|NC_014974\|PILER-CR,CRT	575409-575440	32	NZ_CP039912	Agrobacterium tumefaciens strain CFBP6625 plasmid pAtCFBP6625a, complete sequence	198052-198083	9	0.719
NC_014974_3	3.5\|1182358\|32\|NC_014974\|CRISPRCasFinder,CRT	1182358-1182389	32	NZ_CP022999	Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-A, complete sequence	44654-44685	9	0.719
NC_014974_3	3.6\|1182419\|32\|NC_014974\|CRISPRCasFinder,CRT	1182419-1182450	32	NZ_CP020740	[Pseudomonas] mesoacidophila strain ATCC 31433 plasmid pATCC31433, complete sequence	78578-78609	9	0.719
NC_014974_3	3.6\|1182419\|32\|NC_014974\|CRISPRCasFinder,CRT	1182419-1182450	32	AJ304453	Uncultured bacterium plasmid pSB102 complete genome	24114-24145	9	0.719
NC_014974_3	3.6\|1182419\|32\|NC_014974\|CRISPRCasFinder,CRT	1182419-1182450	32	NC_018853	Streptomyce phage TG1, complete genome	36702-36733	9	0.719
NC_014974_3	3.6\|1182419\|32\|NC_014974\|CRISPRCasFinder,CRT	1182419-1182450	32	AB251920	Streptomyces phage TG1 DNA, region around attP and integrase	224-255	9	0.719
NC_014974_3	3.6\|1182419\|32\|NC_014974\|CRISPRCasFinder,CRT	1182419-1182450	32	JX182372	Streptomyces virus TG1, complete genome	36702-36733	9	0.719
NC_014974_3	3.12\|1182786\|32\|NC_014974\|CRISPRCasFinder,CRT	1182786-1182817	32	JQ807246	Environmental Halophage eHP-27, partial genome	16438-16469	9	0.719
NC_014974_3	3.19\|1183215\|32\|NC_014974\|CRISPRCasFinder,CRT	1183215-1183246	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	240220-240251	9	0.719
NC_014974_3	3.22\|1183399\|33\|NC_014974\|CRISPRCasFinder,CRT	1183399-1183431	33	NC_015146	Pseudarthrobacter phenanthrenivorans Sphe3 plasmid pASPHE301, complete sequence	144461-144493	9	0.727
NC_014974_3	3.22\|1183399\|33\|NC_014974\|CRISPRCasFinder,CRT	1183399-1183431	33	NZ_CP022369	Azospirillum sp. TSH58 plasmid TSH58_p05, complete sequence	352860-352892	9	0.727
NC_014974_3	3.22\|1183399\|33\|NC_014974\|CRISPRCasFinder,CRT	1183399-1183431	33	NZ_CP051544	Paracoccus sanguinis strain OM2164 plasmid pPspOM44, complete sequence	36418-36450	9	0.727
NC_014974_3	3.23\|1183461\|32\|NC_014974\|CRISPRCasFinder,CRT	1183461-1183492	32	NZ_CP034186	Deinococcus sp. S14-83 strain S14-83T plasmid unnamed2, complete sequence	206470-206501	9	0.719
NC_014974_3	3.23\|1183461\|32\|NC_014974\|CRISPRCasFinder,CRT	1183461-1183492	32	NC_016624	Azospirillum lipoferum 4B plasmid AZO_p5, complete sequence	16328-16359	9	0.719
NC_014974_3	3.28\|1183768\|32\|NC_014974\|CRISPRCasFinder,CRT,PILER-CR	1183768-1183799	32	MK496724	Capybara microvirus Cap1_SP_141, complete genome	111-142	9	0.719
NC_014974_3	3.31\|1183950\|31\|NC_014974\|CRISPRCasFinder,CRT,PILER-CR	1183950-1183980	31	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	1513719-1513749	9	0.71
NC_014974_3	3.32\|1184010\|32\|NC_014974\|CRISPRCasFinder,CRT,PILER-CR	1184010-1184041	32	NZ_CP022370	Bosea sp. AS-1 plasmid unnamed1, complete sequence	177280-177311	9	0.719
NC_014974_3	3.40\|1182358\|33\|NC_014974\|PILER-CR	1182358-1182390	33	KY053532	Siphovirus 29632, complete genome	1672-1704	9	0.727
NC_014974_3	3.47\|1182786\|33\|NC_014974\|PILER-CR	1182786-1182818	33	JQ807246	Environmental Halophage eHP-27, partial genome	16437-16469	9	0.727
NC_014974_3	3.57\|1183399\|34\|NC_014974\|PILER-CR	1183399-1183432	34	NZ_CP015739	Shinella sp. HZN7 plasmid pShin-03, complete sequence	390232-390265	9	0.735
NC_014974_3	3.57\|1183399\|34\|NC_014974\|PILER-CR	1183399-1183432	34	NZ_CP032324	Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence	379008-379041	9	0.735
NC_014974_3	3.57\|1183399\|34\|NC_014974\|PILER-CR	1183399-1183432	34	NC_016587	Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence	187027-187060	9	0.735
NC_014974_3	3.57\|1183399\|34\|NC_014974\|PILER-CR	1183399-1183432	34	NZ_CP007797	Azospirillum brasilense strain Az39 plasmid AbAZ39_p4, complete sequence	528993-529026	9	0.735
NC_014974_3	3.57\|1183399\|34\|NC_014974\|PILER-CR	1183399-1183432	34	NZ_CP029833	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed3, complete sequence	415057-415090	9	0.735
NC_014974_3	3.57\|1183399\|34\|NC_014974\|PILER-CR	1183399-1183432	34	NZ_CP032349	Azospirillum brasilense strain MTCC4039 plasmid p3, complete sequence	382334-382367	9	0.735
NC_014974_4	4.7\|1194859\|33\|NC_014974\|PILER-CR	1194859-1194891	33	NC_017385	Ketogulonicigenium vulgare WSH-001 plasmid 2, complete sequence	205248-205280	9	0.727
NC_014974_4	4.7\|1194859\|33\|NC_014974\|PILER-CR	1194859-1194891	33	NZ_CP012910	Ketogulonicigenium vulgare strain Hbe602 plasmid 2, complete sequence	39735-39767	9	0.727
NC_014974_4	4.7\|1194859\|33\|NC_014974\|PILER-CR	1194859-1194891	33	NC_014626	Ketogulonicigenium vulgare Y25 plasmid pYP12, complete sequence	13430-13462	9	0.727
NC_014974_4	4.15\|1195351\|33\|NC_014974\|PILER-CR	1195351-1195383	33	NC_014157	Salinibacter ruber M8 plasmid pSR84, complete sequence	58702-58734	9	0.727
NC_014974_4	4.16\|1195412\|33\|NC_014974\|PILER-CR	1195412-1195444	33	NZ_CP032346	Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence	1480515-1480547	9	0.727
NC_014974_4	4.16\|1195412\|33\|NC_014974\|PILER-CR	1195412-1195444	33	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	378427-378459	9	0.727
NC_014974_4	4.16\|1195412\|33\|NC_014974\|PILER-CR	1195412-1195444	33	NZ_AP019802	Thermus thermophilus strain HC11 plasmid pHC11, complete sequence	13960-13992	9	0.727
NC_014974_4	4.16\|1195412\|33\|NC_014974\|PILER-CR	1195412-1195444	33	NC_017588	Thermus thermophilus JL-18 plasmid pTTJL1801, complete sequence	132102-132134	9	0.727
NC_014974_4	4.16\|1195412\|33\|NC_014974\|PILER-CR	1195412-1195444	33	NZ_LR027520	Thermus thermophilus isolate TTHNAR1 plasmid 4, complete sequence	232750-232782	9	0.727
NC_014974_4	4.19\|1195594\|33\|NC_014974\|PILER-CR	1195594-1195626	33	MH067970	Arthrobacter sp. strain ANT_H40 plasmid pA40H1, complete sequence	11737-11769	9	0.727
NC_014974_4	4.20\|1195655\|33\|NC_014974\|PILER-CR	1195655-1195687	33	NZ_CP028971	Aminobacter sp. MSH1 plasmid pUSP3, complete sequence	7160-7192	9	0.727
NC_014974_4	4.22\|1195777\|33\|NC_014974\|PILER-CR	1195777-1195809	33	NZ_CP006570	Sodalis praecaptivus strain HS1 plasmid pHS1, complete sequence	360990-361022	9	0.727
NC_014974_4	4.23\|1195838\|33\|NC_014974\|PILER-CR	1195838-1195870	33	NZ_CP020372	Candidatus Thiodictyon syntrophicum strain Cad16T plasmid pTs485, complete sequence	121522-121554	9	0.727
NC_014974_4	4.30\|1196266\|33\|NC_014974\|PILER-CR	1196266-1196298	33	NZ_CP030833	Neorhizobium sp. NCHU2750 plasmid pNCHU2750e, complete sequence	1567-1599	9	0.727
NC_014974_4	4.30\|1196266\|33\|NC_014974\|PILER-CR	1196266-1196298	33	KC460990	Serratia phage Eta, complete genome	28997-29029	9	0.727
NC_014974_4	4.34\|1196513\|33\|NC_014974\|PILER-CR	1196513-1196545	33	NZ_CP032343	Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence	44132-44164	9	0.727
NC_014974_4	4.34\|1196513\|33\|NC_014974\|PILER-CR	1196513-1196545	33	NZ_CP032324	Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence	348730-348762	9	0.727
NC_014974_4	4.34\|1196513\|33\|NC_014974\|PILER-CR	1196513-1196545	33	NZ_CP012917	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence	49276-49308	9	0.727
NC_014974_4	4.39\|1196819\|34\|NC_014974\|PILER-CR	1196819-1196852	34	NZ_CP035092	Paracoccus denitrificans strain ATCC 19367 plasmid unnamed1, complete sequence	562151-562184	9	0.735
NC_014974_4	4.39\|1196819\|34\|NC_014974\|PILER-CR	1196819-1196852	34	NC_008688	Paracoccus denitrificans PD1222 plasmid 1, complete sequence	155684-155717	9	0.735
NC_014974_4	4.49\|1194860\|32\|NC_014974\|CRISPRCasFinder,CRT	1194860-1194891	32	NC_017385	Ketogulonicigenium vulgare WSH-001 plasmid 2, complete sequence	205249-205280	9	0.719
NC_014974_4	4.49\|1194860\|32\|NC_014974\|CRISPRCasFinder,CRT	1194860-1194891	32	NZ_CP012910	Ketogulonicigenium vulgare strain Hbe602 plasmid 2, complete sequence	39735-39766	9	0.719
NC_014974_4	4.49\|1194860\|32\|NC_014974\|CRISPRCasFinder,CRT	1194860-1194891	32	NZ_CP030864	Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence	46098-46129	9	0.719
NC_014974_4	4.49\|1194860\|32\|NC_014974\|CRISPRCasFinder,CRT	1194860-1194891	32	NC_014626	Ketogulonicigenium vulgare Y25 plasmid pYP12, complete sequence	13431-13462	9	0.719
NC_014974_4	4.57\|1195352\|32\|NC_014974\|CRISPRCasFinder,CRT	1195352-1195383	32	NC_014157	Salinibacter ruber M8 plasmid pSR84, complete sequence	58702-58733	9	0.719
NC_014974_4	4.58\|1195413\|32\|NC_014974\|CRISPRCasFinder,CRT	1195413-1195444	32	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	378428-378459	9	0.719
NC_014974_4	4.58\|1195413\|32\|NC_014974\|CRISPRCasFinder,CRT	1195413-1195444	32	AP021850	Deinococcus grandis ATCC 43672 plasmid: pDEGR-1 DNA, complete genome	263657-263688	9	0.719
NC_014974_4	4.58\|1195413\|32\|NC_014974\|CRISPRCasFinder,CRT	1195413-1195444	32	NZ_AP019802	Thermus thermophilus strain HC11 plasmid pHC11, complete sequence	13961-13992	9	0.719
NC_014974_4	4.58\|1195413\|32\|NC_014974\|CRISPRCasFinder,CRT	1195413-1195444	32	NC_017588	Thermus thermophilus JL-18 plasmid pTTJL1801, complete sequence	132102-132133	9	0.719
NC_014974_4	4.58\|1195413\|32\|NC_014974\|CRISPRCasFinder,CRT	1195413-1195444	32	NZ_LR027520	Thermus thermophilus isolate TTHNAR1 plasmid 4, complete sequence	232751-232782	9	0.719
NC_014974_4	4.58\|1195413\|32\|NC_014974\|CRISPRCasFinder,CRT	1195413-1195444	32	NZ_CP029357	Azospirillum sp. CFH 70021 plasmid unnamed2	126483-126514	9	0.719
NC_014974_4	4.58\|1195413\|32\|NC_014974\|CRISPRCasFinder,CRT	1195413-1195444	32	NZ_CP032346	Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence	1037414-1037445	9	0.719
NC_014974_4	4.58\|1195413\|32\|NC_014974\|CRISPRCasFinder,CRT	1195413-1195444	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	771094-771125	9	0.719
NC_014974_4	4.58\|1195413\|32\|NC_014974\|CRISPRCasFinder,CRT	1195413-1195444	32	NZ_CP015040	Rhodovulum sp. P5 plasmid pRGUI01, complete sequence	133888-133919	9	0.719
NC_014974_4	4.58\|1195413\|32\|NC_014974\|CRISPRCasFinder,CRT	1195413-1195444	32	MF351863	Synechococcus phage Bellamy, complete genome	41452-41483	9	0.719
NC_014974_4	4.62\|1195656\|32\|NC_014974\|CRISPRCasFinder,CRT	1195656-1195687	32	NZ_CP042265	Litoreibacter sp. LN3S51 plasmid unnamed4, complete sequence	497375-497406	9	0.719
NC_014974_4	4.64\|1195778\|32\|NC_014974\|CRISPRCasFinder,CRT	1195778-1195809	32	NZ_CP006570	Sodalis praecaptivus strain HS1 plasmid pHS1, complete sequence	360990-361021	9	0.719
NC_014974_4	4.64\|1195778\|32\|NC_014974\|CRISPRCasFinder,CRT	1195778-1195809	32	NC_014309	Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome	608056-608087	9	0.719
NC_014974_4	4.65\|1195839\|32\|NC_014974\|CRISPRCasFinder,CRT	1195839-1195870	32	NC_013855	Azospirillum sp. B510 plasmid pAB510a, complete sequence	337535-337566	9	0.719
NC_014974_4	4.72\|1196267\|32\|NC_014974\|CRISPRCasFinder,CRT	1196267-1196298	32	KC460990	Serratia phage Eta, complete genome	28997-29028	9	0.719
NC_014974_4	4.76\|1196514\|32\|NC_014974\|CRISPRCasFinder,CRT	1196514-1196545	32	NZ_CP032324	Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence	348730-348761	9	0.719
NC_014974_4	4.76\|1196514\|32\|NC_014974\|CRISPRCasFinder,CRT	1196514-1196545	32	NZ_CP032343	Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence	44133-44164	9	0.719
NC_014974_4	4.76\|1196514\|32\|NC_014974\|CRISPRCasFinder,CRT	1196514-1196545	32	NZ_CP012917	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence	49276-49307	9	0.719
NC_014974_4	4.84\|1197005\|32\|NC_014974\|CRISPRCasFinder,CRT	1197005-1197036	32	NZ_CP041205	Rhizobium sp. NIBRBAC000502774 plasmid pMK-2, complete sequence	475678-475709	9	0.719
NC_014974_4	4.84\|1197005\|32\|NC_014974\|CRISPRCasFinder,CRT	1197005-1197036	32	NC_015184	Agrobacterium sp. H13-3 plasmid pAspH13-3a, complete sequence	355386-355417	9	0.719
NC_014974_4	4.84\|1197005\|32\|NC_014974\|CRISPRCasFinder,CRT	1197005-1197036	32	NZ_CP032923	Agrobacterium tumefaciens strain 1D1108 plasmid pAt1D1108a, complete sequence	233536-233567	9	0.719
NC_014974_4	4.84\|1197005\|32\|NC_014974\|CRISPRCasFinder,CRT	1197005-1197036	32	NC_003064	Agrobacterium fabrum str. C58 plasmid At, complete sequence	167034-167065	9	0.719
NC_014974_2	2.7\|575409\|31\|NC_014974\|CRISPRCasFinder	575409-575439	31	NZ_CP039912	Agrobacterium tumefaciens strain CFBP6625 plasmid pAtCFBP6625a, complete sequence	198053-198083	10	0.677
NC_014974_2	2.11\|575105\|32\|NC_014974\|PILER-CR,CRT	575105-575136	32	NZ_CP022367	Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence	1831404-1831435	10	0.688
NC_014974_2	2.11\|575105\|32\|NC_014974\|PILER-CR,CRT	575105-575136	32	NZ_CP032340	Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence	1211875-1211906	10	0.688
NC_014974_2	2.11\|575105\|32\|NC_014974\|PILER-CR,CRT	575105-575136	32	NZ_CP012915	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence	920499-920530	10	0.688
NC_014974_2	2.11\|575105\|32\|NC_014974\|PILER-CR,CRT	575105-575136	32	NZ_MK851048	Morganella morganii strain MM1L5 plasmid pMM1L5, complete sequence	58573-58604	10	0.688
NC_014974_2	2.11\|575105\|32\|NC_014974\|PILER-CR,CRT	575105-575136	32	NZ_MK851047	Actinobacillus pleuropneumoniae strain APP1L5 plasmid pAPP1L5, complete sequence	10402-10433	10	0.688
NC_014974_2	2.14\|575287\|32\|NC_014974\|PILER-CR,CRT	575287-575318	32	NZ_CP014310	Burkholderia sp. PAMC 26561 plasmid unnamed3, complete sequence	276821-276852	10	0.688
NC_014974_2	2.16\|575409\|32\|NC_014974\|PILER-CR,CRT	575409-575440	32	NZ_CP029832	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence	64546-64577	10	0.688
NC_014974_3	3.4\|1182297\|32\|NC_014974\|CRISPRCasFinder,CRT	1182297-1182328	32	MN586038	Mycobacterium phage WalterMcMickey, complete genome	5740-5771	10	0.688
NC_014974_3	3.4\|1182297\|32\|NC_014974\|CRISPRCasFinder,CRT	1182297-1182328	32	NC_041982	Mycobacterium phage Twister, complete genome	5740-5771	10	0.688
NC_014974_3	3.4\|1182297\|32\|NC_014974\|CRISPRCasFinder,CRT	1182297-1182328	32	MT522002	Mycobacterium phage Topanga, complete genome	5841-5872	10	0.688
NC_014974_3	3.5\|1182358\|32\|NC_014974\|CRISPRCasFinder,CRT	1182358-1182389	32	MT889367	Gordonia phage Orla, complete genome	46517-46548	10	0.688
NC_014974_3	3.22\|1183399\|33\|NC_014974\|CRISPRCasFinder,CRT	1183399-1183431	33	NZ_CP012917	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence	387470-387502	10	0.697
NC_014974_3	3.22\|1183399\|33\|NC_014974\|CRISPRCasFinder,CRT	1183399-1183431	33	NZ_CP032343	Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence	340724-340756	10	0.697
NC_014974_3	3.41\|1182419\|33\|NC_014974\|PILER-CR	1182419-1182451	33	NZ_CP020740	[Pseudomonas] mesoacidophila strain ATCC 31433 plasmid pATCC31433, complete sequence	78578-78610	10	0.697
NC_014974_3	3.57\|1183399\|34\|NC_014974\|PILER-CR	1183399-1183432	34	NC_015146	Pseudarthrobacter phenanthrenivorans Sphe3 plasmid pASPHE301, complete sequence	144460-144493	10	0.706
NC_014974_3	3.57\|1183399\|34\|NC_014974\|PILER-CR	1183399-1183432	34	NZ_CP022369	Azospirillum sp. TSH58 plasmid TSH58_p05, complete sequence	352860-352893	10	0.706
NC_014974_3	3.57\|1183399\|34\|NC_014974\|PILER-CR	1183399-1183432	34	NZ_CP051544	Paracoccus sanguinis strain OM2164 plasmid pPspOM44, complete sequence	36418-36451	10	0.706
NC_014974_3	3.58\|1183461\|33\|NC_014974\|PILER-CR	1183461-1183493	33	NZ_CP034186	Deinococcus sp. S14-83 strain S14-83T plasmid unnamed2, complete sequence	206469-206501	10	0.697
NC_014974_4	4.16\|1195412\|33\|NC_014974\|PILER-CR	1195412-1195444	33	AP021850	Deinococcus grandis ATCC 43672 plasmid: pDEGR-1 DNA, complete genome	263656-263688	10	0.697
NC_014974_4	4.16\|1195412\|33\|NC_014974\|PILER-CR	1195412-1195444	33	NZ_CP029357	Azospirillum sp. CFH 70021 plasmid unnamed2	126483-126515	10	0.697
NC_014974_4	4.16\|1195412\|33\|NC_014974\|PILER-CR	1195412-1195444	33	MK279857	Mycobacterium phage IronMan, complete genome	5644-5676	10	0.697
NC_014974_4	4.58\|1195413\|32\|NC_014974\|CRISPRCasFinder,CRT	1195413-1195444	32	NC_014310	Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence	1787819-1787850	10	0.688
NC_014974_4	4.58\|1195413\|32\|NC_014974\|CRISPRCasFinder,CRT	1195413-1195444	32	NZ_CP039340	Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence	1104054-1104085	10	0.688
NC_014974_4	4.58\|1195413\|32\|NC_014974\|CRISPRCasFinder,CRT	1195413-1195444	32	NZ_CP040762	Paracoccus sp. 2251 plasmid unnamed2, complete sequence	6509-6540	10	0.688
NC_014974_4	4.58\|1195413\|32\|NC_014974\|CRISPRCasFinder,CRT	1195413-1195444	32	NZ_CP022760	Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence	1701199-1701230	10	0.688
NC_014974_4	4.58\|1195413\|32\|NC_014974\|CRISPRCasFinder,CRT	1195413-1195444	32	NZ_CP022789	Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence	1701200-1701231	10	0.688
NC_014974_4	4.58\|1195413\|32\|NC_014974\|CRISPRCasFinder,CRT	1195413-1195444	32	NZ_CP023073	Sinorhizobium fredii CCBAU 83666 plasmid pSF83666d, complete sequence	29996-30027	10	0.688
NC_014974_4	4.58\|1195413\|32\|NC_014974\|CRISPRCasFinder,CRT	1195413-1195444	32	NZ_CP051295	Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence	527186-527217	10	0.688
NC_014974_4	4.58\|1195413\|32\|NC_014974\|CRISPRCasFinder,CRT	1195413-1195444	32	MK279857	Mycobacterium phage IronMan, complete genome	5645-5676	10	0.688
NC_014974_4	4.58\|1195413\|32\|NC_014974\|CRISPRCasFinder,CRT	1195413-1195444	32	NC_008195	Mycobacterium phage Cooper, complete genome	30562-30593	10	0.688
NC_014974_4	4.71\|1196206\|32\|NC_014974\|CRISPRCasFinder,CRT	1196206-1196237	32	NZ_CP017076	Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence	1086716-1086747	10	0.688
NC_014974_3	3.32\|1184010\|32\|NC_014974\|CRISPRCasFinder,CRT,PILER-CR	1184010-1184041	32	NZ_CP042332	Bosea sp. F3-2 plasmid pB32-1, complete sequence	333249-333280	11	0.656
NC_014974_3	3.57\|1183399\|34\|NC_014974\|PILER-CR	1183399-1183432	34	NZ_CP012917	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence	387469-387502	11	0.676
NC_014974_3	3.57\|1183399\|34\|NC_014974\|PILER-CR	1183399-1183432	34	NZ_CP032343	Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence	340724-340757	11	0.676
NC_014974_4	4.16\|1195412\|33\|NC_014974\|PILER-CR	1195412-1195444	33	NZ_CP038854	Pantoea vagans strain LMG 24199 plasmid unnamed1, complete sequence	483991-484023	11	0.667
NC_014974_4	4.46\|1194677\|32\|NC_014974\|CRISPRCasFinder,CRT	1194677-1194708	32	NZ_CP017904	Vibrio alginolyticus strain K05K4 plasmid pL289, complete sequence	119096-119127	11	0.656
NC_014974_4	4.46\|1194677\|32\|NC_014974\|CRISPRCasFinder,CRT	1194677-1194708	32	NZ_CP017901	Vibrio alginolyticus strain K04M5 plasmid pL294, complete sequence	124752-124783	11	0.656
NC_014974_4	4.46\|1194677\|32\|NC_014974\|CRISPRCasFinder,CRT	1194677-1194708	32	NZ_CP017909	Vibrio alginolyticus strain K06K5 plasmid pL291, complete sequence	102690-102721	11	0.656
NC_014974_4	4.46\|1194677\|32\|NC_014974\|CRISPRCasFinder,CRT	1194677-1194708	32	NZ_CP017893	Vibrio alginolyticus strain K04M1 plasmid pL280, complete sequence	102690-102721	11	0.656
NC_014974_4	4.46\|1194677\|32\|NC_014974\|CRISPRCasFinder,CRT	1194677-1194708	32	NZ_CP017898	Vibrio alginolyticus isolate K04M3 plasmid pL294, complete sequence	124117-124148	11	0.656
NC_014974_4	4.55\|1195229\|32\|NC_014974\|CRISPRCasFinder,CRT	1195229-1195260	32	KF147891	Pseudomonas phage PaBG, complete genome	251022-251053	11	0.656
NC_014974_4	4.58\|1195413\|32\|NC_014974\|CRISPRCasFinder,CRT	1195413-1195444	32	NZ_CP038854	Pantoea vagans strain LMG 24199 plasmid unnamed1, complete sequence	483992-484023	11	0.656
NC_014974_4	4.79\|1196698\|32\|NC_014974\|CRISPRCasFinder,CRT	1196698-1196729	32	NZ_CP050098	Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b4, complete sequence	273326-273357	11	0.656
NC_014974_4	4.79\|1196698\|32\|NC_014974\|CRISPRCasFinder,CRT	1196698-1196729	32	NZ_CP053440	Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eF, complete sequence	279043-279074	11	0.656
NC_014974_4	4.79\|1196698\|32\|NC_014974\|CRISPRCasFinder,CRT	1196698-1196729	32	NZ_CP018229	Rhizobium leguminosarum strain Vaf-108 plasmid unnamed1, complete sequence	647161-647192	11	0.656
NC_014974_4	4.79\|1196698\|32\|NC_014974\|CRISPRCasFinder,CRT	1196698-1196729	32	NZ_CP016287	Rhizobium leguminosarum strain Vaf10 plasmid unnamed1, complete sequence	241927-241958	11	0.656
NC_014974_4	4.79\|1196698\|32\|NC_014974\|CRISPRCasFinder,CRT	1196698-1196729	32	NC_012848	Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132501, complete sequence	93980-94011	11	0.656
NC_014974_4	4.79\|1196698\|32\|NC_014974\|CRISPRCasFinder,CRT	1196698-1196729	32	CP003952	Rhodococcus opacus PD630 plasmid 3, complete sequence	8522-8553	11	0.656
NC_014974_4	4.84\|1197005\|32\|NC_014974\|CRISPRCasFinder,CRT	1197005-1197036	32	NZ_CP042276	Agrobacterium tumefaciens strain 186 plasmid pAt, complete sequence	79078-79109	11	0.656

1. spacer 3.31|1183950|31|NC_014974|CRISPRCasFinder,CRT,PILER-CR matches to NC_004462 (Thermus thermophilus phage IN93, complete genome) position: , mismatch: 0, identity: 1.0

gagcttccgccggcggagcctcccgtgatcc	CRISPR spacer
gagcttccgccggcggagcctcccgtgatcc	Protospacer
*******************************

2. spacer 3.31|1183950|31|NC_014974|CRISPRCasFinder,CRT,PILER-CR matches to AB063393 (Thermus thermophilus phage IN93 DNA, complete genome) position: , mismatch: 0, identity: 1.0

gagcttccgccggcggagcctcccgtgatcc	CRISPR spacer
gagcttccgccggcggagcctcccgtgatcc	Protospacer
*******************************

3. spacer 4.7|1194859|33|NC_014974|PILER-CR matches to NC_004462 (Thermus thermophilus phage IN93, complete genome) position: , mismatch: 0, identity: 1.0

ggtgaggtctagggcggcggcgggcatgagcac	CRISPR spacer
ggtgaggtctagggcggcggcgggcatgagcac	Protospacer
*********************************

4. spacer 4.7|1194859|33|NC_014974|PILER-CR matches to AB063393 (Thermus thermophilus phage IN93 DNA, complete genome) position: , mismatch: 0, identity: 1.0

ggtgaggtctagggcggcggcgggcatgagcac	CRISPR spacer
ggtgaggtctagggcggcggcgggcatgagcac	Protospacer
*********************************

5. spacer 4.8|1194920|33|NC_014974|PILER-CR matches to NC_004462 (Thermus thermophilus phage IN93, complete genome) position: , mismatch: 0, identity: 1.0

gagcttgaacccatgcggatcaccgccgtggaa	CRISPR spacer
gagcttgaacccatgcggatcaccgccgtggaa	Protospacer
*********************************

6. spacer 4.8|1194920|33|NC_014974|PILER-CR matches to AB063393 (Thermus thermophilus phage IN93 DNA, complete genome) position: , mismatch: 0, identity: 1.0

gagcttgaacccatgcggatcaccgccgtggaa	CRISPR spacer
gagcttgaacccatgcggatcaccgccgtggaa	Protospacer
*********************************

7. spacer 4.34|1196513|33|NC_014974|PILER-CR matches to NC_010878 (Thermus sp. 4C plasmid pL4C, complete sequence) position: , mismatch: 0, identity: 1.0

ggcaggtggtggcggtgtcccaggttttccctc	CRISPR spacer
ggcaggtggtggcggtgtcccaggttttccctc	Protospacer
*********************************

8. spacer 4.49|1194860|32|NC_014974|CRISPRCasFinder,CRT matches to NC_004462 (Thermus thermophilus phage IN93, complete genome) position: , mismatch: 0, identity: 1.0

gtgaggtctagggcggcggcgggcatgagcac	CRISPR spacer
gtgaggtctagggcggcggcgggcatgagcac	Protospacer
********************************

9. spacer 4.49|1194860|32|NC_014974|CRISPRCasFinder,CRT matches to AB063393 (Thermus thermophilus phage IN93 DNA, complete genome) position: , mismatch: 0, identity: 1.0

gtgaggtctagggcggcggcgggcatgagcac	CRISPR spacer
gtgaggtctagggcggcggcgggcatgagcac	Protospacer
********************************

10. spacer 4.50|1194921|32|NC_014974|CRISPRCasFinder,CRT matches to NC_004462 (Thermus thermophilus phage IN93, complete genome) position: , mismatch: 0, identity: 1.0

agcttgaacccatgcggatcaccgccgtggaa	CRISPR spacer
agcttgaacccatgcggatcaccgccgtggaa	Protospacer
********************************

11. spacer 4.50|1194921|32|NC_014974|CRISPRCasFinder,CRT matches to AB063393 (Thermus thermophilus phage IN93 DNA, complete genome) position: , mismatch: 0, identity: 1.0

agcttgaacccatgcggatcaccgccgtggaa	CRISPR spacer
agcttgaacccatgcggatcaccgccgtggaa	Protospacer
********************************

12. spacer 4.76|1196514|32|NC_014974|CRISPRCasFinder,CRT matches to NC_010878 (Thermus sp. 4C plasmid pL4C, complete sequence) position: , mismatch: 0, identity: 1.0

gcaggtggtggcggtgtcccaggttttccctc	CRISPR spacer
gcaggtggtggcggtgtcccaggttttccctc	Protospacer
********************************

13. spacer 3.12|1182786|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.844

tcgtgggcgtccagaatccacccgtcgcccgt-	CRISPR spacer
ccgtgcgcgcccagaatccacccg-cgctcgta	Protospacer
.**** ***.************** ***.***

14. spacer 2.7|575409|31|NC_014974|CRISPRCasFinder matches to NC_015952 (Streptomyces violaceusniger Tu 4113 plasmid pSTRVI02, complete sequence) position: , mismatch: 6, identity: 0.806

ccctcgtcccgcagggcgtggatgcccgccc	CRISPR spacer
ccctcgtcgcgcagggcgttgatgaaccacc	Protospacer
******** ********** ****  *  **

15. spacer 3.6|1182419|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP022317 (Brachybacterium avium strain VR2415 plasmid unnamed1) position: , mismatch: 6, identity: 0.812

cgtgtccc---cgtgccgggcggcgtcggtcatga	CRISPR spacer
---atcccaggcgtgccggtcggcgtcggtcacga	Protospacer
   .****   ******** ************.**

16. spacer 3.17|1183093|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.812

tggacctccacggtgtagctgggcaccgtggc----	CRISPR spacer
tgggccaccacggtgtagctgggc----tggccgtc	Protospacer
***.** *****************    ****

17. spacer 3.22|1183399|33|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP049317 (Caballeronia sp. SBC2 plasmid pSBC2-1, complete sequence) position: , mismatch: 6, identity: 0.818

ggttgcgggccgcttcctcggcgatgcgggcgg	CRISPR spacer
gctgatgggccgctttctcggcgatgcgggagg	Protospacer
* * ..*********.************** **

18. spacer 3.22|1183399|33|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP049157 (Caballeronia sp. SBC1 plasmid pSBC1_1, complete sequence) position: , mismatch: 6, identity: 0.818

ggttgcgggccgcttcctcggcgatgcgggcgg	CRISPR spacer
gctgatgggccgctttctcggcgatgcgggagg	Protospacer
* * ..*********.************** **

19. spacer 3.22|1183399|33|NC_014974|CRISPRCasFinder,CRT matches to LN997843 (Streptomyces reticuli genome assembly TUE45, plasmid : II) position: , mismatch: 6, identity: 0.818

ggttgcgggccgcttcctcggcgatgcgggcgg	CRISPR spacer
aggggcgggccgcctcctcggcgaggcgggccg	Protospacer
.*  *********.********** ****** *

20. spacer 3.23|1183461|32|NC_014974|CRISPRCasFinder,CRT matches to NC_015727 (Cupriavidus necator N-1 plasmid pBB1, complete sequence) position: , mismatch: 6, identity: 0.812

caggacgtggccgagggtgtcccccacctgga-	CRISPR spacer
caggacgtggccgcaggtgtcccct-tgtggac	Protospacer
************* .*********. . ****

21. spacer 3.31|1183950|31|NC_014974|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP032346 (Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence) position: , mismatch: 6, identity: 0.806

gagcttccgccggcggagcctcc-cgtgatcc	CRISPR spacer
gagcatccggcggcggagcctccgcggggtg-	Protospacer
**** **** ************* ** *.*

22. spacer 3.52|1183093|33|NC_014974|PILER-CR matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.818

tggacctccacggtgtagctgggcaccgtggcc----	CRISPR spacer
tgggccaccacggtgtagctgggc----tggccgtcg	Protospacer
***.** *****************    *****

23. spacer 3.57|1183399|34|NC_014974|PILER-CR matches to NZ_CP049317 (Caballeronia sp. SBC2 plasmid pSBC2-1, complete sequence) position: , mismatch: 6, identity: 0.824

ggttgcgggccgcttcctcggcgatgcgggcggc	CRISPR spacer
gctgatgggccgctttctcggcgatgcgggaggc	Protospacer
* * ..*********.************** ***

24. spacer 3.57|1183399|34|NC_014974|PILER-CR matches to NZ_CP049157 (Caballeronia sp. SBC1 plasmid pSBC1_1, complete sequence) position: , mismatch: 6, identity: 0.824

ggttgcgggccgcttcctcggcgatgcgggcggc	CRISPR spacer
gctgatgggccgctttctcggcgatgcgggaggc	Protospacer
* * ..*********.************** ***

25. spacer 3.58|1183461|33|NC_014974|PILER-CR matches to NC_015727 (Cupriavidus necator N-1 plasmid pBB1, complete sequence) position: , mismatch: 6, identity: 0.818

caggacgtggccgagggtgtcccccacctggac-	CRISPR spacer
caggacgtggccgcaggtgtcccct-tgtggacg	Protospacer
************* .*********. . *****

26. spacer 4.37|1196697|33|NC_014974|PILER-CR matches to NC_002679 (Mesorhizobium japonicum MAFF 303099 plasmid pMLa, complete sequence) position: , mismatch: 6, identity: 0.818

gacgcccggcgggcggagcttctcgggaagaaa	CRISPR spacer
gaagcgcggcgggcggagcttctcgacacgcaa	Protospacer
** ** *******************. * * **

27. spacer 4.76|1196514|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP049359 (Deinococcus wulumuqiensis R12 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.812

gcaggtggtggcggtgtcccaggttttccctc	CRISPR spacer
accgttagtggcggtgccccaggtttttcctc	Protospacer
.* * *.*********.**********.****

28. spacer 2.2|575105|31|NC_014974|CRISPRCasFinder matches to NZ_CP042916 (Rhodococcus qingshengii strain RL1 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

tcaccgcggccaggacgatgacggtagtcat	CRISPR spacer
tcagcgcggccacgacgatgacggcgaggat	Protospacer
*** ******** ***********...  **

29. spacer 2.2|575105|31|NC_014974|CRISPRCasFinder matches to MN586022 (Gordonia phage Chidiebere, complete genome) position: , mismatch: 7, identity: 0.774

tcaccgcggccaggacgatgacggtagtcat	CRISPR spacer
tcaccgctgccaggacgatgactgaatccgg	Protospacer
******* ************** * * .*.

30. spacer 2.2|575105|31|NC_014974|CRISPRCasFinder matches to NZ_CP012916 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence) position: , mismatch: 7, identity: 0.774

tcaccgcggccaggacgatgacggtagtcat	CRISPR spacer
ccaccgcggccaggacgctgccggcgatcag	Protospacer
.**************** ** ***...***

31. spacer 2.2|575105|31|NC_014974|CRISPRCasFinder matches to NZ_CP022367 (Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence) position: , mismatch: 7, identity: 0.774

tcaccgcggccaggacgatgacggtagtcat	CRISPR spacer
ccaccgcggccaggacgctgccggcgatcag	Protospacer
.**************** ** ***...***

32. spacer 2.2|575105|31|NC_014974|CRISPRCasFinder matches to NZ_CP032341 (Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence) position: , mismatch: 7, identity: 0.774

tcaccgcggccaggacgatgacggtagtcat	CRISPR spacer
ccaccgcggccaggacgctgccggcgatcag	Protospacer
.**************** ** ***...***

33. spacer 2.2|575105|31|NC_014974|CRISPRCasFinder matches to NZ_CP033321 (Azospirillum brasilense strain Cd plasmid p3, complete sequence) position: , mismatch: 7, identity: 0.774

tcaccgcggccaggacgatgacggtagtcat	CRISPR spacer
ccaccgcggccaggacgctgccggcgatcag	Protospacer
.**************** ** ***...***

34. spacer 2.2|575105|31|NC_014974|CRISPRCasFinder matches to NZ_CP033315 (Azospirillum brasilense strain Sp 7 plasmid p3, complete sequence) position: , mismatch: 7, identity: 0.774

tcaccgcggccaggacgatgacggtagtcat	CRISPR spacer
ccaccgcggccaggacgctgccggcgatcag	Protospacer
.**************** ** ***...***

35. spacer 2.3|575166|31|NC_014974|CRISPRCasFinder matches to NZ_CP032322 (Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.774

cggcaccagccagcgccgtcccaagcgcacc	CRISPR spacer
cggcacctgccagcgccgtcccgccagcgcg	Protospacer
******* **************.   **.*

36. spacer 2.3|575166|31|NC_014974|CRISPRCasFinder matches to NZ_CP007794 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence) position: , mismatch: 7, identity: 0.774

cggcaccagccagcgccgtcccaagcgcacc	CRISPR spacer
cggcacctgccagcgccgtcccgccagcgcg	Protospacer
******* **************.   **.*

37. spacer 2.3|575166|31|NC_014974|CRISPRCasFinder matches to NZ_CP032340 (Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.774

cggcaccagccagcgccgtcccaagcgcacc	CRISPR spacer
cggcacctgccagcgccgtcccgccagcgcg	Protospacer
******* **************.   **.*

38. spacer 2.3|575166|31|NC_014974|CRISPRCasFinder matches to NZ_CP032346 (Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.774

cggcaccagccagcgccgtcccaagcgcacc	CRISPR spacer
cggcacctgccagcgccgtcccgccagcgcg	Protospacer
******* **************.   **.*

39. spacer 2.3|575166|31|NC_014974|CRISPRCasFinder matches to NZ_CP012915 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence) position: , mismatch: 7, identity: 0.774

cggcaccagccagcgccgtcccaagcgcacc	CRISPR spacer
cggcacctgccagcgccgtcccgccagcgcg	Protospacer
******* **************.   **.*

40. spacer 2.3|575166|31|NC_014974|CRISPRCasFinder matches to NZ_CP016452 (Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence) position: , mismatch: 7, identity: 0.774

cggcaccagccagcgccgtcccaagcgcacc	CRISPR spacer
cggcatcagccagcgccgtgccaccggtgcc	Protospacer
*****.************* ***   *..**

41. spacer 2.4|575227|30|NC_014974|CRISPRCasFinder matches to NZ_CP017589 (Pantoea stewartii subsp. stewartii DC283 plasmid pDSJ08, complete sequence) position: , mismatch: 7, identity: 0.767

gactcatgccatcaccccccagggcttgct	CRISPR spacer
ggcctcggccatcaccgcccagagcttgct	Protospacer
*.*..  ********* *****.*******

42. spacer 2.4|575227|30|NC_014974|CRISPRCasFinder matches to CP054911 (Pantoea ananatis strain FDAARGOS_680 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.767

gactcatgccatcaccccccagggcttgct	CRISPR spacer
ggcctcggccatcaccgcccagagcttgct	Protospacer
*.*..  ********* *****.*******

43. spacer 2.6|575348|31|NC_014974|CRISPRCasFinder matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 7, identity: 0.774

tttggcgttcctttcctccttccgggccgcg	CRISPR spacer
ccgagcgttgctttcctgcttccgggccgag	Protospacer
.. .***** ******* *********** *

44. spacer 2.7|575409|31|NC_014974|CRISPRCasFinder matches to NZ_CP012944 (Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.774

ccctcgtcccgcagggcgtggatgcccgccc	CRISPR spacer
cgcgcgtcccgcagcgcgcggatgccccagc	Protospacer
* * ********** ***.********   *

45. spacer 2.7|575409|31|NC_014974|CRISPRCasFinder matches to NZ_CP021653 (Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.774

ccctcgtcccgcagggcgtggatgcccgccc	CRISPR spacer
cgcgcgtcccgcagcgcgcggatgccccagc	Protospacer
* * ********** ***.********   *

46. spacer 2.7|575409|31|NC_014974|CRISPRCasFinder matches to NZ_CP012688 (Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.774

ccctcgtcccgcagggcgtggatgcccgccc	CRISPR spacer
cgcgcgtcccgcagcgcgcggatgccccagc	Protospacer
* * ********** ***.********   *

47. spacer 2.7|575409|31|NC_014974|CRISPRCasFinder matches to CP047139 (Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.774

ccctcgtcccgcagggcgtggatgcccgccc	CRISPR spacer
cgcgcgtcccgcagcgcgcggatgccccagc	Protospacer
* * ********** ***.********   *

48. spacer 2.7|575409|31|NC_014974|CRISPRCasFinder matches to CP047137 (Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.774

ccctcgtcccgcagggcgtggatgcccgccc	CRISPR spacer
cgcgcgtcccgcagcgcgcggatgccccagc	Protospacer
* * ********** ***.********   *

49. spacer 2.7|575409|31|NC_014974|CRISPRCasFinder matches to NZ_CP026518 (Deinococcus sp. NW-56 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.774

ccctcgtcccgcagggcgtggatgcccgccc	CRISPR spacer
gcgccgtcccgcagggcctggaggcccatcc	Protospacer
 * .************* **** ****..**

50. spacer 2.16|575409|32|NC_014974|PILER-CR,CRT matches to NC_015952 (Streptomyces violaceusniger Tu 4113 plasmid pSTRVI02, complete sequence) position: , mismatch: 7, identity: 0.781

ccctcgtcccgcagggcgtggatgcccgccca	CRISPR spacer
ccctcgtcgcgcagggcgttgatgaaccacct	Protospacer
******** ********** ****  *  **

51. spacer 3.5|1182358|32|NC_014974|CRISPRCasFinder,CRT matches to MH271302 (Gordonia phage Margaret, complete genome) position: , mismatch: 7, identity: 0.781

atccggttgaacgcctcctgcatctttgcctc---	CRISPR spacer
gtctgcttgaacgcctcctgcatc---gcgtcgat	Protospacer
.**.* ******************   ** **

52. spacer 3.6|1182419|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP020371 (Candidatus Thiodictyon syntrophicum strain Cad16T plasmid pTs417, complete sequence) position: , mismatch: 7, identity: 0.781

cgtgtcc---ccgtgccgggcggcgtcggtcatga	CRISPR spacer
---ttccgggctgtgtctggcggcgtcggtcatga	Protospacer
    ***   *.***.* *****************

53. spacer 3.17|1183093|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP032322 (Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.781

tggacctccacggtgtagctgggcaccgtggc	CRISPR spacer
aggccggcaacggtggagctgggcacagtggc	Protospacer
 ** *  * ****** ********** *****

54. spacer 3.22|1183399|33|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP032323 (Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence) position: , mismatch: 7, identity: 0.788

----ggttgcgggccgcttcctcggcgatgcgggcgg	CRISPR spacer
ccagggt----ggcggcttcctcggcgatgcggacgc	Protospacer
    ***    *** ******************.**

55. spacer 3.22|1183399|33|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP007795 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence) position: , mismatch: 7, identity: 0.788

----ggttgcgggccgcttcctcggcgatgcgggcgg	CRISPR spacer
ccagggt----ggcggcttcctcggcgatgcggacgc	Protospacer
    ***    *** ******************.**

56. spacer 3.22|1183399|33|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 7, identity: 0.788

ggttgcgggccgcttcctcggcgatgcgggcgg	CRISPR spacer
tgaagcgggccgcgacctcggcgatgcggcccg	Protospacer
 *  *********  ************** * *

57. spacer 3.41|1182419|33|NC_014974|PILER-CR matches to NZ_CP022317 (Brachybacterium avium strain VR2415 plasmid unnamed1) position: , mismatch: 7, identity: 0.788

cgtgtccc---cgtgccgggcggcgtcggtcatgac	CRISPR spacer
---atcccaggcgtgccggtcggcgtcggtcacgaa	Protospacer
   .****   ******** ************.**

58. spacer 3.52|1183093|33|NC_014974|PILER-CR matches to NZ_CP032322 (Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.788

tggacctccacggtgtagctgggcaccgtggcc	CRISPR spacer
aggccggcaacggtggagctgggcacagtggcc	Protospacer
 ** *  * ****** ********** ******

59. spacer 3.57|1183399|34|NC_014974|PILER-CR matches to NZ_CP032323 (Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence) position: , mismatch: 7, identity: 0.794

----ggttgcgggccgcttcctcggcgatgcgggcggc	CRISPR spacer
ccagggt----ggcggcttcctcggcgatgcggacgcc	Protospacer
    ***    *** ******************.** *

60. spacer 3.57|1183399|34|NC_014974|PILER-CR matches to NZ_CP007795 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence) position: , mismatch: 7, identity: 0.794

----ggttgcgggccgcttcctcggcgatgcgggcggc	CRISPR spacer
ccagggt----ggcggcttcctcggcgatgcggacgcc	Protospacer
    ***    *** ******************.** *

61. spacer 4.16|1195412|33|NC_014974|PILER-CR matches to NZ_CP035092 (Paracoccus denitrificans strain ATCC 19367 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.788

gtggtgacggcggtgacgctggtgtccggggga	CRISPR spacer
ggcgcgacggcggtgacgccggtgtcctgggtc	Protospacer
*  *.**************.******* ***

62. spacer 4.16|1195412|33|NC_014974|PILER-CR matches to NC_008688 (Paracoccus denitrificans PD1222 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.788

gtggtgacggcggtgacgctggtgtccggggga	CRISPR spacer
ggcgcgacggcggtgacgccggtgtcctgggtc	Protospacer
*  *.**************.******* ***

63. spacer 4.34|1196513|33|NC_014974|PILER-CR matches to NZ_CP049359 (Deinococcus wulumuqiensis R12 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.788

ggcaggtggtggcggtgtcccaggttttccctc	CRISPR spacer
aaccgttagtggcggtgccccaggtttttcctc	Protospacer
..* * *.*********.**********.****

64. spacer 4.49|1194860|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_LR134463 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 21, complete sequence) position: , mismatch: 7, identity: 0.781

gtgaggtctagggcggcggcgggcatgagcac	CRISPR spacer
gcgcggtcgaggtcggcggcgggcatgcggat	Protospacer
*.* **** *** ************** * *.

65. spacer 4.54|1195168|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP020040 (Streptomyces sp. 3211 isolate 3 plasmid p3211-1, complete sequence) position: , mismatch: 7, identity: 0.781

gccgc-cttcctccagcgaccggatcgcccgcc	CRISPR spacer
-ccgcaacgcctccaccgaccggatcccccgcg	Protospacer
 ****  . ****** ********** *****

66. spacer 4.54|1195168|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP050953 (Rhodococcus sp. DMU1 plasmid unnamed) position: , mismatch: 7, identity: 0.781

----gccgccttcctccagcgaccggatcgcccgcc	CRISPR spacer
caccggcgactacc----gcgaccggatcgcccgcc	Protospacer
    * ** ** **    ******************

67. spacer 4.54|1195168|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP042998 (Aquisphaera giovannonii strain OJF2 plasmid pOJF2_1, complete sequence) position: , mismatch: 7, identity: 0.781

gccgccttcctccagcgaccggatcgcccgcc	CRISPR spacer
tccacgctcctccggcggccggatcgcccggc	Protospacer
 **.* .******.***.************ *

68. spacer 4.58|1195413|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP035092 (Paracoccus denitrificans strain ATCC 19367 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

tggtgacggcggtgacgctggtgtccggggga	CRISPR spacer
gcgcgacggcggtgacgccggtgtcctgggtc	Protospacer
  *.**************.******* ***

69. spacer 4.58|1195413|32|NC_014974|CRISPRCasFinder,CRT matches to NC_008688 (Paracoccus denitrificans PD1222 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.781

tggtgacggcggtgacgctggtgtccggggga	CRISPR spacer
gcgcgacggcggtgacgccggtgtcctgggtc	Protospacer
  *.**************.******* ***

70. spacer 4.58|1195413|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP022195 (Yangia pacifica strain YSBP01 plasmid unnamed5, complete sequence) position: , mismatch: 7, identity: 0.781

tggtgacggcggtgacgctggtg----tccggggga	CRISPR spacer
tggcggcggcggtgacgctggtgaggctgcgg----	Protospacer
***.*.*****************    * ***

71. spacer 4.64|1195778|32|NC_014974|CRISPRCasFinder,CRT matches to NC_047749 (Enterobacteria phage DT571/2, complete genome) position: , mismatch: 7, identity: 0.781

agccaaccgccagtgcaagccccatcgccatc	CRISPR spacer
atccaaccgccagtgtaagcaccattgacttt	Protospacer
* *************.**** ****.* * *.

72. spacer 4.64|1195778|32|NC_014974|CRISPRCasFinder,CRT matches to KM979354 (Enterobacteria phage DT57C, complete genome) position: , mismatch: 7, identity: 0.781

agccaaccgccagtgcaagccccatcgccatc	CRISPR spacer
atccaaccgccagtgtaagcaccattgacttt	Protospacer
* *************.**** ****.* * *.

73. spacer 4.64|1195778|32|NC_014974|CRISPRCasFinder,CRT matches to NC_047979 (Escherichia phage Gostya9, complete genome) position: , mismatch: 7, identity: 0.781

agccaaccgccagtgcaagccccatcgccatc	CRISPR spacer
atccaaccgccagtgtaagcaccattgacttt	Protospacer
* *************.**** ****.* * *.

74. spacer 4.69|1196084|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP054606 (Sulfitobacter pseudonitzschiae strain H46 plasmid unnamed7, complete sequence) position: , mismatch: 7, identity: 0.781

taccgccccccacggcgctggcaaggcgctcc	CRISPR spacer
tctcgcccgccacggcgctggcaagggtcggc	Protospacer
* .***** *****************  *  *

75. spacer 2.2|575105|31|NC_014974|CRISPRCasFinder matches to NZ_CP011665 (Streptomyces sp. Mg1 plasmid pSMg1-1, complete sequence) position: , mismatch: 8, identity: 0.742

tcaccgcggccaggacgatgacggtagtcat	CRISPR spacer
tcaccgcgcccaagacgatgacgggccggct	Protospacer
******** ***.***********      *

76. spacer 2.2|575105|31|NC_014974|CRISPRCasFinder matches to MK279853 (Gordonia phage Gray, complete genome) position: , mismatch: 8, identity: 0.742

tcaccgcggccaggacgatgacggtagtcat	CRISPR spacer
tcaccgctgccaggacgatgactgaatctgg	Protospacer
******* ************** * * ...

77. spacer 2.2|575105|31|NC_014974|CRISPRCasFinder matches to NZ_CP007130 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 2, complete sequence) position: , mismatch: 8, identity: 0.742

tcaccgcggccaggacgatgacggtagtcat	CRISPR spacer
cgaccgtggccaggacgatggcggtgcgcac	Protospacer
. ****.*************.****.  **.

78. spacer 2.2|575105|31|NC_014974|CRISPRCasFinder matches to NC_016586 (Azospirillum lipoferum 4B plasmid AZO_p2, complete sequence) position: , mismatch: 8, identity: 0.742

tcaccgcggccaggacgatgacggtagtcat	CRISPR spacer
gcaccgcgaccaggaagatgacggagatcgc	Protospacer
 *******.****** ******** ..**..

79. spacer 2.2|575105|31|NC_014974|CRISPRCasFinder matches to NZ_CP029832 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

tcaccgcggccaggacgatgacggtagtcat	CRISPR spacer
gcaccgcgaccaggaagatgacggagatcgc	Protospacer
 *******.****** ******** ..**..

80. spacer 2.3|575166|31|NC_014974|CRISPRCasFinder matches to LC549807 (Klebsiella pneumoniae VNCKp115 plasmid pVNCKp115 DNA, complete sequence) position: , mismatch: 8, identity: 0.742

cggcaccagccagcgccgtcccaagcgcacc	CRISPR spacer
tcagaccagccagcgccatcccaagcactgc	Protospacer
. . *************.********.*  *

81. spacer 2.3|575166|31|NC_014974|CRISPRCasFinder matches to NZ_CP031818 (Klebsiella pneumoniae strain INF235-sc-2280127 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

cggcaccagccagcgccgtcccaagcgcacc	CRISPR spacer
tcagaccagccagcgccatcccaagcactgc	Protospacer
. . *************.********.*  *

82. spacer 2.3|575166|31|NC_014974|CRISPRCasFinder matches to NZ_CP042482 (Klebsiella pneumoniae strain C51 plasmid pC51_001, complete sequence) position: , mismatch: 8, identity: 0.742

cggcaccagccagcgccgtcccaagcgcacc	CRISPR spacer
tcagaccagccagcgccatcccaagcactgc	Protospacer
. . *************.********.*  *

83. spacer 2.3|575166|31|NC_014974|CRISPRCasFinder matches to AP021850 (Deinococcus grandis ATCC 43672 plasmid: pDEGR-1 DNA, complete genome) position: , mismatch: 8, identity: 0.742

cggcaccagccagcgccgtcccaagcgcacc	CRISPR spacer
gcacgaaagccagcgccgtccccagcgcgcc	Protospacer
  .*.  *************** *****.**

84. spacer 2.3|575166|31|NC_014974|CRISPRCasFinder matches to NZ_AP019689 (Klebsiella quasipneumoniae strain SNI47 plasmid pTMSNI47-2, complete sequence) position: , mismatch: 8, identity: 0.742

cggcaccagccagcgccgtcccaagcgcacc	CRISPR spacer
tcagaccagccagcgccatcccaagcactgc	Protospacer
. . *************.********.*  *

85. spacer 2.3|575166|31|NC_014974|CRISPRCasFinder matches to NZ_CP031809 (Klebsiella pneumoniae strain INF206-sc-2280074 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.742

cggcaccagccagcgccgtcccaagcgcacc	CRISPR spacer
tcagaccagccagcgccatcccaagcactgc	Protospacer
. . *************.********.*  *

86. spacer 2.3|575166|31|NC_014974|CRISPRCasFinder matches to NZ_CP014763 (Klebsiella pneumoniae strain KPNIH39 plasmid pKPN-332, complete sequence) position: , mismatch: 8, identity: 0.742

cggcaccagccagcgccgtcccaagcgcacc	CRISPR spacer
tcagaccagccagcgccatcccaagcactgc	Protospacer
. . *************.********.*  *

87. spacer 2.3|575166|31|NC_014974|CRISPRCasFinder matches to NZ_CP014778 (Pluralibacter gergoviae strain FB2 plasmid pFB2.3, complete sequence) position: , mismatch: 8, identity: 0.742

cggcaccagccagcgccgtcccaagcgcacc	CRISPR spacer
tcagaccagccagcgccatcccaagcactgc	Protospacer
. . *************.********.*  *

88. spacer 2.5|575287|31|NC_014974|CRISPRCasFinder matches to NC_022534 (Plautia stali symbiont plasmid pPstS2 DNA, complete genome) position: , mismatch: 8, identity: 0.742

gcattcccggcattcccgggccgggacctcc	CRISPR spacer
gcgttcccggcattcccggggcggatttcac	Protospacer
**.***************** ***. ... *

89. spacer 2.7|575409|31|NC_014974|CRISPRCasFinder matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 8, identity: 0.742

ccctcgtcccgcagggcgtggatgcccgccc	CRISPR spacer
acctcttcccgcagggcgtcgatgcgccggg	Protospacer
 **** ************* ***** *

90. spacer 2.7|575409|31|NC_014974|CRISPRCasFinder matches to NZ_CP014142 (Thermus parvatiensis strain RL plasmid pTP143, complete sequence) position: , mismatch: 8, identity: 0.742

ccctcgtcccgcagggcgtggatgcccgccc	CRISPR spacer
acctcttcccgcagggcgtcgatgcgccggg	Protospacer
 **** ************* ***** *

91. spacer 2.7|575409|31|NC_014974|CRISPRCasFinder matches to NC_005838 (Thermus thermophilus HB27 plasmid pTT27, complete sequence) position: , mismatch: 8, identity: 0.742

ccctcgtcccgcagggcgtggatgcccgccc	CRISPR spacer
acctcttcccgcagggcgtcgatgcgccggg	Protospacer
 **** ************* ***** *

92. spacer 2.7|575409|31|NC_014974|CRISPRCasFinder matches to NC_017588 (Thermus thermophilus JL-18 plasmid pTTJL1801, complete sequence) position: , mismatch: 8, identity: 0.742

ccctcgtcccgcagggcgtggatgcccgccc	CRISPR spacer
acctcttcccgcagggcgtcgatgcgccggg	Protospacer
 **** ************* ***** *

93. spacer 2.7|575409|31|NC_014974|CRISPRCasFinder matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 8, identity: 0.742

ccctcgtcccgcagggcgtggatgcccgccc	CRISPR spacer
gcgtcgtcccgcagggcgtggctgaccagga	Protospacer
 * ****************** ** **.

94. spacer 2.7|575409|31|NC_014974|CRISPRCasFinder matches to NZ_LR027520 (Thermus thermophilus isolate TTHNAR1 plasmid 4, complete sequence) position: , mismatch: 8, identity: 0.742

ccctcgtcccgcagggcgtggatgcccgccc	CRISPR spacer
acctcttcccgcagggcgtcgatgcgccggg	Protospacer
 **** ************* ***** *

95. spacer 2.7|575409|31|NC_014974|CRISPRCasFinder matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 8, identity: 0.742

ccctcgtcccgcagggcgtggatgcccgccc	CRISPR spacer
gcgtcgtcccgcagggcgtggctgaccagga	Protospacer
 * ****************** ** **.

96. spacer 2.7|575409|31|NC_014974|CRISPRCasFinder matches to NZ_AP019795 (Thermus thermophilus strain AA2-29 plasmid pAA229, complete sequence) position: , mismatch: 8, identity: 0.742

ccctcgtcccgcagggcgtggatgcccgccc	CRISPR spacer
acctcttcccgcagggcgtcgatgcgccggg	Protospacer
 **** ************* ***** *

97. spacer 2.7|575409|31|NC_014974|CRISPRCasFinder matches to NZ_AP019793 (Thermus thermophilus strain AA2-20 plasmid pAA220, complete sequence) position: , mismatch: 8, identity: 0.742

ccctcgtcccgcagggcgtggatgcccgccc	CRISPR spacer
acctcttcccgcagggcgtcgatgcgccggg	Protospacer
 **** ************* ***** *

98. spacer 2.11|575105|32|NC_014974|PILER-CR,CRT matches to NZ_CP042916 (Rhodococcus qingshengii strain RL1 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

tcaccgcggccaggacgatgacggtagtcata	CRISPR spacer
tcagcgcggccacgacgatgacggcgaggatc	Protospacer
*** ******** ***********...  **

99. spacer 2.11|575105|32|NC_014974|PILER-CR,CRT matches to NZ_CP022367 (Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence) position: , mismatch: 8, identity: 0.75

tcaccgcggccaggacgatgacggtagtcata	CRISPR spacer
ccaccgcggccaggacgctgccggcgatcagg	Protospacer
.**************** ** ***...*** .

100. spacer 2.11|575105|32|NC_014974|PILER-CR,CRT matches to NZ_CP032341 (Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence) position: , mismatch: 8, identity: 0.75

tcaccgcggccaggacgatgacggtagtcata	CRISPR spacer
ccaccgcggccaggacgctgccggcgatcagg	Protospacer
.**************** ** ***...*** .

101. spacer 2.11|575105|32|NC_014974|PILER-CR,CRT matches to NZ_CP033321 (Azospirillum brasilense strain Cd plasmid p3, complete sequence) position: , mismatch: 8, identity: 0.75

tcaccgcggccaggacgatgacggtagtcata	CRISPR spacer
ccaccgcggccaggacgctgccggcgatcagg	Protospacer
.**************** ** ***...*** .

102. spacer 2.11|575105|32|NC_014974|PILER-CR,CRT matches to NZ_CP033315 (Azospirillum brasilense strain Sp 7 plasmid p3, complete sequence) position: , mismatch: 8, identity: 0.75

tcaccgcggccaggacgatgacggtagtcata	CRISPR spacer
ccaccgcggccaggacgctgccggcgatcagg	Protospacer
.**************** ** ***...*** .

103. spacer 2.11|575105|32|NC_014974|PILER-CR,CRT matches to NZ_CP012916 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence) position: , mismatch: 8, identity: 0.75

tcaccgcggccaggacgatgacggtagtcata	CRISPR spacer
ccaccgcggccaggacgctgccggcgatcagg	Protospacer
.**************** ** ***...*** .

104. spacer 2.12|575166|32|NC_014974|PILER-CR,CRT matches to AP021850 (Deinococcus grandis ATCC 43672 plasmid: pDEGR-1 DNA, complete genome) position: , mismatch: 8, identity: 0.75

cggcaccagccagcgccgtcccaagcgcaccc	CRISPR spacer
gcacgaaagccagcgccgtccccagcgcgccc	Protospacer
  .*.  *************** *****.***

105. spacer 2.12|575166|32|NC_014974|PILER-CR,CRT matches to NZ_CP016452 (Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence) position: , mismatch: 8, identity: 0.75

cggcaccagccagcgccgtcccaagcgcaccc	CRISPR spacer
cggcatcagccagcgccgtgccaccggtgccg	Protospacer
*****.************* ***   *..**

106. spacer 2.13|575227|31|NC_014974|PILER-CR,CRT matches to NZ_CP017589 (Pantoea stewartii subsp. stewartii DC283 plasmid pDSJ08, complete sequence) position: , mismatch: 8, identity: 0.742

gactcatgccatcaccccccagggcttgcta	CRISPR spacer
ggcctcggccatcaccgcccagagcttgctg	Protospacer
*.*..  ********* *****.*******.

107. spacer 2.13|575227|31|NC_014974|PILER-CR,CRT matches to CP054911 (Pantoea ananatis strain FDAARGOS_680 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.742

gactcatgccatcaccccccagggcttgcta	CRISPR spacer
ggcctcggccatcaccgcccagagcttgctg	Protospacer
*.*..  ********* *****.*******.

108. spacer 2.15|575348|32|NC_014974|PILER-CR,CRT matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 8, identity: 0.75

tttggcgttcctttcctccttccgggccgcga	CRISPR spacer
ccgagcgttgctttcctgcttccgggccgagg	Protospacer
.. .***** ******* *********** *.

109. spacer 2.16|575409|32|NC_014974|PILER-CR,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 8, identity: 0.75

ccctcgtcccgcagggcgtggatgcccgccca	CRISPR spacer
acctcttcccgcagggcgtcgatgcgccggga	Protospacer
 **** ************* ***** *    *

110. spacer 2.16|575409|32|NC_014974|PILER-CR,CRT matches to NZ_CP014142 (Thermus parvatiensis strain RL plasmid pTP143, complete sequence) position: , mismatch: 8, identity: 0.75

ccctcgtcccgcagggcgtggatgcccgccca	CRISPR spacer
acctcttcccgcagggcgtcgatgcgccggga	Protospacer
 **** ************* ***** *    *

111. spacer 2.16|575409|32|NC_014974|PILER-CR,CRT matches to NC_005838 (Thermus thermophilus HB27 plasmid pTT27, complete sequence) position: , mismatch: 8, identity: 0.75

ccctcgtcccgcagggcgtggatgcccgccca	CRISPR spacer
acctcttcccgcagggcgtcgatgcgccggga	Protospacer
 **** ************* ***** *    *

112. spacer 2.16|575409|32|NC_014974|PILER-CR,CRT matches to NC_017588 (Thermus thermophilus JL-18 plasmid pTTJL1801, complete sequence) position: , mismatch: 8, identity: 0.75

ccctcgtcccgcagggcgtggatgcccgccca	CRISPR spacer
acctcttcccgcagggcgtcgatgcgccggga	Protospacer
 **** ************* ***** *    *

113. spacer 2.16|575409|32|NC_014974|PILER-CR,CRT matches to NZ_AP019795 (Thermus thermophilus strain AA2-29 plasmid pAA229, complete sequence) position: , mismatch: 8, identity: 0.75

ccctcgtcccgcagggcgtggatgcccgccca	CRISPR spacer
acctcttcccgcagggcgtcgatgcgccggga	Protospacer
 **** ************* ***** *    *

114. spacer 2.16|575409|32|NC_014974|PILER-CR,CRT matches to NZ_LR027520 (Thermus thermophilus isolate TTHNAR1 plasmid 4, complete sequence) position: , mismatch: 8, identity: 0.75

ccctcgtcccgcagggcgtggatgcccgccca	CRISPR spacer
acctcttcccgcagggcgtcgatgcgccggga	Protospacer
 **** ************* ***** *    *

115. spacer 2.16|575409|32|NC_014974|PILER-CR,CRT matches to NZ_AP019793 (Thermus thermophilus strain AA2-20 plasmid pAA220, complete sequence) position: , mismatch: 8, identity: 0.75

ccctcgtcccgcagggcgtggatgcccgccca	CRISPR spacer
acctcttcccgcagggcgtcgatgcgccggga	Protospacer
 **** ************* ***** *    *

116. spacer 2.16|575409|32|NC_014974|PILER-CR,CRT matches to NZ_CP021653 (Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

ccctcgtcccgcagggcgtggatgcccgccca	CRISPR spacer
cgcgcgtcccgcagcgcgcggatgccccagcc	Protospacer
* * ********** ***.********   *

117. spacer 2.16|575409|32|NC_014974|PILER-CR,CRT matches to NZ_CP012944 (Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

ccctcgtcccgcagggcgtggatgcccgccca	CRISPR spacer
cgcgcgtcccgcagcgcgcggatgccccagcc	Protospacer
* * ********** ***.********   *

118. spacer 2.16|575409|32|NC_014974|PILER-CR,CRT matches to NZ_CP012688 (Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

ccctcgtcccgcagggcgtggatgcccgccca	CRISPR spacer
cgcgcgtcccgcagcgcgcggatgccccagcc	Protospacer
* * ********** ***.********   *

119. spacer 2.16|575409|32|NC_014974|PILER-CR,CRT matches to CP047139 (Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

ccctcgtcccgcagggcgtggatgcccgccca	CRISPR spacer
cgcgcgtcccgcagcgcgcggatgccccagcc	Protospacer
* * ********** ***.********   *

120. spacer 2.16|575409|32|NC_014974|PILER-CR,CRT matches to CP047137 (Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

ccctcgtcccgcagggcgtggatgcccgccca	CRISPR spacer
cgcgcgtcccgcagcgcgcggatgccccagcc	Protospacer
* * ********** ***.********   *

121. spacer 2.16|575409|32|NC_014974|PILER-CR,CRT matches to NZ_CP026518 (Deinococcus sp. NW-56 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

ccctcgtcccgcagggcgtggatgcccgccca	CRISPR spacer
gcgccgtcccgcagggcctggaggcccatccg	Protospacer
 * .************* **** ****..**.

122. spacer 3.5|1182358|32|NC_014974|CRISPRCasFinder,CRT matches to KY053532 (Siphovirus 29632, complete genome) position: , mismatch: 8, identity: 0.75

atccggttgaacgcctcctgcatctttgcctc	CRISPR spacer
gtccgcttgagcgcctcctgcatctgctcgcc	Protospacer
.**** ****.************** . * .*

123. spacer 3.6|1182419|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP023549 (Rhodobacter sp. CZR27 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

cgtgtccccgtgccgggcggcgtcggtcatga	CRISPR spacer
gatgatctcgcgccgggcggcgtcggacatgg	Protospacer
 .** .*.**.*************** ****.

124. spacer 3.22|1183399|33|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP026518 (Deinococcus sp. NW-56 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.758

ggttgcgggccgcttcctcggcgatgcgggcgg	CRISPR spacer
ccatccccgccgcttcctcggcgctgcgggcgc	Protospacer
   * *  *************** ********

125. spacer 3.22|1183399|33|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP015739 (Shinella sp. HZN7 plasmid pShin-03, complete sequence) position: , mismatch: 8, identity: 0.758

ggttgcgggccgcttcctcggcgatgcgggcgg	CRISPR spacer
agttgctggccgcatcctcggcgatgatcgtgt	Protospacer
.***** ****** ************   *.*

126. spacer 3.22|1183399|33|NC_014974|CRISPRCasFinder,CRT matches to NC_016587 (Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence) position: , mismatch: 8, identity: 0.758

ggttgcgggccgcttcctcggcgatgcgggcgg	CRISPR spacer
tgtgggacaccgcctccccggcgatgcgggcgg	Protospacer
 ** * . .****.***.***************

127. spacer 3.22|1183399|33|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP032324 (Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence) position: , mismatch: 8, identity: 0.758

ggttgcgggccgcttcctcggcgatgcgggcgg	CRISPR spacer
cgtcggccaccgccgcctcggcgatgcgggcgg	Protospacer
 **.*   .****. ******************

128. spacer 3.22|1183399|33|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP007797 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p4, complete sequence) position: , mismatch: 8, identity: 0.758

ggttgcgggccgcttcctcggcgatgcgggcgg	CRISPR spacer
cgtcggccaccgccgcctcggcgatgcgggcgg	Protospacer
 **.*   .****. ******************

129. spacer 3.22|1183399|33|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP029833 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.758

ggttgcgggccgcttcctcggcgatgcgggcgg	CRISPR spacer
cgtgggacaccgcctccccggcgatgcgggcgg	Protospacer
 ** * . .****.***.***************

130. spacer 3.22|1183399|33|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP032349 (Azospirillum brasilense strain MTCC4039 plasmid p3, complete sequence) position: , mismatch: 8, identity: 0.758

ggttgcgggccgcttcctcggcgatgcgggcgg	CRISPR spacer
cgtcggccaccgccgcctcggcgatgcgggcgg	Protospacer
 **.*   .****. ******************

131. spacer 3.23|1183461|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_KJ940992 (Pseudomonas sp. ZM1 plasmid pZM1P1, complete sequence) position: , mismatch: 8, identity: 0.75

caggacgtggccgagggtgtcccccacctgga	CRISPR spacer
cagggcgtggccgagggtgtcacccgcgaacg	Protospacer
****.**************** ***.*  . .

132. spacer 3.29|1183829|32|NC_014974|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP021082 (Deinococcus ficus strain CC-FR2-10 plasmid pDFI1, complete sequence) position: , mismatch: 8, identity: 0.75

gtagcccggggatggtcaggggttatccccgt	CRISPR spacer
gtaccccggggatggtcaggcgtcctgcctcg	Protospacer
*** **************** **. * **.

133. spacer 3.32|1184010|32|NC_014974|CRISPRCasFinder,CRT,PILER-CR matches to LN997843 (Streptomyces reticuli genome assembly TUE45, plasmid : II) position: , mismatch: 8, identity: 0.75

gggctcgggccgagctggggcggcggtttccg	CRISPR spacer
cggcccgggccgggctggggcggctcctgcct	Protospacer
 ***.*******.***********  .* **

134. spacer 3.57|1183399|34|NC_014974|PILER-CR matches to NZ_CP026518 (Deinococcus sp. NW-56 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.765

ggttgcgggccgcttcctcggcgatgcgggcggc	CRISPR spacer
ccatccccgccgcttcctcggcgctgcgggcgcc	Protospacer
   * *  *************** ******** *

135. spacer 3.57|1183399|34|NC_014974|PILER-CR matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 8, identity: 0.765

ggttgcgggccgcttcctcggcgatgcgggcggc	CRISPR spacer
tgaagcgggccgcgacctcggcgatgcggcccga	Protospacer
 *  *********  ************** * *

136. spacer 3.58|1183461|33|NC_014974|PILER-CR matches to NZ_KJ940992 (Pseudomonas sp. ZM1 plasmid pZM1P1, complete sequence) position: , mismatch: 8, identity: 0.758

caggacgtggccgagggtgtcccccacctggac	CRISPR spacer
cagggcgtggccgagggtgtcacccgcgaacgc	Protospacer
****.**************** ***.*  . .*

137. spacer 4.16|1195412|33|NC_014974|PILER-CR matches to NZ_CP049158 (Caballeronia sp. SBC1 plasmid pSBC1_2, complete sequence) position: , mismatch: 8, identity: 0.758

gtggtgacggcggtgacgctggtgtccggggga	CRISPR spacer
gtggtgacggcggtgacgctcgtgattggcttt	Protospacer
******************** *** ..**

138. spacer 4.16|1195412|33|NC_014974|PILER-CR matches to NZ_CP049318 (Caballeronia sp. SBC2 plasmid pSBC2-2, complete sequence) position: , mismatch: 8, identity: 0.758

gtggtgacggcggtgacgctggtgtccggggga	CRISPR spacer
gtggtgacggcggtgacgctcgtgattggcttt	Protospacer
******************** *** ..**

139. spacer 4.16|1195412|33|NC_014974|PILER-CR matches to NC_017385 (Ketogulonicigenium vulgare WSH-001 plasmid 2, complete sequence) position: , mismatch: 8, identity: 0.758

gtggtgacggcggtgacgctggtgtccggggga	CRISPR spacer
ggcgcaacggcggtgacgccggtgtcctgggtc	Protospacer
*  *..*************.******* ***

140. spacer 4.16|1195412|33|NC_014974|PILER-CR matches to NZ_CP012910 (Ketogulonicigenium vulgare strain Hbe602 plasmid 2, complete sequence) position: , mismatch: 8, identity: 0.758

gtggtgacggcggtgacgctggtgtccggggga	CRISPR spacer
ggcgcaacggcggtgacgccggtgtcctgggtc	Protospacer
*  *..*************.******* ***

141. spacer 4.16|1195412|33|NC_014974|PILER-CR matches to NC_014626 (Ketogulonicigenium vulgare Y25 plasmid pYP12, complete sequence) position: , mismatch: 8, identity: 0.758

gtggtgacggcggtgacgctggtgtccggggga	CRISPR spacer
ggcgcaacggcggtgacgccggtgtcctgggtc	Protospacer
*  *..*************.******* ***

142. spacer 4.16|1195412|33|NC_014974|PILER-CR matches to NZ_LR594669 (Variovorax sp. SRS16 plasmid 4) position: , mismatch: 8, identity: 0.758

gtggtgacggcggtgacgctggtgtccggggga	CRISPR spacer
gtctcgacggcggtgacgctggtgctcggctgc	Protospacer
**  .*******************..***  *

143. spacer 4.16|1195412|33|NC_014974|PILER-CR matches to NZ_CP034470 (Pantoea agglomerans strain CFSAN047153 plasmid pCFSAN047153_1, complete sequence) position: , mismatch: 8, identity: 0.758

gtggtgacggcggtgacgctggtgtccggggga	CRISPR spacer
gtggtgacggcggtggcgatggtggtggtgcgt	Protospacer
***************.** ***** . * * *

144. spacer 4.16|1195412|33|NC_014974|PILER-CR matches to NZ_CP034475 (Pantoea agglomerans strain CFSAN047154 plasmid pCFSAN047154_1, complete sequence) position: , mismatch: 8, identity: 0.758

gtggtgacggcggtgacgctggtgtccggggga	CRISPR spacer
gtggtgacggcggtggcgatggtggtggtgcgt	Protospacer
***************.** ***** . * * *

145. spacer 4.16|1195412|33|NC_014974|PILER-CR matches to NZ_LR594673 (Variovorax sp. PBL-E5 plasmid 3) position: , mismatch: 8, identity: 0.758

gtggtgacggcggtgacgctggtgtccggggga	CRISPR spacer
gtctcgacggcggtgacgctggtgctcggctgc	Protospacer
**  .*******************..***  *

146. spacer 4.36|1196636|33|NC_014974|PILER-CR matches to KJ000058 (Salmonella phage STP4-a, complete genome) position: , mismatch: 8, identity: 0.758

gccccatctcccgtccgatatccacagcaatgg	CRISPR spacer
gcttattatcccgtccgatacccagagcaatgc	Protospacer
**..  * ************.*** *******

147. spacer 4.43|1194492|32|NC_014974|CRISPRCasFinder,CRT matches to KJ019089 (Synechococcus phage ACG-2014j isolate Syn7803US23, complete genome) position: , mismatch: 8, identity: 0.75

-----gggactctggcaggtatcctggcggttctggc	CRISPR spacer
atattggg-----ggcagggatcctggtggttctggt	Protospacer
     ***     ****** *******.********.

148. spacer 4.49|1194860|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP032323 (Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence) position: , mismatch: 8, identity: 0.75

gtgaggtctagggcggcggcgggcatgagcac	CRISPR spacer
gtccggtccagggcggcggcgggaatgcgaca	Protospacer
**  ****.************** *** *

149. spacer 4.49|1194860|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP022363 (Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence) position: , mismatch: 8, identity: 0.75

gtgaggtctagggcggcggcgggcatgagcac	CRISPR spacer
gtccggtccagggcggcggcgggaatgcgata	Protospacer
**  ****.************** *** *

150. spacer 4.49|1194860|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP007795 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence) position: , mismatch: 8, identity: 0.75

gtgaggtctagggcggcggcgggcatgagcac	CRISPR spacer
gtccggtccagggcggcggcgggaatgcgata	Protospacer
**  ****.************** *** *

151. spacer 4.49|1194860|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP032347 (Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence) position: , mismatch: 8, identity: 0.75

gtgaggtctagggcggcggcgggcatgagcac	CRISPR spacer
gtccggtccagggcggcggcgggaatgcgata	Protospacer
**  ****.************** *** *

152. spacer 4.54|1195168|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP033873 (Caulobacter sp. FWC26 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.75

gccgccttcctccagcgaccggatcgcccgcc	CRISPR spacer
gaccgcgccctccagcggccggatcgccagca	Protospacer
* *  * .*********.********** **

153. spacer 4.58|1195413|32|NC_014974|CRISPRCasFinder,CRT matches to NC_017385 (Ketogulonicigenium vulgare WSH-001 plasmid 2, complete sequence) position: , mismatch: 8, identity: 0.75

tggtgacggcggtgacgctggtgtccggggga	CRISPR spacer
gcgcaacggcggtgacgccggtgtcctgggtc	Protospacer
  *..*************.******* ***

154. spacer 4.58|1195413|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP012910 (Ketogulonicigenium vulgare strain Hbe602 plasmid 2, complete sequence) position: , mismatch: 8, identity: 0.75

tggtgacggcggtgacgctggtgtccggggga	CRISPR spacer
gcgcaacggcggtgacgccggtgtcctgggtc	Protospacer
  *..*************.******* ***

155. spacer 4.58|1195413|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP049158 (Caballeronia sp. SBC1 plasmid pSBC1_2, complete sequence) position: , mismatch: 8, identity: 0.75

tggtgacggcggtgacgctggtgtccggggga	CRISPR spacer
tggtgacggcggtgacgctcgtgattggcttt	Protospacer
******************* *** ..**

156. spacer 4.58|1195413|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP049318 (Caballeronia sp. SBC2 plasmid pSBC2-2, complete sequence) position: , mismatch: 8, identity: 0.75

tggtgacggcggtgacgctggtgtccggggga	CRISPR spacer
tggtgacggcggtgacgctcgtgattggcttt	Protospacer
******************* *** ..**

157. spacer 4.58|1195413|32|NC_014974|CRISPRCasFinder,CRT matches to NC_014626 (Ketogulonicigenium vulgare Y25 plasmid pYP12, complete sequence) position: , mismatch: 8, identity: 0.75

tggtgacggcggtgacgctggtgtccggggga	CRISPR spacer
gcgcaacggcggtgacgccggtgtcctgggtc	Protospacer
  *..*************.******* ***

158. spacer 4.58|1195413|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_LR594669 (Variovorax sp. SRS16 plasmid 4) position: , mismatch: 8, identity: 0.75

tggtgacggcggtgacgctggtgtccggggga	CRISPR spacer
tctcgacggcggtgacgctggtgctcggctgc	Protospacer
*  .*******************..***  *

159. spacer 4.58|1195413|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_LR594673 (Variovorax sp. PBL-E5 plasmid 3) position: , mismatch: 8, identity: 0.75

tggtgacggcggtgacgctggtgtccggggga	CRISPR spacer
tctcgacggcggtgacgctggtgctcggctgc	Protospacer
*  .*******************..***  *

160. spacer 4.58|1195413|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP032346 (Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.75

tggtgacggcggtgacgctggtgtccggggga	CRISPR spacer
cgaacagggcggtgacgctggtgcccgcgggg	Protospacer
.*.  * ****************.*** ***.

161. spacer 4.58|1195413|32|NC_014974|CRISPRCasFinder,CRT matches to NC_018022 (Mycolicibacterium chubuense NBB4 plasmid pMYCCH.01, complete sequence) position: , mismatch: 8, identity: 0.75

tggtgacggcggtgacgctggtgtccggggga	CRISPR spacer
gggtgacggcggagacggtggtgttggtgagg	Protospacer
 *********** **** ******. * *.*.

162. spacer 4.58|1195413|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP034470 (Pantoea agglomerans strain CFSAN047153 plasmid pCFSAN047153_1, complete sequence) position: , mismatch: 8, identity: 0.75

tggtgacggcggtgacgctggtgtccggggga	CRISPR spacer
tggtgacggcggtggcgatggtggtggtgcgt	Protospacer
**************.** ***** . * * *

163. spacer 4.58|1195413|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP034475 (Pantoea agglomerans strain CFSAN047154 plasmid pCFSAN047154_1, complete sequence) position: , mismatch: 8, identity: 0.75

tggtgacggcggtgacgctggtgtccggggga	CRISPR spacer
tggtgacggcggtggcgatggtggtggtgcgt	Protospacer
**************.** ***** . * * *

164. spacer 4.58|1195413|32|NC_014974|CRISPRCasFinder,CRT matches to KT997863 (Uncultured Mediterranean phage uvDeep-CGR2-KM21-C338, complete genome) position: , mismatch: 8, identity: 0.75

tggtgacggcggtgacgctggtgtccggggga	CRISPR spacer
tggtgacgctggtgacgctggtgacgatgaaa	Protospacer
******** .************* * . *..*

165. spacer 4.58|1195413|32|NC_014974|CRISPRCasFinder,CRT matches to NC_047804 (Ralstonia phage RS-PII-1, complete genome) position: , mismatch: 8, identity: 0.75

tggtgacggcggtgacgctggtgtccggggga	CRISPR spacer
cgatgacggcggtgatgctgttgtccttgagc	Protospacer
.*.************.**** *****  *.*

166. spacer 4.61|1195595|32|NC_014974|CRISPRCasFinder,CRT matches to MH067970 (Arthrobacter sp. strain ANT_H40 plasmid pA40H1, complete sequence) position: , mismatch: 8, identity: 0.75

gaaaaatccacgccgcatattcctttttgggc	CRISPR spacer
cagctttccacgccttatattcctttttggcc	Protospacer
 *.   ******** .************** *

167. spacer 4.62|1195656|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP028971 (Aminobacter sp. MSH1 plasmid pUSP3, complete sequence) position: , mismatch: 8, identity: 0.75

cgggcgtttggggacgtggccgccaagttcgg	CRISPR spacer
ttcgcccttgcggacatggccgccaagttcgc	Protospacer
.  ** .*** ****.***************

168. spacer 4.65|1195839|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP020372 (Candidatus Thiodictyon syntrophicum strain Cad16T plasmid pTs485, complete sequence) position: , mismatch: 8, identity: 0.75

gccctgctgacctcctccagcagggccccctc	CRISPR spacer
tcacccatgatctcctccagcagcgccccctt	Protospacer
 * *.  ***.************ *******.

169. spacer 4.72|1196267|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP030833 (Neorhizobium sp. NCHU2750 plasmid pNCHU2750e, complete sequence) position: , mismatch: 8, identity: 0.75

ttcctcgttgtcggtcatcgcctcctcagccc	CRISPR spacer
ctaacccttgacggtcatcggctcctcagcct	Protospacer
.*  .* *** ********* **********.

170. spacer 4.78|1196637|32|NC_014974|CRISPRCasFinder,CRT matches to KJ000058 (Salmonella phage STP4-a, complete genome) position: , mismatch: 8, identity: 0.75

ccccatctcccgtccgatatccacagcaatgg	CRISPR spacer
cttattatcccgtccgatacccagagcaatgc	Protospacer
*..  * ************.*** *******

171. spacer 2.2|575105|31|NC_014974|CRISPRCasFinder matches to NZ_CP012915 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence) position: , mismatch: 9, identity: 0.71

tcaccgcggccaggacgatgacggtagtcat	CRISPR spacer
acagcgccgccaggacgatgacgggacaggc	Protospacer
 ** *** **************** *   ..

172. spacer 2.2|575105|31|NC_014974|CRISPRCasFinder matches to NZ_CP022367 (Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence) position: , mismatch: 9, identity: 0.71

tcaccgcggccaggacgatgacggtagtcat	CRISPR spacer
gcagcgccgccaggacgatgacgggacaggc	Protospacer
 ** *** **************** *   ..

173. spacer 2.2|575105|31|NC_014974|CRISPRCasFinder matches to NZ_CP032340 (Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence) position: , mismatch: 9, identity: 0.71

tcaccgcggccaggacgatgacggtagtcat	CRISPR spacer
acagcgccgccaggacgatgacgggacaggc	Protospacer
 ** *** **************** *   ..

174. spacer 2.2|575105|31|NC_014974|CRISPRCasFinder matches to NZ_MK851048 (Morganella morganii strain MM1L5 plasmid pMM1L5, complete sequence) position: , mismatch: 9, identity: 0.71

tcaccgcggccaggacgatgacggtagtcat	CRISPR spacer
gtaatattgcccggacgatgacggtaatcat	Protospacer
 .* ... *** **************.****

175. spacer 2.2|575105|31|NC_014974|CRISPRCasFinder matches to NZ_MK851047 (Actinobacillus pleuropneumoniae strain APP1L5 plasmid pAPP1L5, complete sequence) position: , mismatch: 9, identity: 0.71

tcaccgcggccaggacgatgacggtagtcat	CRISPR spacer
gtaatattgcccggacgatgacggtaatcat	Protospacer
 .* ... *** **************.****

176. spacer 2.3|575166|31|NC_014974|CRISPRCasFinder matches to CP008701 (Klebsiella variicola strain Kp5-1 plasmid pKp5-1, complete sequence) position: , mismatch: 9, identity: 0.71

cggcaccagccagcgccgtcccaagcgcacc	CRISPR spacer
tcagaccagccagcgccatcccaagcactga	Protospacer
. . *************.********.*

177. spacer 2.3|575166|31|NC_014974|CRISPRCasFinder matches to NZ_CP029140 (Klebsiella michiganensis strain AR375 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.71

cggcaccagccagcgccgtcccaagcgcacc	CRISPR spacer
tcagaccagccagcgccatcccaagcactga	Protospacer
. . *************.********.*

178. spacer 2.5|575287|31|NC_014974|CRISPRCasFinder matches to NZ_CP014310 (Burkholderia sp. PAMC 26561 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.71

gcattcccggcattcccgggccgggacctcc	CRISPR spacer
acatgccgggcattcccgggccggtcatgct	Protospacer
.*** ** ****************   . *.

179. spacer 2.7|575409|31|NC_014974|CRISPRCasFinder matches to NZ_CP029832 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.71

ccctcgtcccgcagggcgtggatgcccgccc	CRISPR spacer
atggctcccagcagggcgtggttgcccgcca	Protospacer
 .  * .** *********** ********

180. spacer 2.11|575105|32|NC_014974|PILER-CR,CRT matches to NZ_CP011665 (Streptomyces sp. Mg1 plasmid pSMg1-1, complete sequence) position: , mismatch: 9, identity: 0.719

tcaccgcggccaggacgatgacggtagtcata	CRISPR spacer
tcaccgcgcccaagacgatgacgggccggctg	Protospacer
******** ***.***********      *.

181. spacer 2.11|575105|32|NC_014974|PILER-CR,CRT matches to NZ_CP007130 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 2, complete sequence) position: , mismatch: 9, identity: 0.719

tcaccgcggccaggacgatgacggtagtcata	CRISPR spacer
cgaccgtggccaggacgatggcggtgcgcacc	Protospacer
. ****.*************.****.  **.

182. spacer 2.11|575105|32|NC_014974|PILER-CR,CRT matches to NZ_CP029832 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

tcaccgcggccaggacgatgacggtagtcata	CRISPR spacer
gcaccgcgaccaggaagatgacggagatcgcg	Protospacer
 *******.****** ******** ..**...

183. spacer 2.11|575105|32|NC_014974|PILER-CR,CRT matches to NC_016586 (Azospirillum lipoferum 4B plasmid AZO_p2, complete sequence) position: , mismatch: 9, identity: 0.719

tcaccgcggccaggacgatgacggtagtcata	CRISPR spacer
gcaccgcgaccaggaagatgacggagatcgcg	Protospacer
 *******.****** ******** ..**...

184. spacer 2.14|575287|32|NC_014974|PILER-CR,CRT matches to NC_022534 (Plautia stali symbiont plasmid pPstS2 DNA, complete genome) position: , mismatch: 9, identity: 0.719

gcattcccggcattcccgggccgggacctccc	CRISPR spacer
gcgttcccggcattcccggggcggatttcacg	Protospacer
**.***************** ***. ... *

185. spacer 2.16|575409|32|NC_014974|PILER-CR,CRT matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 9, identity: 0.719

ccctcgtcccgcagggcgtggatgcccgccca	CRISPR spacer
gcgtcgtcccgcagggcgtggctgaccaggac	Protospacer
 * ****************** ** **.

186. spacer 2.16|575409|32|NC_014974|PILER-CR,CRT matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 9, identity: 0.719

ccctcgtcccgcagggcgtggatgcccgccca	CRISPR spacer
gcgtcgtcccgcagggcgtggctgaccaggac	Protospacer
 * ****************** ** **.

187. spacer 2.16|575409|32|NC_014974|PILER-CR,CRT matches to NZ_CP039912 (Agrobacterium tumefaciens strain CFBP6625 plasmid pAtCFBP6625a, complete sequence) position: , mismatch: 9, identity: 0.719

ccctcgtcccgcagggcgtggatgc---ccgccca	CRISPR spacer
ggctcgtcgagcagggcgtggatgcggtttgc---	Protospacer
  ******  ***************   ..**

188. spacer 3.5|1182358|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP022999 (Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-A, complete sequence) position: , mismatch: 9, identity: 0.719

atccggttgaacgcctcctgcatctttgcctc	CRISPR spacer
ggccggttgaacgccgcctggatctcggggcc	Protospacer
. ************* **** ****. *  .*

189. spacer 3.6|1182419|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP020740 ([Pseudomonas] mesoacidophila strain ATCC 31433 plasmid pATCC31433, complete sequence) position: , mismatch: 9, identity: 0.719

cgtgtccccgtgccgggcggcgtcggtcatga	CRISPR spacer
gaactgatcgcgcccggcggcgtcggtcatga	Protospacer
 .  *  .**.*** *****************

190. spacer 3.6|1182419|32|NC_014974|CRISPRCasFinder,CRT matches to AJ304453 (Uncultured bacterium plasmid pSB102 complete genome) position: , mismatch: 9, identity: 0.719

cgtgtccccgtgccgggcggcgtcggtcatga	CRISPR spacer
gttctggccgtggcgggcggcgtcggttattg	Protospacer
  * *  ***** **************.** .

191. spacer 3.6|1182419|32|NC_014974|CRISPRCasFinder,CRT matches to NC_018853 (Streptomyce phage TG1, complete genome) position: , mismatch: 9, identity: 0.719

cgtgtccccgtgccgggcggcgtcggtcatga	CRISPR spacer
gaagtgcccgtgccggtcggcgtcggcgacgg	Protospacer
 . ** ********** *********. *.*.

192. spacer 3.6|1182419|32|NC_014974|CRISPRCasFinder,CRT matches to AB251920 (Streptomyces phage TG1 DNA, region around attP and integrase) position: , mismatch: 9, identity: 0.719

cgtgtccccgtgccgggcggcgtcggtcatga	CRISPR spacer
gaagtgcccgtgccggtcggcgtcggcgacgg	Protospacer
 . ** ********** *********. *.*.

193. spacer 3.6|1182419|32|NC_014974|CRISPRCasFinder,CRT matches to JX182372 (Streptomyces virus TG1, complete genome) position: , mismatch: 9, identity: 0.719

cgtgtccccgtgccgggcggcgtcggtcatga	CRISPR spacer
gaagtgcccgtgccggtcggcgtcggcgacgg	Protospacer
 . ** ********** *********. *.*.

194. spacer 3.12|1182786|32|NC_014974|CRISPRCasFinder,CRT matches to JQ807246 (Environmental Halophage eHP-27, partial genome) position: , mismatch: 9, identity: 0.719

tcgtgggcgtccagaatccacccgtcgcccgt	CRISPR spacer
gccccggcgtcaagcatccacccgtcgccgaa	Protospacer
 * . ****** ** ************** .

195. spacer 3.19|1183215|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 9, identity: 0.719

ggctccggcattggggccgccggggagaacga----	CRISPR spacer
ggctccggcactggggccgctg----gatcagtgcc	Protospacer
**********.*********.*    ** *..

196. spacer 3.22|1183399|33|NC_014974|CRISPRCasFinder,CRT matches to NC_015146 (Pseudarthrobacter phenanthrenivorans Sphe3 plasmid pASPHE301, complete sequence) position: , mismatch: 9, identity: 0.727

ggttgcgggccgcttcctcggcgatgcgggcgg	CRISPR spacer
cgaggcgggccgcgtcctcggcggtgcgtccct	Protospacer
 *  ********* *********.****  *

197. spacer 3.22|1183399|33|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP022369 (Azospirillum sp. TSH58 plasmid TSH58_p05, complete sequence) position: , mismatch: 9, identity: 0.727

ggttgcgggccgcttcctcggcgatgcgggcgg	CRISPR spacer
catcggccaccgccgcctcggcgatgcgggcgg	Protospacer
 .*.*   .****. ******************

198. spacer 3.22|1183399|33|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP051544 (Paracoccus sanguinis strain OM2164 plasmid pPspOM44, complete sequence) position: , mismatch: 9, identity: 0.727

ggttgcgggccgcttcctcggcgatgcgggcgg	CRISPR spacer
ccaggcccgccgcttcctcggcggcgcgggcgc	Protospacer
    **  ***************..*******

199. spacer 3.23|1183461|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP034186 (Deinococcus sp. S14-83 strain S14-83T plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

caggacgtggccgagggtgtcccccacctgga	CRISPR spacer
agggaggtggccgagggtgtgccccagccacc	Protospacer
 .*** ************** ***** *..

200. spacer 3.23|1183461|32|NC_014974|CRISPRCasFinder,CRT matches to NC_016624 (Azospirillum lipoferum 4B plasmid AZO_p5, complete sequence) position: , mismatch: 9, identity: 0.719

caggacgtggccgagggtgtcccccacctgga	CRISPR spacer
gaagggccggccgagggtgaccgccacctggg	Protospacer
 *.*.  .*********** ** ********.

201. spacer 3.28|1183768|32|NC_014974|CRISPRCasFinder,CRT,PILER-CR matches to MK496724 (Capybara microvirus Cap1_SP_141, complete genome) position: , mismatch: 9, identity: 0.719

tgcgttccgccatctcagcgtaaaacggaaca	CRISPR spacer
caggcatagccatctcagcgtaaataggaaca	Protospacer
.. *. . ****************  ******

202. spacer 3.31|1183950|31|NC_014974|CRISPRCasFinder,CRT,PILER-CR matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 9, identity: 0.71

gagcttccgccggcggagcctcccgtgatcc	CRISPR spacer
aagatcccgccggcggagcctcccatcgaga	Protospacer
.** *.******************.* .

203. spacer 3.32|1184010|32|NC_014974|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP022370 (Bosea sp. AS-1 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

gggctcgggccgagctggggcggcggtttccg	CRISPR spacer
aggctcggcgcgagctggggcggcgttcattc	Protospacer
.*******  *************** *. ..

204. spacer 3.40|1182358|33|NC_014974|PILER-CR matches to KY053532 (Siphovirus 29632, complete genome) position: , mismatch: 9, identity: 0.727

atccggttgaacgcctcctgcatctttgcctcc	CRISPR spacer
gtccgcttgagcgcctcctgcatctgctcgccg	Protospacer
.**** ****.************** . * .*

205. spacer 3.47|1182786|33|NC_014974|PILER-CR matches to JQ807246 (Environmental Halophage eHP-27, partial genome) position: , mismatch: 9, identity: 0.727

tcgtgggcgtccagaatccacccgtcgcccgtc	CRISPR spacer
gccccggcgtcaagcatccacccgtcgccgaac	Protospacer
 * . ****** ** ************** . *

206. spacer 3.57|1183399|34|NC_014974|PILER-CR matches to NZ_CP015739 (Shinella sp. HZN7 plasmid pShin-03, complete sequence) position: , mismatch: 9, identity: 0.735

ggttgcgggccgcttcctcggcgatgcgggcggc	CRISPR spacer
agttgctggccgcatcctcggcgatgatcgtgtt	Protospacer
.***** ****** ************   *.* .

207. spacer 3.57|1183399|34|NC_014974|PILER-CR matches to NZ_CP032324 (Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence) position: , mismatch: 9, identity: 0.735

ggttgcgggccgcttcctcggcgatgcgggcggc	CRISPR spacer
cgtcggccaccgccgcctcggcgatgcgggcgga	Protospacer
 **.*   .****. ******************

208. spacer 3.57|1183399|34|NC_014974|PILER-CR matches to NC_016587 (Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence) position: , mismatch: 9, identity: 0.735

ggttgcgggccgcttcctcggcgatgcgggcggc	CRISPR spacer
tgtgggacaccgcctccccggcgatgcgggcgga	Protospacer
 ** * . .****.***.***************

209. spacer 3.57|1183399|34|NC_014974|PILER-CR matches to NZ_CP007797 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p4, complete sequence) position: , mismatch: 9, identity: 0.735

ggttgcgggccgcttcctcggcgatgcgggcggc	CRISPR spacer
cgtcggccaccgccgcctcggcgatgcgggcgga	Protospacer
 **.*   .****. ******************

210. spacer 3.57|1183399|34|NC_014974|PILER-CR matches to NZ_CP029833 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.735

ggttgcgggccgcttcctcggcgatgcgggcggc	CRISPR spacer
cgtgggacaccgcctccccggcgatgcgggcgga	Protospacer
 ** * . .****.***.***************

211. spacer 3.57|1183399|34|NC_014974|PILER-CR matches to NZ_CP032349 (Azospirillum brasilense strain MTCC4039 plasmid p3, complete sequence) position: , mismatch: 9, identity: 0.735

ggttgcgggccgcttcctcggcgatgcgggcggc	CRISPR spacer
cgtcggccaccgccgcctcggcgatgcgggcgga	Protospacer
 **.*   .****. ******************

212. spacer 4.7|1194859|33|NC_014974|PILER-CR matches to NC_017385 (Ketogulonicigenium vulgare WSH-001 plasmid 2, complete sequence) position: , mismatch: 9, identity: 0.727

ggtgaggtctagggcggcggcgggcatgagcac	CRISPR spacer
ggtgcggtcttgggcggcggcgggggcggcaaa	Protospacer
**** ***** ************* ..*.  *

213. spacer 4.7|1194859|33|NC_014974|PILER-CR matches to NZ_CP012910 (Ketogulonicigenium vulgare strain Hbe602 plasmid 2, complete sequence) position: , mismatch: 9, identity: 0.727

ggtgaggtctagggcggcggcgggcatgagcac	CRISPR spacer
ggtgcggtcttgggcggcggcgggggcggcaaa	Protospacer
**** ***** ************* ..*.  *

214. spacer 4.7|1194859|33|NC_014974|PILER-CR matches to NC_014626 (Ketogulonicigenium vulgare Y25 plasmid pYP12, complete sequence) position: , mismatch: 9, identity: 0.727

ggtgaggtctagggcggcggcgggcatgagcac	CRISPR spacer
ggtgcggtcttgggcggcggcgggggcggcaaa	Protospacer
**** ***** ************* ..*.  *

215. spacer 4.15|1195351|33|NC_014974|PILER-CR matches to NC_014157 (Salinibacter ruber M8 plasmid pSR84, complete sequence) position: , mismatch: 9, identity: 0.727

gcgcgcctggcgctccacgtgcgggacgaagcc	CRISPR spacer
gtgcgcctggcccaccacgtgcgggacatgctg	Protospacer
*.********* * *************. . .

216. spacer 4.16|1195412|33|NC_014974|PILER-CR matches to NZ_CP032346 (Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence) position: , mismatch: 9, identity: 0.727

gtggtgacggcggtgacgctggtgtccggggga	CRISPR spacer
ccgaacagggcggtgacgctggtgcccgcgggg	Protospacer
 .*.  * ****************.*** ***.

217. spacer 4.16|1195412|33|NC_014974|PILER-CR matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 9, identity: 0.727

gtggtgacggcggtgacgctggtgtccggggga	CRISPR spacer
gtggtgagggcggtgacgccggtggcgacgatg	Protospacer
******* ***********.**** * . *. .

218. spacer 4.16|1195412|33|NC_014974|PILER-CR matches to NZ_AP019802 (Thermus thermophilus strain HC11 plasmid pHC11, complete sequence) position: , mismatch: 9, identity: 0.727

gtggtgacggcggtgacgctggtgtccggggga	CRISPR spacer
gtggtggcgtcggtgacgctggtgatctcgttg	Protospacer
******.** ************** .*  *  .

219. spacer 4.16|1195412|33|NC_014974|PILER-CR matches to NC_017588 (Thermus thermophilus JL-18 plasmid pTTJL1801, complete sequence) position: , mismatch: 9, identity: 0.727

gtggtgacggcggtgacgctggtgtccggggga	CRISPR spacer
gtggtggcgtcggtgacgctggtgatctcgttg	Protospacer
******.** ************** .*  *  .

220. spacer 4.16|1195412|33|NC_014974|PILER-CR matches to NZ_LR027520 (Thermus thermophilus isolate TTHNAR1 plasmid 4, complete sequence) position: , mismatch: 9, identity: 0.727

gtggtgacggcggtgacgctggtgtccggggga	CRISPR spacer
gtggtggcgtcggtgacgctggtgatctcgttg	Protospacer
******.** ************** .*  *  .

221. spacer 4.19|1195594|33|NC_014974|PILER-CR matches to MH067970 (Arthrobacter sp. strain ANT_H40 plasmid pA40H1, complete sequence) position: , mismatch: 9, identity: 0.727

ggaaaaatccacgccgcatattcctttttgggc	CRISPR spacer
tcagctttccacgccttatattcctttttggcc	Protospacer
  *.   ******** .************** *

222. spacer 4.20|1195655|33|NC_014974|PILER-CR matches to NZ_CP028971 (Aminobacter sp. MSH1 plasmid pUSP3, complete sequence) position: , mismatch: 9, identity: 0.727

gcgggcgtttggggacgtggccgccaagttcgg	CRISPR spacer
tttcgcccttgcggacatggccgccaagttcgc	Protospacer
 .  ** .*** ****.***************

223. spacer 4.22|1195777|33|NC_014974|PILER-CR matches to NZ_CP006570 (Sodalis praecaptivus strain HS1 plasmid pHS1, complete sequence) position: , mismatch: 9, identity: 0.727

gagccaaccgccagtgcaagccccatcgccatc	CRISPR spacer
gcgccaaccgccagtggaagcccgatcatatag	Protospacer
* ************** ****** ***..

224. spacer 4.23|1195838|33|NC_014974|PILER-CR matches to NZ_CP020372 (Candidatus Thiodictyon syntrophicum strain Cad16T plasmid pTs485, complete sequence) position: , mismatch: 9, identity: 0.727

ggccctgctgacctcctccagcagggccccctc	CRISPR spacer
ctcacccatgatctcctccagcagcgccccctt	Protospacer
  * *.  ***.************ *******.

225. spacer 4.30|1196266|33|NC_014974|PILER-CR matches to NZ_CP030833 (Neorhizobium sp. NCHU2750 plasmid pNCHU2750e, complete sequence) position: , mismatch: 9, identity: 0.727

tttcctcgttgtcggtcatcgcctcctcagccc	CRISPR spacer
cctaacccttgacggtcatcggctcctcagcct	Protospacer
..*  .* *** ********* **********.

226. spacer 4.30|1196266|33|NC_014974|PILER-CR matches to KC460990 (Serratia phage Eta, complete genome) position: , mismatch: 9, identity: 0.727

tttcctcgttgtcggtcatcgcctcctcagccc	CRISPR spacer
tatgttcgttgttggtcatcgcttcctcactaa	Protospacer
* * .*******.*********.****** .

227. spacer 4.34|1196513|33|NC_014974|PILER-CR matches to NZ_CP032343 (Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence) position: , mismatch: 9, identity: 0.727

ggcaggtggtggcggtgtcccaggttttccctc	CRISPR spacer
ggccggtggtggcggtgttccaggccgcctcct	Protospacer
*** **************.*****.. .*.*..

228. spacer 4.34|1196513|33|NC_014974|PILER-CR matches to NZ_CP032324 (Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence) position: , mismatch: 9, identity: 0.727

ggcaggtggtggcggtgtcccaggttttccctc	CRISPR spacer
ggccggtggtggcggtgttccaggccgcctcct	Protospacer
*** **************.*****.. .*.*..

229. spacer 4.34|1196513|33|NC_014974|PILER-CR matches to NZ_CP012917 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence) position: , mismatch: 9, identity: 0.727

ggcaggtggtggcggtgtcccaggttttccctc	CRISPR spacer
ggccggtggtggcggtgttccaggccgcctcct	Protospacer
*** **************.*****.. .*.*..

230. spacer 4.39|1196819|34|NC_014974|PILER-CR matches to NZ_CP035092 (Paracoccus denitrificans strain ATCC 19367 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.735

ggccaccccgctcgctcccaggcgctggatgcgc	CRISPR spacer
ggcgaccccgctcgcgcccaggcgatccgcgacc	Protospacer
*** *********** ******** *  ..*  *

231. spacer 4.39|1196819|34|NC_014974|PILER-CR matches to NC_008688 (Paracoccus denitrificans PD1222 plasmid 1, complete sequence) position: , mismatch: 9, identity: 0.735

ggccaccccgctcgctcccaggcgctggatgcgc	CRISPR spacer
ggcgaccccgctcgcgcccaggcgatccgcgacc	Protospacer
*** *********** ******** *  ..*  *

232. spacer 4.49|1194860|32|NC_014974|CRISPRCasFinder,CRT matches to NC_017385 (Ketogulonicigenium vulgare WSH-001 plasmid 2, complete sequence) position: , mismatch: 9, identity: 0.719

gtgaggtctagggcggcggcgggcatgagcac	CRISPR spacer
gtgcggtcttgggcggcggcgggggcggcaaa	Protospacer
*** ***** ************* ..*.  *

233. spacer 4.49|1194860|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP012910 (Ketogulonicigenium vulgare strain Hbe602 plasmid 2, complete sequence) position: , mismatch: 9, identity: 0.719

gtgaggtctagggcggcggcgggcatgagcac	CRISPR spacer
gtgcggtcttgggcggcggcgggggcggcaaa	Protospacer
*** ***** ************* ..*.  *

234. spacer 4.49|1194860|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP030864 (Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

gtgaggtctagggcggcggcgggcatgagcac	CRISPR spacer
ccggtgcgcagggcggcggcggccatgtgcac	Protospacer
 .*. *. .************* **** ****

235. spacer 4.49|1194860|32|NC_014974|CRISPRCasFinder,CRT matches to NC_014626 (Ketogulonicigenium vulgare Y25 plasmid pYP12, complete sequence) position: , mismatch: 9, identity: 0.719

gtgaggtctagggcggcggcgggcatgagcac	CRISPR spacer
gtgcggtcttgggcggcggcgggggcggcaaa	Protospacer
*** ***** ************* ..*.  *

236. spacer 4.57|1195352|32|NC_014974|CRISPRCasFinder,CRT matches to NC_014157 (Salinibacter ruber M8 plasmid pSR84, complete sequence) position: , mismatch: 9, identity: 0.719

cgcgcctggcgctccacgtgcgggacgaagcc	CRISPR spacer
tgcgcctggcccaccacgtgcgggacatgctg	Protospacer
.********* * *************. . .

237. spacer 4.58|1195413|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 9, identity: 0.719

tggtgacggcggtgacgctggtgtccggggga	CRISPR spacer
tggtgagggcggtgacgccggtggcgacgatg	Protospacer
****** ***********.**** * . *. .

238. spacer 4.58|1195413|32|NC_014974|CRISPRCasFinder,CRT matches to AP021850 (Deinococcus grandis ATCC 43672 plasmid: pDEGR-1 DNA, complete genome) position: , mismatch: 9, identity: 0.719

tggtgacggcggtgacgctggtgtccggggga	CRISPR spacer
gggtggcggcggtgccgctggtgtcgatgttc	Protospacer
 ****.******** ********** . *

239. spacer 4.58|1195413|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_AP019802 (Thermus thermophilus strain HC11 plasmid pHC11, complete sequence) position: , mismatch: 9, identity: 0.719

tggtgacggcggtgacgctggtgtccggggga	CRISPR spacer
tggtggcgtcggtgacgctggtgatctcgttg	Protospacer
*****.** ************** .*  *  .

240. spacer 4.58|1195413|32|NC_014974|CRISPRCasFinder,CRT matches to NC_017588 (Thermus thermophilus JL-18 plasmid pTTJL1801, complete sequence) position: , mismatch: 9, identity: 0.719

tggtgacggcggtgacgctggtgtccggggga	CRISPR spacer
tggtggcgtcggtgacgctggtgatctcgttg	Protospacer
*****.** ************** .*  *  .

241. spacer 4.58|1195413|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_LR027520 (Thermus thermophilus isolate TTHNAR1 plasmid 4, complete sequence) position: , mismatch: 9, identity: 0.719

tggtgacggcggtgacgctggtgtccggggga	CRISPR spacer
tggtggcgtcggtgacgctggtgatctcgttg	Protospacer
*****.** ************** .*  *  .

242. spacer 4.58|1195413|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP029357 (Azospirillum sp. CFH 70021 plasmid unnamed2) position: , mismatch: 9, identity: 0.719

tggtgacggcggtgacgctggtgtccggggga	CRISPR spacer
aggtgacggcggcggcgctggtgtcggaaaac	Protospacer
 ***********.*.********** *....

243. spacer 4.58|1195413|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP032346 (Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence) position: , mismatch: 9, identity: 0.719

tggtgacggcggtgacgctggtgtccggggga	CRISPR spacer
tgaccggggcggtgacgctgctgtccgcggtg	Protospacer
**.. . ************* ****** ** .

244. spacer 4.58|1195413|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 9, identity: 0.719

tggtgacggcggtgacgctggtgtccggggga	CRISPR spacer
tcaaggcggcgttgacgctggtggccgggatg	Protospacer
* . *.***** *********** *****. .

245. spacer 4.58|1195413|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP015040 (Rhodovulum sp. P5 plasmid pRGUI01, complete sequence) position: , mismatch: 9, identity: 0.719

tggtgacggcggtgacgctggtgtccggggga	CRISPR spacer
tgctgacggcgctgacgctggtgatcctgtcg	Protospacer
** ******** *********** .*  *  .

246. spacer 4.58|1195413|32|NC_014974|CRISPRCasFinder,CRT matches to MF351863 (Synechococcus phage Bellamy, complete genome) position: , mismatch: 9, identity: 0.719

tggtgacggcggtgacgctggtgtccggggga	CRISPR spacer
tggtggcggcggtggcgctggtggatacagaa	Protospacer
*****.********.********  .. .*.*

247. spacer 4.62|1195656|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP042265 (Litoreibacter sp. LN3S51 plasmid unnamed4, complete sequence) position: , mismatch: 9, identity: 0.719

cgggcgtttggggacgtggccgccaagttcgg	CRISPR spacer
cgggcgtttggggccggggccgcgttactggc	Protospacer
************* ** ******   ..* *

248. spacer 4.64|1195778|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP006570 (Sodalis praecaptivus strain HS1 plasmid pHS1, complete sequence) position: , mismatch: 9, identity: 0.719

agccaaccgccagtgcaagccccatcgccatc	CRISPR spacer
cgccaaccgccagtggaagcccgatcatatag	Protospacer
 ************** ****** ***..

249. spacer 4.64|1195778|32|NC_014974|CRISPRCasFinder,CRT matches to NC_014309 (Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome) position: , mismatch: 9, identity: 0.719

agccaaccgccagtgcaagccccatcgccatc	CRISPR spacer
agccatccgctagtgcaagccccgcaggccct	Protospacer
***** ****.************.. * * ..

250. spacer 4.65|1195839|32|NC_014974|CRISPRCasFinder,CRT matches to NC_013855 (Azospirillum sp. B510 plasmid pAB510a, complete sequence) position: , mismatch: 9, identity: 0.719

gccctgctgacctcctccagcagggccccctc	CRISPR spacer
tggatgcggacctccgccagcagggccttgtc	Protospacer
    *** ******* ***********.. **

251. spacer 4.72|1196267|32|NC_014974|CRISPRCasFinder,CRT matches to KC460990 (Serratia phage Eta, complete genome) position: , mismatch: 9, identity: 0.719

ttcctcgttgtcggtcatcgcctcctcagccc	CRISPR spacer
atgttcgttgttggtcatcgcttcctcactaa	Protospacer
 * .*******.*********.****** .

252. spacer 4.76|1196514|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP032324 (Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence) position: , mismatch: 9, identity: 0.719

gcaggtggtggcggtgtcccaggttttccctc	CRISPR spacer
gccggtggtggcggtgttccaggccgcctcct	Protospacer
** **************.*****.. .*.*..

253. spacer 4.76|1196514|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP032343 (Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence) position: , mismatch: 9, identity: 0.719

gcaggtggtggcggtgtcccaggttttccctc	CRISPR spacer
gccggtggtggcggtgttccaggccgcctcct	Protospacer
** **************.*****.. .*.*..

254. spacer 4.76|1196514|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP012917 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence) position: , mismatch: 9, identity: 0.719

gcaggtggtggcggtgtcccaggttttccctc	CRISPR spacer
gccggtggtggcggtgttccaggccgcctcct	Protospacer
** **************.*****.. .*.*..

255. spacer 4.84|1197005|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP041205 (Rhizobium sp. NIBRBAC000502774 plasmid pMK-2, complete sequence) position: , mismatch: 9, identity: 0.719

catcggaggaggtgggatgatgcgcagggcaa	CRISPR spacer
atccggaggaggtgagatgatgcgcatccctc	Protospacer
  .***********.***********   *

256. spacer 4.84|1197005|32|NC_014974|CRISPRCasFinder,CRT matches to NC_015184 (Agrobacterium sp. H13-3 plasmid pAspH13-3a, complete sequence) position: , mismatch: 9, identity: 0.719

catcggaggaggtgggatgatgcgcagggcaa	CRISPR spacer
atccggaggaggtgagatgatgcgcatccctc	Protospacer
  .***********.***********   *

257. spacer 4.84|1197005|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP032923 (Agrobacterium tumefaciens strain 1D1108 plasmid pAt1D1108a, complete sequence) position: , mismatch: 9, identity: 0.719

catcggaggaggtgggatgatgcgcagggcaa	CRISPR spacer
atccggaggaggtgagatgatgcgcatccctc	Protospacer
  .***********.***********   *

258. spacer 4.84|1197005|32|NC_014974|CRISPRCasFinder,CRT matches to NC_003064 (Agrobacterium fabrum str. C58 plasmid At, complete sequence) position: , mismatch: 9, identity: 0.719

catcggaggaggtgggatgatgcgcagggcaa	CRISPR spacer
atccggaggaggtgagatgatgcgcatccctc	Protospacer
  .***********.***********   *

259. spacer 2.7|575409|31|NC_014974|CRISPRCasFinder matches to NZ_CP039912 (Agrobacterium tumefaciens strain CFBP6625 plasmid pAtCFBP6625a, complete sequence) position: , mismatch: 10, identity: 0.677

ccctcgtcccgcagggcgtggatgcccgccc	CRISPR spacer
ggctcgtcgagcagggcgtggatgcggtttg	Protospacer
  ******  ***************   ..

260. spacer 2.11|575105|32|NC_014974|PILER-CR,CRT matches to NZ_CP022367 (Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence) position: , mismatch: 10, identity: 0.688

tcaccgcggccaggacgatgacggtagtcata	CRISPR spacer
gcagcgccgccaggacgatgacgggacaggcg	Protospacer
 ** *** **************** *   ...

261. spacer 2.11|575105|32|NC_014974|PILER-CR,CRT matches to NZ_CP032340 (Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence) position: , mismatch: 10, identity: 0.688

tcaccgcggccaggacgatgacggtagtcata	CRISPR spacer
acagcgccgccaggacgatgacgggacaggcg	Protospacer
 ** *** **************** *   ...

262. spacer 2.11|575105|32|NC_014974|PILER-CR,CRT matches to NZ_CP012915 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence) position: , mismatch: 10, identity: 0.688

tcaccgcggccaggacgatgacggtagtcata	CRISPR spacer
acagcgccgccaggacgatgacgggacaggcg	Protospacer
 ** *** **************** *   ...

263. spacer 2.11|575105|32|NC_014974|PILER-CR,CRT matches to NZ_MK851048 (Morganella morganii strain MM1L5 plasmid pMM1L5, complete sequence) position: , mismatch: 10, identity: 0.688

tcaccgcggccaggacgatgacggtagtcata	CRISPR spacer
gtaatattgcccggacgatgacggtaatcatc	Protospacer
 .* ... *** **************.****

264. spacer 2.11|575105|32|NC_014974|PILER-CR,CRT matches to NZ_MK851047 (Actinobacillus pleuropneumoniae strain APP1L5 plasmid pAPP1L5, complete sequence) position: , mismatch: 10, identity: 0.688

tcaccgcggccaggacgatgacggtagtcata	CRISPR spacer
gtaatattgcccggacgatgacggtaatcatc	Protospacer
 .* ... *** **************.****

265. spacer 2.14|575287|32|NC_014974|PILER-CR,CRT matches to NZ_CP014310 (Burkholderia sp. PAMC 26561 plasmid unnamed3, complete sequence) position: , mismatch: 10, identity: 0.688

gcattcccggcattcccgggccgggacctccc	CRISPR spacer
acatgccgggcattcccgggccggtcatgctg	Protospacer
.*** ** ****************   . *.

266. spacer 2.16|575409|32|NC_014974|PILER-CR,CRT matches to NZ_CP029832 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence) position: , mismatch: 10, identity: 0.688

ccctcgtcccgcagggcgtggatgcccgccca	CRISPR spacer
atggctcccagcagggcgtggttgcccgccac	Protospacer
 .  * .** *********** ********

267. spacer 3.4|1182297|32|NC_014974|CRISPRCasFinder,CRT matches to MN586038 (Mycobacterium phage WalterMcMickey, complete genome) position: , mismatch: 10, identity: 0.688

gctgccctccagggcttgaccagctcccctat	CRISPR spacer
gtcctgatccaggcgttgaccagctcccctga	Protospacer
*.. .  ******  ***************.

268. spacer 3.4|1182297|32|NC_014974|CRISPRCasFinder,CRT matches to NC_041982 (Mycobacterium phage Twister, complete genome) position: , mismatch: 10, identity: 0.688

gctgccctccagggcttgaccagctcccctat	CRISPR spacer
gtcctgatccaggcgttgaccagctcccctga	Protospacer
*.. .  ******  ***************.

269. spacer 3.4|1182297|32|NC_014974|CRISPRCasFinder,CRT matches to MT522002 (Mycobacterium phage Topanga, complete genome) position: , mismatch: 10, identity: 0.688

gctgccctccagggcttgaccagctcccctat	CRISPR spacer
gtcctgatccaggcgttgaccagctcccctga	Protospacer
*.. .  ******  ***************.

270. spacer 3.5|1182358|32|NC_014974|CRISPRCasFinder,CRT matches to MT889367 (Gordonia phage Orla, complete genome) position: , mismatch: 10, identity: 0.688

atccggttgaacgcctcctgcatctttgcctc	CRISPR spacer
gtctgcttgaacgcctcctgcatcgcgtctat	Protospacer
.**.* ****************** .  *. .

271. spacer 3.22|1183399|33|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP012917 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence) position: , mismatch: 10, identity: 0.697

ggttgcgggccgcttcctcggcgatgcgggcgg	CRISPR spacer
catccgccaccgccgcctcggcgatgcgggcgg	Protospacer
 .*.    .****. ******************

272. spacer 3.22|1183399|33|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP032343 (Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence) position: , mismatch: 10, identity: 0.697

ggttgcgggccgcttcctcggcgatgcgggcgg	CRISPR spacer
catccgccaccgccgcctcggcgatgcgggcgg	Protospacer
 .*.    .****. ******************

273. spacer 3.41|1182419|33|NC_014974|PILER-CR matches to NZ_CP020740 ([Pseudomonas] mesoacidophila strain ATCC 31433 plasmid pATCC31433, complete sequence) position: , mismatch: 10, identity: 0.697

cgtgtccccgtgccgggcggcgtcggtcatgac	CRISPR spacer
gaactgatcgcgcccggcggcgtcggtcatgat	Protospacer
 .  *  .**.*** *****************.

274. spacer 3.57|1183399|34|NC_014974|PILER-CR matches to NC_015146 (Pseudarthrobacter phenanthrenivorans Sphe3 plasmid pASPHE301, complete sequence) position: , mismatch: 10, identity: 0.706

ggttgcgggccgcttcctcggcgatgcgggcggc	CRISPR spacer
cgaggcgggccgcgtcctcggcggtgcgtccctt	Protospacer
 *  ********* *********.****  *  .

275. spacer 3.57|1183399|34|NC_014974|PILER-CR matches to NZ_CP022369 (Azospirillum sp. TSH58 plasmid TSH58_p05, complete sequence) position: , mismatch: 10, identity: 0.706

ggttgcgggccgcttcctcggcgatgcgggcggc	CRISPR spacer
catcggccaccgccgcctcggcgatgcgggcgga	Protospacer
 .*.*   .****. ******************

276. spacer 3.57|1183399|34|NC_014974|PILER-CR matches to NZ_CP051544 (Paracoccus sanguinis strain OM2164 plasmid pPspOM44, complete sequence) position: , mismatch: 10, identity: 0.706

ggttgcgggccgcttcctcggcgatgcgggcggc	CRISPR spacer
ccaggcccgccgcttcctcggcggcgcgggcgcg	Protospacer
    **  ***************..*******

277. spacer 3.58|1183461|33|NC_014974|PILER-CR matches to NZ_CP034186 (Deinococcus sp. S14-83 strain S14-83T plasmid unnamed2, complete sequence) position: , mismatch: 10, identity: 0.697

caggacgtggccgagggtgtcccccacctggac	CRISPR spacer
agggaggtggccgagggtgtgccccagccacct	Protospacer
 .*** ************** ***** *..  .

278. spacer 4.16|1195412|33|NC_014974|PILER-CR matches to AP021850 (Deinococcus grandis ATCC 43672 plasmid: pDEGR-1 DNA, complete genome) position: , mismatch: 10, identity: 0.697

gtggtgacggcggtgacgctggtgtccggggga	CRISPR spacer
agggtggcggcggtgccgctggtgtcgatgttc	Protospacer
. ****.******** ********** . *

279. spacer 4.16|1195412|33|NC_014974|PILER-CR matches to NZ_CP029357 (Azospirillum sp. CFH 70021 plasmid unnamed2) position: , mismatch: 10, identity: 0.697

gtggtgacggcggtgacgctggtgtccggggga	CRISPR spacer
caggtgacggcggcggcgctggtgtcggaaaac	Protospacer
  ***********.*.********** *....

280. spacer 4.16|1195412|33|NC_014974|PILER-CR matches to MK279857 (Mycobacterium phage IronMan, complete genome) position: , mismatch: 10, identity: 0.697

gtggtgacggcggtgacgctggtgtccggggga	CRISPR spacer
gtggtggcggcggtaacgctggtgcgtcgttct	Protospacer
******.*******.*********. . *

281. spacer 4.58|1195413|32|NC_014974|CRISPRCasFinder,CRT matches to NC_014310 (Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence) position: , mismatch: 10, identity: 0.688

tggtgacggcggtgacgctggtgtccggggga	CRISPR spacer
tggtgatggtggtgacgctggtgctgctgccc	Protospacer
******.**.*************..   *

282. spacer 4.58|1195413|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP039340 (Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence) position: , mismatch: 10, identity: 0.688

tggtgacggcggtgacgctggtgtccggggga	CRISPR spacer
tggtgatggtggtgacgctggtgctgctgccc	Protospacer
******.**.*************..   *

283. spacer 4.58|1195413|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP040762 (Paracoccus sp. 2251 plasmid unnamed2, complete sequence) position: , mismatch: 10, identity: 0.688

tggtgacggcggtgacgctggtgtccggggga	CRISPR spacer
gcgtggcggtggtgacgctggtgtcggatctg	Protospacer
  ***.***.*************** *.   .

284. spacer 4.58|1195413|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP022760 (Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

tggtgacggcggtgacgctggtgtccggggga	CRISPR spacer
tggtgatggtggtgacgctggtgctgctgccc	Protospacer
******.**.*************..   *

285. spacer 4.58|1195413|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP022789 (Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

tggtgacggcggtgacgctggtgtccggggga	CRISPR spacer
tggtgatggtggtgacgctggtgctgctgccc	Protospacer
******.**.*************..   *

286. spacer 4.58|1195413|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP023073 (Sinorhizobium fredii CCBAU 83666 plasmid pSF83666d, complete sequence) position: , mismatch: 10, identity: 0.688

tggtgacggcggtgacgctggtgtccggggga	CRISPR spacer
gagtgacagcggggacgctggtgtcatcgctg	Protospacer
 .*****.**** ************   *  .

287. spacer 4.58|1195413|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP051295 (Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence) position: , mismatch: 10, identity: 0.688

tggtgacggcggtgacgctggtgtccggggga	CRISPR spacer
acagcacgccggtgacggtggtgtccggcaaa	Protospacer
  .  *** ******** ********** ..*

288. spacer 4.58|1195413|32|NC_014974|CRISPRCasFinder,CRT matches to MK279857 (Mycobacterium phage IronMan, complete genome) position: , mismatch: 10, identity: 0.688

tggtgacggcggtgacgctggtgtccggggga	CRISPR spacer
tggtggcggcggtaacgctggtgcgtcgttct	Protospacer
*****.*******.*********. . *

289. spacer 4.58|1195413|32|NC_014974|CRISPRCasFinder,CRT matches to NC_008195 (Mycobacterium phage Cooper, complete genome) position: , mismatch: 10, identity: 0.688

tggtgacggcggtgacgctggtgtccggggga	CRISPR spacer
cggtggcggcggtgacgttggtgttgacgaac	Protospacer
.****.***********.******. . *..

290. spacer 4.71|1196206|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP017076 (Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence) position: , mismatch: 10, identity: 0.688

ggttgcgccctacagcgtgttcccggtgcccc	CRISPR spacer
ctcgaccgcctacagcctgttctcggtgccct	Protospacer
  . .*  ******** *****.********.

291. spacer 3.32|1184010|32|NC_014974|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP042332 (Bosea sp. F3-2 plasmid pB32-1, complete sequence) position: , mismatch: 11, identity: 0.656

gggctcgggccgagctggggcggcggtttccg	CRISPR spacer
aagctcggtgcgagctggggcggcgtccattc	Protospacer
..******  *************** .. ..

292. spacer 3.57|1183399|34|NC_014974|PILER-CR matches to NZ_CP012917 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence) position: , mismatch: 11, identity: 0.676

ggttgcgggccgcttcctcggcgatgcgggcggc	CRISPR spacer
catccgccaccgccgcctcggcgatgcgggcgga	Protospacer
 .*.    .****. ******************

293. spacer 3.57|1183399|34|NC_014974|PILER-CR matches to NZ_CP032343 (Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence) position: , mismatch: 11, identity: 0.676

ggttgcgggccgcttcctcggcgatgcgggcggc	CRISPR spacer
catccgccaccgccgcctcggcgatgcgggcgga	Protospacer
 .*.    .****. ******************

294. spacer 4.16|1195412|33|NC_014974|PILER-CR matches to NZ_CP038854 (Pantoea vagans strain LMG 24199 plasmid unnamed1, complete sequence) position: , mismatch: 11, identity: 0.667

gtggtgacggcggtgacgctggtgtccggggga	CRISPR spacer
gtggtgacggtggtgacggtggtgcgtaatcag	Protospacer
**********.******* *****. ...  ..

295. spacer 4.46|1194677|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP017904 (Vibrio alginolyticus strain K05K4 plasmid pL289, complete sequence) position: , mismatch: 11, identity: 0.656

cgcaccacctggttgtccataagccccccggc	CRISPR spacer
aaaggtacttggttgtccatacgcccccctat	Protospacer
 . . .**.************ ******* ..

296. spacer 4.46|1194677|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP017901 (Vibrio alginolyticus strain K04M5 plasmid pL294, complete sequence) position: , mismatch: 11, identity: 0.656

cgcaccacctggttgtccataagccccccggc	CRISPR spacer
aaaggtacttggttgtccatacgcccccctat	Protospacer
 . . .**.************ ******* ..

297. spacer 4.46|1194677|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP017909 (Vibrio alginolyticus strain K06K5 plasmid pL291, complete sequence) position: , mismatch: 11, identity: 0.656

cgcaccacctggttgtccataagccccccggc	CRISPR spacer
aaaggtacttggttgtccatacgcccccctat	Protospacer
 . . .**.************ ******* ..

298. spacer 4.46|1194677|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP017893 (Vibrio alginolyticus strain K04M1 plasmid pL280, complete sequence) position: , mismatch: 11, identity: 0.656

cgcaccacctggttgtccataagccccccggc	CRISPR spacer
aaaggtacttggttgtccatacgcccccctat	Protospacer
 . . .**.************ ******* ..

299. spacer 4.46|1194677|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP017898 (Vibrio alginolyticus isolate K04M3 plasmid pL294, complete sequence) position: , mismatch: 11, identity: 0.656

cgcaccacctggttgtccataagccccccggc	CRISPR spacer
aaaggtacttggttgtccatacgcccccctat	Protospacer
 . . .**.************ ******* ..

300. spacer 4.55|1195229|32|NC_014974|CRISPRCasFinder,CRT matches to KF147891 (Pseudomonas phage PaBG, complete genome) position: , mismatch: 11, identity: 0.656

ccccaccctgagggccccacgtctagccgtcc	CRISPR spacer
gaagaccctgaggtcccaacgtctagcatcat	Protospacer
    ********* *** *********  . .

301. spacer 4.58|1195413|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP038854 (Pantoea vagans strain LMG 24199 plasmid unnamed1, complete sequence) position: , mismatch: 11, identity: 0.656

tggtgacggcggtgacgctggtgtccggggga	CRISPR spacer
tggtgacggtggtgacggtggtgcgtaatcag	Protospacer
*********.******* *****. ...  ..

302. spacer 4.79|1196698|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP050098 (Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b4, complete sequence) position: , mismatch: 11, identity: 0.656

acgcccggcgggcggagcttctcgggaagaaa	CRISPR spacer
gttgtcggcgggcggagcttgccgggaaaggg	Protospacer
..  .*************** .******....

303. spacer 4.79|1196698|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP053440 (Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eF, complete sequence) position: , mismatch: 11, identity: 0.656

acgcccggcgggcggagcttctcgggaagaaa	CRISPR spacer
gttgtcggcgggcggagcttgccgggaaaggg	Protospacer
..  .*************** .******....

304. spacer 4.79|1196698|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP018229 (Rhizobium leguminosarum strain Vaf-108 plasmid unnamed1, complete sequence) position: , mismatch: 11, identity: 0.656

acgcccggcgggcggagcttctcgggaagaaa	CRISPR spacer
gttgtcggcgggcggagcttgccgggaaaggg	Protospacer
..  .*************** .******....

305. spacer 4.79|1196698|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP016287 (Rhizobium leguminosarum strain Vaf10 plasmid unnamed1, complete sequence) position: , mismatch: 11, identity: 0.656

acgcccggcgggcggagcttctcgggaagaaa	CRISPR spacer
gttgtcggcgggcggagcttgccgggaaaggg	Protospacer
..  .*************** .******....

306. spacer 4.79|1196698|32|NC_014974|CRISPRCasFinder,CRT matches to NC_012848 (Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132501, complete sequence) position: , mismatch: 11, identity: 0.656

acgcccggcgggcggagcttctcgggaagaaa	CRISPR spacer
gttatcggcgggcggagcttgccgggaaaggg	Protospacer
..  .*************** .******....

307. spacer 4.79|1196698|32|NC_014974|CRISPRCasFinder,CRT matches to CP003952 (Rhodococcus opacus PD630 plasmid 3, complete sequence) position: , mismatch: 11, identity: 0.656

acgcccggcgggcggagcttctcgggaagaaa	CRISPR spacer
cggcccggcgggcggagattcgcggccgatcg	Protospacer
  *************** *** ***  ..  .

308. spacer 4.84|1197005|32|NC_014974|CRISPRCasFinder,CRT matches to NZ_CP042276 (Agrobacterium tumefaciens strain 186 plasmid pAt, complete sequence) position: , mismatch: 11, identity: 0.656

catcggaggaggtgggatgatgcgcagggcaa	CRISPR spacer
atccggaggaggtaagatgatgcgcaccttgc	Protospacer
  .**********..***********   ..

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1495855 : 1506867

Synechococcus_phage(33.33%)

tRNA

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015717441.1\|1495855_1497049_-	peptidoglycan DD-metalloendopeptidase family protein	V5R8R0	Arthrobacter_phage	4.7e-23	49.6
WP_015717442.1\|1497169_1498453_-	transcription termination factor Rho	NA	NA	NA	NA
WP_015717443.1\|1498449_1499121_-	fructose-6-phosphate aldolase	H8ZMU3	Synechococcus_phage	8.8e-43	43.4
WP_015717444.1\|1499532_1502664_+\|tRNA	isoleucine--tRNA ligase	A0A2I2L3Y0	Orpheovirus	9.5e-148	30.3
WP_015717446.1\|1502886_1503921_+	aminopeptidase P family protein	NA	NA	NA	NA
WP_015717447.1\|1503921_1504419_+	septal ring lytic transglycosylase RlpA family protein	F5B3X9	Synechococcus_phage	2.0e-23	56.1
WP_015717448.1\|1504420_1505236_+	deoxyribonuclease IV	A0A1V0SBL9	Catovirus	1.7e-19	27.8
WP_041438947.1\|1505289_1506867_+	type I restriction-modification system subunit M	A0A220A2U4	Liberibacter_phage	7.5e-85	38.0

DBSCAN-SWA_2

1588036 : 1639345

uncultured_Mediterranean_phage(33.33%)

protease,transposase,integrase

attL 1602368:1602384|attR 1610990:1611006

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_008632315.1\|1588036_1589161_+\|transposase	transposase	NA	NA	NA	NA
WP_015717553.1\|1589233_1589656_+	Fis family transcriptional regulator	NA	NA	NA	NA
WP_015717554.1\|1589655_1590696_+	alcohol dehydrogenase catalytic domain-containing protein	NA	NA	NA	NA
WP_015717555.1\|1590700_1591600_+	R2-like ligand-binding oxidase	NA	NA	NA	NA
WP_015717556.1\|1591599_1593081_+	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_015716433.1\|1594216_1594732_-	hypothetical protein	NA	NA	NA	NA
WP_015716434.1\|1594752_1595307_-\|transposase	DDE transposase family protein	NA	NA	NA	NA
WP_015717558.1\|1595378_1596491_+	FtsX-like permease family protein	NA	NA	NA	NA
WP_015717559.1\|1596578_1597328_+	TIM barrel protein	NA	NA	NA	NA
WP_015717560.1\|1597341_1598250_+	sugar ABC transporter permease	NA	NA	NA	NA
WP_015717561.1\|1598242_1599058_+	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_015717562.1\|1599069_1600392_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_015717563.1\|1600481_1601216_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	5.7e-35	39.3
WP_015717564.1\|1601208_1601964_+	glycosyltransferase	NA	NA	NA	NA
WP_126200308.1\|1602060_1602654_+	hypothetical protein	NA	NA	NA	NA
1602368:1602384	attL	NA	NA	NA	NA
WP_015717566.1\|1602732_1602876_-	hypothetical protein	NA	NA	NA	NA
WP_158305233.1\|1602906_1603512_-	zinc ABC transporter solute-binding protein	NA	NA	NA	NA
WP_015717569.1\|1603810_1604020_-	type II toxin-antitoxin system HicB family antitoxin	NA	NA	NA	NA
WP_015717570.1\|1604057_1604630_-	hypothetical protein	NA	NA	NA	NA
WP_015717571.1\|1604620_1605856_-	AAA family ATPase	NA	NA	NA	NA
WP_158305234.1\|1606887_1607085_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_041438982.1\|1607168_1608305_+\|integrase	site-specific integrase	A0A2H4JCB7	uncultured_Caudovirales_phage	1.6e-28	26.4
WP_015717575.1\|1608606_1609395_+	30S ribosomal protein S2	NA	NA	NA	NA
WP_015717576.1\|1609391_1609982_+	translation elongation factor Ts	NA	NA	NA	NA
WP_015717577.1\|1610057_1610762_+	UMP kinase	NA	NA	NA	NA
WP_015717578.1\|1610772_1611330_+	ribosome recycling factor	NA	NA	NA	NA
1610990:1611006	attR	NA	NA	NA	NA
WP_015717579.1\|1611423_1612254_+	phosphatidate cytidylyltransferase	NA	NA	NA	NA
WP_015717580.1\|1612250_1613354_+	1-deoxy-D-xylulose-5-phosphate reductoisomerase	NA	NA	NA	NA
WP_015717581.1\|1613350_1614361_+\|protease	site-2 protease family protein	NA	NA	NA	NA
WP_015717582.1\|1614361_1614991_+	glycosyltransferase	NA	NA	NA	NA
WP_015717583.1\|1614987_1615560_-	hypothetical protein	NA	NA	NA	NA
WP_015717584.1\|1615564_1616350_-	pyrroline-5-carboxylate reductase	A0A1X9I6T5	Streptococcus_phage	3.1e-23	33.2
WP_015717585.1\|1616346_1617546_-	MFS transporter	NA	NA	NA	NA
WP_014515944.1\|1617542_1617815_-	stage V sporulation protein S	NA	NA	NA	NA
WP_015717586.1\|1617906_1618344_-	cyclase	NA	NA	NA	NA
WP_015717587.1\|1618353_1618794_-	regulatory protein RecX	NA	NA	NA	NA
WP_015717588.1\|1618811_1619498_+	phosphohydrolase	NA	NA	NA	NA
WP_015717589.1\|1619502_1619781_+	Lrp/AsnC ligand binding domain-containing protein	NA	NA	NA	NA
WP_015717590.1\|1619792_1620341_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_015717591.1\|1620463_1623655_+	serine protein kinase	NA	NA	NA	NA
WP_015717592.1\|1623651_1624695_+	DUF444 family protein	NA	NA	NA	NA
WP_015717593.1\|1624698_1626075_+	stage V sporulation protein R	NA	NA	NA	NA
WP_015717594.1\|1626071_1626863_-	TlpA family protein disulfide reductase	NA	NA	NA	NA
WP_015717595.1\|1626862_1627240_-	rhodanese-like domain-containing protein	NA	NA	NA	NA
WP_081454938.1\|1627241_1627931_-	glutaredoxin	NA	NA	NA	NA
WP_015717597.1\|1628098_1629535_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_015717598.1\|1629596_1630256_+	rhodanese-like domain-containing protein	NA	NA	NA	NA
WP_015717599.1\|1630252_1631014_+	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
WP_015717600.1\|1631023_1631872_+	carbon-nitrogen hydrolase family protein	NA	NA	NA	NA
WP_015717601.1\|1631866_1632790_-	peptidylprolyl isomerase	NA	NA	NA	NA
WP_041438986.1\|1632803_1633835_+	uroporphyrinogen decarboxylase	NA	NA	NA	NA
WP_015717603.1\|1633831_1634785_+	ferrochelatase	NA	NA	NA	NA
WP_015717604.1\|1634772_1636128_+	protoporphyrinogen oxidase	NA	NA	NA	NA
WP_015717605.1\|1636162_1638403_+	diguanylate cyclase	NA	NA	NA	NA
WP_158305235.1\|1638838_1639345_-\|transposase	IS630 family transposase	NA	NA	NA	NA

DBSCAN-SWA_3

1807651 : 1816382

Staphylococcus_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015717785.1\|1807651_1809334_+	long-chain fatty acid--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	7.6e-43	32.0
WP_148228701.1\|1809336_1810461_-	aminotransferase class V-fold PLP-dependent enzyme	A0A0H3TPH2	Faustovirus	3.2e-37	30.9
WP_038041747.1\|1810530_1810977_-	RrF2 family transcriptional regulator	NA	NA	NA	NA
WP_015717788.1\|1811000_1811807_-	metal ABC transporter permease	NA	NA	NA	NA
WP_015717789.1\|1811799_1812540_-	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	2.8e-13	33.1
WP_049775651.1\|1812685_1814497_-	ABC transporter ATP-binding protein	F2Y2R6	Organic_Lake_phycodnavirus	2.3e-21	29.3
WP_015717791.1\|1814594_1815380_-	3-methyl-2-oxobutanoate hydroxymethyltransferase	A0A0P0BXC9	Ostreococcus_lucimarinus_virus	7.9e-51	38.0
WP_015717792.1\|1815410_1816382_+	Holliday junction branch migration DNA helicase RuvB	A0A127AWE7	Bacillus_phage	9.2e-09	28.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_014974

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection