CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NC_015144	Weeksella virosa DSM 16922, complete sequence	1 crisprs	DEDDh,WYL,cas3,cas2,cas1,cas9	7	13	1	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_015144_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_015144_1

1975310-1976959

TypeII

Consensus_repeat	Method
GTTGTGAATTCCTTTCAAATTTTTGTAGATTTACTCAGTAGAATTACAAC	CRISPRCasFinder
GTTGTGAATTCCTTTCAAATTTTTGTAGATTTACTCAGTAGAATTACAAC	PILER-CR

20 spacers

cas2,cas1,cas9

The CRISPR arrays of NC_015144_1

>merge|NC_015144|1|1975310-1976959|CRISPRCasFinder,PILER-CR
ACGCTTCGCTTGATTCAAATTTTTGTAGATTTACTCAGTAGAATTACAACAACAAAATAAGATGAGTGTAATTGATTTATGTTGTGAATTCCTTTCAAATTTTTGTAGATTTACTCAGTAGAATTACAACCTTTGTGCAATGCCGAGTTCGGTGCTTCATGTTGTGAATTCCTTTCAAATTTTTGTAGATTTACTCAGTAGAATTACAACTGTATTTCATAAATTTATCTAATCTCTCAAGTTGTGAATTCCTTTCAAATTTTTGTAGATTTACTCAGTAGAATTACAACGGAAACGGGCGTCGGTGAAGTCATCGATACGTTGTGAATTCCTTTCAAATTTTTGTAGATTTACTCAGTAGAATTACAACTGTTTATAACAAGCTAAGAGGGTGGAAGTCGTTGTGAATTCCTTTCAAATTTTTGTAGATTTACTCAGTAGAATTACAACTACTCCATCATGCGTTATCGATCCCGATAAGTTGTGAATTCCTTTCAAATTTTTGTAGATTTACTCAGTAGAATTACAACATGTAGAATATGAATCAGATAGAGATGCAAGTTGTGAATTCCTTTCAAATTTTTGTAGATTTACTCAGTAGAATTACAACTCTGAAATTCAGATGCCTGTTTTACTTTATGTTGTGAATTCCTTTCAAATTTTTGTAGATTTACTCAGTAGAATTACAACATATTATTTTGAGAAAACTTATAAATCATCGTTGTGAATTCCTTTCAAATTTTTGTAGATTTACTCAGTAGAATTACAACTCGCCATTGGTTTGGACGCCTTGTGCCCATGTTGTGAATTCCTTTCAAATTTTTGTAGATTTACTCAGTAGAATTACAACTCGCTTCGGTATTGACCGAAATAGCCCACCGTTGTGAATTCCTTTCAAATTTTTGTAGATTTACTCAGTAGAATTACAACATAAAACATTTCAAACAAAATTCTTTAAGCGTTGTGAATTCCTTTCAAATTTTTGTAGATTTACTCAGTAGAATTACAACTATTAATTCAAGCATAATGTTTTGATGGTTGTTGTGAATTCCTTTCAAATTTTTGTAGATTTACTCAGTAGAATTACAACAAGTAGATCTTGATTTTATAGCTGGCTATAGTTGTGAATTCCTTTCAAATTTTTGTAGATTTACTCAGTAGAATTACAACGCACTGAATATGGATATCCAGACGATCGTCGTTGTGAATTCCTTTCAAATTTTTGTAGATTTACTCAGTAGAATTACAACTTTATAGCAGACGTAGAGGTTGTGGTAAGTGTTGTGAATTCCTTTCAAATTTTTGTAGATTTACTCAGTAGAATTACAACGTACTTGCCGTTCGGTCTTGCGTGGTATACGTTGTGAATTCCTTTCAAATTTTTGTAGATTTACTCAGTAGAATTACAACCAGTTTCTAATCCAACGCTGAACGTTGATAGTTGTGAATTCCTTTCAAATTTTTGTAGATTTACTCAGTAGAATTACAACGTGGAGTATTTGCTTAATGCCTTTGTTGGCGTTGTGAATTCCTTTCAAATTTTTGTAGATTTACTCAGTAGAATTACAACGCTCAATATATCCAAGAGCAACACAATGGTGTTGTGAATTCCTTTCAAATTTTTGTAGATTTACTCAGTAGAATTACAAC

>NC_015144|1|1|1975310-1976959|CRISPRCasFinder
ACGCTTCGCTTGATTCAAATTTTTGTAGATTTACTCAGTAGAATTACAAC	AACAAAATAAGATGAGTGTAATTGATTTAT
GTTGTGAATTCCTTTCAAATTTTTGTAGATTTACTCAGTAGAATTACAAC	CTTTGTGCAATGCCGAGTTCGGTGCTTCAT
GTTGTGAATTCCTTTCAAATTTTTGTAGATTTACTCAGTAGAATTACAAC	TGTATTTCATAAATTTATCTAATCTCTCAA
GTTGTGAATTCCTTTCAAATTTTTGTAGATTTACTCAGTAGAATTACAAC	GGAAACGGGCGTCGGTGAAGTCATCGATAC
GTTGTGAATTCCTTTCAAATTTTTGTAGATTTACTCAGTAGAATTACAAC	TGTTTATAACAAGCTAAGAGGGTGGAAGTC
GTTGTGAATTCCTTTCAAATTTTTGTAGATTTACTCAGTAGAATTACAAC	TACTCCATCATGCGTTATCGATCCCGATAA
GTTGTGAATTCCTTTCAAATTTTTGTAGATTTACTCAGTAGAATTACAAC	ATGTAGAATATGAATCAGATAGAGATGCAA
GTTGTGAATTCCTTTCAAATTTTTGTAGATTTACTCAGTAGAATTACAAC	TCTGAAATTCAGATGCCTGTTTTACTTTAT
GTTGTGAATTCCTTTCAAATTTTTGTAGATTTACTCAGTAGAATTACAAC	ATATTATTTTGAGAAAACTTATAAATCATC
GTTGTGAATTCCTTTCAAATTTTTGTAGATTTACTCAGTAGAATTACAAC	TCGCCATTGGTTTGGACGCCTTGTGCCCAT
GTTGTGAATTCCTTTCAAATTTTTGTAGATTTACTCAGTAGAATTACAAC	TCGCTTCGGTATTGACCGAAATAGCCCACC
GTTGTGAATTCCTTTCAAATTTTTGTAGATTTACTCAGTAGAATTACAAC	ATAAAACATTTCAAACAAAATTCTTTAAGC
GTTGTGAATTCCTTTCAAATTTTTGTAGATTTACTCAGTAGAATTACAAC	TATTAATTCAAGCATAATGTTTTGATGGTT
GTTGTGAATTCCTTTCAAATTTTTGTAGATTTACTCAGTAGAATTACAAC	AAGTAGATCTTGATTTTATAGCTGGCTATA
GTTGTGAATTCCTTTCAAATTTTTGTAGATTTACTCAGTAGAATTACAAC	GCACTGAATATGGATATCCAGACGATCGTC
GTTGTGAATTCCTTTCAAATTTTTGTAGATTTACTCAGTAGAATTACAAC	TTTATAGCAGACGTAGAGGTTGTGGTAAGT
GTTGTGAATTCCTTTCAAATTTTTGTAGATTTACTCAGTAGAATTACAAC	GTACTTGCCGTTCGGTCTTGCGTGGTATAC
GTTGTGAATTCCTTTCAAATTTTTGTAGATTTACTCAGTAGAATTACAAC	CAGTTTCTAATCCAACGCTGAACGTTGATA
GTTGTGAATTCCTTTCAAATTTTTGTAGATTTACTCAGTAGAATTACAAC	GTGGAGTATTTGCTTAATGCCTTTGTTGGC
GTTGTGAATTCCTTTCAAATTTTTGTAGATTTACTCAGTAGAATTACAAC	GCTCAATATATCCAAGAGCAACACAATGGT
GTTGTGAATTCCTTTCAAATTTTTGTAGATTTACTCAGTAGAATTACAAC

>NC_015144|1|1|1975390-1976959|PILER-CR
GTTGTGAATTCCTTTCAAATTTTTGTAGATTTACTCAGTAGAATTACAAC	CTTTGTGCAATGCCGAGTTCGGTGCTTCAT
GTTGTGAATTCCTTTCAAATTTTTGTAGATTTACTCAGTAGAATTACAAC	TGTATTTCATAAATTTATCTAATCTCTCAA
GTTGTGAATTCCTTTCAAATTTTTGTAGATTTACTCAGTAGAATTACAAC	GGAAACGGGCGTCGGTGAAGTCATCGATAC
GTTGTGAATTCCTTTCAAATTTTTGTAGATTTACTCAGTAGAATTACAAC	TGTTTATAACAAGCTAAGAGGGTGGAAGTC
GTTGTGAATTCCTTTCAAATTTTTGTAGATTTACTCAGTAGAATTACAAC	TACTCCATCATGCGTTATCGATCCCGATAA
GTTGTGAATTCCTTTCAAATTTTTGTAGATTTACTCAGTAGAATTACAAC	ATGTAGAATATGAATCAGATAGAGATGCAA
GTTGTGAATTCCTTTCAAATTTTTGTAGATTTACTCAGTAGAATTACAAC	TCTGAAATTCAGATGCCTGTTTTACTTTAT
GTTGTGAATTCCTTTCAAATTTTTGTAGATTTACTCAGTAGAATTACAAC	ATATTATTTTGAGAAAACTTATAAATCATC
GTTGTGAATTCCTTTCAAATTTTTGTAGATTTACTCAGTAGAATTACAAC	TCGCCATTGGTTTGGACGCCTTGTGCCCAT
GTTGTGAATTCCTTTCAAATTTTTGTAGATTTACTCAGTAGAATTACAAC	TCGCTTCGGTATTGACCGAAATAGCCCACC
GTTGTGAATTCCTTTCAAATTTTTGTAGATTTACTCAGTAGAATTACAAC	ATAAAACATTTCAAACAAAATTCTTTAAGC
GTTGTGAATTCCTTTCAAATTTTTGTAGATTTACTCAGTAGAATTACAAC	TATTAATTCAAGCATAATGTTTTGATGGTT
GTTGTGAATTCCTTTCAAATTTTTGTAGATTTACTCAGTAGAATTACAAC	AAGTAGATCTTGATTTTATAGCTGGCTATA
GTTGTGAATTCCTTTCAAATTTTTGTAGATTTACTCAGTAGAATTACAAC	GCACTGAATATGGATATCCAGACGATCGTC
GTTGTGAATTCCTTTCAAATTTTTGTAGATTTACTCAGTAGAATTACAAC	TTTATAGCAGACGTAGAGGTTGTGGTAAGT
GTTGTGAATTCCTTTCAAATTTTTGTAGATTTACTCAGTAGAATTACAAC	GTACTTGCCGTTCGGTCTTGCGTGGTATAC
GTTGTGAATTCCTTTCAAATTTTTGTAGATTTACTCAGTAGAATTACAAC	CAGTTTCTAATCCAACGCTGAACGTTGATA
GTTGTGAATTCCTTTCAAATTTTTGTAGATTTACTCAGTAGAATTACAAC	GTGGAGTATTTGCTTAATGCCTTTGTTGGC
GTTGTGAATTCCTTTCAAATTTTTGTAGATTTACTCAGTAGAATTACAAC	GCTCAATATATCCAAGAGCAACACAATGGT
GTTGTGAATTCCTTTCAAATTTTTGTAGATTTACTCAGTAGAATTACAAC

Protein	Signature genes	Signature genes Name	Protein_function
NC_015144.1\|WP_013598924.1\|1967735_1968800_+\|FecR-family-protein	unknown	unknown	gnl\|CDD\|377406
NC_015144.1\|WP_013598935.1\|1987624_1988293_+\|uracil-DNA-glycosylase	unknown	unknown	gnl\|CDD\|235376
NC_015144.1\|WP_013598930.1\|1978291_1982614_-\|CRISPR-associated-protein-Csn1	cas9	cd09643_cas9_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|375967
NC_015144.1\|WP_013598931.1\|1982945_1984211_+\|Y-family-DNA-polymerase	unknown	unknown	gnl\|CDD\|176454
NC_015144.1\|WP_013598926.1\|1972106_1973549_+\|SusD/RagB-family-nutrient-binding-outer-membrane-lipoprotein	unknown	unknown	gnl\|CDD\|378943
NC_015144.1\|WP_013598932.1\|1984207_1984672_+\|error-prone-repair-protein	unknown	unknown	gnl\|CDD\|224885
NC_015144.1\|WP_013598929.1\|1977397_1978288_-\|type-II-CRISPR-associated-endonuclease-Cas1	cas1	cd09720_cas1_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|274694
NC_015144.1\|WP_168160796.1\|1984814_1985357_-\|SOS-response-associated-peptidase-family-protein	unknown	unknown	gnl\|CDD\|376837
NC_015144.1\|WP_013598920.1\|1964244_1964937_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|212491
NC_015144.1\|WP_013598921.1\|1964929_1965889_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224045
NC_015144.1\|WP_013598918.1\|1962223_1963147_-\|hypothetical-protein	unknown	unknown	unknown
NC_015144.1\|WP_013598928.1\|1977062_1977401_-\|CRISPR-associated-endonuclease-Cas2	cas2	COG3512_cas2_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|226043
NC_015144.1\|WP_013598919.1\|1963193_1964132_-\|hypothetical-protein	unknown	unknown	unknown
NC_015144.1\|WP_013598936.1\|1988352_1989063_-\|3-ketoacyl-ACP-reductase	unknown	unknown	gnl\|CDD\|236074
NC_015144.1\|WP_174254465.1\|1968880_1972084_+\|SusC/RagA-family-TonB-linked-outer-membrane-protein	unknown	unknown	gnl\|CDD\|274948
NC_015144.1\|WP_041942156.1\|1967085_1967661_+\|sigma-70-family-RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|274376
NC_015144.1\|WP_013598922.1\|1965885_1966893_-\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376439
NC_015144.1\|WP_013598934.1\|1985431_1987579_-\|DNA-mismatch-repair-protein-MutS	unknown	unknown	gnl\|CDD\|234750
NC_015144.1\|WP_013598927.1\|1973560_1975147_+\|calcineurin-like-phosphoesterase-C-terminal-domain-containing-protein	unknown	unknown	gnl\|CDD\|379837
NC_015144.1\|WP_013598937.1\|1989375_1990152_-\|glycoside-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|119384

Protein	Function_ID	Function_description	E-value
NC_015144.1\|WP_013598929.1\|1977397_1978288_-\|type-II-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|274694	TIGR03639, cas1_NMENI, CRISPR-associated endonuclease Cas1, subtype II/NMENI. The CRISPR-associated protein Cas1 is virtually universal to CRISPR systems. CRISPR, an acronym for Clustered Regularly Interspaced Short Palindromic Repeats, is a prokaryotic immunity system for foreign DNA, mostly from phage. CRISPR systems belong to different subtypes, distinguished by both nature of the repeats, the makeup of the cohort of associated Cas proteins, and by molecular phylogeny within the more universal Cas proteins such as this one. This model is of type EXCEPTION and provides more specific information than the EQUIVALOG model TIGR00287. It describes the Cas1 variant of the NMENI subtype of CRISPR/Cas system.	9.04288e-107
NC_015144.1\|WP_013598924.1\|1967735_1968800_+\|FecR-family-protein	gnl\|CDD\|377406	pfam04773, FecR, FecR protein. FecR is involved in regulation of iron dicitrate transport. In the absence of citrate FecR inactivates FecI. FecR is probably a sensor that recognizes iron dicitrate in the periplasm.	3.94875e-16
NC_015144.1\|WP_013598935.1\|1987624_1988293_+\|uracil-DNA-glycosylase	gnl\|CDD\|235376	PRK05254, PRK05254, uracil-DNA glycosylase; Provisional.	2.10616e-126
NC_015144.1\|WP_013598931.1\|1982945_1984211_+\|Y-family-DNA-polymerase	gnl\|CDD\|176454	cd01700, PolY_Pol_V_umuC, umuC subunit of DNA Polymerase V. umuC subunit of Pol V. Pol V is a bacterial translesion synthesis (TLS) polymerase that consists of the heterotrimer of one umuC and two umuD subunits. Translesion synthesis is a process that allows the bypass of a variety of DNA lesions. TLS polymerases lack proofreading activity and have low fidelity and low processivity. They use damaged DNA as templates and insert nucleotides opposite the lesions. Pol V, RecA, single stranded DNA-binding protein, beta sliding clamp, and gamma clamp loading complex are responsible for inducing the SOS response in bacteria to repair UV-induced DNA damage.	1.46073e-143
NC_015144.1\|WP_013598926.1\|1972106_1973549_+\|SusD/RagB-family-nutrient-binding-outer-membrane-lipoprotein	gnl\|CDD\|378943	pfam12771, SusD-like_2, Starch-binding associating with outer membrane. SusD is a secreted starch-binding protein with an N-terminal lipid tail that allows it to associate with the outer membrane.	4.52855e-159
NC_015144.1\|WP_013598932.1\|1984207_1984672_+\|error-prone-repair-protein	gnl\|CDD\|224885	COG1974, LexA, SOS-response transcriptional repressors (RecA-mediated autopeptidases) [Transcription / Signal transduction mechanisms].	1.87703e-15
NC_015144.1\|WP_013598930.1\|1978291_1982614_-\|CRISPR-associated-protein-Csn1	gnl\|CDD\|375967	pfam18541, RuvC_III, RuvC endonuclease subdomain 3. Cas9 proteins are abundant across the bacterial kingdom, but vary widely in both sequence and size. All known Cas9 enzymes contain an HNH domain that cleaves the DNA strand complementary to the guide RNA sequence (target strand), and a RuvC nuclease domain required for cleaving the noncomplementary strand (non-target strand), yielding double-strand DNA breaks (DSBs). The crystal structures of type II-A and II-C Cas9 proteins highlight the features in Cas9 enzymes that support their function as RNA-guided endonucleases. Cas9 enzymes adopt a bilobed architecture composed of a nuclease lobe containing juxtaposed RuvC and HNH nuclease domains and a variable alpha-helical lobe likely to be involved in nucleic acid binding. The RuvC domain forms the structural core of the nuclease lobe, a six-stranded beta sheet surrounded by four alpha helices, with all three conserved subdomains (I, II, III) contributing catalytic residues to the active site.	2.80293e-54
NC_015144.1\|WP_168160796.1\|1984814_1985357_-\|SOS-response-associated-peptidase-family-protein	gnl\|CDD\|376837	pfam02586, SRAP, SOS response associated peptidase (SRAP). The SRAP family functions as a DNA-associated autoproteolytic switch that recruits diverse repair enzymes onto DNA damage. We propose that the human protein Q96FZ2:UniProtKB, the eukaryotic member of the SRAP family, which has been recently shown to bind specifically to DNA with 5-hydroxymethylcytosine, 5-formylcytosine and 5-carboxycytosine, is a sensor for these oxidized bases generated by the TET (tetrahedral aminopeptidase of the M42 family) enzymes from methylcytosine. Hence, its autoproteolytic activity might help it act as a switch that recruits DNA repair enzymes to remove these oxidized methylcytosine species as part of the DNA demethylation pathway downstream of the TET enzymes.	1.41521e-37
NC_015144.1\|WP_013598920.1\|1964244_1964937_-\|SDR-family-oxidoreductase	gnl\|CDD\|212491	cd05233, SDR_c, classical (c) SDRs. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human prostaglandin dehydrogenase (PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, PGDH numbering) and/or an Asn (Asn-107, PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	5.19741e-48
NC_015144.1\|WP_013598921.1\|1964929_1965889_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224045	COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism].	6.99889e-61
NC_015144.1\|WP_013598928.1\|1977062_1977401_-\|CRISPR-associated-endonuclease-Cas2	gnl\|CDD\|226043	COG3512, COG3512, CRISPR-associated protein, Cas2 homolog [Defense mechanisms].	1.87945e-27
NC_015144.1\|WP_013598937.1\|1989375_1990152_-\|glycoside-hydrolase-family-protein	gnl\|CDD\|119384	cd06524, GH25_YegX-like, YegX is an uncharacterized bacterial protein with a glycosyl hydrolase family 25 (GH25) catalytic domain that is similar in sequence to the CH-type (Chalaropsis-type) lysozymes of the GH25 family of endolysins.	2.10379e-72
NC_015144.1\|WP_013598936.1\|1988352_1989063_-\|3-ketoacyl-ACP-reductase	gnl\|CDD\|236074	PRK07666, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional.	7.74678e-125
NC_015144.1\|WP_174254465.1\|1968880_1972084_+\|SusC/RagA-family-TonB-linked-outer-membrane-protein	gnl\|CDD\|274948	TIGR04056, OMP_RagA_SusC, TonB-linked outer membrane protein, SusC/RagA family. This model describes a distinctive clade among the TonB-linked outer membrane proteins (OMP). Members of this family are restricted to the Bacteriodetes lineage (except for Gemmatimonas aurantiaca T-27 from the novel phylum Gemmatimonadetes) and occur in high copy numbers, with over 100 members from Bacteroides thetaiotaomicron VPI-5482 alone. Published descriptions of members of this family are available for RagA from Porphyromonas gingivalis, SusC from Bacteroides thetaiotaomicron, and OmpW from Bacteroides caccae. Members form pairs with members of the SusD/RagB family (pfam07980). Transporter complexes including these outer membrane proteins are likely to import large degradation products of proteins (e.g. RagA) or carbohydrates (e.g. SusC) as nutrients, rather than siderophores. [Transport and binding proteins, Unknown substrate].	2.16468e-150
NC_015144.1\|WP_041942156.1\|1967085_1967661_+\|sigma-70-family-RNA-polymerase-sigma-factor	gnl\|CDD\|274376	TIGR02985, Sig70_bacteroi1, RNA polymerase sigma-70 factor, Bacteroides expansion family 1. This group of sigma factors are members of the sigma-70 family (TIGR02937) and are found primarily in the genus Bacteroides. This family appears to have resulted from a lineage-specific expansion as B. thetaiotaomicron VPI-5482, Bacteroides forsythus ATCC 43037, Bacteroides fragilis YCH46 and Bacteroides fragilis NCTC 9343 contain 25, 12, 24 and 23 members, respectively. There are currentlyonly two known members of this family outside of the Bacteroides, in Rhodopseudomonas and Bradyrhizobium.	7.15579e-30
NC_015144.1\|WP_013598922.1\|1965885_1966893_-\|iron-ABC-transporter-permease	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	1.38172e-53
NC_015144.1\|WP_013598934.1\|1985431_1987579_-\|DNA-mismatch-repair-protein-MutS	gnl\|CDD\|234750	PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed.	3.54775e-107
NC_015144.1\|WP_013598927.1\|1973560_1975147_+\|calcineurin-like-phosphoesterase-C-terminal-domain-containing-protein	gnl\|CDD\|379837	pfam16370, MetallophosC, C terminal of Calcineurin-like phosphoesterase. This is the C-terminal of Calcineurin-like phosphoesterases. It is around 150 residues in length from various Bacteroides species. The function of this family is unknown.	1.58274e-51

>NC_015144.1|WP_013598927.1|1973560_1975147_+|calcineurin-like-phosphoesterase-C-terminal-domain-containing-protein
MKKIIFSIAVIVNLQANAQQIVKGIVFEDRNNNGRLDKKEKGIENVAVSNGIDVVLTDSKGRYTLTVNDDNQVFVIKPSHYKTPLDTYFTPKFYHTHKPKGSPKNFKYAGVEPTKKLPKSVDFPLLPEKESSTFTAFVFGDPQAYTEEELTFFRKAIVDDAMQHKENVSFGISLGDLVGDDLSLQPKYKKIMSALSLPWYNVIGNHDMNFEATIDEYSDETFEKNFGPSTYAFNYGNAHFLILDNILYPNPRGGKGYLGGFRQDQLEFIKNDLKFVPKNKLIVLSFHIPIFIEGEDHFDKESRQQLLAILKDFPNVLMMSAHTHYQMHQFYGKDKGWEGAKPLHEYNVGTTSGDWYSGELNALGVPVSTMRDGTPRGYAYLTVKDNQYELDYKVASKPLDYKMEIYAPNVIANKGWNTSYVVANIFMGSEKDQVEIRFGNGKWQKMEKTLQEDPTFYHQVQRWDISQELLTGRRPSNPIKSSHLWQKKLPNNLGIGEHSIEVRVLDMFGRTYSNSTTYRIEEKKEIAK
>NC_015144.1|WP_013598926.1|1972106_1973549_+|SusD/RagB-family-nutrient-binding-outer-membrane-lipoprotein
MKNLFVKISLFSLLCSGPIACTEDFDQTNINPNLVSEVTPGSLINPVLYNLASNNAIKNYDITSALMQVHVPFPDVTAGGVHRYDITDRTGNSSWNAAYRWLTNINEMLVRSKELKQSNYEAISLTLRAYAFANLTDIFGDVPFSEAFRAEEGISQAKFDSQKEIYQTLLADLERANSLYDHKIPLPYVADLLFGNDITKWQKFTNSLHLRLLLRVSDKSEMNAFPKMVNMLSNPEKYPIMTSNLDNAVLQVTGISPNVSPWARPQDFNNGRAMAEFFIDQLVESKDPRILKIATQAKSLGDNNSIGYKGIPAGYDGSEAFDFSPSGLLRIQAEAPMKITLFTYSEIEFIQAELAYKGYTSDAEKHYQNGVKAAIEYLTEEEIPIDYFDSDATRYDGTLERIMLQKYLSLYFVDYQQWFEYRRTGYPNLPKIPAGKNDGVVPSRLLYPSSVKIYNKENYDKAVAAMGGDNINTKVWWQTK
>NC_015144.1|WP_174254465.1|1968880_1972084_+|SusC/RagA-family-TonB-linked-outer-membrane-protein
MKKLKLFIQMKRYLTLLSLCFAAVQMVAQENSKIKGIVQDEKGKPVSGASVHITSDSDTSISFSTTTNSNGIFEVSGLLSDEKYDIEIDHLHHESYYIDNYKVNAGDNNSLSVKLNQSIGLEAAVVTALGIKREEKKLGFAQQTIDSESLNNAENNNWSDGLKGKVAGLNIISAGSGPINSQNIVLRGNNSTELHKNYALIVIDGVPMNPEMTSSGNNSSYMGADSPIDFGNAISDLNPNDIESVTVLKGPSAAALYGSRAANGAIMITTKSGNKNKKIGVDFRSSLMVDVINRWPDYQYEYGQGTLQKNKKGEFYYSYGNSSDGNSTSATSSAFGPKFDGQFYYQYDPFLQGQGEERTLWRPYKDNRKAFWNTGITFTNNVSISGSGKEGAMRASFGHVKNSWIMPNTGFDSYTASINANYNVSERIKLTSVVNYTNKVSDNIPGTGYNNGSIAYFMIFQNPNVSLDWYRDRWYAGQEYLSQIQPYSSYIDNPYVIAYDATNPLQSNQITGNIQANIQLTSKLNFMLRSGVNMYNQIRQQNRPHDMNRWLNGHYKRQDIQKREINTDFLLSYQDYIGEDFSMSMNFGGNKRDYQYLRKDAQVDELVIPNVYMLSNGMNSPIVKTYDKYIKVNSLYGLISLGFRDQVFIDITARNDWSSTLPKNNRSYFYPSVSSSFILSDIFRLSKPIDYLKYRLSFAQVGNDAEPYSTSKYYNANDFPGSSTTPSKLHNLDLKPEISKSWETGIELMMFRKRVGIDVTLYQTNTRNQIIEVPTDQVTGYTSAIINGGEVRNRGIEVMLNLKPIRTTDFTWQLIGNWAINENRIIALTDGVEEKPLASSGTVSVIGKVGGTTTALYGYGFVRDNQGNIVYENGVPAYPTEIQYIGDAAPKWRAGLTNSFKYKNLSLSVTLDGQYGGIVYSQSHHKMMEQGKLKATLPGRDTGFIVGEGVVQNPDGSYSPNTEQVKITDYYAKYYRRANVESNSFDASYLKLREVNFTYNLPKKLIEKTGLDNLSLSVFGKNLAVWSDFPLYDPETASIEGSTIIPGVEMGQMPSTASIGFTLKASL
>NC_015144.1|WP_013598924.1|1967735_1968800_+|FecR-family-protein
MIRKLLEKYWSNNSSLEEKKELLEIIDNPKVVSEKITQTWSENDNTIMIDKRLSRKVLQKIHQKINETHKTKKHFSTYSSFIKFSIAASLVLFCVFGLLYHKNIASTSTVALVNYDTISNETADKLMNIRLNDNSTVVLYPKSEIVYDGQFNQKNRAVLLMGKAKFKVYKNKELPFTVSIKSFTTTALGTEFIVTENIKNNQASVQLLEGKVRIDSQKKAAFESVFLNAGENFWLDLENNQVQITNQKISKPKTVSTKKYTEKTEIITLPEIPETEKNNEITDEIIFDKTPLIDVFDKIEKTYQTKIHTTNIPKELTFTGRFKSTDNYQQIIEIICQLNDLQYQAIDKQVYIEK
>NC_015144.1|WP_041942156.1|1967085_1967661_+|sigma-70-family-RNA-polymerase-sigma-factor
MKVKISKTLEEKQFDQIYFQYHSSIYRNIRKLIYDEDIALDILQEVFITLWNHRAEKLADTALAGWLFTVSYNKSIDYLRKTIKEEIAESDKIFSIQSNYEESLEFEQQYSLKLELIEEAVENLSPRRKEVFRLCRFEGYTKDEVAQMLKISTDSVSDYLKQANQFIREYIQKEYPTYSSLFVLSCLIKFF
>NC_015144.1|WP_013598922.1|1965885_1966893_-|iron-ABC-transporter-permease
MKKHWLTITCLLIVFIFICLNLLIGKANISIEDIFRILVGQSEDNFAQNLILHYRLPKVITSILVGLALPIAGFLLQELFKNSLAEPSVLGITAMASLGVAIVVFLFSIIGLDYLLGNSWLTISAAMIGSLTALVLIGTFSYRVKSSTALIVLGMMLSGLAVSFIGLLQYFAPSEKIKSFLLWSFGSLTGLKWEQIFVFSLCVFTGLLLAYGTLKSLTFLLLGEKYAQTLGVNLLRLRFTLLLSTSILTAAATAFAGPIAFIGLAVPHICRNILKTSNMHYLFFSVMMMGAALMLIFSFLTDIFPFGTFPINIITSLFGTPIVISIVLKNSKSEG
>NC_015144.1|WP_013598921.1|1964929_1965889_-|ABC-transporter-ATP-binding-protein
MNNRTVDNIRLENLVVGYKNKTLLKELNLQIETGKFIVLLGNNGAGKSSLLNTILGINQPISGDILYSNQAISQMKTSEIAKQVAVVFSNLTHIPTIKVADLIEIGANDHFSYKQQMALNRVILEEIPIKNILDKYATEISEGQLQLAMITRALKQNTPFLLLDEPTANLDLGNQFRIFDLLKKLSKQLQKTFLMATHQVDLALEMADEIWWIENKQLVSGLPEDIAYRYRILEKLSDNILQFIPSRNIYSIPIETKKTVNLQGEGELFYWTSKALLKQGYQQSSLSQTSVIVREKEIYYEDKTFHSIEKFIYYFIQNA
>NC_015144.1|WP_013598920.1|1964244_1964937_-|SDR-family-oxidoreductase
MHKNIIVTGASRGIGKEIAKQHLALGNRVLTISRNLEKLDELNHFAQPNQLINIGLDLSKYKDIDQILAYIKDWETVDILYNNAGLCINKPFEDVSEQDLLHSWQINFMAPYRLIQLLLTKFTNTSHVVNISTMGAVQGSVKFAGLSAYSSSKSATCNLTELLAEELNQNGPRINCIALGAVQTEMLQEAFPGYQAPTTPKEMAEFLVDFGLNGHRFFNGKILPASISTP
>NC_015144.1|WP_013598919.1|1963193_1964132_-|hypothetical-protein
MKHFYTFLFIHILGFQQLYAQINYEEQSVQVKPQWYVGNQYNYQFTDVDYVISINDTISKVVTNSHKKFSVLDENPYVYKLRWENLAVSTNDPDPFYNDYMVNSKGVNYEFATNKDGEFLELLNEDGVKNQLMAVAKNLKRKNRRNAIYQANVSGLEDMILSQDYVSYTFSQEINNLLQFNGLYLKVGEKYQGKQIQENLFGFPISSTSTTWLEGIDPKSETYTIVTSQILSKEDFESLWQLMAKSMLEQSNVNLTHEQVEREIKKYSDTIELTIDYKNKYNKDSILINSHYKFSLNIGAKKTVNQLEIELL
>NC_015144.1|WP_013598918.1|1962223_1963147_-|hypothetical-protein
MKIFYCILFTFLAIISQAQTNDNDSVVEVKQYLNIDNQYNYKITTYDTRTEGLDTIQKEYLSYKVSINVLDLYQDQYTLHWRITNIENSKKQISKNPLSILDEIDIYYSVDSDGKFLGFQTNNWTMVQFYTALENAEDDYADNSEVLKTLAEMEKQYATADKLNSLFEKEIKQFHYFFGLGNFTVNSEPKVYKTYLDNLFNPNPTPAITTYSLREISPYLGNYVMISSSVAEEEWLKESWFNYLEKIAKEMKVDAPDRSTIDDNIIYTVDTMSRIKENGWPSYCLQSKKVYFQNTEFTQKRVIEILP
>NC_015144.1|WP_013598928.1|1977062_1977401_-|CRISPR-associated-endonuclease-Cas2
MSFSRYNAYRIMWVLVFFDLPTETKKHRAIATRFRKKLLDDGFTMFQFSIYIRHCPSRENADVHIKRVKKSLPPEGKVGILCITDKQFGQMELYFAQKETDLPQVPQQLELF
>NC_015144.1|WP_013598929.1|1977397_1978288_-|type-II-CRISPR-associated-endonuclease-Cas1
MLKRTIYIGNPAYLKFKDHQLKIEDPETKQEKASIPIEDLGFLVLDHYQITISQPLIVALQQNNVAIISCDESHLPLGLMLPISGHVEHSERLKHQVNISEPLRKQLWKQTVEAKIFQQKEVLRLNNLPHDRMITYMNSVKSGDSTNMEGIAAQYYWSTLFDDFIRDRKGDAPNNFLNFGYAVLRSMVARAIVCSGLHPTIGIFHKNKYNAYCLADDLMEPYRPYVDLLVVEWMQKPFSPYQLDKNVKAHLLQIATRDVTINGLQRPLMTALSITSSSLYKCFTGENRVLSYPMLS
>NC_015144.1|WP_013598930.1|1978291_1982614_-|CRISPR-associated-protein-Csn1
MKTILGLDLGTNSIGWALVEQDFENKQGLILGMGSRIIPMDAGIIGKFAEGSSISQTAERTGYRSIRRLRERHLLRRERLHRVLNILKFLPEHYAAEIDFEKRFGQFLAETEPKLAWKKNAEGKFEFLFQRSFDEMVADFKANGQDIKIPYDWTIYYLRKKALTQKISPQELAWIILNFNQKRGYYQLRGEEEEENPNKKVEFYSLKIVDVVADEQPNKKGDTWYSLHLENGWVYRRSSKIPLYDWKDKVRDFIVTTDINEDGSEKLDKDGEVKRSFRAPKEDDWTLIKKKTEQEIEQFNQTVGSYIYEALLDNPTQKIRGKLVRTIERKFYKSELKKILEKQIELQPELFTEDLYNACARELYRRNVAHQQQLSSRDFVYLFLNDIIFYQRPLRSQKSLISNCSLEFRTIKDKDGNGQIIYLKAIPKSNPYYQEFRVWQWLYNLKIFTKEDDKDVTNQFINKVEDLEALFEFLMNQKEVNHTDILTYLIEPIVKSKYPNAKGKAFKDELKKELKKYRWNYVYDADKDESKSYPMNETRYELRKRLDKVENVPADFMTRKIEQHLWHIIYSVTDKIEFEKALKSFANKYDLHQESFVENFKRFKPFDSDYGTYSEKAIKKLLPLMRVGKYWSWDIIDDKTKTRIGKIITGEYDETIKNRVREKAIDLTEENHFQGLQLWLAQYIVYDRHSEADIAGKWNSVADLEQYLSEFKQHSLRNPIVEQVITETLRVVRDIWKQYGKGAKDYFDEIHIELGREMKNTAEERKRLSSIISENETTNLRIRAILEELMYDENMENVRPYSPMQQEALKIYEDGVLSSSVEIPEDIEKISKKSEPTKSEIQRYKLWLEQKYRSPYTGRPIPLSKLFTPAYQIEHIIPQARFFDDGFSNKVICESEVNALKDKMLGLEFIQNYYGQKVTTSFGEVTILTEDAYKAFVKEHYDKNRSKRNKLLLEEIPEKMIDRQMNDTRYISKYISKVLSNLVRGEKDDEGVNSKNIIPGNGKITGILKQDWGLNDVWNDLILPRFERMNQLTNSTDFTAWNEKHQKFLPSVPLELSKGFQKKRIDHRHHALDALIIACATRDHVNLLNNKHAKSRNERYDLQHKLRHTTPWQDKEGKVRTKFTEFKKPWETFTQDTKKELEKIVVNFKQNLRVINKATNYYEKIVDGKKVMFKQEGVNWAIRKPMHKETVSGKIDLPRVKVSKGKILTATRKSLDTSFNAKTILSITDTGIQKILLNYLKAKGNPELAFSPEGIEEMNQNISLYNDGKPHQPILKVRVFEQGSKFPLGETGNKTTKYVEAAKGTNLFFGVYEDNQGKRSYDTIPLNIVIERQKQGLNSVPETNEKGHRLLFSLSPNDLVYVPIEGEVFDETNPDVNRIYKVVSFSGSQMFCVRQDVATSIVYKLEFSSLNKMERTIDGIMIKEICIKLKVDRLGNISKA
>NC_015144.1|WP_013598931.1|1982945_1984211_+|Y-family-DNA-polymerase
MYALIDCNNFYASCERIFNPKLRGKPIVVLSNNDGCVIARSDEAKALGIPMGAPAFEYDGFFRLHKVHVFSSNYVLYADMSNRVVKILQTFCPAVEVYSIDESFLCLKGFDSIDLEKYGQQIKDTIFQLTKLPVCVGIAPTKTLAKAANRIAKKFPNHHQGVYIIDTEIKKNKALKWLKCEDIWGIGHQLSRRLNYIGCRTAYDFSRLDDAYIRRNFSVVELRLKKELLGESVLQLEEVKRKKSIATTRSFEHTIDNYDELKERVATFAISCAEKLRQEQSNCKMITVFVMTNRFDEHLPFVSATLSTTLESDSSSSIVLSKTALFLLDKLVPSEGKVPAYKKAGVIVSGITPNHQTQLNIFYEESTKHKALMQVMDKINARYGGHKLLLGSQDLQRKWKMKQERLSPNYTTNWQEILTVQ
>NC_015144.1|WP_013598932.1|1984207_1984672_+|error-prone-repair-protein
MKLIQDIQFGNELEFLTIEKVNTRYYAHYYGDVSAGFPSPAEDFRQERISLDERFLSKPESTFLVRVGGLSMYPHYQMNDVLVNRSDYQLMHGDDAVVSINNSDFTLKRWDANKKMFYALNPDFKDSLIIQPEDVVVCLGVVSTIIRELKRFRK
>NC_015144.1|WP_168160796.1|1984814_1985357_-|SOS-response-associated-peptidase-family-protein
MENNTRIPFLSNQKFEPKEHFNGFAHPYLPIIKTGQEAIELLQWGLKPSWAQEDFDTNNTLNARVETLEEKPSFRESFNNRCVLVVDSFYEWRHEGRNKIRYEIGHDNELLFLAALYQNDTFSVVTTEALGVMKYIHNRKQRMPIAFDSLPSCEQWLHGEDFVPFIDFSTQREDNQIRLF
>NC_015144.1|WP_013598934.1|1985431_1987579_-|DNA-mismatch-repair-protein-MutS
MQVSKQTLKDLEFPVVLAEIIQYIYTEKVAERTKNLVPYSNRNELLIDLHTTSEYLSTLESGNSLPFSEYFILDEYLKRLSIENYYLPAEEFFKIKSNTLQIKEIKKYTRNFIEYVPYLHAKTEQIIYEKEIVKIIDQVFNKFGEIKDDASPELRIVRQEIRAISSRITELFNKSMSYHSDVLDEIRESVVGNRRVLAVKSALRKRVKGQFLGTSKTGSISYIEPESVLNPRRQLDELREEEKHLIIQILLKLTSEIAIYQPLIEEYQAFLEYLDLTQAKAKYAQNIQAILPTLKEELQLQLIDAYHPVLYLNNLRKERRTIPQTLSLTKKQRIIIISGPNAGGKSITLKTVGLNQLMIQSGILIPVHPKSEVGFFDKIFTDIGDNQSIENHLSTYSYRLKQMAYFLKYADEKSLLLVDEFGTGSDPELGGALAEVFFEEFYERNAYGIFTTHYTNIKLSAERLEEAINASMLFDKKSLEPMYKLELGQAGSSFTFEVAEKNKIPYRLINRAKKKVENDKVRLDKTILKLQQEKFEIQKTRDQVVELKETHEAHQGKLEEMQDKIQQKLYDFQQLYASEQKTLMMGKRINEMADSYLKSKNKKQLISNFLKIIEMENSKKTNEIQQQKKIEKIVAKEVQRELKSNANEIKKEQHKKEQREKEAMQKKIRELKIGDRVKINGSSSVGTIDKIKDDIIFINYGVFTTKISVDEVYKI
>NC_015144.1|WP_013598935.1|1987624_1988293_+|uracil-DNA-glycosylase
MFDNIQDEKWLEVFRQEAKKDYFRDLIVFIEREYAEHTVYPPKSELFSAFLQTPFDAIKVVILGQDPYHGNGQANGLAFSVNSSVKIPPSLRNIFKELETDVLKKMPTSGDLLPWAKQGVFLLNDVLSVRKASAGSHKNKGWETFTQTIIQTISDQKEHVVFLLWGNHAHKKEKLIDTSKHLILKSGHPSPMSANQGKWFGNHHFSQTNSYLEKHNKEKINW
>NC_015144.1|WP_013598936.1|1988352_1989063_-|3-ketoacyl-ACP-reductase
MLNTKKALITGGSRGLGKAIALAFAKEGIDVAITGRNKDLLKKVVTELQELGVRATYAIFDIKNREEVHSSLTKLTEDFGPFDILVNNAGISKFGTLLEMEESDWENILLTNVLGMYYVTREILPQMIEKNEGDIFNVSSTAGLAGNPTTSAYSASKFAVIGMNESLMKEVRKNNIRVTTLTPSTIASDMSKQLGLTDGNPESVLQPEDFAELIVATLKLPRRALLKSASLWSTNP
>NC_015144.1|WP_013598937.1|1989375_1990152_-|glycoside-hydrolase-family-protein
MTRKVALWVLAIFITILLLFAAYRLIKNPVYLKNKELTTFDKRNIELMKNHRDKCFGIDISQYQGEIHWKSVEKINHLYPINFVVVRASMGKDGADKKFTSNWKKAKQKNLIRGAYHYYRPDEESELQALNFIAKVSLSPGDLPPVLDIEEYPTIQTKENLIKGLKNWLKIIEEYYDVKPIIYSYDKYYEHILNEHFSDYPLWIANYNFDVTQPKEKWLFWQFSENGSVKGIKGTVDLNIFNGNVFDLQNLTTKKMVY

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NC_015144_1	1.8\|1975920\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1975920-1975949	30	NC_015144.1	252000-252029	0	1.0
NC_015144_1	1.12\|1976240\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976240-1976269	30	NC_015144.1	242810-242839	0	1.0
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NC_015144.1	237175-237204	0	1.0
NC_015144_1	1.15\|1976480\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976480-1976509	30	NC_015144.1	233821-233850	0	1.0
NC_015144_1	1.16\|1976560\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976560-1976589	30	NC_015144.1	269922-269951	1	0.967
NC_015144_1	1.17\|1976640\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976640-1976669	30	NC_015144.1	235852-235881	1	0.967
NC_015144_1	1.18\|1976720\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976720-1976749	30	NC_015144.1	240878-240907	2	0.933

1. spacer 1.8|1975920|30|NC_015144|CRISPRCasFinder,PILER-CR matches to position: 252000-252029, mismatch: 0, identity: 1.0

tctgaaattcagatgcctgttttactttat	CRISPR spacer
tctgaaattcagatgcctgttttactttat	Protospacer
******************************

2. spacer 1.12|1976240|30|NC_015144|CRISPRCasFinder,PILER-CR matches to position: 242810-242839, mismatch: 0, identity: 1.0

ataaaacatttcaaacaaaattctttaagc	CRISPR spacer
ataaaacatttcaaacaaaattctttaagc	Protospacer
******************************

3. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to position: 237175-237204, mismatch: 0, identity: 1.0

tattaattcaagcataatgttttgatggtt	CRISPR spacer
tattaattcaagcataatgttttgatggtt	Protospacer
******************************

4. spacer 1.15|1976480|30|NC_015144|CRISPRCasFinder,PILER-CR matches to position: 233821-233850, mismatch: 0, identity: 1.0

gcactgaatatggatatccagacgatcgtc	CRISPR spacer
gcactgaatatggatatccagacgatcgtc	Protospacer
******************************

5. spacer 1.16|1976560|30|NC_015144|CRISPRCasFinder,PILER-CR matches to position: 269922-269951, mismatch: 1, identity: 0.967

tttatagcagacgtagaggttgtggtaagt	CRISPR spacer
tttgtagcagacgtagaggttgtggtaagt	Protospacer
***.**************************

6. spacer 1.17|1976640|30|NC_015144|CRISPRCasFinder,PILER-CR matches to position: 235852-235881, mismatch: 1, identity: 0.967

gtacttgccgttcggtcttgcgtggtatac	CRISPR spacer
gtacttggcgttcggtcttgcgtggtatac	Protospacer
******* **********************

7. spacer 1.18|1976720|30|NC_015144|CRISPRCasFinder,PILER-CR matches to position: 240878-240907, mismatch: 2, identity: 0.933

cagtttctaatccaacgctgaacgttgata	CRISPR spacer
cagtttctaatccaacgctgaacattaata	Protospacer
***********************.**.***

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_015144_1	1.1\|1975360\|30\|NC_015144\|CRISPRCasFinder	1975360-1975389	30	AJ842011	Bacteriophage 11b complete genome	11631-11660	5	0.833
NC_015144_1	1.1\|1975360\|30\|NC_015144\|CRISPRCasFinder	1975360-1975389	30	NC_006356	Flavobacterium phage 11b, complete genome	11631-11660	5	0.833
NC_015144_1	1.9\|1976000\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976000-1976029	30	MF360958	Salicola phage SCTP-2, complete genome	114390-114419	5	0.833
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MF547664	Clostridioides difficile strain LIBA-6289 plasmid LIBA6289, complete sequence	65016-65045	5	0.833
NC_015144_1	1.3\|1975520\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1975520-1975549	30	MN694026	Marine virus AFVG_250M644, complete genome	3671-3700	6	0.8
NC_015144_1	1.3\|1975520\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1975520-1975549	30	NZ_CP009921	Bacillus megaterium NBRC 15308 = ATCC 14581 plasmid pBMV_2, complete sequence	221761-221790	6	0.8
NC_015144_1	1.3\|1975520\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1975520-1975549	30	NZ_CP035095	Bacillus megaterium NBRC 15308 = ATCC 14581 plasmid unnamed1, complete sequence	255183-255212	6	0.8
NC_015144_1	1.3\|1975520\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1975520-1975549	30	NC_013940	Deferribacter desulfuricans SSM1 megaplasmid pDF308, complete sequence	72204-72233	6	0.8
NC_015144_1	1.5\|1975680\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1975680-1975709	30	NZ_CP029455	Bacillus cereus strain FORC087 plasmid pFORC087.1, complete sequence	410293-410322	6	0.8
NC_015144_1	1.5\|1975680\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1975680-1975709	30	CP024686	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-2-313K, complete sequence	208838-208867	6	0.8
NC_015144_1	1.12\|1976240\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976240-1976269	30	MN180249	UNVERIFIED: Wolbachia phage WO isolate Seq2WORi_AMD2 genomic sequence	6258-6287	6	0.8
NC_015144_1	1.1\|1975360\|30\|NC_015144\|CRISPRCasFinder	1975360-1975389	30	AJ842011	Bacteriophage 11b complete genome	11874-11903	7	0.767
NC_015144_1	1.1\|1975360\|30\|NC_015144\|CRISPRCasFinder	1975360-1975389	30	NC_006356	Flavobacterium phage 11b, complete genome	11874-11903	7	0.767
NC_015144_1	1.3\|1975520\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1975520-1975549	30	NZ_LR735422	Staphylococcus epidermidis strain none isolate Se_BPH0697 plasmid 2	51206-51235	7	0.767
NC_015144_1	1.3\|1975520\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1975520-1975549	30	NZ_CP031268	Staphylococcus warneri strain 16A plasmid unnamed2	10348-10377	7	0.767
NC_015144_1	1.3\|1975520\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1975520-1975549	30	NZ_CP031268	Staphylococcus warneri strain 16A plasmid unnamed2	45592-45621	7	0.767
NC_015144_1	1.3\|1975520\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1975520-1975549	30	NZ_HG813246	Staphylococcus epidermidis PM221 plasmid 1, complete sequence	13729-13758	7	0.767
NC_015144_1	1.3\|1975520\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1975520-1975549	30	NZ_CP042875	Bacillus cereus strain 09 plasmid unnamed1, complete sequence	316137-316166	7	0.767
NC_015144_1	1.4\|1975600\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1975600-1975629	30	NZ_CP040761	Paracoccus sp. 2251 plasmid unnamed5, complete sequence	7266-7295	7	0.767
NC_015144_1	1.4\|1975600\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1975600-1975629	30	NZ_CP054032	Rhizobium sp. JKLM13E plasmid pPR13E01, complete sequence	913560-913589	7	0.767
NC_015144_1	1.7\|1975840\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1975840-1975869	30	NC_007021	Staphylococcus phage Twort, complete genome	71973-72002	7	0.767
NC_015144_1	1.7\|1975840\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1975840-1975869	30	MT151386	Staphylococcus virus Twort, complete genome	114502-114531	7	0.767
NC_015144_1	1.7\|1975840\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1975840-1975869	30	NZ_CP045273	Bacillus megaterium strain FDU301 plasmid pFDU301A, complete sequence	593953-593982	7	0.767
NC_015144_1	1.9\|1976000\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976000-1976029	30	NZ_CP022299	Acinetobacter johnsonii strain IC001 plasmid pIC001A, complete sequence	4793-4822	7	0.767
NC_015144_1	1.9\|1976000\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976000-1976029	30	MN694614	Marine virus AFVG_250M469, complete genome	51463-51492	7	0.767
NC_015144_1	1.18\|1976720\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976720-1976749	30	MT423824	Staphylococcus virus pSp_SNUABM-S, complete genome	8032-8061	7	0.767
NC_015144_1	1.18\|1976720\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976720-1976749	30	MT423823	Staphylococcus virus pSp_SNUABM-J, complete genome	8610-8639	7	0.767
NC_015144_1	1.20\|1976880\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976880-1976909	30	MN694574	Marine virus AFVG_250M706, complete genome	12651-12680	7	0.767
NC_015144_1	1.3\|1975520\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1975520-1975549	30	NZ_CP022909	Staphylococcus aureus strain 545 plasmid pPS00078.1A.1, complete sequence	3892-3921	8	0.733
NC_015144_1	1.3\|1975520\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1975520-1975549	30	NZ_CP007500	Staphylococcus aureus strain 2395 USA500 plasmid pUSA500, complete sequence	15488-15517	8	0.733
NC_015144_1	1.3\|1975520\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1975520-1975549	30	NZ_CP027420	Staphylococcus cohnii strain FDAARGOS_334 plasmid unnamed1, complete sequence	22815-22844	8	0.733
NC_015144_1	1.3\|1975520\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1975520-1975549	30	NZ_CP046300	Staphylococcus hominis strain FDAARGOS_747 plasmid unnamed1, complete sequence	3456-3485	8	0.733
NC_015144_1	1.3\|1975520\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1975520-1975549	30	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	11199-11228	8	0.733
NC_015144_1	1.3\|1975520\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1975520-1975549	30	NZ_CP035293	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed2, complete sequence	6970-6999	8	0.733
NC_015144_1	1.3\|1975520\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1975520-1975549	30	NC_013321	Staphylococcus aureus plasmid SAP017A, complete sequence	15433-15462	8	0.733
NC_015144_1	1.3\|1975520\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1975520-1975549	30	NC_005004	Staphylococcus epidermidis ATCC 12228 plasmid pSE-12228-05, complete sequence	6588-6617	8	0.733
NC_015144_1	1.3\|1975520\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1975520-1975549	30	NZ_HG813245	Staphylococcus epidermidis PM221 plasmid 2, complete sequence	13166-13195	8	0.733
NC_015144_1	1.3\|1975520\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1975520-1975549	30	NC_013379	Staphylococcus epidermidis plasmid SAP106A, complete sequence	9025-9054	8	0.733
NC_015144_1	1.3\|1975520\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1975520-1975549	30	NZ_CP022907	Staphylococcus aureus strain 546 plasmid pPS00077.1A.1, complete sequence	3892-3921	8	0.733
NC_015144_1	1.3\|1975520\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1975520-1975549	30	CP027492	Staphylococcus aureus strain ST2594 isolate 004 plasmid unnamed7	3817-3846	8	0.733
NC_015144_1	1.3\|1975520\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1975520-1975549	30	NZ_CP031281	Staphylococcus pasteuri strain 3C plasmid unnamed1, complete sequence	17338-17367	8	0.733
NC_015144_1	1.3\|1975520\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1975520-1975549	30	NZ_CP033731	Staphylococcus hominis strain FDAARGOS_575 plasmid unnamed1, complete sequence	2382-2411	8	0.733
NC_015144_1	1.3\|1975520\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1975520-1975549	30	NZ_CP043303	Staphylococcus aureus strain 16445 plasmid unnamed1, complete sequence	20894-20923	8	0.733
NC_015144_1	1.3\|1975520\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1975520-1975549	30	NZ_CP053638	Staphylococcus aureus strain 14732 plasmid unnamed, complete sequence	25756-25785	8	0.733
NC_015144_1	1.3\|1975520\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1975520-1975549	30	NZ_MK046687	Staphylococcus epidermidis strain 107.2 plasmid pAQZ1, complete sequence	24544-24573	8	0.733
NC_015144_1	1.4\|1975600\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1975600-1975629	30	MN908684	Arthrobacter phage Shoya, complete genome	14399-14428	8	0.733
NC_015144_1	1.9\|1976000\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976000-1976029	30	NZ_CP040343	Bacillus cereus strain DLOU-Weihai plasmid unnamed1, complete sequence	68390-68419	8	0.733
NC_015144_1	1.9\|1976000\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976000-1976029	30	NC_028998	Phormidium phage MIS-PhV1B, complete genome	11031-11060	8	0.733
NC_015144_1	1.12\|1976240\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976240-1976269	30	NZ_CP045305	Legionella longbeachae strain B1445CHC plasmid pB1445CHC_150k, complete sequence	46791-46820	8	0.733
NC_015144_1	1.12\|1976240\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976240-1976269	30	NZ_CP042253	Legionella longbeachae strain B3526CHC plasmid pB3526CHC_150k, complete sequence	48979-49008	8	0.733
NC_015144_1	1.12\|1976240\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976240-1976269	30	NZ_MH671358	Bacillus pumilus strain 63-2-2 plasmid pBP-6322, complete sequence	2009-2038	8	0.733
NC_015144_1	1.12\|1976240\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976240-1976269	30	MT002873	Tenacibaculum phage JQ, complete genome	3217-3246	8	0.733
NC_015144_1	1.12\|1976240\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976240-1976269	30	NC_018141	Legionella pneumophila subsp. pneumophila plasmid pLELO, complete sequence	107263-107292	8	0.733
NC_015144_1	1.12\|1976240\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976240-1976269	30	NZ_CP025492	Legionella sainthelensi strain LA01-117 plasmid pLA01-117_150k, complete sequence	29293-29322	8	0.733
NC_015144_1	1.12\|1976240\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976240-1976269	30	NZ_CP021284	Legionella pneumophila subsp. pneumophila strain Allentown 1 (D-7475) plasmid unnamed1, complete sequence	100597-100626	8	0.733
NC_015144_1	1.12\|1976240\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976240-1976269	30	NZ_CP011106	Legionella pneumophila strain L10-023 isolate Ulm plasmid unnamed, complete sequence	97476-97505	8	0.733
NC_015144_1	1.15\|1976480\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976480-1976509	30	MH617537	Phage sp. isolate ctcb314, complete genome	389-418	8	0.733
NC_015144_1	1.15\|1976480\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976480-1976509	30	NC_010844	Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)' plasmid p74, complete sequence	52251-52280	8	0.733
NC_015144_1	1.15\|1976480\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976480-1976509	30	NC_010846	Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)' plasmid p74, complete sequence	52024-52053	8	0.733
NC_015144_1	1.19\|1976800\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976800-1976829	30	NZ_CP004007	Legionella oakridgensis ATCC 33761 = DSM 21215 plasmid unnamed, complete sequence	11149-11178	8	0.733
NC_015144_1	1.4\|1975600\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1975600-1975629	30	NZ_CP022194	Yangia pacifica strain YSBP01 plasmid unnamed4, complete sequence	58316-58345	9	0.7
NC_015144_1	1.12\|1976240\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976240-1976269	30	MK373778	Escherichia phage vB_EcoM_WFbE185, complete genome	68072-68101	9	0.7
NC_015144_1	1.12\|1976240\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976240-1976269	30	NC_024794	Escherichia phage vB_EcoM_PhAPEC2, complete genome	66963-66992	9	0.7
NC_015144_1	1.12\|1976240\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976240-1976269	30	MT782071	Escherichia phage JN02, complete genome	68457-68486	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_KX518743	Escherichia coli strain HYEC7 plasmid pHYEC7-IncHI2, complete sequence	175173-175202	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_KY401053	Salmonella enterica subsp. enterica serovar Enteritidis strain SE380 plasmid unnamed, complete sequence	220894-220923	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_KY689633	Escherichia coli strain 100R plasmid p100R, complete sequence	99957-99986	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_KY689632	Escherichia coli strain 19-M12 plasmid p19M12, complete sequence	103209-103238	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_KY019259	Escherichia coli strain YJMC8 plasmid pHNYJC8, complete sequence	199565-199594	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_KY421937	Escherichia coli strain FS13Z2S plasmid pFS13Z2S, complete sequence	186767-186796	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP033256	Salmonella enterica subsp. enterica strain CFSA12 plasmid pCFSA12, complete sequence	40957-40986	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP026492	Escherichia coli strain HS13-1 plasmid pHS13-1-IncHI2, complete sequence	135259-135288	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP034785	Escherichia coli strain ECZP248 plasmid pTBMCR401, complete sequence	166957-166986	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_KU743384	Escherichia coli strain SA26 plasmid pSA26-MCR-1, complete sequence	191587-191616	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_KX421096	Salmonella enterica subsp. enterica serovar Indiana strain A3 plasmid pA3T, complete sequence	203504-203533	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_KX434879	Klebsiella pneumoniae strain KP2442 plasmid pKP2442_1c330, complete sequence	63061-63090	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_KU341381	Escherichia coli strain SHP45 plasmid pHNSHP45-2, complete sequence	201905-201934	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_KY019258	Escherichia coli strain LDHF400 plasmid pHNLDF400, complete sequence	199564-199593	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_KX721511	Salmonella enterica subsp. enterica serovar Typhimurium strain SC523 plasmid pSC523, complete sequence	74801-74830	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_KU254578	Escherichia coli strain YD786 plasmid pYD786-1, complete sequence	174720-174749	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_KX810825	Salmonella enterica subsp. enterica serovar Typhimurium strain MU1 plasmid pIMP4-SEM1, complete sequence	290661-290690	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_KX276657	Escherichia coli strain MRSN388634 plasmid pMR0516mcr, complete sequence	72788-72817	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_KX246266	Escherichia coli strain AHCH67 plasmid pHNAH67, complete sequence	184229-184258	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_KX254341	Escherichia coli strain JS-B60 plasmid pECJS-B60-267, complete sequence	217912-217941	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_KM396300	Salmonella enterica subsp. enterica serovar Enteritidis strain SEN110055 plasmid pSEN110055, complete sequence	181085-181114	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_KM396298	Salmonella enterica subsp. enterica serovar Enteritidis strain KUSR18 plasmid pKUSR18, complete sequence	181049-181078	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_KM396299	Salmonella enterica subsp. enterica serovar Enteritidis strain SEN112499 plasmid pSEN112499, complete sequence	181054-181083	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_KR653209	Escherichia coli strain GDZ13 plasmid pGD0503Z13, complete sequence	266786-266815	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_KT334335	Salmonella enterica subsp. enterica serovar Typhimurium strain ST06-53 plasmid pHK0653, complete sequence	195263-195292	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_KT347600	Escherichia coli strain EC5207 plasmid pEC5207, complete sequence	223171-223200	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_KP975077	Enterobacter cloacae strain MRSN17626 plasmid pMRVIM0813, complete sequence	173691-173720	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	LT221036	Yersinia pseudotuberculosis strain Yps.F1, plasmid pYps.F1 complete sequence	51655-51684	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP028197	Salmonella enterica subsp. enterica serovar Concord strain CFSAN018747 plasmid pGMI14-002_1, complete sequence	88523-88552	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP042628	Escherichia coli strain NCYU-25-82 plasmid pNCYU-25-82-1_MCR3, complete sequence	158278-158307	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP011601	Phytobacter ursingii strain CAV1151 plasmid pCAV1151-296, complete sequence	87592-87621	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	CP019195	Salmonella enterica subsp. enterica serovar Senftenberg str. ATCC 43845 plasmid pATCC43845, complete sequence	108268-108297	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP028975	Cronobacter sakazakii strain GZcsf-1 plasmid pGW1, complete sequence	259220-259249	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP043951	Escherichia coli strain ST95-32 plasmid pST95-32-1, complete sequence	76565-76594	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP040457	Salmonella enterica subsp. enterica serovar Typhimurium strain TJWQ005 plasmid pTJWQ005, complete sequence	66165-66194	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	KY075659	Escherichia coli strain GD80 plasmid pGD80-2, complete sequence	192788-192817	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	MN539018	Salmonella sp. strain OYZ4 plasmid pOYZ4, complete sequence	131077-131106	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	MN732922	Escherichia coli strain 49K plasmid unnamed, complete sequence	80641-80670	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP026790	Shigella flexneri 2a strain ATCC 29903 plasmid unnamed2, complete sequence	161091-161120	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP019559	Escherichia coli strain KSC207 plasmid pMRGN207, complete sequence	24474-24503	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP039717	Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS000211 plasmid p10-3184.1, complete sequence	105827-105856	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP010380	Enterobacter hormaechei subsp. hormaechei strain 34983 plasmid p34983-328.905kb, complete sequence	12460-12489	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	KX023262	Escherichia coli plasmid pSCE516-1, complete sequence	188351-188380	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP026171	Leclercia sp. LSNIH1 plasmid pLEC-1cb1, complete sequence	321381-321410	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP048293	Escherichia coli strain CVM N18EC0432 plasmid pN18EC0432-1, complete sequence	231560-231589	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	KP899803	Salmonella enterica strain 8025 plasmid p8025, complete sequence	138417-138446	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	KP899804	Salmonella enterica strain F8475 plasmid pF8475, complete sequence	95950-95979	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	KP899805	Salmonella enterica strain 109/9 plasmid p109/9, complete sequence	86954-86983	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	KP899806	Salmonella enterica strain B71 plasmid pB71, complete sequence	70315-70344	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP037875	Salmonella enterica subsp. enterica serovar 4,[5],12:i:- strain PNCS015054 plasmid pPNCS015054_S2, complete sequence	145614-145643	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP018652	Salmonella enterica subsp. enterica serovar Enteritidis strain 81-1705 plasmid pSE81-1705-1, complete sequence	159152-159181	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	MK574666	Escherichia coli strain DJB-3 plasmid pDJB-3, complete sequence	70807-70836	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	MN915010	Escherichia coli strain TJ-33 plasmid pNDM-TJ33, complete sequence	318019-318048	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	MN915011	Escherichia coli strain GD-33 plasmid pNDM33-1, complete sequence	218525-218554	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	CP009869	Pantoea sp. PSNIH2 plasmid pPSP-75c, complete sequence	341091-341120	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP019260	Escherichia coli strain 13C1065T plasmid p13C1065T-1, complete sequence	19896-19925	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP020529	Enterobacter cloacae strain 174 plasmid unnamed1, complete sequence	126758-126787	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	MN232189	Escherichia coli plasmid pGD27-124, complete sequence	77799-77828	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	MN232191	Escherichia coli plasmid pGD27-37, complete sequence	76068-76097	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	MN232195	Escherichia coli plasmid pGD27-70, complete sequence	76932-76961	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	CP042639	Escherichia coli strain NCYU-24-74 plasmid pNCYU-24-74-1, complete sequence	229853-229882	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP031567	Enterobacter hormaechei strain 2013_1a plasmid pIncHI2-1301491, complete sequence	83940-83969	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	MN200941	Escherichia coli strain E648 plasmid pE648CTX-M-65, complete sequence	189838-189867	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP040888	Leclercia adecarboxylata strain Z96-1 plasmid pZ96-1_1, complete sequence	41442-41471	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP044306	Escherichia coli strain C27A plasmid pC27A-CTX-M-55, complete sequence	140085-140114	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP039559	Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014846 plasmid p08-4425.1, complete sequence	104774-104803	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP038139	Escherichia coli strain G3X16-2 plasmid pG3X16-2-2, complete sequence	30562-30591	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP034820	Salmonella sp. SSDFZ54 plasmid pTB501, complete sequence	58126-58155	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	CP031284	Escherichia fergusonii strain 40A plasmid p280_40A, complete sequence	70678-70707	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	MK461930	Escherichia coli strain 2009_36 plasmid p2009_36_HI2, complete sequence	249584-249613	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP029037	Salmonella enterica subsp. enterica serovar Senftenberg str. 361154004 plasmid unnamed, complete sequence	215180-215209	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	CP042895	Escherichia coli strain CFSAN061772 plasmid pCFSAN061772_02, complete sequence	115995-116024	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP021209	Escherichia coli strain strain Z247 plasmid p2474-MCR1, complete sequence	191644-191673	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP022735	Escherichia coli strain SA186 plasmid pSA186_MCR1, complete sequence	71404-71433	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	CP042898	Escherichia coli strain CFSAN061771 plasmid pCFSAN061771_02, complete sequence	135462-135491	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP040806	Escherichia fergusonii strain EFCF056 plasmid pEF01, complete sequence	107643-107672	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP041180	Salmonella enterica subsp. enterica serovar Indiana strain SJTUF87912v2 isolate food plasmid p87912, complete sequence	74856-74885	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP019443	Salmonella enterica subsp. enterica serovar Typhimurium strain 81741 plasmid unnamed1, complete sequence	214923-214952	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP032179	Citrobacter freundii strain AR_0116 plasmid unnamed1, complete sequence	236316-236345	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP029142	Klebsiella michiganensis strain AR375 plasmid unnamed2, complete sequence	167135-167164	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	MN256758	Escherichia coli strain 4M8F plasmid p4M8F, complete sequence	116409-116438	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	MN256759	Escherichia coli strain 4M9F plasmid p4M9F, complete sequence	92187-92216	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP031575	Enterobacter hormaechei strain A1 plasmid pIncHI2-1502264, complete sequence	297279-297308	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_LT795115	Salmonella enterica subsp. enterica serovar Typhimurium isolate VNB151-sc-2315230 plasmid p1	166689-166718	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP017632	Escherichia coli strain SLK172 plasmid pSLK172-1, complete sequence	258045-258074	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP046007	Escherichia coli strain 1919D62 plasmid p1919D62-1, complete sequence	51754-51783	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP023570	Enterobacter hormaechei strain BW plasmid unnamed2, complete sequence	241936-241965	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NC_002305	Salmonella typhi plasmid R27, complete sequence	5612-5641	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	LC532224	Enterobacter hormaechei subsp. xiangfangensis A2483 plasmid pA2483mcr-9 DNA, complete sequence	136725-136754	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	LC532226	Enterobacter hormaechei subsp. xiangfangensis A2504 plasmid pA2504mcr-9 DNA, complete sequence	136725-136754	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NC_021845	Salmonella enterica subsp. enterica serovar Cubana str. CFSAN002050 plasmid unnamed, complete sequence	14979-15008	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP026642	Escherichia coli strain FORC_082 plasmid pFORC82_1, complete sequence	141406-141435	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	LT905061	Salmonella enterica subsp. enterica serovar Typhi isolate ISP_03_07467_SGB110-sc-1979083 genome assembly, plasmid: 2	136460-136489	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP031135	Escherichia coli strain CFSAN064035 plasmid pGMI17-003_1, complete sequence	268404-268433	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	MN816370	Escherichia coli strain A102 plasmid pA102-CTX-M-65, complete sequence	214125-214154	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP043767	Enterobacter hormaechei strain EB_P9_L5_03.19 plasmid pIMPIncH12_331kb, complete sequence	282629-282658	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP047668	Klebsiella aerogenes strain HNHF1 plasmid pHNHF1_NDM-9, complete sequence	71898-71927	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP027144	Enterobacter hormaechei subsp. hoffmannii strain AR_0365 plasmid unnamed1, complete sequence	261028-261057	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP034788	Escherichia coli strain ECCNB20-2 plasmid pTBMCR421, complete sequence	192000-192029	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP022495	Salmonella enterica subsp. enterica serovar Derby strain SA20035215 plasmid unnamed1, complete sequence	107711-107740	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP016184	Escherichia coli strain EC2 plasmid pEC2-4, complete sequence	84487-84516	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP016183	Escherichia coli strain EC2_1 plasmid pEC2_1-4, complete sequence	54268-54297	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP033636	Escherichia coli isolate ECCNB12-2 plasmid pTB-nb4, complete sequence	210223-210252	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP050778	Salmonella enterica subsp. enterica serovar Indiana strain SI96 plasmid pSI96-1, complete sequence	12166-12195	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	MN256757	Escherichia coli strain 4M18F plasmid p4M18F, complete sequence	116409-116438	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_AP018352	Enterobacter hormaechei strain TUM11043 plasmid pMTY11043_IncHI2, complete sequence	319622-319651	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP038654	Citrobacter freundii strain 154 plasmid p154_1, complete sequence	59960-59989	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP038657	Citrobacter freundii strain 565 plasmid p565_1, complete sequence	62077-62106	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP027411	Salmonella enterica strain FDAARGOS_319 plasmid unnamed, complete sequence	82950-82979	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP044111	Klebsiella michiganensis strain FDAARGOS_647 plasmid unnamed2	292948-292977	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NC_016825	Salmonella enterica subsp. enterica serovar Typhi str. P-stx-12 plasmid unnamed, complete sequence	26650-26679	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP044051	Klebsiella variicola strain FDAARGOS_627 plasmid unnamed2, complete sequence	258272-258301	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP025402	Escherichia coli strain MS8345 plasmid pMS8345A, complete sequence	192408-192437	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MK477605	Salmonella enterica strain SH15G1428 plasmid pSH15G1428, complete sequence	202017-202046	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MK477609	Salmonella enterica strain SH15G1598 plasmid pSH15G1598, complete sequence	125372-125401	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MK477614	Salmonella enterica strain SH16G1394 plasmid pSH16G1394, complete sequence	201032-201061	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MK477619	Salmonella enterica strain SH16G4918 plasmid pSH16G4918, complete sequence	166795-166824	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MK673548	Salmonella enterica subsp. enterica serovar Typhimurium strain GDP37-4 plasmid pGDP37-4, complete sequence	200039-200068	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MK477606	Salmonella enterica strain SH15G1450 plasmid pSH15G1450, complete sequence	203554-203583	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MK477620	Salmonella enterica strain SH16G4926 plasmid pSH16G4926, complete sequence	166358-166387	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MK673549	Salmonella enterica subsp. enterica serovar Typhimurium strain JXP9 plasmid pJXP9, complete sequence	195212-195241	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MK477602	Salmonella enterica strain SH15G1169 plasmid pSH15G1169, complete sequence	166358-166387	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MK477607	Salmonella enterica strain SH15G1452 plasmid pSH15G1452, complete sequence	173461-173490	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MK477611	Salmonella enterica strain SH15G2194 plasmid pSH15G2194, complete sequence	210487-210516	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MK477616	Salmonella enterica strain SH16G2456 plasmid pSH16G2456, complete sequence	200218-200247	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MK477603	Salmonella enterica strain SH15G1219 plasmid pSH15G1219, complete sequence	173461-173490	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MK477608	Salmonella enterica strain SH15G1571 plasmid pSH15G1571, complete sequence	124371-124400	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MK477617	Salmonella enterica strain SH16G4466 plasmid pSH16G4466, complete sequence	198236-198265	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MK477618	Salmonella enterica strain SH16G4511 plasmid pSH16G4511, complete sequence	168306-168335	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MK673547	Salmonella enterica subsp. enterica serovar Typhimurium strain GDP25-25 plasmid pGDP25-25, complete sequence	206658-206687	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MH179305	Salmonella enterica subsp. enterica serovar Indiana strain JT01 plasmid pJT01, complete sequence	77216-77245	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MH105051	Salmonella enterica subsp. enterica serovar Lomita strain SL131 plasmid pSL131_IncHI2, complete sequence	4820-4849	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MH208235	Escherichia coli strain APECA2 plasmid pJMA2, complete sequence	176625-176654	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MH522413	Salmonella enterica subsp. enterica serovar Typhimurium strain SH14G1670 plasmid pSH14G1670, complete sequence	77683-77712	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MH459020	Escherichia coli strain GZ6DS2 plasmid pHN6DS2, complete sequence	204195-204224	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MH491004	Escherichia coli strain RJ749 plasmid pRJ749, complete sequence	66592-66621	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	MT219825	Escherichia coli strain RW7-1 plasmid pRW7-1_235k_tetX, complete sequence	178662-178691	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MF174859	Escherichia coli strain 6/14/6b plasmid pIncHI2-MU3, complete sequence	206840-206869	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MG014722	Escherichia coli strain P2-3 plasmid pP2-3T, complete sequence	341241-341270	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MG014720	Escherichia coli strain A74 plasmid pA74T, complete sequence	272029-272058	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MG014721	Escherichia coli strain FS11Y5C plasmid pFS11Y5CT, complete sequence	189845-189874	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MG773376	Escherichia coli strain LSB54 plasmid pLSB54-mcr-1, complete sequence	202066-202095	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MG825373	Escherichia coli strain 1106 plasmid p1106-IncHI2, complete sequence	62129-62158	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MG385063	Escherichia coli strain WF5-29 plasmid pWF5-29, complete sequence	346170-346199	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MG656414	Escherichia coli strain 15-50 plasmid pEC15-MCR-50, complete sequence	300614-300643	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MH522418	Salmonella enterica subsp. enterica serovar Typhimurium strain SH16G0648 plasmid pSH16G0648, complete sequence	78580-78609	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MH128771	Escherichia coli strain 803DBmcr plasmid 803-DB-mcr, complete sequence	90709-90738	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MH522420	Salmonella enterica subsp. enterica serovar Typhimurium strain SH16G1508 plasmid pSH16G1508, complete sequence	79532-79561	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MH522421	Salmonella enterica subsp. enterica serovar Typhimurium strain SH16G2457 plasmid pSH16G2457, complete sequence	277377-277406	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MH522423	Salmonella enterica subsp. enterica serovar Typhimurium strain SH16G4498 plasmid pSH16G4498, complete sequence	79532-79561	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP049047	Enterobacter hormaechei strain Y233 plasmid pIHI2-233, complete sequence	157101-157130	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	MT219824	Escherichia coli strain RT18-1 plasmid pRT18-1_294k_tetX, complete sequence	59055-59084	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP015725	Salmonella enterica strain C629 plasmid pC629, complete sequence	105066-105095	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_KY990887	Escherichia coli strain XG-E1 plasmid pXGE1mcr, complete sequence	204814-204843	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MF083142	Citrobacter freundii strain D36-1 plasmid pD36-1, complete sequence	60191-60220	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MF135534	Raoultella ornithinolytica strain TS48CTX plasmid pHNTS48-1, complete sequence	203433-203462	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MG372114	Salmonella enterica subsp. enterica serovar Typhimurium strain JZ26 plasmid pJZ26, complete sequence	195373-195402	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MG878867	Escherichia coli strain Ec21617 plasmid pEc21617-310, complete sequence	274847-274876	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP022169	Salmonella enterica subsp. enterica serovar Typhimurium strain WW012 plasmid pWW012, complete sequence	72654-72683	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	KM877269	Salmonella enterica subsp. enterica serovar Typhimurium strain GDS147 plasmid pHXY0908, complete sequence	199555-199584	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP032993	Escherichia coli strain W5-6 plasmid pMCR_W5-6, complete sequence	9862-9891	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_KX710093	Leclercia adecarboxylata strain pP10164 plasmid pP10164-2, complete sequence	35632-35661	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_KY270852	Enterobacter cloacae strain T5282 plasmid pT5282-mphA, complete sequence	35390-35419	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_KY270851	Citrobacter freundii strain 112298 plasmid p112298-catA, complete sequence	35632-35661	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP045446	Salmonella enterica subsp. enterica serovar Schwarzengrund strain 9355 plasmid p280_9355, complete sequence	37678-37707	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_LT904879	Salmonella enterica subsp. enterica serovar Typhi strain ty3-193 genome assembly, plasmid: 2	135011-135040	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP016764	Citrobacter freundii strain B38 plasmid pOZ181, complete sequence	136575-136604	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_KX084394	Escherichia coli strain 59 plasmid pECJS-59-244, complete sequence	235887-235916	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_KX129784	Escherichia coli strain H226B plasmid pH226B, complete sequence	20197-20226	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_KX129782	Escherichia coli strain S38 plasmid pS38, complete sequence	36666-36695	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_LN830952	Enterobacter sp. 247 strain 247 BMC plasmid pEB247, complete sequence	35894-35923	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP028537	Enterobacter hormaechei strain SCEH020042 plasmid pQnrB4_020042, complete sequence	35881-35910	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP015833	Escherichia coli O157 strain 180-PT54 plasmid unnamed, complete sequence	35317-35346	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_AP023191	Escherichia coli strain TUM18530 plasmid pMTY18530-1_lncHI2, complete sequence	37272-37301	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP019647	Salmonella enterica subsp. enterica serovar Typhimurium strain TW-Stm6 plasmid pSTM6-275, complete sequence	34316-34345	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP048350	Raoultella ornithinolytica strain 23 plasmid p23_A-OXA140, complete sequence	35881-35910	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP044256	Salmonella enterica strain CFSAN096147 plasmid pCFSAN096147, complete sequence	55568-55597	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP045449	Salmonella enterica subsp. enterica serovar Schwarzengrund strain 12888 plasmid p280_12888, complete sequence	37677-37706	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NC_009981	Salmonella enterica subsp. enterica serovar Choleraesuis plasmid pMAK1, complete sequence	19737-19766	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP029645	Salmonella enterica subsp. enterica serovar Typhi strain 311189_217186 plasmid pHCM1, complete sequence	80202-80231	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP027678	Salmonella enterica subsp. enterica serovar Corvallis strain 12-01738 plasmid pSE12-01738-1, complete sequence	157393-157422	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP026242	Citrobacter freundii complex sp. CFNIH9 plasmid pCFR-eb27, complete sequence	258286-258315	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP029729	Citrobacter sp. CRE-46 strain AR_0157 plasmid unnamed1, complete sequence	151744-151773	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP035634	Enterobacter cloacae strain EN3600 plasmid unnamed2, complete sequence	38325-38354	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	MN539017	Salmonella sp. strain PJM1 plasmid pPJM1, complete sequence	61874-61903	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP053721	Escherichia coli strain CP131_Sichuan plasmid pCP131-IncHI1, complete sequence	18448-18477	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP042506	Leclercia adecarboxylata strain E1 plasmid pE1_001, complete sequence	35881-35910	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP020493	Salmonella enterica subsp. enterica strain 08-00436 plasmid pSE08-00436-1, complete sequence	38233-38262	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP009883	Pantoea sp. PSNIH1 plasmid pPSP-a3e, complete sequence	96152-96181	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	MT077884	Escherichia coli plasmid p33, complete sequence	36658-36687	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	MT077886	Escherichia coli plasmid p39, complete sequence	35881-35910	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	MT077888	Escherichia coli plasmid p65, complete sequence	37366-37395	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP051431	Escherichia sp. SCLE84 plasmid pSCLE1, complete sequence	36502-36531	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NC_009838	Escherichia coli APEC O1 plasmid pAPEC-O1-R, complete sequence	36770-36799	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP026196	Enterobacteriaceae bacterium ENNIH1 plasmid pENT-1f0b, complete sequence	229750-229779	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP021727	Escherichia coli strain Combat11I9 plasmid pCombat11I9-1, complete sequence	204156-204185	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	MN423361	Leclercia sp. strain 1106151 plasmid p1106151-mcr, complete sequence	35881-35910	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP031547	Escherichia coli strain cq9 plasmid unnamed1, complete sequence	219267-219296	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	MN232190	Escherichia coli plasmid pGD27-31, complete sequence	124441-124470	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP044299	Escherichia coli strain P59A plasmid pP59A-CTX-M-55, complete sequence	43031-43060	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP029690	Escherichia coli strain SD134209 plasmid pSD134209-1, complete sequence	34878-34907	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP029748	Escherichia coli strain 2016C-3878 plasmid pMCR1-PA, complete sequence	59181-59210	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NC_003384	Salmonella enterica subsp. enterica serovar Typhi str. CT18 plasmid pHCM1, complete sequence	76438-76467	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP025277	Salmonella enterica subsp. enterica strain USDA-ARS-USMARC-60984 plasmid pSJO-60984, complete sequence	34815-34844	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	MN577015	Salmonella enterica plasmid p0085-NDM, complete sequence	36151-36180	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP045844	Kluyvera intermedia strain HR2 plasmid pHR2-1, complete sequence	36163-36192	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP030182	Salmonella enterica strain SA20030575 plasmid pSA20030575.1, complete sequence	18447-18476	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP049354	Escherichia coli strain T28R plasmid pT28R-1, complete sequence	18451-18480	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP047379	Escherichia coli strain CAU16175 plasmid pCAU16175_1, complete sequence	36164-36193	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP023167	Salmonella enterica subsp. enterica serovar Saintpaul strain SGB23 plasmid pSGB23, complete sequence	21788-21817	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	MH909331	Leclercia adecarboxylata plasmid p707804-NDM, complete sequence	36699-36728	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	AP020333	Salmonella enterica SESen3709 plasmid pSESen3709_1 DNA, complete genome	48550-48579	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP033382	Salmonella enterica subsp. enterica strain CFSA300 plasmid pCFSA300-1, complete sequence	14028-14057	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP035916	Salmonella enterica strain S61394 plasmid pLS61394-MCR, complete sequence	36150-36179	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP019019	Escherichia coli strain Ecol_244 plasmid pEC244_1, complete sequence	190716-190745	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP030080	Enterobacter hormaechei strain 20710 plasmid pIMP-20710, complete sequence	46299-46328	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP042616	Escherichia coli strain NCYU-26-73 plasmid pNCYU-26-73-1, complete sequence	146465-146494	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP037911	Escherichia coli strain YSP8-1 plasmid pYSP8-1, complete sequence	34872-34901	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP008825	UNVERIFIED_ORG: Enterobacter cloacae ECNIH2 plasmid pKPC-272, complete sequence	38013-38042	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP022696	Citrobacter farmeri strain AUSMDU00008141 plasmid pAUSMDU8141-1, complete sequence	35931-35960	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP052871	Enterobacter cloacae strain 3849 plasmid p3846_IncHI2_mcr, complete sequence	155797-155826	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP012141	Shigella flexneri 4c strain 1205 plasmid 1205p1, complete sequence	34814-34843	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP033385	Salmonella enterica subsp. enterica strain CFSA1007 plasmid pCFSA1007-1, complete sequence	63007-63036	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP047877	Escherichia coli strain LD22-1 plasmid pLD22-1-MCR1, complete sequence	34814-34843	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP035918	Salmonella enterica strain S44712 plasmid pLS44712-MCR, complete sequence	34814-34843	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP046717	Escherichia coli strain T16R plasmid pT16R-1, complete sequence	18451-18480	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	CP049311	Salmonella enterica subsp. enterica serovar Heidelberg strain CVM N53023 plasmid pN53023, complete sequence	251987-252016	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_LT991958	Enterobacter cloacae complex sp. isolate C45 plasmid pC45-VIM4	35881-35910	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	LC511657	Escherichia coli 2017.02.01CC plasmid p2017.02.01CC DNA, complete genome	34814-34843	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	LC511658	Escherichia coli 2017.03.03CC plasmid p2017_03_03CC DNA, complete genome	37502-37531	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP043855	Enterobacter hormaechei strain EB_P6_L3_02.19 plasmid unnamed2, complete sequence	161044-161073	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP044215	Klebsiella aerogenes strain KA_P10_L5_03.19 plasmid pIMPIncH12_334kb, complete sequence	67405-67434	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP026208	Escherichia coli strain ECONIH5 plasmid pECO-109b, complete sequence	140911-140940	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP039857	Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014876 plasmid p15-0756.1, complete sequence	234179-234208	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP031850	Klebsiella pneumoniae strain 121 plasmid pKP121-1-mcr, complete sequence	34814-34843	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	CP049309	Salmonella enterica subsp. enterica serovar Johannesburg strain CVM N58011 plasmid p58011, complete sequence	145004-145033	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NC_010870	Klebsiella pneumoniae plasmid pK29, complete sequence	34711-34740	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP024813	Enterobacter sp. CRENT-193 plasmid pCRENT-193_1, complete sequence	57475-57504	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	CP049307	Salmonella enterica subsp. enterica serovar Heidelberg strain CVM N58631 plasmid p58631, complete sequence	168257-168286	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP019214	Escherichia coli strain WCHEC050613 plasmid pMCR_WCHEC050613, complete sequence	36773-36802	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP041182	Salmonella enterica subsp. enterica serovar Indiana strain SJTUF13520v2 isolate food plasmid p13520, complete sequence	82922-82951	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	CP043545	Escherichia coli strain F2_81 plasmid pF2_18C_HI2, complete sequence	34316-34345	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP030940	Escherichia coli strain AMSHJX01 plasmid pAMSH1, complete sequence	133765-133794	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP034832	Salmonella sp. SSDFZ69 plasmid pTB601, complete sequence	108368-108397	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP036178	Escherichia coli strain WCHEC025970 plasmid pCTXM199_025970, complete sequence	36163-36192	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP022451	Salmonella enterica subsp. enterica serovar Indiana strain D90 plasmid pD90-1, complete sequence	153110-153139	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP030186	Salmonella enterica strain SA20094620 plasmid pSA20094620.1, complete sequence	90230-90259	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP042494	Leclercia adecarboxylata strain E61 plasmid pE61_001, complete sequence	35881-35910	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP033353	Salmonella enterica subsp. enterica strain CFSA664 plasmid pCFSA664-1, complete sequence	148375-148404	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP040696	Citrobacter freundii strain R47 plasmid pR47-309, complete sequence	297441-297470	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP024143	Escherichia coli strain 14EC029 plasmid p14EC029b, complete sequence	34846-34875	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP026391	Leclercia sp. LSNIH3 plasmid pLEC-7c0d, complete sequence	97153-97182	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP047116	Salmonella enterica subsp. enterica strain SCSM4.1 plasmid plas4.1.1, complete sequence	34814-34843	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP008899	Enterobacter hormaechei subsp. hoffmannii ECNIH3 plasmid pENT-8a4, complete sequence	35881-35910	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP008906	Enterobacter hormaechei subsp. hoffmannii ECR091 plasmid pENT-08e, complete sequence	35881-35910	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP042552	Enterobacter hormaechei strain C45 plasmid pC45_001, complete sequence	35881-35910	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP039271	Salmonella enterica subsp. enterica serovar Senftenberg str. CFSAN004025 plasmid pCFSAN004025.1, complete sequence	37230-37259	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP016526	Salmonella enterica subsp. enterica serovar Heidelberg strain 09-036813-1A plasmid p09-036813-1A_261, complete sequence	228231-228260	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	CP050163	Escherichia coli plasmid Carbapenemase(KPC-2)_IncHI2, complete sequence	35881-35910	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	KX856066	Salmonella Typhimurium strain HSHLJ1 plasmid pHSHLJ1-MCR1, complete sequence	153397-153426	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP041174	Salmonella enterica subsp. enterica serovar Enteritidis strain SJTUF12519v2 plasmid p12519A, complete sequence	122353-122382	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP039170	Salmonella enterica subsp. enterica serovar Goldcoast strain Sal-5364 plasmid pSal-5364, complete sequence	59857-59886	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP041734	Enterobacter hormaechei subsp. steigerwaltii strain ME-1 plasmid pME-1a, complete sequence	35881-35910	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP022165	Escherichia coli strain M160133 plasmid pM160133_p1, complete sequence	35316-35345	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP046004	Escherichia coli strain 1919D3 plasmid p1919D3-1, complete sequence	207726-207755	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP024236	Escherichia coli O6:H16 strain 2014EL-1346-6 plasmid unnamed4, complete sequence	163222-163251	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	MK933279	Enterobacter hormaechei strain SCNJ07 plasmid pMCR-SCNJ07, complete sequence	131278-131307	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP012931	Salmonella enterica subsp. enterica serovar Heidelberg strain N13-01290 plasmid pN13-01290_23, complete sequence	109856-109885	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP029895	Salmonella enterica subsp. enterica serovar Typhi strain 311189_252186 plasmid pHCM1, complete sequence	80519-80548	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP029877	Salmonella enterica subsp. enterica serovar Typhi strain 311189_224186 plasmid pHCM1, complete sequence	80519-80548	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	CP048299	Salmonella enterica subsp. enterica serovar Schwarzengrund strain WAPHL_SAL-A00527 plasmid pN1566-2, complete sequence	186214-186243	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NC_005211	Serratia marcescens plasmid R478, complete sequence	34815-34844	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP026661	Salmonella enterica subsp. enterica strain 15-SA01028 plasmid pSE15-SA01028, complete sequence	35881-35910	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP042587	Escherichia coli strain LD91-1 plasmid pLD91-1-MCR1, complete sequence	34814-34843	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP033094	Escherichia coli strain CP53 plasmid pCP53-mcr, complete sequence	146535-146564	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	LN794248	Salmonella enterica subsp. enterica serovar Typhimurium plasmid incHI2, complete sequence	152607-152636	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP029248	Enterobacter hormaechei subsp. xiangfangensis strain OSUVMCKPC4-2 plasmid pOSUEC_D, complete sequence	40894-40923	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP043927	Klebsiella quasipneumoniae subsp. quasipneumoniae strain M17277 plasmid p17277A_477, complete sequence	35881-35910	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP029926	Salmonella enterica subsp. enterica serovar Typhi strain 311189_218186 plasmid pHCM1, complete sequence	22556-22585	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP029947	Salmonella enterica subsp. enterica serovar Typhi strain 311189_210186 plasmid pHCM1, complete sequence	81752-81781	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP031102	Leclercia sp. W17 plasmid pW17-1, complete sequence	122985-123014	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP012170	Enterobacter hormaechei subsp. steigerwaltii strain 34977 plasmid p34977-263.138kb, complete sequence	240711-240740	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	LC542971	Escherichia coli IOMTU413 plasmid pIOMTU413 DNA, complete sequence	35880-35909	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	LC542972	Escherichia coli IOMTU792 plasmid pIOMTU792 DNA, complete sequence	35629-35658	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	CP048303	Salmonella enterica subsp. enterica serovar Schwarzengrund strain WAPHL-SAL-A00375 plasmid p28945-2, complete sequence	31502-31531	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	CP051274	Salmonella enterica subsp. enterica serovar Worthington strain OLF-FSR1_WB_Partridge_SW-37 plasmid pSW37-267109, complete sequence	168438-168467	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP033347	Salmonella enterica subsp. enterica strain CFSA1096 plasmid pCFSA1096, complete sequence	58304-58333	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP043034	Escherichia coli strain XDL plasmid pXDL-CTX-M-14, complete sequence	34814-34843	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NC_024983	Salmonella enterica subsp. enterica serovar Typhimurium plasmid pSTm-A54650, strain A54560, complete sequence	35881-35910	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP011635	Klebsiella oxytoca strain CAV1374 plasmid pKPC_CAV1374, complete sequence	100163-100192	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP044968	Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS007098 plasmid pPNCS014881.1, complete sequence	210110-210139	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP044958	Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS007087 plasmid pPNCS007087.1, complete sequence	142348-142377	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP037959	Salmonella enterica subsp. enterica serovar Goldcoast strain R18.0877 plasmid pR18.0877_278k, complete sequence	35313-35342	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	CP051271	Salmonella enterica subsp. enterica serovar Worthington strain OLF-FSR1_WB_Quail_SW-70 plasmid pSW37-267106, complete sequence	151834-151863	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP033224	Salmonella enterica subsp. enterica strain CFSA122 plasmid pCFSA122-1, complete sequence	129475-129504	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP033253	Salmonella enterica subsp. enterica strain CFSA244 plasmid pCFSA244-1, complete sequence	34944-34973	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP047659	Escherichia coli strain LD39-1 plasmid pLD39-1-MCR1, complete sequence	34814-34843	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP047666	Escherichia coli strain LD26-1 plasmid pLD26-1-MCR1, complete sequence	34814-34843	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP039861	Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014880 plasmid p16-6773.1, complete sequence	229947-229976	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP034390	Escherichia coli strain RS571 plasmid pRS571-MCR-1.1, complete sequence	34817-34846	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	KX856065	Salmonella enterica subsp. enterica serovar Typhimurium plasmid pASSD2-MCR1, complete sequence	106143-106172	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP013215	Klebsiella pneumoniae subsp. pneumoniae strain H11 plasmid pH11, complete sequence	73382-73411	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP029943	Salmonella enterica subsp. enterica serovar Typhi strain 311189_212186 plasmid pHCM1, complete sequence	80306-80335	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP029953	Salmonella enterica subsp. enterica serovar Typhi strain 311189_204186 plasmid pHCM1, complete sequence	80519-80548	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP029955	Salmonella enterica subsp. enterica serovar Typhi strain 311189_202186 plasmid pHCM1, complete sequence	80519-80548	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP021463	Salmonella enterica subsp. enterica serovar Typhimurium strain UGA14 plasmid pUGA14_1, complete sequence	191305-191334	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NC_012556	Enterobacter cloacae plasmid pEC-IMPQ, complete sequence	35881-35910	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NC_012555	Enterobacter cloacae plasmid pEC-IMP, complete sequence	35881-35910	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP042579	Enterobacter kobei strain C16 plasmid pC16_001, complete sequence	36260-36289	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP029924	Salmonella enterica subsp. enterica serovar Typhi strain 311189_221186 plasmid pHCM1, complete sequence	164465-164494	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP029934	Salmonella enterica subsp. enterica serovar Typhi strain 311189_214186 plasmid pHCM1, complete sequence	80519-80548	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP050780	Salmonella enterica subsp. enterica serovar Indiana strain SI85 plasmid pSI85-1, complete sequence	36150-36179	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP048776	Salmonella enterica subsp. enterica serovar Agona strain SG17-135 plasmid pSG17-135-HI2, complete sequence	35313-35342	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP033351	Salmonella enterica subsp. enterica strain CFSA629 plasmid pCFSA629, complete sequence	103191-103220	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NC_019114	Salmonella enterica subsp. enterica serovar Heidelberg plasmid pSH111_227, complete sequence	33562-33591	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP023143	Escherichia coli strain CFSAN061770 plasmid pEGY1-MCR-1, complete sequence	126680-126709	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_AP023198	Escherichia coli strain TUM18780 plasmid pMTY18780-1_lncHI2, complete sequence	37272-37301	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP043223	Salmonella enterica subsp. enterica serovar Bredeney strain SA20114778WT plasmid pET1.1-IncH, complete sequence	230384-230413	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP050751	Salmonella enterica subsp. enterica serovar Typhimurium strain ST46 plasmid pST46-1, complete sequence	34814-34843	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP050729	Salmonella enterica subsp. enterica serovar Typhimurium strain ST106 plasmid pST106-1, complete sequence	34814-34843	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP050772	Salmonella enterica subsp. enterica serovar Indiana strain SI102 plasmid pSI102-1, complete sequence	34814-34843	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP050761	Salmonella enterica subsp. enterica serovar Indiana strain SI170 plasmid pSI170-1, complete sequence	36138-36167	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP051135	Enterobacter hormaechei strain AMS-38 plasmid pAMS-38c, complete sequence	106259-106288	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NC_013365	Escherichia coli O111:H- str. 11128 plasmid pO111_1, complete sequence	34827-34856	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP032842	Enterobacter hormaechei strain C15117 plasmid pSPRC-Echo1, complete sequence	35881-35910	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP041449	Escherichia coli strain YPE10 plasmid pYPE10-190k-tetX4, complete sequence	18451-18480	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP029939	Salmonella enterica subsp. enterica serovar Typhi strain 311189_206186 plasmid pHCM1, complete sequence	79137-79166	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP025340	Salmonella enterica subsp. enterica serovar Typhimurium strain BL10 plasmid p220k, complete sequence	42589-42618	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP038454	Escherichia coli strain EC-129 plasmid pEC129_1, complete sequence	37354-37383	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NC_019360	Citrobacter freundii plasmid pNDM-CIT, complete sequence	254261-254290	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP041997	Escherichia coli strain AR Bank #0349 plasmid pAR349, complete sequence	76587-76616	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP029957	Salmonella enterica subsp. enterica serovar Typhi strain 311189_201186 plasmid pHCM1, complete sequence	80202-80231	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP029941	Salmonella enterica subsp. enterica serovar Typhi strain 311189_203186 plasmid pHCM1, complete sequence	80519-80548	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP029910	Salmonella enterica subsp. enterica serovar Typhi strain 311189_219186 plasmid pHCM1, complete sequence	80519-80548	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	KY320277	Leclercia adecarboxylata strain Lec-476 plasmid pLec-476, complete sequence	51327-51356	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP042525	Citrobacter freundii strain E11 plasmid pE11_001, complete sequence	35881-35910	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP050754	Salmonella enterica subsp. enterica serovar Typhimurium strain ST45 plasmid pST45-1, complete sequence	34814-34843	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP050784	Salmonella enterica subsp. enterica serovar Indiana strain SI67 plasmid pSI67-1, complete sequence	34814-34843	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_LT991955	Enterobacter hormaechei subsp. steigerwaltii isolate C309 plasmid pC309-VIM4	35881-35910	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP029887	Salmonella enterica subsp. enterica serovar Typhi strain 311189_220186 plasmid pHCM1, complete sequence	80253-80282	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP029948	Salmonella enterica subsp. enterica serovar Typhi strain 311189_208186 plasmid pHCM1, complete sequence	80519-80548	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP029937	Salmonella enterica subsp. enterica serovar Typhi strain 311189_207186 plasmid pHCM1, complete sequence	79990-80019	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP029879	Salmonella enterica subsp. enterica serovar Typhi strain 311189_223186 plasmid pHCM1, complete sequence	80202-80231	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP050763	Salmonella enterica subsp. enterica serovar Indiana strain SI115 plasmid pSI115-1, complete sequence	66843-66872	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	MH884652	Salmonella sp. strain Sa27 plasmid pSa27-CIP, complete sequence	19783-19812	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	MH884653	Salmonella sp. strain Sa27 plasmid pSa27-TC-CIP, complete sequence	20091-20120	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP022533	Enterobacter hormaechei strain MS7884A plasmid pMS7884A, complete sequence	267592-267621	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP038659	Citrobacter freundii strain 680 plasmid p680_1, complete sequence	259020-259049	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	MH114596	Salmonella enterica strain 13-1681 plasmid p131681, complete sequence	34814-34843	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP026936	Escherichia coli strain CFS3292 plasmid pCFS3292-1, complete sequence	36665-36694	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP029717	UNVERIFIED_ORG: Enterobacter cloacae strain AR_0154 plasmid unnamed4, complete sequence	127659-127688	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP024910	Enterobacter hormaechei subsp. xiangfangensis strain OSUKPC4_L plasmid pOSUKPC4, complete sequence	40894-40923	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP018656	Salmonella enterica subsp. enterica serovar Enteritidis strain 81-1706 plasmid pSE81-1706, complete sequence	46136-46165	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	MK962305	Escherichia coli strain YZUC2624 plasmid pYZUC2624.1, complete sequence	8854-8883	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	MK962305	Escherichia coli strain YZUC2624 plasmid pYZUC2624.1, complete sequence	219764-219793	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP029931	Salmonella enterica subsp. enterica serovar Typhi strain 311189_215186 plasmid pHCM1, complete sequence	80150-80179	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP029935	Salmonella enterica subsp. enterica serovar Typhi strain 311189_213186 plasmid pHCM1, complete sequence	80044-80073	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	MN937241	Enterobacter cloacae strain BSI034 plasmid pBSI034-MCR9, complete sequence	35881-35910	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP042489	Enterobacter hormaechei strain C15 plasmid pC15_001, complete sequence	35881-35910	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_LT985297	Escherichia coli strain B4-25 plasmid RCS77_p, complete sequence	137108-137137	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_LT985296	Escherichia coli strain 1454 plasmid RCS78_p, complete sequence	153367-153396	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP026933	Escherichia coli strain CFS3273 plasmid pCFS3273-1, complete sequence	35316-35345	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MK461931	Escherichia coli strain F2_14D plasmid pF2_14D_HI2, complete sequence	35381-35410	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MN101858	Escherichia coli strain 2019XSD11-TC2 plasmid p2019XSD11-TC2-284, complete sequence	35954-35983	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MK355502	Klebsiella pneumoniae strain CRE plasmid pAN65-1, complete sequence	37087-37116	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MN101856	Escherichia coli strain 2019XSD11 plasmid p2019XSD11-190, complete sequence	34570-34599	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MK477612	Salmonella enterica strain SH16G0600 plasmid pSH16G0600, complete sequence	241989-242018	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MN540571	Escherichia coli strain E.coli4feg plasmid pIV_IncHI2_CTX_M_15, complete sequence	113342-113371	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP033103	Enterobacter hormaechei strain L51 plasmid pEHZJ1, complete sequence	35881-35910	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MH829594	Enterobacter cloacae strain EC62 plasmid pIMP-4-EC62, complete sequence	35879-35908	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MH522426	Salmonella enterica subsp. enterica serovar Typhimurium strain SH16G4928 plasmid pSH16G4928, complete sequence	121628-121657	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MH924589	Escherichia coli strain RDB9 plasmid pRDB9, complete sequence	187263-187292	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MH287085	Escherichia coli strain F2_12B plasmid pSDC-F2_12BHI2, complete sequence	35653-35682	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MH287084	Escherichia coli O157 strain SvETEC plasmid pSDE-SvHI2, complete sequence	34316-34345	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MH733010	Klebsiella pneumoniae strain KP14812 plasmid pKP14812-MCR-1, complete sequence	142573-142602	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MK169211	Escherichia coli strain DUK14-2 plasmid pMOO-32, complete sequence	36328-36357	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MK413720	Enterobacter cloacae strain 12949 plasmid p12949-HI2, complete sequence	48396-48425	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MK736669	Enterobacter cloacae strain EclC2185 plasmid pEclC2185CTXM15, complete sequence	162943-162972	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MG904992	Escherichia coli strain 14OD0056 plasmid p14ODMR, complete sequence	67768-67797	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_LC511997	Enterobacter hormaechei subsp. xiangfangensis strain MY460 plasmid pMY460-rmtE, complete sequence	34815-34844	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MF344580	Enterobacter cloacae strain 30860 plasmid p30860-HI2, complete sequence	35881-35910	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MF344581	Enterobacter cloacae strain 13E573 plasmid p13E573-HI2, complete sequence	37541-37570	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MF344583	Enterobacter cloacae strain N1863 plasmid pN1863-HI2, complete sequence	39683-39712	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MG591702	Escherichia coli strain EC36 plasmid pMCR-EC36, complete sequence	35340-35369	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MG662415	Escherichia coli strain EC1107 plasmid EC1107-IncHI2-226K, complete sequence	36152-36181	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MH522419	Salmonella enterica subsp. enterica serovar Typhimurium strain SH16G1369 plasmid pSH16G1369, complete sequence	151376-151405	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MH329870	Escherichia coli strain 92944 plasmid p92944-MCR, complete sequence	34814-34843	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MH522425	Salmonella enterica subsp. enterica serovar Typhimurium strain SH16G4909 plasmid pSH16G4909, complete sequence	18131-18160	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MH399264	Enterobacter cloacae strain RJ702 plasmid pIMP26, complete sequence	82936-82965	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MG948335	Escherichia coli strain 3498 plasmid p3498, complete sequence	48339-48368	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MH077952	Escherichia coli strain EC17S-208 plasmid p17S-208, complete sequence	219938-219967	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MH522424	Salmonella enterica subsp. enterica serovar Typhimurium strain SH16G4525 plasmid pSH16G4525, complete sequence	120186-120215	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NC_023277	Escherichia coli strain 63743 plasmid pEQ2, complete sequence	20196-20225	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NC_023289	Escherichia coli strain T23 plasmid pEQ1, complete sequence	20248-20277	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MF072964	Citrobacter freundii strain P10159 plasmid pP10159-4, complete sequence	33968-33997	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_KY863418	Enterobacter asburiae strain AMA 497 plasmid pOXA436, complete sequence	36658-36687	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_KY978628	Cronobacter sakazakii strain 505108 plasmid p505108-MDR, complete sequence	36169-36198	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MG288680	Klebsiella pneumoniae strain D610 plasmid pD610-HI2, complete sequence	48703-48732	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MF344582	Citrobacter freundii strain 525011 plasmid p525011-HI2, complete sequence	46299-46328	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_MF788071	Raoultella ornithinolytica strain 23141 plasmid p23141-3, complete sequence	35881-35910	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	MG874042	Salmonella sp. strain Sa4 plasmid pSa4-CIP, complete sequence	158968-158997	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP031724	Enterobacter hormaechei strain WCHEH020038 plasmid pCTXM9_020038, complete sequence	35881-35910	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP011062	Escherichia coli str. Sanji plasmid pSJ_255, complete sequence	34814-34843	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP027202	Escherichia coli strain WCHEC025943 plasmid pMCR1_025943, complete sequence	34814-34843	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP053191	Enterobacter hormaechei strain EGYMCRVIM plasmid pMS-37a, complete sequence	35881-35910	9	0.7
NC_015144_1	1.13\|1976320\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976320-1976349	30	NZ_CP016838	Salmonella enterica subsp. enterica serovar Senftenberg strain 775W (ATCC 43845) plasmid pSSE-ATCC-43845, complete sequence	37057-37086	9	0.7
NC_015144_1	1.14\|1976400\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976400-1976429	30	NZ_CP016293	Rhizobium leguminosarum strain Vaf10 plasmid unnamed5, complete sequence	72857-72886	9	0.7
NC_015144_1	1.15\|1976480\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976480-1976509	30	NZ_CP028919	Gemmobacter sp. HYN0069 plasmid unnamed1, complete sequence	45070-45099	9	0.7
NC_015144_1	1.20\|1976880\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976880-1976909	30	KJ010548	Bacillus phage Bp8p-T, complete genome	62714-62743	9	0.7
NC_015144_1	1.20\|1976880\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976880-1976909	30	NC_029121	Bacillus phage Bp8p-C, complete genome	62712-62741	9	0.7
NC_015144_1	1.20\|1976880\|30\|NC_015144\|CRISPRCasFinder,PILER-CR	1976880-1976909	30	NC_024792	Bacillus phage Bobb, complete genome	85307-85336	9	0.7

1. spacer 1.1|1975360|30|NC_015144|CRISPRCasFinder matches to AJ842011 (Bacteriophage 11b complete genome) position: , mismatch: 5, identity: 0.833

aacaaaataagatgagtgt--aattgatttat	CRISPR spacer
aaccaaataagatgagtgtaaaagtaattt--	Protospacer
*** ***************  ** *.****

2. spacer 1.1|1975360|30|NC_015144|CRISPRCasFinder matches to NC_006356 (Flavobacterium phage 11b, complete genome) position: , mismatch: 5, identity: 0.833

aacaaaataagatgagtgt--aattgatttat	CRISPR spacer
aaccaaataagatgagtgtaaaagtaattt--	Protospacer
*** ***************  ** *.****

3. spacer 1.9|1976000|30|NC_015144|CRISPRCasFinder,PILER-CR matches to MF360958 (Salicola phage SCTP-2, complete genome) position: , mismatch: 5, identity: 0.833

atattattttgagaaaacttataaatcatc	CRISPR spacer
atattattttgagaaaaattattaaaaata	Protospacer
***************** **** **  **

4. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MF547664 (Clostridioides difficile strain LIBA-6289 plasmid LIBA6289, complete sequence) position: , mismatch: 5, identity: 0.833

tattaattcaagcataatgttttgatggtt	CRISPR spacer
tattaatttaagcataattttttgctcttt	Protospacer
********.********* ***** *  **

5. spacer 1.3|1975520|30|NC_015144|CRISPRCasFinder,PILER-CR matches to MN694026 (Marine virus AFVG_250M644, complete genome) position: , mismatch: 6, identity: 0.8

tgtatttcataaatttatctaatctctcaa	CRISPR spacer
attattttataaatttatctaatcttttta	Protospacer
  *****.*****************.*. *

6. spacer 1.3|1975520|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP009921 (Bacillus megaterium NBRC 15308 = ATCC 14581 plasmid pBMV_2, complete sequence) position: , mismatch: 6, identity: 0.8

tgtatttcataaatttatctaatctctcaa	CRISPR spacer
agcgtttcaaaaatttatcaaatctctcta	Protospacer
 *..***** ********* ******** *

7. spacer 1.3|1975520|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP035095 (Bacillus megaterium NBRC 15308 = ATCC 14581 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

tgtatttcataaatttatctaatctctcaa	CRISPR spacer
agcgtttcaaaaatttatcaaatctctcta	Protospacer
 *..***** ********* ******** *

8. spacer 1.3|1975520|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NC_013940 (Deferribacter desulfuricans SSM1 megaplasmid pDF308, complete sequence) position: , mismatch: 6, identity: 0.8

tgtatttcataaatttatctaatctctcaa	CRISPR spacer
tgtctttcttaaatttatctaattcttcta	Protospacer
*** **** **************...** *

9. spacer 1.5|1975680|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP029455 (Bacillus cereus strain FORC087 plasmid pFORC087.1, complete sequence) position: , mismatch: 6, identity: 0.8

tgtttataacaagctaagagggtggaagtc	CRISPR spacer
ggttattggcaagctaagagggtgaaagtc	Protospacer
 ***  *..***************.*****

10. spacer 1.5|1975680|30|NC_015144|CRISPRCasFinder,PILER-CR matches to CP024686 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-2-313K, complete sequence) position: , mismatch: 6, identity: 0.8

tgtttataacaagctaagagggtggaagtc	CRISPR spacer
ggttattggcaagctaagagggtgaaagtc	Protospacer
 ***  *..***************.*****

11. spacer 1.12|1976240|30|NC_015144|CRISPRCasFinder,PILER-CR matches to MN180249 (UNVERIFIED: Wolbachia phage WO isolate Seq2WORi_AMD2 genomic sequence) position: , mismatch: 6, identity: 0.8

ataaaacatttcaaacaaaattctttaagc	CRISPR spacer
ataaaacatttgaaacaaaattctgtggaa	Protospacer
*********** ************ *...

12. spacer 1.1|1975360|30|NC_015144|CRISPRCasFinder matches to AJ842011 (Bacteriophage 11b complete genome) position: , mismatch: 7, identity: 0.767

aacaaaataagatgagtgtaattgatttat	CRISPR spacer
aaccaaataagatgagtgtaaaagcagtgt	Protospacer
*** *****************  *   *.*

13. spacer 1.1|1975360|30|NC_015144|CRISPRCasFinder matches to NC_006356 (Flavobacterium phage 11b, complete genome) position: , mismatch: 7, identity: 0.767

aacaaaataagatgagtgtaattgatttat	CRISPR spacer
aaccaaataagatgagtgtaaaagcagtgt	Protospacer
*** *****************  *   *.*

14. spacer 1.3|1975520|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_LR735422 (Staphylococcus epidermidis strain none isolate Se_BPH0697 plasmid 2) position: , mismatch: 7, identity: 0.767

tgtatttcataaatttatctaatctctcaa-----	CRISPR spacer
agtctttcataaatttatctaat-----aatgggt	Protospacer
 ** *******************     **

15. spacer 1.3|1975520|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP031268 (Staphylococcus warneri strain 16A plasmid unnamed2) position: , mismatch: 7, identity: 0.767

tgtatttcataaatttatctaatctctcaa-----	CRISPR spacer
agtctttcataaatttatctaat-----aaaggat	Protospacer
 ** *******************     **

16. spacer 1.3|1975520|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP031268 (Staphylococcus warneri strain 16A plasmid unnamed2) position: , mismatch: 7, identity: 0.767

tgtatttcataaatttatctaatctctcaa-----	CRISPR spacer
agtctttcataaatttatctaat-----aaaggat	Protospacer
 ** *******************     **

17. spacer 1.3|1975520|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_HG813246 (Staphylococcus epidermidis PM221 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.767

tgtatttcataaatttatctaatctctcaa-----	CRISPR spacer
agtctttcataaatttatctaat-----aagggat	Protospacer
 ** *******************     **

18. spacer 1.3|1975520|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP042875 (Bacillus cereus strain 09 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

tgtatttcataaatttatctaatctctcaa	CRISPR spacer
tgtatttaaaaaatttatctaataattcct	Protospacer
******* * *************  .**

19. spacer 1.4|1975600|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP040761 (Paracoccus sp. 2251 plasmid unnamed5, complete sequence) position: , mismatch: 7, identity: 0.767

ggaaacgggcgtcggtgaagtcatcgatac	CRISPR spacer
gggcgcgggcatcggtgaagtcgtcgatga	Protospacer
**. .*****.***********.*****.

20. spacer 1.4|1975600|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP054032 (Rhizobium sp. JKLM13E plasmid pPR13E01, complete sequence) position: , mismatch: 7, identity: 0.767

ggaaacgggcgtcggtgaagtcatcgatac	CRISPR spacer
cgccataggcatcggtgaagtcatcgaaac	Protospacer
 *  *..***.**************** **

21. spacer 1.7|1975840|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NC_007021 (Staphylococcus phage Twort, complete genome) position: , mismatch: 7, identity: 0.767

atgtagaatatgaatcagatagagatgcaa	CRISPR spacer
atgtaaaatatgaatcagatagtgaacatg	Protospacer
*****.**************** **    .

22. spacer 1.7|1975840|30|NC_015144|CRISPRCasFinder,PILER-CR matches to MT151386 (Staphylococcus virus Twort, complete genome) position: , mismatch: 7, identity: 0.767

atgtagaatatgaatcagatagagatgcaa	CRISPR spacer
atgtaaaatatgaatcagatagtgaacatg	Protospacer
*****.**************** **    .

23. spacer 1.7|1975840|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP045273 (Bacillus megaterium strain FDU301 plasmid pFDU301A, complete sequence) position: , mismatch: 7, identity: 0.767

atgtagaatatgaatcagatagagatgcaa	CRISPR spacer
ttgaagaatttgaatcagatagagtaaaaa	Protospacer
 ** ***** **************  . **

24. spacer 1.9|1976000|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP022299 (Acinetobacter johnsonii strain IC001 plasmid pIC001A, complete sequence) position: , mismatch: 7, identity: 0.767

atattattttgagaaaacttataaatcatc	CRISPR spacer
aattgattttgagataacatataaatcagg	Protospacer
*  * ********* *** *********

25. spacer 1.9|1976000|30|NC_015144|CRISPRCasFinder,PILER-CR matches to MN694614 (Marine virus AFVG_250M469, complete genome) position: , mismatch: 7, identity: 0.767

atattattttgagaaaacttataaatcatc	CRISPR spacer
acattattttcagaagacttataaagatcc	Protospacer
*.******** ****.*********   .*

26. spacer 1.18|1976720|30|NC_015144|CRISPRCasFinder,PILER-CR matches to MT423824 (Staphylococcus virus pSp_SNUABM-S, complete genome) position: , mismatch: 7, identity: 0.767

cagtttctaatccaacgctgaacgttgata	CRISPR spacer
aagtttctaatgcaacgcttaacgtagcag	Protospacer
 ********** ******* ***** *  .

27. spacer 1.18|1976720|30|NC_015144|CRISPRCasFinder,PILER-CR matches to MT423823 (Staphylococcus virus pSp_SNUABM-J, complete genome) position: , mismatch: 7, identity: 0.767

cagtttctaatccaacgctgaacgttgata	CRISPR spacer
aagtttctaatgcaacgcttaacgtagcag	Protospacer
 ********** ******* ***** *  .

28. spacer 1.20|1976880|30|NC_015144|CRISPRCasFinder,PILER-CR matches to MN694574 (Marine virus AFVG_250M706, complete genome) position: , mismatch: 7, identity: 0.767

gctcaatatatccaagagcaacacaatggt	CRISPR spacer
gagcgttatatccaatagcaacacaatttt	Protospacer
*  *. ********* ***********  *

29. spacer 1.3|1975520|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP022909 (Staphylococcus aureus strain 545 plasmid pPS00078.1A.1, complete sequence) position: , mismatch: 8, identity: 0.733

tgtatttcataaatttatctaatctctcaa	CRISPR spacer
agtctttcataaatttatctaataatggat	Protospacer
 ** *******************  .  *

30. spacer 1.3|1975520|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP007500 (Staphylococcus aureus strain 2395 USA500 plasmid pUSA500, complete sequence) position: , mismatch: 8, identity: 0.733

tgtatttcataaatttatctaatctctcaa	CRISPR spacer
agtctttcataaatttatctaataatggat	Protospacer
 ** *******************  .  *

31. spacer 1.3|1975520|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP027420 (Staphylococcus cohnii strain FDAARGOS_334 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

tgtatttcataaatttatctaatctctcaa	CRISPR spacer
agtctttcataaatttatctaatagtggat	Protospacer
 ** *******************  .  *

32. spacer 1.3|1975520|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP046300 (Staphylococcus hominis strain FDAARGOS_747 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

tgtatttcataaatttatctaatctctcaa	CRISPR spacer
agtctttcataaatttatctaataatggat	Protospacer
 ** *******************  .  *

33. spacer 1.3|1975520|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

tgtatttcataaatttatctaatctctcaa	CRISPR spacer
agtctttcataaatttatctaataatggat	Protospacer
 ** *******************  .  *

34. spacer 1.3|1975520|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP035293 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.733

tgtatttcataaatttatctaatctctcaa	CRISPR spacer
agtctttcataaatttatctaataatggat	Protospacer
 ** *******************  .  *

35. spacer 1.3|1975520|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NC_013321 (Staphylococcus aureus plasmid SAP017A, complete sequence) position: , mismatch: 8, identity: 0.733

tgtatttcataaatttatctaatctctcaa	CRISPR spacer
agtctttcataaatttatctaataatggat	Protospacer
 ** *******************  .  *

36. spacer 1.3|1975520|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NC_005004 (Staphylococcus epidermidis ATCC 12228 plasmid pSE-12228-05, complete sequence) position: , mismatch: 8, identity: 0.733

tgtatttcataaatttatctaatctctcaa	CRISPR spacer
ggtctttcataaatttatctaataatggat	Protospacer
 ** *******************  .  *

37. spacer 1.3|1975520|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_HG813245 (Staphylococcus epidermidis PM221 plasmid 2, complete sequence) position: , mismatch: 8, identity: 0.733

tgtatttcataaatttatctaatctctcaa	CRISPR spacer
agtctttcataaatttatctaataatggat	Protospacer
 ** *******************  .  *

38. spacer 1.3|1975520|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NC_013379 (Staphylococcus epidermidis plasmid SAP106A, complete sequence) position: , mismatch: 8, identity: 0.733

tgtatttcataaatttatctaatctctcaa	CRISPR spacer
agtctttcataaatttatctaataatggat	Protospacer
 ** *******************  .  *

39. spacer 1.3|1975520|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP022907 (Staphylococcus aureus strain 546 plasmid pPS00077.1A.1, complete sequence) position: , mismatch: 8, identity: 0.733

tgtatttcataaatttatctaatctctcaa	CRISPR spacer
agtctttcataaatttatctaataatggat	Protospacer
 ** *******************  .  *

40. spacer 1.3|1975520|30|NC_015144|CRISPRCasFinder,PILER-CR matches to CP027492 (Staphylococcus aureus strain ST2594 isolate 004 plasmid unnamed7) position: , mismatch: 8, identity: 0.733

tgtatttcataaatttatctaatctctcaa	CRISPR spacer
agtctttcataaatttatctaataatggat	Protospacer
 ** *******************  .  *

41. spacer 1.3|1975520|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP031281 (Staphylococcus pasteuri strain 3C plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

tgtatttcataaatttatctaatctctcaa	CRISPR spacer
ggtctttcataaatttatctaataatggat	Protospacer
 ** *******************  .  *

42. spacer 1.3|1975520|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP033731 (Staphylococcus hominis strain FDAARGOS_575 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

tgtatttcataaatttatctaatctctcaa	CRISPR spacer
agtctttcataaatttatctaataatggat	Protospacer
 ** *******************  .  *

43. spacer 1.3|1975520|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP043303 (Staphylococcus aureus strain 16445 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

tgtatttcataaatttatctaatctctcaa	CRISPR spacer
agtctttcataaatttatctaataatggat	Protospacer
 ** *******************  .  *

44. spacer 1.3|1975520|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP053638 (Staphylococcus aureus strain 14732 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

tgtatttcataaatttatctaatctctcaa	CRISPR spacer
agtctttcataaatttatctaataatggat	Protospacer
 ** *******************  .  *

45. spacer 1.3|1975520|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MK046687 (Staphylococcus epidermidis strain 107.2 plasmid pAQZ1, complete sequence) position: , mismatch: 8, identity: 0.733

tgtatttcataaatttatctaatctctcaa	CRISPR spacer
ggtctttcataaatttatctaataatggat	Protospacer
 ** *******************  .  *

46. spacer 1.4|1975600|30|NC_015144|CRISPRCasFinder,PILER-CR matches to MN908684 (Arthrobacter phage Shoya, complete genome) position: , mismatch: 8, identity: 0.733

ggaaacgggcgtcggtgaagtcatcgatac	CRISPR spacer
cgttgcgggcgtcggtgaagacctcgatct	Protospacer
 *  .*************** * ***** .

47. spacer 1.9|1976000|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP040343 (Bacillus cereus strain DLOU-Weihai plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

atattattttgagaaaacttataaatcatc	CRISPR spacer
atgttattttcagaaaacttatactaattt	Protospacer
**.******* ************     *.

48. spacer 1.9|1976000|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NC_028998 (Phormidium phage MIS-PhV1B, complete genome) position: , mismatch: 8, identity: 0.733

atattattttgagaaaacttataaatcatc	CRISPR spacer
tggtgattttgacaaaacttataaatgctt	Protospacer
  .* ******* *************  *.

49. spacer 1.12|1976240|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP045305 (Legionella longbeachae strain B1445CHC plasmid pB1445CHC_150k, complete sequence) position: , mismatch: 8, identity: 0.733

ataaaacatttcaaacaaaattctttaagc	CRISPR spacer
ttggataatttcaaacataattctttaaca	Protospacer
 *..*  ********** **********

50. spacer 1.12|1976240|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP042253 (Legionella longbeachae strain B3526CHC plasmid pB3526CHC_150k, complete sequence) position: , mismatch: 8, identity: 0.733

ataaaacatttcaaacaaaattctttaagc	CRISPR spacer
ttggataatttcaaacataattctttaaca	Protospacer
 *..*  ********** **********

51. spacer 1.12|1976240|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MH671358 (Bacillus pumilus strain 63-2-2 plasmid pBP-6322, complete sequence) position: , mismatch: 8, identity: 0.733

ataaaacatttcaaacaaaattctttaagc	CRISPR spacer
ttacaacatttcaaacaaaattgaccatga	Protospacer
 ** ******************  ..* *

52. spacer 1.12|1976240|30|NC_015144|CRISPRCasFinder,PILER-CR matches to MT002873 (Tenacibaculum phage JQ, complete genome) position: , mismatch: 8, identity: 0.733

ataaaacatttcaaacaaaattctttaagc	CRISPR spacer
ataaaacattacaaacaaaataacattata	Protospacer
********** **********  . * *

53. spacer 1.12|1976240|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NC_018141 (Legionella pneumophila subsp. pneumophila plasmid pLELO, complete sequence) position: , mismatch: 8, identity: 0.733

ataaaacatttcaaacaaaattctttaagc	CRISPR spacer
ttggataatttcaaacataattctttaaca	Protospacer
 *..*  ********** **********

54. spacer 1.12|1976240|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP025492 (Legionella sainthelensi strain LA01-117 plasmid pLA01-117_150k, complete sequence) position: , mismatch: 8, identity: 0.733

ataaaacatttcaaacaaaattctttaagc	CRISPR spacer
ttggataatttcaaacataattctttaaca	Protospacer
 *..*  ********** **********

55. spacer 1.12|1976240|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP021284 (Legionella pneumophila subsp. pneumophila strain Allentown 1 (D-7475) plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ataaaacatttcaaacaaaattctttaagc	CRISPR spacer
ttggataatttcaaacataattctttaaca	Protospacer
 *..*  ********** **********

56. spacer 1.12|1976240|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP011106 (Legionella pneumophila strain L10-023 isolate Ulm plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

ataaaacatttcaaacaaaattctttaagc	CRISPR spacer
ttggataatttcaaacataattctttaaca	Protospacer
 *..*  ********** **********

57. spacer 1.15|1976480|30|NC_015144|CRISPRCasFinder,PILER-CR matches to MH617537 (Phage sp. isolate ctcb314, complete genome) position: , mismatch: 8, identity: 0.733

gcactgaatatggatatccagacgatcgtc	CRISPR spacer
aggttgaatatgcatatccagaagatcttg	Protospacer
. ..******** ********* **** *

58. spacer 1.15|1976480|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NC_010844 (Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)' plasmid p74, complete sequence) position: , mismatch: 8, identity: 0.733

gcactgaatatggatatccagacgatcgtc	CRISPR spacer
gcactgaaaatggatatccaggaagtctcg	Protospacer
******** ************. ..** .

59. spacer 1.15|1976480|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NC_010846 (Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)' plasmid p74, complete sequence) position: , mismatch: 8, identity: 0.733

gcactgaatatggatatccagacgatcgtc	CRISPR spacer
gcactgaaaatggatatccaggaagtctcg	Protospacer
******** ************. ..** .

60. spacer 1.19|1976800|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP004007 (Legionella oakridgensis ATCC 33761 = DSM 21215 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

gtggagtatttgcttaatgcctttgttggc	CRISPR spacer
ccctatgttttgcttaatgcctttgatggc	Protospacer
 .  *   ***************** ****

61. spacer 1.4|1975600|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP022194 (Yangia pacifica strain YSBP01 plasmid unnamed4, complete sequence) position: , mismatch: 9, identity: 0.7

ggaaacgggcgtcggtgaagtcatcgatac	CRISPR spacer
cgccgcgggcgtcgatgaagtcatcgccgg	Protospacer
 *  .*********.*********** ..

62. spacer 1.12|1976240|30|NC_015144|CRISPRCasFinder,PILER-CR matches to MK373778 (Escherichia phage vB_EcoM_WFbE185, complete genome) position: , mismatch: 9, identity: 0.7

ataaaacatttcaaacaaaattctttaagc	CRISPR spacer
gtaaaacgtttcaaacaaaatttccatatg	Protospacer
.******.**************...  *

63. spacer 1.12|1976240|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NC_024794 (Escherichia phage vB_EcoM_PhAPEC2, complete genome) position: , mismatch: 9, identity: 0.7

ataaaacatttcaaacaaaattctttaagc	CRISPR spacer
gtaaaacgtttcaaacaaaatttccatatg	Protospacer
.******.**************...  *

64. spacer 1.12|1976240|30|NC_015144|CRISPRCasFinder,PILER-CR matches to MT782071 (Escherichia phage JN02, complete genome) position: , mismatch: 9, identity: 0.7

ataaaacatttcaaacaaaattctttaagc	CRISPR spacer
gtaaaacgtttcaaacaaaatttccatatg	Protospacer
.******.**************...  *

65. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_KX518743 (Escherichia coli strain HYEC7 plasmid pHYEC7-IncHI2, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

66. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_KY401053 (Salmonella enterica subsp. enterica serovar Enteritidis strain SE380 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

67. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_KY689633 (Escherichia coli strain 100R plasmid p100R, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

68. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_KY689632 (Escherichia coli strain 19-M12 plasmid p19M12, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

69. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_KY019259 (Escherichia coli strain YJMC8 plasmid pHNYJC8, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

70. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_KY421937 (Escherichia coli strain FS13Z2S plasmid pFS13Z2S, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

71. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP033256 (Salmonella enterica subsp. enterica strain CFSA12 plasmid pCFSA12, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

72. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP026492 (Escherichia coli strain HS13-1 plasmid pHS13-1-IncHI2, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

73. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP034785 (Escherichia coli strain ECZP248 plasmid pTBMCR401, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

74. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_KU743384 (Escherichia coli strain SA26 plasmid pSA26-MCR-1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

75. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_KX421096 (Salmonella enterica subsp. enterica serovar Indiana strain A3 plasmid pA3T, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

76. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_KX434879 (Klebsiella pneumoniae strain KP2442 plasmid pKP2442_1c330, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

77. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_KU341381 (Escherichia coli strain SHP45 plasmid pHNSHP45-2, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

78. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_KY019258 (Escherichia coli strain LDHF400 plasmid pHNLDF400, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

79. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_KX721511 (Salmonella enterica subsp. enterica serovar Typhimurium strain SC523 plasmid pSC523, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

80. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_KU254578 (Escherichia coli strain YD786 plasmid pYD786-1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

81. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_KX810825 (Salmonella enterica subsp. enterica serovar Typhimurium strain MU1 plasmid pIMP4-SEM1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

82. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_KX276657 (Escherichia coli strain MRSN388634 plasmid pMR0516mcr, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

83. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_KX246266 (Escherichia coli strain AHCH67 plasmid pHNAH67, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

84. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_KX254341 (Escherichia coli strain JS-B60 plasmid pECJS-B60-267, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

85. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_KM396300 (Salmonella enterica subsp. enterica serovar Enteritidis strain SEN110055 plasmid pSEN110055, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

86. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_KM396298 (Salmonella enterica subsp. enterica serovar Enteritidis strain KUSR18 plasmid pKUSR18, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

87. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_KM396299 (Salmonella enterica subsp. enterica serovar Enteritidis strain SEN112499 plasmid pSEN112499, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

88. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_KR653209 (Escherichia coli strain GDZ13 plasmid pGD0503Z13, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

89. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_KT334335 (Salmonella enterica subsp. enterica serovar Typhimurium strain ST06-53 plasmid pHK0653, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

90. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_KT347600 (Escherichia coli strain EC5207 plasmid pEC5207, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

91. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_KP975077 (Enterobacter cloacae strain MRSN17626 plasmid pMRVIM0813, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

92. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to LT221036 (Yersinia pseudotuberculosis strain Yps.F1, plasmid pYps.F1 complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

93. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP028197 (Salmonella enterica subsp. enterica serovar Concord strain CFSAN018747 plasmid pGMI14-002_1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

94. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP042628 (Escherichia coli strain NCYU-25-82 plasmid pNCYU-25-82-1_MCR3, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

95. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP011601 (Phytobacter ursingii strain CAV1151 plasmid pCAV1151-296, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

96. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to CP019195 (Salmonella enterica subsp. enterica serovar Senftenberg str. ATCC 43845 plasmid pATCC43845, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

97. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP028975 (Cronobacter sakazakii strain GZcsf-1 plasmid pGW1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

98. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP043951 (Escherichia coli strain ST95-32 plasmid pST95-32-1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

99. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP040457 (Salmonella enterica subsp. enterica serovar Typhimurium strain TJWQ005 plasmid pTJWQ005, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

100. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to KY075659 (Escherichia coli strain GD80 plasmid pGD80-2, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

101. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to MN539018 (Salmonella sp. strain OYZ4 plasmid pOYZ4, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

102. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to MN732922 (Escherichia coli strain 49K plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

103. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP026790 (Shigella flexneri 2a strain ATCC 29903 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

104. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP019559 (Escherichia coli strain KSC207 plasmid pMRGN207, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

105. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP039717 (Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS000211 plasmid p10-3184.1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

106. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP010380 (Enterobacter hormaechei subsp. hormaechei strain 34983 plasmid p34983-328.905kb, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaattgc	Protospacer
  ***** ********* *******    .

107. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to KX023262 (Escherichia coli plasmid pSCE516-1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

108. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP026171 (Leclercia sp. LSNIH1 plasmid pLEC-1cb1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaattgc	Protospacer
  ***** ********* *******    .

109. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP048293 (Escherichia coli strain CVM N18EC0432 plasmid pN18EC0432-1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

110. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to KP899803 (Salmonella enterica strain 8025 plasmid p8025, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaattgc	Protospacer
  ***** ********* *******    .

111. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to KP899804 (Salmonella enterica strain F8475 plasmid pF8475, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

112. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to KP899805 (Salmonella enterica strain 109/9 plasmid p109/9, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

113. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to KP899806 (Salmonella enterica strain B71 plasmid pB71, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

114. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP037875 (Salmonella enterica subsp. enterica serovar 4,[5],12:i:- strain PNCS015054 plasmid pPNCS015054_S2, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

115. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP018652 (Salmonella enterica subsp. enterica serovar Enteritidis strain 81-1705 plasmid pSE81-1705-1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

116. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to MK574666 (Escherichia coli strain DJB-3 plasmid pDJB-3, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

117. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to MN915010 (Escherichia coli strain TJ-33 plasmid pNDM-TJ33, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

118. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to MN915011 (Escherichia coli strain GD-33 plasmid pNDM33-1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

119. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to CP009869 (Pantoea sp. PSNIH2 plasmid pPSP-75c, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaattgc	Protospacer
  ***** ********* *******    .

120. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP019260 (Escherichia coli strain 13C1065T plasmid p13C1065T-1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

121. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP020529 (Enterobacter cloacae strain 174 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

122. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to MN232189 (Escherichia coli plasmid pGD27-124, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

123. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to MN232191 (Escherichia coli plasmid pGD27-37, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

124. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to MN232195 (Escherichia coli plasmid pGD27-70, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

125. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to CP042639 (Escherichia coli strain NCYU-24-74 plasmid pNCYU-24-74-1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

126. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP031567 (Enterobacter hormaechei strain 2013_1a plasmid pIncHI2-1301491, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

127. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to MN200941 (Escherichia coli strain E648 plasmid pE648CTX-M-65, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

128. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP040888 (Leclercia adecarboxylata strain Z96-1 plasmid pZ96-1_1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

129. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP044306 (Escherichia coli strain C27A plasmid pC27A-CTX-M-55, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

130. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP039559 (Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014846 plasmid p08-4425.1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

131. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP038139 (Escherichia coli strain G3X16-2 plasmid pG3X16-2-2, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

132. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP034820 (Salmonella sp. SSDFZ54 plasmid pTB501, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

133. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to CP031284 (Escherichia fergusonii strain 40A plasmid p280_40A, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

134. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to MK461930 (Escherichia coli strain 2009_36 plasmid p2009_36_HI2, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

135. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP029037 (Salmonella enterica subsp. enterica serovar Senftenberg str. 361154004 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

136. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to CP042895 (Escherichia coli strain CFSAN061772 plasmid pCFSAN061772_02, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

137. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP021209 (Escherichia coli strain strain Z247 plasmid p2474-MCR1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

138. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP022735 (Escherichia coli strain SA186 plasmid pSA186_MCR1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

139. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to CP042898 (Escherichia coli strain CFSAN061771 plasmid pCFSAN061771_02, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

140. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP040806 (Escherichia fergusonii strain EFCF056 plasmid pEF01, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

141. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP041180 (Salmonella enterica subsp. enterica serovar Indiana strain SJTUF87912v2 isolate food plasmid p87912, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

142. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP019443 (Salmonella enterica subsp. enterica serovar Typhimurium strain 81741 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

143. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP032179 (Citrobacter freundii strain AR_0116 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaattgc	Protospacer
  ***** ********* *******    .

144. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP029142 (Klebsiella michiganensis strain AR375 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaattgc	Protospacer
  ***** ********* *******    .

145. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to MN256758 (Escherichia coli strain 4M8F plasmid p4M8F, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

146. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to MN256759 (Escherichia coli strain 4M9F plasmid p4M9F, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

147. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP031575 (Enterobacter hormaechei strain A1 plasmid pIncHI2-1502264, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

148. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_LT795115 (Salmonella enterica subsp. enterica serovar Typhimurium isolate VNB151-sc-2315230 plasmid p1) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

149. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP017632 (Escherichia coli strain SLK172 plasmid pSLK172-1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

150. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP046007 (Escherichia coli strain 1919D62 plasmid p1919D62-1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

151. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP023570 (Enterobacter hormaechei strain BW plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

152. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NC_002305 (Salmonella typhi plasmid R27, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

153. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to LC532224 (Enterobacter hormaechei subsp. xiangfangensis A2483 plasmid pA2483mcr-9 DNA, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

154. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to LC532226 (Enterobacter hormaechei subsp. xiangfangensis A2504 plasmid pA2504mcr-9 DNA, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

155. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NC_021845 (Salmonella enterica subsp. enterica serovar Cubana str. CFSAN002050 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

156. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP026642 (Escherichia coli strain FORC_082 plasmid pFORC82_1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

157. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to LT905061 (Salmonella enterica subsp. enterica serovar Typhi isolate ISP_03_07467_SGB110-sc-1979083 genome assembly, plasmid: 2) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

158. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP031135 (Escherichia coli strain CFSAN064035 plasmid pGMI17-003_1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaattgc	Protospacer
  ***** ********* *******    .

159. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to MN816370 (Escherichia coli strain A102 plasmid pA102-CTX-M-65, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

160. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP043767 (Enterobacter hormaechei strain EB_P9_L5_03.19 plasmid pIMPIncH12_331kb, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

161. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP047668 (Klebsiella aerogenes strain HNHF1 plasmid pHNHF1_NDM-9, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

162. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP027144 (Enterobacter hormaechei subsp. hoffmannii strain AR_0365 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

163. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP034788 (Escherichia coli strain ECCNB20-2 plasmid pTBMCR421, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

164. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP022495 (Salmonella enterica subsp. enterica serovar Derby strain SA20035215 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

165. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP016184 (Escherichia coli strain EC2 plasmid pEC2-4, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

166. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP016183 (Escherichia coli strain EC2_1 plasmid pEC2_1-4, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

167. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP033636 (Escherichia coli isolate ECCNB12-2 plasmid pTB-nb4, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

168. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP050778 (Salmonella enterica subsp. enterica serovar Indiana strain SI96 plasmid pSI96-1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

169. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to MN256757 (Escherichia coli strain 4M18F plasmid p4M18F, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

170. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_AP018352 (Enterobacter hormaechei strain TUM11043 plasmid pMTY11043_IncHI2, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

171. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP038654 (Citrobacter freundii strain 154 plasmid p154_1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

172. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP038657 (Citrobacter freundii strain 565 plasmid p565_1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

173. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP027411 (Salmonella enterica strain FDAARGOS_319 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

174. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP044111 (Klebsiella michiganensis strain FDAARGOS_647 plasmid unnamed2) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaattgc	Protospacer
  ***** ********* *******    .

175. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NC_016825 (Salmonella enterica subsp. enterica serovar Typhi str. P-stx-12 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

176. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP044051 (Klebsiella variicola strain FDAARGOS_627 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

177. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP025402 (Escherichia coli strain MS8345 plasmid pMS8345A, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

178. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MK477605 (Salmonella enterica strain SH15G1428 plasmid pSH15G1428, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

179. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MK477609 (Salmonella enterica strain SH15G1598 plasmid pSH15G1598, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

180. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MK477614 (Salmonella enterica strain SH16G1394 plasmid pSH16G1394, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

181. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MK477619 (Salmonella enterica strain SH16G4918 plasmid pSH16G4918, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

182. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MK673548 (Salmonella enterica subsp. enterica serovar Typhimurium strain GDP37-4 plasmid pGDP37-4, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

183. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MK477606 (Salmonella enterica strain SH15G1450 plasmid pSH15G1450, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

184. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MK477620 (Salmonella enterica strain SH16G4926 plasmid pSH16G4926, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

185. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MK673549 (Salmonella enterica subsp. enterica serovar Typhimurium strain JXP9 plasmid pJXP9, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

186. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MK477602 (Salmonella enterica strain SH15G1169 plasmid pSH15G1169, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

187. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MK477607 (Salmonella enterica strain SH15G1452 plasmid pSH15G1452, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

188. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MK477611 (Salmonella enterica strain SH15G2194 plasmid pSH15G2194, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

189. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MK477616 (Salmonella enterica strain SH16G2456 plasmid pSH16G2456, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

190. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MK477603 (Salmonella enterica strain SH15G1219 plasmid pSH15G1219, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

191. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MK477608 (Salmonella enterica strain SH15G1571 plasmid pSH15G1571, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

192. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MK477617 (Salmonella enterica strain SH16G4466 plasmid pSH16G4466, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

193. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MK477618 (Salmonella enterica strain SH16G4511 plasmid pSH16G4511, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

194. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MK673547 (Salmonella enterica subsp. enterica serovar Typhimurium strain GDP25-25 plasmid pGDP25-25, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

195. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MH179305 (Salmonella enterica subsp. enterica serovar Indiana strain JT01 plasmid pJT01, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

196. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MH105051 (Salmonella enterica subsp. enterica serovar Lomita strain SL131 plasmid pSL131_IncHI2, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

197. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MH208235 (Escherichia coli strain APECA2 plasmid pJMA2, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

198. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MH522413 (Salmonella enterica subsp. enterica serovar Typhimurium strain SH14G1670 plasmid pSH14G1670, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

199. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MH459020 (Escherichia coli strain GZ6DS2 plasmid pHN6DS2, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

200. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MH491004 (Escherichia coli strain RJ749 plasmid pRJ749, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

201. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to MT219825 (Escherichia coli strain RW7-1 plasmid pRW7-1_235k_tetX, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

202. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MF174859 (Escherichia coli strain 6/14/6b plasmid pIncHI2-MU3, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

203. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MG014722 (Escherichia coli strain P2-3 plasmid pP2-3T, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

204. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MG014720 (Escherichia coli strain A74 plasmid pA74T, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

205. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MG014721 (Escherichia coli strain FS11Y5C plasmid pFS11Y5CT, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

206. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MG773376 (Escherichia coli strain LSB54 plasmid pLSB54-mcr-1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

207. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MG825373 (Escherichia coli strain 1106 plasmid p1106-IncHI2, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

208. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MG385063 (Escherichia coli strain WF5-29 plasmid pWF5-29, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

209. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MG656414 (Escherichia coli strain 15-50 plasmid pEC15-MCR-50, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

210. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MH522418 (Salmonella enterica subsp. enterica serovar Typhimurium strain SH16G0648 plasmid pSH16G0648, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

211. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MH128771 (Escherichia coli strain 803DBmcr plasmid 803-DB-mcr, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

212. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MH522420 (Salmonella enterica subsp. enterica serovar Typhimurium strain SH16G1508 plasmid pSH16G1508, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

213. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MH522421 (Salmonella enterica subsp. enterica serovar Typhimurium strain SH16G2457 plasmid pSH16G2457, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

214. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MH522423 (Salmonella enterica subsp. enterica serovar Typhimurium strain SH16G4498 plasmid pSH16G4498, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

215. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP049047 (Enterobacter hormaechei strain Y233 plasmid pIHI2-233, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

216. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to MT219824 (Escherichia coli strain RT18-1 plasmid pRT18-1_294k_tetX, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

217. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP015725 (Salmonella enterica strain C629 plasmid pC629, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

218. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_KY990887 (Escherichia coli strain XG-E1 plasmid pXGE1mcr, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

219. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MF083142 (Citrobacter freundii strain D36-1 plasmid pD36-1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

220. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MF135534 (Raoultella ornithinolytica strain TS48CTX plasmid pHNTS48-1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

221. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MG372114 (Salmonella enterica subsp. enterica serovar Typhimurium strain JZ26 plasmid pJZ26, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

222. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MG878867 (Escherichia coli strain Ec21617 plasmid pEc21617-310, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

223. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP022169 (Salmonella enterica subsp. enterica serovar Typhimurium strain WW012 plasmid pWW012, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

224. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to KM877269 (Salmonella enterica subsp. enterica serovar Typhimurium strain GDS147 plasmid pHXY0908, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

225. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP032993 (Escherichia coli strain W5-6 plasmid pMCR_W5-6, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

226. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_KX710093 (Leclercia adecarboxylata strain pP10164 plasmid pP10164-2, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

227. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_KY270852 (Enterobacter cloacae strain T5282 plasmid pT5282-mphA, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

228. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_KY270851 (Citrobacter freundii strain 112298 plasmid p112298-catA, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

229. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP045446 (Salmonella enterica subsp. enterica serovar Schwarzengrund strain 9355 plasmid p280_9355, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

230. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_LT904879 (Salmonella enterica subsp. enterica serovar Typhi strain ty3-193 genome assembly, plasmid: 2) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

231. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP016764 (Citrobacter freundii strain B38 plasmid pOZ181, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

232. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_KX084394 (Escherichia coli strain 59 plasmid pECJS-59-244, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

233. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_KX129784 (Escherichia coli strain H226B plasmid pH226B, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

234. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_KX129782 (Escherichia coli strain S38 plasmid pS38, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

235. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_LN830952 (Enterobacter sp. 247 strain 247 BMC plasmid pEB247, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

236. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP028537 (Enterobacter hormaechei strain SCEH020042 plasmid pQnrB4_020042, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

237. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP015833 (Escherichia coli O157 strain 180-PT54 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

238. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_AP023191 (Escherichia coli strain TUM18530 plasmid pMTY18530-1_lncHI2, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

239. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP019647 (Salmonella enterica subsp. enterica serovar Typhimurium strain TW-Stm6 plasmid pSTM6-275, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

240. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP048350 (Raoultella ornithinolytica strain 23 plasmid p23_A-OXA140, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

241. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP044256 (Salmonella enterica strain CFSAN096147 plasmid pCFSAN096147, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

242. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP045449 (Salmonella enterica subsp. enterica serovar Schwarzengrund strain 12888 plasmid p280_12888, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

243. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NC_009981 (Salmonella enterica subsp. enterica serovar Choleraesuis plasmid pMAK1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

244. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP029645 (Salmonella enterica subsp. enterica serovar Typhi strain 311189_217186 plasmid pHCM1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

245. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP027678 (Salmonella enterica subsp. enterica serovar Corvallis strain 12-01738 plasmid pSE12-01738-1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

246. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP026242 (Citrobacter freundii complex sp. CFNIH9 plasmid pCFR-eb27, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaattgc	Protospacer
  ***** ********* *******    .

247. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP029729 (Citrobacter sp. CRE-46 strain AR_0157 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

248. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP035634 (Enterobacter cloacae strain EN3600 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

249. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to MN539017 (Salmonella sp. strain PJM1 plasmid pPJM1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

250. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP053721 (Escherichia coli strain CP131_Sichuan plasmid pCP131-IncHI1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

251. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP042506 (Leclercia adecarboxylata strain E1 plasmid pE1_001, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

252. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP020493 (Salmonella enterica subsp. enterica strain 08-00436 plasmid pSE08-00436-1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

253. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP009883 (Pantoea sp. PSNIH1 plasmid pPSP-a3e, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaattgc	Protospacer
  ***** ********* *******    .

254. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to MT077884 (Escherichia coli plasmid p33, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

255. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to MT077886 (Escherichia coli plasmid p39, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

256. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to MT077888 (Escherichia coli plasmid p65, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

257. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP051431 (Escherichia sp. SCLE84 plasmid pSCLE1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

258. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NC_009838 (Escherichia coli APEC O1 plasmid pAPEC-O1-R, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

259. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP026196 (Enterobacteriaceae bacterium ENNIH1 plasmid pENT-1f0b, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaattgc	Protospacer
  ***** ********* *******    .

260. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP021727 (Escherichia coli strain Combat11I9 plasmid pCombat11I9-1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

261. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to MN423361 (Leclercia sp. strain 1106151 plasmid p1106151-mcr, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

262. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP031547 (Escherichia coli strain cq9 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

263. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to MN232190 (Escherichia coli plasmid pGD27-31, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

264. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP044299 (Escherichia coli strain P59A plasmid pP59A-CTX-M-55, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

265. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP029690 (Escherichia coli strain SD134209 plasmid pSD134209-1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

266. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP029748 (Escherichia coli strain 2016C-3878 plasmid pMCR1-PA, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

267. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NC_003384 (Salmonella enterica subsp. enterica serovar Typhi str. CT18 plasmid pHCM1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

268. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP025277 (Salmonella enterica subsp. enterica strain USDA-ARS-USMARC-60984 plasmid pSJO-60984, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

269. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to MN577015 (Salmonella enterica plasmid p0085-NDM, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

270. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP045844 (Kluyvera intermedia strain HR2 plasmid pHR2-1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

271. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP030182 (Salmonella enterica strain SA20030575 plasmid pSA20030575.1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

272. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP049354 (Escherichia coli strain T28R plasmid pT28R-1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

273. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP047379 (Escherichia coli strain CAU16175 plasmid pCAU16175_1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

274. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP023167 (Salmonella enterica subsp. enterica serovar Saintpaul strain SGB23 plasmid pSGB23, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

275. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to MH909331 (Leclercia adecarboxylata plasmid p707804-NDM, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

276. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to AP020333 (Salmonella enterica SESen3709 plasmid pSESen3709_1 DNA, complete genome) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

277. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP033382 (Salmonella enterica subsp. enterica strain CFSA300 plasmid pCFSA300-1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

278. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP035916 (Salmonella enterica strain S61394 plasmid pLS61394-MCR, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

279. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP019019 (Escherichia coli strain Ecol_244 plasmid pEC244_1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

280. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP030080 (Enterobacter hormaechei strain 20710 plasmid pIMP-20710, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

281. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP042616 (Escherichia coli strain NCYU-26-73 plasmid pNCYU-26-73-1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

282. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP037911 (Escherichia coli strain YSP8-1 plasmid pYSP8-1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

283. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP008825 (UNVERIFIED_ORG: Enterobacter cloacae ECNIH2 plasmid pKPC-272, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

284. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP022696 (Citrobacter farmeri strain AUSMDU00008141 plasmid pAUSMDU8141-1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

285. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP052871 (Enterobacter cloacae strain 3849 plasmid p3846_IncHI2_mcr, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

286. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP012141 (Shigella flexneri 4c strain 1205 plasmid 1205p1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

287. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP033385 (Salmonella enterica subsp. enterica strain CFSA1007 plasmid pCFSA1007-1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

288. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP047877 (Escherichia coli strain LD22-1 plasmid pLD22-1-MCR1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

289. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP035918 (Salmonella enterica strain S44712 plasmid pLS44712-MCR, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

290. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP046717 (Escherichia coli strain T16R plasmid pT16R-1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

291. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to CP049311 (Salmonella enterica subsp. enterica serovar Heidelberg strain CVM N53023 plasmid pN53023, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

292. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_LT991958 (Enterobacter cloacae complex sp. isolate C45 plasmid pC45-VIM4) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

293. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to LC511657 (Escherichia coli 2017.02.01CC plasmid p2017.02.01CC DNA, complete genome) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

294. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to LC511658 (Escherichia coli 2017.03.03CC plasmid p2017_03_03CC DNA, complete genome) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

295. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP043855 (Enterobacter hormaechei strain EB_P6_L3_02.19 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

296. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP044215 (Klebsiella aerogenes strain KA_P10_L5_03.19 plasmid pIMPIncH12_334kb, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

297. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP026208 (Escherichia coli strain ECONIH5 plasmid pECO-109b, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaattgc	Protospacer
  ***** ********* *******    .

298. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP039857 (Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014876 plasmid p15-0756.1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

299. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP031850 (Klebsiella pneumoniae strain 121 plasmid pKP121-1-mcr, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

300. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to CP049309 (Salmonella enterica subsp. enterica serovar Johannesburg strain CVM N58011 plasmid p58011, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

301. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NC_010870 (Klebsiella pneumoniae plasmid pK29, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

302. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP024813 (Enterobacter sp. CRENT-193 plasmid pCRENT-193_1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

303. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to CP049307 (Salmonella enterica subsp. enterica serovar Heidelberg strain CVM N58631 plasmid p58631, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

304. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP019214 (Escherichia coli strain WCHEC050613 plasmid pMCR_WCHEC050613, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

305. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP041182 (Salmonella enterica subsp. enterica serovar Indiana strain SJTUF13520v2 isolate food plasmid p13520, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

306. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to CP043545 (Escherichia coli strain F2_81 plasmid pF2_18C_HI2, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

307. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP030940 (Escherichia coli strain AMSHJX01 plasmid pAMSH1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

308. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP034832 (Salmonella sp. SSDFZ69 plasmid pTB601, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

309. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP036178 (Escherichia coli strain WCHEC025970 plasmid pCTXM199_025970, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

310. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP022451 (Salmonella enterica subsp. enterica serovar Indiana strain D90 plasmid pD90-1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

311. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP030186 (Salmonella enterica strain SA20094620 plasmid pSA20094620.1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

312. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP042494 (Leclercia adecarboxylata strain E61 plasmid pE61_001, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

313. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP033353 (Salmonella enterica subsp. enterica strain CFSA664 plasmid pCFSA664-1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

314. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP040696 (Citrobacter freundii strain R47 plasmid pR47-309, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

315. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP024143 (Escherichia coli strain 14EC029 plasmid p14EC029b, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

316. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP026391 (Leclercia sp. LSNIH3 plasmid pLEC-7c0d, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaattgc	Protospacer
  ***** ********* *******    .

317. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP047116 (Salmonella enterica subsp. enterica strain SCSM4.1 plasmid plas4.1.1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

318. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP008899 (Enterobacter hormaechei subsp. hoffmannii ECNIH3 plasmid pENT-8a4, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

319. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP008906 (Enterobacter hormaechei subsp. hoffmannii ECR091 plasmid pENT-08e, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

320. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP042552 (Enterobacter hormaechei strain C45 plasmid pC45_001, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

321. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP039271 (Salmonella enterica subsp. enterica serovar Senftenberg str. CFSAN004025 plasmid pCFSAN004025.1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

322. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP016526 (Salmonella enterica subsp. enterica serovar Heidelberg strain 09-036813-1A plasmid p09-036813-1A_261, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

323. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to CP050163 (Escherichia coli plasmid Carbapenemase(KPC-2)_IncHI2, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

324. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to KX856066 (Salmonella Typhimurium strain HSHLJ1 plasmid pHSHLJ1-MCR1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

325. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP041174 (Salmonella enterica subsp. enterica serovar Enteritidis strain SJTUF12519v2 plasmid p12519A, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

326. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP039170 (Salmonella enterica subsp. enterica serovar Goldcoast strain Sal-5364 plasmid pSal-5364, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

327. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP041734 (Enterobacter hormaechei subsp. steigerwaltii strain ME-1 plasmid pME-1a, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

328. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP022165 (Escherichia coli strain M160133 plasmid pM160133_p1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

329. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP046004 (Escherichia coli strain 1919D3 plasmid p1919D3-1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

330. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP024236 (Escherichia coli O6:H16 strain 2014EL-1346-6 plasmid unnamed4, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

331. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to MK933279 (Enterobacter hormaechei strain SCNJ07 plasmid pMCR-SCNJ07, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

332. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP012931 (Salmonella enterica subsp. enterica serovar Heidelberg strain N13-01290 plasmid pN13-01290_23, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

333. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP029895 (Salmonella enterica subsp. enterica serovar Typhi strain 311189_252186 plasmid pHCM1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

334. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP029877 (Salmonella enterica subsp. enterica serovar Typhi strain 311189_224186 plasmid pHCM1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

335. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to CP048299 (Salmonella enterica subsp. enterica serovar Schwarzengrund strain WAPHL_SAL-A00527 plasmid pN1566-2, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

336. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NC_005211 (Serratia marcescens plasmid R478, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

337. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP026661 (Salmonella enterica subsp. enterica strain 15-SA01028 plasmid pSE15-SA01028, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

338. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP042587 (Escherichia coli strain LD91-1 plasmid pLD91-1-MCR1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

339. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP033094 (Escherichia coli strain CP53 plasmid pCP53-mcr, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

340. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to LN794248 (Salmonella enterica subsp. enterica serovar Typhimurium plasmid incHI2, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

341. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP029248 (Enterobacter hormaechei subsp. xiangfangensis strain OSUVMCKPC4-2 plasmid pOSUEC_D, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

342. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP043927 (Klebsiella quasipneumoniae subsp. quasipneumoniae strain M17277 plasmid p17277A_477, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

343. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP029926 (Salmonella enterica subsp. enterica serovar Typhi strain 311189_218186 plasmid pHCM1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

344. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP029947 (Salmonella enterica subsp. enterica serovar Typhi strain 311189_210186 plasmid pHCM1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

345. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP031102 (Leclercia sp. W17 plasmid pW17-1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

346. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP012170 (Enterobacter hormaechei subsp. steigerwaltii strain 34977 plasmid p34977-263.138kb, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

347. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to LC542971 (Escherichia coli IOMTU413 plasmid pIOMTU413 DNA, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

348. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to LC542972 (Escherichia coli IOMTU792 plasmid pIOMTU792 DNA, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

349. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to CP048303 (Salmonella enterica subsp. enterica serovar Schwarzengrund strain WAPHL-SAL-A00375 plasmid p28945-2, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

350. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to CP051274 (Salmonella enterica subsp. enterica serovar Worthington strain OLF-FSR1_WB_Partridge_SW-37 plasmid pSW37-267109, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

351. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP033347 (Salmonella enterica subsp. enterica strain CFSA1096 plasmid pCFSA1096, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

352. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP043034 (Escherichia coli strain XDL plasmid pXDL-CTX-M-14, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

353. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NC_024983 (Salmonella enterica subsp. enterica serovar Typhimurium plasmid pSTm-A54650, strain A54560, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

354. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP011635 (Klebsiella oxytoca strain CAV1374 plasmid pKPC_CAV1374, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaattgc	Protospacer
  ***** ********* *******    .

355. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP044968 (Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS007098 plasmid pPNCS014881.1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

356. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP044958 (Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS007087 plasmid pPNCS007087.1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

357. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP037959 (Salmonella enterica subsp. enterica serovar Goldcoast strain R18.0877 plasmid pR18.0877_278k, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

358. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to CP051271 (Salmonella enterica subsp. enterica serovar Worthington strain OLF-FSR1_WB_Quail_SW-70 plasmid pSW37-267106, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

359. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP033224 (Salmonella enterica subsp. enterica strain CFSA122 plasmid pCFSA122-1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

360. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP033253 (Salmonella enterica subsp. enterica strain CFSA244 plasmid pCFSA244-1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

361. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP047659 (Escherichia coli strain LD39-1 plasmid pLD39-1-MCR1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

362. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP047666 (Escherichia coli strain LD26-1 plasmid pLD26-1-MCR1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

363. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP039861 (Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014880 plasmid p16-6773.1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

364. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP034390 (Escherichia coli strain RS571 plasmid pRS571-MCR-1.1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

365. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to KX856065 (Salmonella enterica subsp. enterica serovar Typhimurium plasmid pASSD2-MCR1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

366. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP013215 (Klebsiella pneumoniae subsp. pneumoniae strain H11 plasmid pH11, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

367. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP029943 (Salmonella enterica subsp. enterica serovar Typhi strain 311189_212186 plasmid pHCM1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

368. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP029953 (Salmonella enterica subsp. enterica serovar Typhi strain 311189_204186 plasmid pHCM1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

369. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP029955 (Salmonella enterica subsp. enterica serovar Typhi strain 311189_202186 plasmid pHCM1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

370. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP021463 (Salmonella enterica subsp. enterica serovar Typhimurium strain UGA14 plasmid pUGA14_1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

371. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NC_012556 (Enterobacter cloacae plasmid pEC-IMPQ, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

372. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NC_012555 (Enterobacter cloacae plasmid pEC-IMP, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

373. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP042579 (Enterobacter kobei strain C16 plasmid pC16_001, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

374. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP029924 (Salmonella enterica subsp. enterica serovar Typhi strain 311189_221186 plasmid pHCM1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

375. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP029934 (Salmonella enterica subsp. enterica serovar Typhi strain 311189_214186 plasmid pHCM1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

376. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP050780 (Salmonella enterica subsp. enterica serovar Indiana strain SI85 plasmid pSI85-1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

377. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP048776 (Salmonella enterica subsp. enterica serovar Agona strain SG17-135 plasmid pSG17-135-HI2, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

378. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP033351 (Salmonella enterica subsp. enterica strain CFSA629 plasmid pCFSA629, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

379. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NC_019114 (Salmonella enterica subsp. enterica serovar Heidelberg plasmid pSH111_227, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

380. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP023143 (Escherichia coli strain CFSAN061770 plasmid pEGY1-MCR-1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

381. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_AP023198 (Escherichia coli strain TUM18780 plasmid pMTY18780-1_lncHI2, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

382. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP043223 (Salmonella enterica subsp. enterica serovar Bredeney strain SA20114778WT plasmid pET1.1-IncH, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

383. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP050751 (Salmonella enterica subsp. enterica serovar Typhimurium strain ST46 plasmid pST46-1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

384. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP050729 (Salmonella enterica subsp. enterica serovar Typhimurium strain ST106 plasmid pST106-1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

385. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP050772 (Salmonella enterica subsp. enterica serovar Indiana strain SI102 plasmid pSI102-1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

386. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP050761 (Salmonella enterica subsp. enterica serovar Indiana strain SI170 plasmid pSI170-1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

387. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP051135 (Enterobacter hormaechei strain AMS-38 plasmid pAMS-38c, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

388. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NC_013365 (Escherichia coli O111:H- str. 11128 plasmid pO111_1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

389. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP032842 (Enterobacter hormaechei strain C15117 plasmid pSPRC-Echo1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

390. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP041449 (Escherichia coli strain YPE10 plasmid pYPE10-190k-tetX4, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

391. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP029939 (Salmonella enterica subsp. enterica serovar Typhi strain 311189_206186 plasmid pHCM1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

392. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP025340 (Salmonella enterica subsp. enterica serovar Typhimurium strain BL10 plasmid p220k, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

393. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP038454 (Escherichia coli strain EC-129 plasmid pEC129_1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

394. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NC_019360 (Citrobacter freundii plasmid pNDM-CIT, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaattgc	Protospacer
  ***** ********* *******    .

395. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP041997 (Escherichia coli strain AR Bank #0349 plasmid pAR349, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

396. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP029957 (Salmonella enterica subsp. enterica serovar Typhi strain 311189_201186 plasmid pHCM1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

397. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP029941 (Salmonella enterica subsp. enterica serovar Typhi strain 311189_203186 plasmid pHCM1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

398. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP029910 (Salmonella enterica subsp. enterica serovar Typhi strain 311189_219186 plasmid pHCM1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

399. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to KY320277 (Leclercia adecarboxylata strain Lec-476 plasmid pLec-476, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaattgc	Protospacer
  ***** ********* *******    .

400. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP042525 (Citrobacter freundii strain E11 plasmid pE11_001, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

401. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP050754 (Salmonella enterica subsp. enterica serovar Typhimurium strain ST45 plasmid pST45-1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

402. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP050784 (Salmonella enterica subsp. enterica serovar Indiana strain SI67 plasmid pSI67-1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

403. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_LT991955 (Enterobacter hormaechei subsp. steigerwaltii isolate C309 plasmid pC309-VIM4) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

404. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP029887 (Salmonella enterica subsp. enterica serovar Typhi strain 311189_220186 plasmid pHCM1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

405. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP029948 (Salmonella enterica subsp. enterica serovar Typhi strain 311189_208186 plasmid pHCM1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

406. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP029937 (Salmonella enterica subsp. enterica serovar Typhi strain 311189_207186 plasmid pHCM1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

407. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP029879 (Salmonella enterica subsp. enterica serovar Typhi strain 311189_223186 plasmid pHCM1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

408. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP050763 (Salmonella enterica subsp. enterica serovar Indiana strain SI115 plasmid pSI115-1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

409. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to MH884652 (Salmonella sp. strain Sa27 plasmid pSa27-CIP, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

410. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to MH884653 (Salmonella sp. strain Sa27 plasmid pSa27-TC-CIP, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

411. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP022533 (Enterobacter hormaechei strain MS7884A plasmid pMS7884A, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

412. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP038659 (Citrobacter freundii strain 680 plasmid p680_1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

413. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to MH114596 (Salmonella enterica strain 13-1681 plasmid p131681, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

414. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP026936 (Escherichia coli strain CFS3292 plasmid pCFS3292-1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

415. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP029717 (UNVERIFIED_ORG: Enterobacter cloacae strain AR_0154 plasmid unnamed4, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

416. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP024910 (Enterobacter hormaechei subsp. xiangfangensis strain OSUKPC4_L plasmid pOSUKPC4, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

417. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP018656 (Salmonella enterica subsp. enterica serovar Enteritidis strain 81-1706 plasmid pSE81-1706, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

418. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to MK962305 (Escherichia coli strain YZUC2624 plasmid pYZUC2624.1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

419. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to MK962305 (Escherichia coli strain YZUC2624 plasmid pYZUC2624.1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

420. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP029931 (Salmonella enterica subsp. enterica serovar Typhi strain 311189_215186 plasmid pHCM1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

421. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP029935 (Salmonella enterica subsp. enterica serovar Typhi strain 311189_213186 plasmid pHCM1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

422. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to MN937241 (Enterobacter cloacae strain BSI034 plasmid pBSI034-MCR9, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

423. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP042489 (Enterobacter hormaechei strain C15 plasmid pC15_001, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

424. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_LT985297 (Escherichia coli strain B4-25 plasmid RCS77_p, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

425. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_LT985296 (Escherichia coli strain 1454 plasmid RCS78_p, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

426. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP026933 (Escherichia coli strain CFS3273 plasmid pCFS3273-1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

427. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MK461931 (Escherichia coli strain F2_14D plasmid pF2_14D_HI2, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

428. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MN101858 (Escherichia coli strain 2019XSD11-TC2 plasmid p2019XSD11-TC2-284, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

429. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MK355502 (Klebsiella pneumoniae strain CRE plasmid pAN65-1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

430. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MN101856 (Escherichia coli strain 2019XSD11 plasmid p2019XSD11-190, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

431. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MK477612 (Salmonella enterica strain SH16G0600 plasmid pSH16G0600, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

432. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MN540571 (Escherichia coli strain E.coli4feg plasmid pIV_IncHI2_CTX_M_15, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

433. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP033103 (Enterobacter hormaechei strain L51 plasmid pEHZJ1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

434. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MH829594 (Enterobacter cloacae strain EC62 plasmid pIMP-4-EC62, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

435. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MH522426 (Salmonella enterica subsp. enterica serovar Typhimurium strain SH16G4928 plasmid pSH16G4928, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

436. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MH924589 (Escherichia coli strain RDB9 plasmid pRDB9, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

437. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MH287085 (Escherichia coli strain F2_12B plasmid pSDC-F2_12BHI2, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

438. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MH287084 (Escherichia coli O157 strain SvETEC plasmid pSDE-SvHI2, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

439. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MH733010 (Klebsiella pneumoniae strain KP14812 plasmid pKP14812-MCR-1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

440. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MK169211 (Escherichia coli strain DUK14-2 plasmid pMOO-32, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

441. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MK413720 (Enterobacter cloacae strain 12949 plasmid p12949-HI2, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

442. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MK736669 (Enterobacter cloacae strain EclC2185 plasmid pEclC2185CTXM15, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

443. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MG904992 (Escherichia coli strain 14OD0056 plasmid p14ODMR, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

444. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_LC511997 (Enterobacter hormaechei subsp. xiangfangensis strain MY460 plasmid pMY460-rmtE, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

445. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MF344580 (Enterobacter cloacae strain 30860 plasmid p30860-HI2, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

446. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MF344581 (Enterobacter cloacae strain 13E573 plasmid p13E573-HI2, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

447. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MF344583 (Enterobacter cloacae strain N1863 plasmid pN1863-HI2, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

448. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MG591702 (Escherichia coli strain EC36 plasmid pMCR-EC36, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

449. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MG662415 (Escherichia coli strain EC1107 plasmid EC1107-IncHI2-226K, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

450. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MH522419 (Salmonella enterica subsp. enterica serovar Typhimurium strain SH16G1369 plasmid pSH16G1369, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

451. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MH329870 (Escherichia coli strain 92944 plasmid p92944-MCR, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

452. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MH522425 (Salmonella enterica subsp. enterica serovar Typhimurium strain SH16G4909 plasmid pSH16G4909, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

453. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MH399264 (Enterobacter cloacae strain RJ702 plasmid pIMP26, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

454. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MG948335 (Escherichia coli strain 3498 plasmid p3498, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

455. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MH077952 (Escherichia coli strain EC17S-208 plasmid p17S-208, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

456. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MH522424 (Salmonella enterica subsp. enterica serovar Typhimurium strain SH16G4525 plasmid pSH16G4525, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

457. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NC_023277 (Escherichia coli strain 63743 plasmid pEQ2, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

458. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NC_023289 (Escherichia coli strain T23 plasmid pEQ1, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

459. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MF072964 (Citrobacter freundii strain P10159 plasmid pP10159-4, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaattgc	Protospacer
  ***** ********* *******    .

460. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_KY863418 (Enterobacter asburiae strain AMA 497 plasmid pOXA436, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

461. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_KY978628 (Cronobacter sakazakii strain 505108 plasmid p505108-MDR, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

462. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MG288680 (Klebsiella pneumoniae strain D610 plasmid pD610-HI2, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

463. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MF344582 (Citrobacter freundii strain 525011 plasmid p525011-HI2, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

464. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_MF788071 (Raoultella ornithinolytica strain 23141 plasmid p23141-3, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

465. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to MG874042 (Salmonella sp. strain Sa4 plasmid pSa4-CIP, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
atttaatgcaagcataaagttttgaacagc	Protospacer
  ***** ********* *******  . .

466. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP031724 (Enterobacter hormaechei strain WCHEH020038 plasmid pCTXM9_020038, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

467. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP011062 (Escherichia coli str. Sanji plasmid pSJ_255, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

468. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP027202 (Escherichia coli strain WCHEC025943 plasmid pMCR1_025943, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

469. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP053191 (Enterobacter hormaechei strain EGYMCRVIM plasmid pMS-37a, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

470. spacer 1.13|1976320|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP016838 (Salmonella enterica subsp. enterica serovar Senftenberg strain 775W (ATCC 43845) plasmid pSSE-ATCC-43845, complete sequence) position: , mismatch: 9, identity: 0.7

tattaattcaagcataatgttttgatggtt	CRISPR spacer
gtttaatgcaagcataaagttttgaaccgc	Protospacer
  ***** ********* *******    .

471. spacer 1.14|1976400|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP016293 (Rhizobium leguminosarum strain Vaf10 plasmid unnamed5, complete sequence) position: , mismatch: 9, identity: 0.7

aagtagatcttgattttatagctggctata	CRISPR spacer
tcgtagatcttgattttttcgctgggctcc	Protospacer
  *************** * ***** . .

472. spacer 1.15|1976480|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NZ_CP028919 (Gemmobacter sp. HYN0069 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.7

gcactgaatatggatatccagacgatcgtc	CRISPR spacer
atcatcgcgatggatatccagatgatcgtc	Protospacer
..  * .  *************.*******

473. spacer 1.20|1976880|30|NC_015144|CRISPRCasFinder,PILER-CR matches to KJ010548 (Bacillus phage Bp8p-T, complete genome) position: , mismatch: 9, identity: 0.7

gctcaatatatccaagagcaacacaatggt	CRISPR spacer
ctataatatatccaagagcaacacagatta	Protospacer
 . .*********************.

474. spacer 1.20|1976880|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NC_029121 (Bacillus phage Bp8p-C, complete genome) position: , mismatch: 9, identity: 0.7

gctcaatatatccaagagcaacacaatggt	CRISPR spacer
ctataatatatccaagagcaacacagatta	Protospacer
 . .*********************.

475. spacer 1.20|1976880|30|NC_015144|CRISPRCasFinder,PILER-CR matches to NC_024792 (Bacillus phage Bobb, complete genome) position: , mismatch: 9, identity: 0.7

gctcaatatatccaagagcaacacaatggt	CRISPR spacer
ctataatatatccaagagcaacacagacta	Protospacer
 . .*********************.

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1007595 : 1014160

Cafeteria_roenbergensis_virus(16.67%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013598060.1\|1007595_1008621_-	NAD-dependent epimerase	E3T4Y8	Cafeteria_roenbergensis_virus	2.2e-37	31.7
WP_013598061.1\|1008633_1009800_-	nucleotide sugar dehydrogenase	M1I798	Paramecium_bursaria_Chlorella_virus	4.7e-116	55.9
WP_013598062.1\|1009814_1011149_-	nucleotide sugar dehydrogenase	NA	NA	NA	NA
WP_013598063.1\|1011463_1012435_-	SDR family oxidoreductase	A0A2K9L0I7	Tupanvirus	2.5e-91	52.4
WP_013598064.1\|1012506_1012950_-	adenylyltransferase/cytidyltransferase family protein	A0A218MN49	uncultured_virus	3.0e-39	56.8
WP_013598065.1\|1012992_1013334_-	phosphomannose isomerase type II C-terminal cupin domain	A0A1V0SH58	Hokovirus	2.5e-25	53.3
WP_013598066.1\|1013674_1014160_-	inorganic diphosphatase	A0A2H4J8U1	uncultured_Caudovirales_phage	3.7e-27	40.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage