CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NC_015214	Lactobacillus amylovorus, complete sequence	1 crisprs	cas2,cas3,csa3,cas14j,DEDDh,DinG	0	8
NC_015213	Lactobacillus amylovorus plasmid pRKC30SC1, complete sequence	1 crisprs	NA	2	0
NC_015218	Lactobacillus amylovorus plasmid pRKC30SC2, complete sequence	0 crisprs	Cas9_archaeal	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_015214_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_015214_1

583384-583567

Orphan

Consensus_repeat	Method
CACGCGTGGGTTCAAATCCCACAT	PILER-CR

2 spacers

The CRISPR arrays of NC_015214_1

>merge|NC_015214|1|583384-583567|PILER-CR
CGCGCGTGGGTTCAAATCCCACATCCTCCTTTGATTGGTCCATTGGAGCAGTGGTTTATCTCGCCTCCCTGTCACGGAGGAGATCGTGGGTTCAAATCCCACATGGACCGTAATATGGCGGAATTGGTGAAGGGGTTAACACACTGGTTTGTGGATCCAGCATGCGTGGGTTCGAATCCCACAT

>NC_015214|1|1|583384-583567|PILER-CR
CGCGCGTGGGTTCAAATCCCACAT	CCTCCTTTGATTGGTCCATTGGAGCAGTGGTTTATCTCGCCTCCCTGTCACGGAGGAGAT
CGTGGGTTCAAATCCCACATGGAC	CGTAATATGGCGGAATTGGTGAAGGGGTTAACACACTGGTTTGTGGATCCAGCATG
CGTGGGTTCGAATCCCACAT

Protein	Signature genes	Signature genes Name	Protein_function
NC_015214.1\|WP_013437364.1\|578373_579084_-\|Bax-inhibitor-1/YccA-family-protein	unknown	unknown	gnl\|CDD\|198414
NC_015214.1\|WP_013437376.1\|592386_592917_-\|bifunctional-pyr-operon-transcriptional-regulator/uracil-phosphoribosyltransferase-PyrR	unknown	unknown	gnl\|CDD\|235365
NC_015214.1\|WP_013641611.1\|589101_589977_-\|transcriptional-regulator	unknown	unknown	unknown
NC_015214.1\|WP_013641607.1\|573999_575439_+\|Asp-tRNA(Asn)/Glu-tRNA(Gln)-amidotransferase-subunit-GatA	unknown	unknown	gnl\|CDD\|234572
NC_015214.1\|WP_013641609.1\|585867_587640_+\|oleate-hydratase	unknown	unknown	gnl\|CDD\|237575
NC_015214.1\|WP_013437375.1\|591047_592376_-\|uracil-transporter	unknown	unknown	gnl\|CDD\|236744
NC_015214.1\|WP_013437380.1\|595533_596733_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340949
NC_015214.1\|WP_013437359.1\|573691_574000_+\|Asp-tRNA(Asn)/Glu-tRNA(Gln)-amidotransferase-subunit-GatC	unknown	unknown	gnl\|CDD\|178810
NC_015214.1\|WP_013437366.1\|579623_581000_-\|Na+/H+-antiporter-NhaC	unknown	unknown	gnl\|CDD\|188097
NC_015214.1\|WP_013437361.1\|575443_576874_+\|Asp-tRNA(Asn)/Glu-tRNA(Gln)-amidotransferase-subunit-GatB	unknown	unknown	gnl\|CDD\|235489
NC_015214.1\|WP_013437368.1\|582724_583225_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NC_015214.1\|WP_013437365.1\|579224_579572_+\|hypothetical-protein	unknown	unknown	unknown
NC_015214.1\|WP_013437362.1\|576899_577820_+\|diacylglycerol-kinase-family-lipid-kinase	unknown	unknown	gnl\|CDD\|237282
NC_015214.1\|WP_013641613.1\|594032_595502_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|129794
NC_015214.1\|WP_013437367.1\|581368_582715_+\|23S-rRNA-(uracil(1939)-C(5))-methyltransferase-RlmD	unknown	unknown	gnl\|CDD\|225174
NC_015214.1\|WP_013641612.1\|590144_590981_+\|aldo/keto-reductase	unknown	unknown	gnl\|CDD\|381359
NC_015214.1\|WP_013641608.1\|583724_585191_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|129794
NC_015214.1\|WP_013641614.1\|596824_597907_+\|M42-family-peptidase	unknown	unknown	gnl\|CDD\|349906
NC_015214.1\|WP_013437363.1\|578074_578323_+\|hypothetical-protein	unknown	unknown	unknown
NC_015214.1\|WP_081456847.1\|587829_588306_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|379228

Protein	Function_ID	Function_description	E-value
NC_015214.1\|WP_013437364.1\|578373_579084_-\|Bax-inhibitor-1/YccA-family-protein	gnl\|CDD\|198414	cd10432, BI-1-like_bacterial, Bacterial BAX inhibitor (BI)-1/YccA-like proteins. This family is comprised of bacterial relatives of the mammalian members of the BAX inhibitor (BI)-1 like family of small transmembrane proteins, which have been shown to have an antiapoptotic effect either by stimulating the antiapoptotic function of Bcl-2, a well-characterized oncogene, or by inhibiting the proapoptotic effect of Bax, another member of the Bcl-2 family. In plants, BI-1 like proteins play a role in pathogen resistance. A characterized prokaryotic member, Escherichia coli YccA, has been shown to interact with ATP-dependent protease FtsH, which degrades abnormal membrane proteins as part of a quality control mechanism to keep the integrity of biological membranes.	1.06509e-50
NC_015214.1\|WP_013437376.1\|592386_592917_-\|bifunctional-pyr-operon-transcriptional-regulator/uracil-phosphoribosyltransferase-PyrR	gnl\|CDD\|235365	PRK05205, PRK05205, bifunctional pyr operon transcriptional regulator/uracil phosphoribosyltransferase PyrR.	2.19606e-98
NC_015214.1\|WP_013641607.1\|573999_575439_+\|Asp-tRNA(Asn)/Glu-tRNA(Gln)-amidotransferase-subunit-GatA	gnl\|CDD\|234572	PRK00012, gatA, Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA.	0
NC_015214.1\|WP_013437375.1\|591047_592376_-\|uracil-transporter	gnl\|CDD\|236744	PRK10720, PRK10720, uracil transporter; Provisional.	3.7936e-144
NC_015214.1\|WP_013437380.1\|595533_596733_-\|MFS-transporter	gnl\|CDD\|340949	cd17391, MFS_MdtG_MDR_like, Multidrug resistance protein MdtG and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This subfamily is composed of Escherichia coli multidrug resistance protein MdtG, Streptococcus pneumoniae multidrug resistance efflux pump PmrA, and similar multidrug resistance (MDR) transporters from bacteria. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. MdtG confers resistance to fosfomycin and deoxycholate. PmrA serves as an efflux pump for various substrates and is associated with fluoroquinolone resistance. MdtG-like MDR transporters belong to the bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.78598e-147
NC_015214.1\|WP_013437359.1\|573691_574000_+\|Asp-tRNA(Asn)/Glu-tRNA(Gln)-amidotransferase-subunit-GatC	gnl\|CDD\|178810	PRK00034, gatC, Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC.	2.74239e-29
NC_015214.1\|WP_013437366.1\|579623_581000_-\|Na+/H+-antiporter-NhaC	gnl\|CDD\|188097	TIGR00931, Uncharacterized_Na+/H+_antiporter_HI_1107, Na+/H+ antiporter NhaC. A single member of the NhaC family, a protein from Bacillus firmus, has been functionally characterized.It is involved in pH homeostasis and sodium extrusion. Members of the NhaC family are found in both Gram-negative bacteria and Gram-positive bacteria. Intriguingly, archaeal homolog ArcD (just outside boundaries of family) has been identified as an arginine/ornithine antiporter. [Transport and binding proteins, Cations and iron carrying compounds].	5.58549e-110
NC_015214.1\|WP_013437361.1\|575443_576874_+\|Asp-tRNA(Asn)/Glu-tRNA(Gln)-amidotransferase-subunit-GatB	gnl\|CDD\|235489	PRK05477, gatB, Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB.	0
NC_015214.1\|WP_013437368.1\|582724_583225_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	1.95213e-13
NC_015214.1\|WP_013437362.1\|576899_577820_+\|diacylglycerol-kinase-family-lipid-kinase	gnl\|CDD\|237282	PRK13055, PRK13055, putative lipid kinase; Reviewed.	0
NC_015214.1\|WP_013641613.1\|594032_595502_+\|MFS-transporter	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	2.10864e-46
NC_015214.1\|WP_013641609.1\|585867_587640_+\|oleate-hydratase	gnl\|CDD\|237575	PRK13977, PRK13977, myosin-cross-reactive antigen; Provisional.	0
NC_015214.1\|WP_013641612.1\|590144_590981_+\|aldo/keto-reductase	gnl\|CDD\|381359	cd19133, AKR_AKR5F1, the AKR5F family of aldo-keto reductase (AKR). Klebsiella sp. 2,5-diketo-D-gluconic acid reductase (2,5-DKG reductase) is a founding member of aldo-keto reductase family 5 member F1 (AKR5F1). It catalyzes the reduction of 2,5-diketo-D-gluconic acid (25DKG) to 2-keto-L-gulonic acid (2KLG).	2.37518e-157
NC_015214.1\|WP_013641608.1\|583724_585191_+\|MFS-transporter	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	1.23907e-42
NC_015214.1\|WP_013641614.1\|596824_597907_+\|M42-family-peptidase	gnl\|CDD\|349906	cd05656, M42_Frv, M42 Peptidase, endoglucanases. Peptidase M42 family, Frv (Frv Operon Protein; Endo-1 4-Beta-Glucanase; Cellulase Protein; Endoglucanase; Endo-1 4-Beta-Glucanase Homolog; Glucanase; EC. 3.2.1.4) subfamily. Frv is a co-catalytic metallopeptidase, found in archaea and bacteria, including Pyrococcus horikoshii tetrahedral shaped phTET1 (DAPPh1; FrvX; PhDAP aminopeptidase; PhTET aminopeptidase; deblocking aminopeptidase), phTET2 (DAPPh2) and phTET3 (DAPPh3), Haloarcula marismortui TET (HmTET) as well as Bacillus subtilis YsdC. All of these exhibit aminopeptidase and deblocking activities. The HmTET is a broad substrate aminopeptidase capable of degrading large peptides. PhTET2, which shares 24% identity with HmTET, is a cobalt-activated peptidase and possibly a deblocking aminopeptidase, assembled as a 12-subunit tetrahedral dodecamer, while PhTET1 can be alternatively assembled as a tetrahedral dodecamer or as an octahedral tetracosameric structure. The active site in such a self-compartmentalized complex is located on the inside such that substrate sizes are limited, indicating function as possible peptide scavengers. PhTET2 cleaves polypeptides by a nonprocessive mechanism, preferring N-terminal hydrophobic or uncharged polar amino acids. Streptococcus pneumoniae PepA (SpPepA) also forms dodecamer with tetrahedral architecture, and exhibits selective substrate specificity to acidic amino acids with the preference to glutamic acid, with the substrate binding S1 pocket containing an Arg allows electrostatic interactions with the N-terminal acidic residue in the substrate. The YsdC gene is conserved in a number of thermophiles, archaea and pathogenic bacterial species; the closest structural homolog is Thermotoga maritima FrwX (34% identity), which is annotated as either a cellulase or an endoglucanase, and is possibly involved in polysaccharide biosynthesis or degradation.	3.4669e-101
NC_015214.1\|WP_013437367.1\|581368_582715_+\|23S-rRNA-(uracil(1939)-C(5))-methyltransferase-RlmD	gnl\|CDD\|225174	COG2265, TrmA, SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis].	1.04296e-158
NC_015214.1\|WP_081456847.1\|587829_588306_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|379228	pfam13508, Acetyltransf_7, Acetyltransferase (GNAT) domain. This domain catalyzes N-acetyltransferase reactions.	6.69814e-08

>NC_015214.1|WP_013437368.1|582724_583225_+|GNAT-family-N-acetyltransferase
MIIKPLISEDEARQTSKLFQKCWQDVYKGILPAEFLDNIPENAWVKRFNESGRHNLIFEDDKNIVRAAVSYGRPRDTRMLGCGELMALYVEPDFQGYNVGKTLLNAAENELKKMGYGKIYLWCLDGNEKAQGFYEHFGWRNIATERFVEIVGKEYKYLLYQKNLRD
>NC_015214.1|WP_013437367.1|581368_582715_+|23S-rRNA-(uracil(1939)-C(5))-methyltransferase-RlmD
MKKNQIVDLEITDLSYEAMGVAHYEGLTVFVTNALPGEIVSAKILKVKKNFAFAKIEKIKKESPDRVKIKLNQWVQTGLASLAHIKYDKQLEFKRNQVVNLLKKAHLDDIEVGQTLPSPEQTGYRNKAQVPVREINGQLEIGFFRRHSHDLVPLTNFFTTDPEIDRVLVAVRDILRKYRVPAYDEINHKGEVRYLDVRRSKATGEIMVILVCLHNDFPRLLGVAAEVSQIPGVTGLILNHNPKKTNVILGKKDYLVLGNDQITDQIGDLKFRISPQSFFQINSLQTPRLYDLAIKKADLKPSDVVIDAYSGIGTIGLSVAKHVKAVRGIEVVRDAIKDAKDNAKLNDIDNAKYYLGKAEEIMPRWAKQGLKTDVVFVDPPRKGLTPEFIDATAKTGPEKVVYISCNPATMVRDLQLFQEQGYEFDRIDPVDMFPQTPHVEAVTVLTKK
>NC_015214.1|WP_013437366.1|579623_581000_-|Na+/H+-antiporter-NhaC
MEKKKVSFAESIIILIVLLAILGVSVIKFGLSPEVPVLFTVLLLTFWARLRGFSWQDVQNGIKEGIGVAIIPIFIFMLIGALIGVWIKAGIIPSIMVLGFNMISGSFFVPSVFIVCSIVGVAIGSGFTTISTVGIALFGIGSSMGANPALVAGAIISGAVFGDKMSPLSDSTNLSSAVAESELFSHIKNMMWSTIPSFVVSLILFWILGNSGHMDPTKIERTSQVLQNNFTISWWALLPIVLMLICAWRKIPAIPTLFMNIAITVVMIFIQSPHESAQSLNNLIMNGFVAKTSDASVNALLTRGGISSMMATVALIISTLSLGGMLMKFNIVQSAMEPLVKHLNKPGRLITVTILSGICINLFVGEQYLSVILPGRAFKPAFDKIGLSPLALSRVLEDGGSVINYLIPWGVAGSFAASALGVPVLQFLPFVFFSLLSPVFSIFSGVTGIGLKWAKKNK
>NC_015214.1|WP_013437365.1|579224_579572_+|hypothetical-protein
MDKKYTDSEVRGERSDHPDKSYAADEVRKLFFTENAKKKYDILTGSQKTFIDRELDDLRLSRSSSVSRKDNSELQQKIVFEEQNNQVIVTDILYDDYRNSKEYKKAQVRMYDMNN
>NC_015214.1|WP_013437364.1|578373_579084_-|Bax-inhibitor-1/YccA-family-protein
MDNMNFSSPERRQVHDVSEVNGFLSKMYSYMGLAVLVSAITAFLTMTVFRAAVMQMPTALMWIILIVPLGLSMGISFRATRNPVAGFVMLMILAVIYGFEFALLAGFYTGAQISTAFLSSAAVFGAMAIFGTFTKRDLNNLGSYMGAALIGLLVAMIVNIFLRNSVASFVFSIIGVIIFTGLTAYDAQKMKSIYNNYGSQVPTNGLAVLGALQLYLDFINIFLFLLQIFGMGNDRN
>NC_015214.1|WP_013437363.1|578074_578323_+|hypothetical-protein
MQRVGTMAGNPQLKLTEKERTLMTINVQVFVHSMIGLVEVLLNYGDILLPYDMRQSIMAFLHQSPVELMSSMVPNKEEKTEQ
>NC_015214.1|WP_013437362.1|576899_577820_+|diacylglycerol-kinase-family-lipid-kinase
MTSKARLIYNPVSGHEQMPKNVADILDVLEQAGYEASAFRTTPEQNSARNEATRAAKEGFDLIVAAGGDGTINEVVNGIAFLDKRPKMAIIPAGTTNDYARALAIPRDNIPDAAKVILKNKTRKMDIGKAVFGDQTQYFVNIAASGSLTELTYGVPSEVKSALGYAAYLIKGAEMLPHLTENEMRLTYDDGVYEGKLSMFLLGMTNSIGGFEQVMPDAQLSDGLFQLIVVKPSDPVSMMKLMALALNGKHVDDPNIIYTKTRSLKAELIGKNSGRDLPVNLDGEIGGYCPVEFHNLQQRIEFYVGK
>NC_015214.1|WP_013437361.1|575443_576874_+|Asp-tRNA(Asn)/Glu-tRNA(Gln)-amidotransferase-subunit-GatB
MNFKSTIGLEVHFELKTKSKIFSPSPVTYGAEQNTETNVIDWAMPGTLPMVNKNVYRLGIMVAIATHAHILPTTHFDRKNYFYPDNPKAYQITQFFQPLARDGYIEVEVRGKKKRIGIHEMHIEEDAGKNTHGTNGFSYVDLNRQGVPLLEVVSEPDMEDPEEAYAYLEKLRKIVQFTGASDVKMEEGSMRVDTNISIRPAGQKELGTKVEMKNLNSFDHVRRSLAYEEKRQEQVLLAGGHIQLSTRRFDEATGKTVLERVKEGDSDYRYFPEPDIAPDHISQEWIDQIAKELPKSPFDRYDDYVNKYGLKPYDANVLLQTKESSDFFDAAVAAGADPTLAANWMNTQVNGYLNDHRVGLNDIKLTPEHLAEMIQLIKDGTISSKIAKKVFAETIANGTDPKKYVEDNGMVQLSDTSVLAPMVKKVVDDNPQSVEDFKNGKDRAIGYLVGQIMKQTRGKANPKMVNKLLNQELQSR
>NC_015214.1|WP_013641607.1|573999_575439_+|Asp-tRNA(Asn)/Glu-tRNA(Gln)-amidotransferase-subunit-GatA
MNYLNEDIDSLNKKLASGDLSADKLAKDTVANIKDTDKKLNAWITVLDDAKPAENLDYSKSKLAGIPIAIKDNIITNGIKTTAASHILYNYMPMYDATVISKLKKAGVTLVGKTNMDEFAMGSSTEHSYYGATHNPWNLDKVPGGSSGGSAAAVAGGQVVAALGSDTGGSIRQPAAFNGIFGIKPTYGRVSRWGLIAFGSSLDQIGVMTKRVKDSAEVLNVIAGADEHDSTVSTREVPDFTKFIGQDVKGLRVAVPKEYMEAVSGEMREVIQKQIDTLKDAGAIINEVSLPHTKYVVPDYYIIASSEASSNLQRYDGIRYGYRAKDTKNLLDVYVKSRSEGFGTEVKRRIMLGSFALSAGSYDRFFRQAAKVRTLICNDFDKIFAENDVIVGPTTTEPAFGIGEEVSDPIKMYNNDILTISANLAGIPAASVPAGLVDGMPVGLQIMAKRFDEGNVFKTADFIERSNKFYEKTPTGMED
>NC_015214.1|WP_013437359.1|573691_574000_+|Asp-tRNA(Asn)/Glu-tRNA(Gln)-amidotransferase-subunit-GatC
MEITKDTIKHVATLSRLAFNEEELDKFTDQMGSIINMADQLSEVDTEGVDETVQVVDRDTVFREDKPEHWQGQTRETLMANVPEKANGYIKVPVIINKDEDE
>NC_015214.1|WP_013641608.1|583724_585191_+|MFS-transporter
MNKKQVTMVTIALMLGNVMSGLDGTIINTAIPAIVASLHGIQFMGWIVAIFLLGMSISIPIWTKVGEKITNKRAFEISLALFVIGSALQGMAPNIIFFLCSRFIMGVGAGGMGSLPYIIAGYVFKNIKTRTKVLGYLTASWNGAAILGPLIGGWLIDAFSWHWVFYINIPIGLIAFLICLIYYKPVTPKQTPVFDIPGASLLVIGLLPFLMGVQLVGLTASWIVISLIIVSLVFIVLFFIRENHAQNPIIPVSLFNNKDLDGDFLLFAFTWGAFIAVNTYLPMWAQALLGLSALLGGMTLIPNSIVEIIASQSVVAIQDHLTTFKLVFIGIFAMLISSAGMFFADLHMPIQLLAAIGAFSGIGVGFIFVALQLKVQIDAGLKNMATATSTSYLIRILAQTVMAAVYGVIMNLNLASGVSSHPGITITMMNKLSDAKSAKLLPQNLVPTMRNILHSGIKEIMLVSVILLVIALVLNFYFNFGKKQKKLQ
>NC_015214.1|WP_013641609.1|585867_587640_+|oleate-hydratase
MHYSNGNYEAFVNASKPKDVDQKSAYIVGSGLAALASAVFLIRDGHMKGERIHIFEELGLPGGSMDGIYNKQKESYIIRGGREMEPHFECLWDLFRSIPSPENKDESVLDEFYRLNRRDPSYAKTRVIVNRGEALPTDGQLLLTPKAVKEIVDLCLTPEKDLQNKKINEVFTKEFFQSNFWLYWSTMFAFEPWASAMEMRRYLMRFVQHVATLKNLSSLRFTKYNQYESLILPMVKYLKDHGVQFHYDTVVDNVFVNRSNGEKVAKQIILTEKGEKKTIDLTENDLVFVTNGSITESTTYGDNLHPAPEEHELGASWQLWKNLAAQDEDFGHPDVFCKDIPKANWRMSATITFKNNDIVPFIEAVNKKDPHSGSIVTSGPTTIKDSNWLLGYSISRQPHFKAQKPNELIVWLYGLFSDTKGNYVEKTMPDCNGIELCEEWLYHMGVPEERIPEMAAAATTIPAHMPYITSYFMPRALGDRPKVVPDHSKNLAFIGNFAETPRDTVFTTEYSVRTAMEAVYTLLDIDRGVPEVFASAFDVRMLMNAMYYLNDQKKLKDLDLPMPEKLAIKGMLKKVKGTYVEELLKKYKLI
>NC_015214.1|WP_081456847.1|587829_588306_+|GNAT-family-N-acetyltransferase
MYMKAFPEWERFSMFSLLAMSLHRNVKFHAIYDDGKFCGITYYAENDNTVYLTYLAVSEKLRGQGYGSKILTMLEDNFPDKQIVIDIEPVTKKVKNYKQRVSRLKFYERNGFHRTDQKLKDPDGEFEALTTGERLDKNSFIKILRQMSFGFYQARVEK
>NC_015214.1|WP_013641611.1|589101_589977_-|transcriptional-regulator
MKQIIDPTYGRQFRKMCKSKHINLINACGNITSKSSLARWENGADNLSWNQVINLLTYNHIQLAEFIRKSASKNLDELLNPIAVAYNANQVPILKEYATDALNKYNEHPSKKNLFQAAIACNYYQDLSATDLASDTLKEKLTEHFHQIIEDKNIWQYEDIFYFGNTVLLFSPKNLYQIAFNLINFIQVHNISAKEWYGFALNMVLNADFALIKIDSVRASRLLTNFDELDIKDIYSLTNIRKKFMRCLLEYIQDHSNTSVAKLISYLDFFNMTDLKHDFQVAFDQIKQIYG
>NC_015214.1|WP_013641612.1|590144_590981_+|aldo/keto-reductase
MEKFVTLNNGVKMPRLGFGVYQIDDLAQTQQVVEDGLEIGYRLVDTAQIYGNEQAVGDAIKRSNVPREDIFVTSKIWVNDYGYDNTLKAFDDSMKKLQLGYIDLYLIHKPYNDYYGTWRALERLYKEGRIRAIGVSSFWNERLADLITFNDVKPAVNQIETNVWNQEWKSQKYMEKEGVQPEAWAPFAEGANHIFTNPVLEEIAAKHHKTTAQVMLRWFLQRNYVVIPKSVHKKRLAENFDVFDFELDAEDMKKIKTLDQGHSILEDKMNPEIVESFR
>NC_015214.1|WP_013437375.1|591047_592376_-|uracil-transporter
MSEKEKFRNPDAILDVYEKPELGQGILLSLQHMFAMFGSTVLVPILIGINPSIALLSSGVGTLVHMILTHFKIPAYLGSSFAFVATMQALMKTDGYPAVAQGAIASGLVYVIVALIIAKVGSGWVNKVLPPIVVGPIIIVIGLSLATTAANDAMMNHQKYDLTYFGVAIFTLVMTLIFQMCFKGFTSLVSIMLGIICGYVLSCFLGIVDFSGVEKAAWFSVPALDVMGISYHFKWYPAAILAMAPIAFVTMTEHMGHIMVLNSLTKRNFFKNPGLHRTMMGDGISTIIAGFIGGPPTTSYGENIGVLAMTKVHSVWVLAGAAVCAIIFSFVGKLAALIESIPMPVIGGISFLLFGTIASNGLKILVDDQIDFGEKRNMLIASVILVIGIGGAYLQLGNFQLTSVALSTIIGMLLNWLLPKKAASEKALEEKNKQKQDGKIYQ
>NC_015214.1|WP_013437376.1|592386_592917_-|bifunctional-pyr-operon-transcriptional-regulator/uracil-phosphoribosyltransferase-PyrR
MAKEIVDAISMKRALMRMTYEIIERNKGTENLVLIGIKTRGLYLAQRIAKNLKNLEDVDVPVGAIDVSQYRDDLPESEKEKMIHGQQLDFDVTDKNVVVVDDVLFTGRTIRAALDAIMDQGRPAKINLAVLIDRGHRELPIRPDFIGKNIPTAMDEEVKVSMTEVDDKDGIDIMNK
>NC_015214.1|WP_013641613.1|594032_595502_+|MFS-transporter
MNKKQISMVTWSLLLANIMSGLDATIINTAIPAIVSDLHGIQYMGWIVACFLLGMSVSVPIWSKLGERMGNKFAFELSLVLFIVGSLLEGVAPNIYFFLIARILMGVGAGGMGSLPYVIVGYIYPNIKRRTVILSYIAASFSAACIAGPLVGGWIVDALSWHWVFYINVPLGLISIILSFIFYRDVHKAKEKVHFDKMGAFTLIAGLSCFLVGIQMLGLASGIMVAAFVIIGIALLVAFIFVEKKADSPIVPLSVFMNKALVGDFILFALAWGAYISVNTYLPMWSQAILGTSALIGGMTLIPNSILDIAGSQSAPYFLRHFSNYRLLIIDFTLIVITVLGLILVPMNTPYQILMIIAALSGLGVGSIFVILQIKVQIDASEKDMAPATSLSFLIRILAQTVMAAIYGVIMNLALARGIAGHRGITMTMMNKLSDAESAKSLPTALLPIMRRIFHSGIIEITYVALFLMICAYVVNFIYNRHEAKKVAE
>NC_015214.1|WP_013437380.1|595533_596733_-|MFS-transporter
MKEKPIWKKNLFVLSIAVFIAGIAFSEIMPFLSLYINTLGNFSHQQLNFWSGIVYSGTFIVSAVVSPWWGKLADKKGRKPMILRAGIGMSVVIACMGLVQNVWQLLLLRMLQGVFAGFISNSNALVATETPKTNSGQALGTIASATTAGTLLGPLVGGALTSIFSYRITFMITGGLLLLCSILVLFFVHEDDFKPVTAKKLDKASGVIKSLRSPHLIFGLLLTTLIIQAANNSINPIVSLYIRQLLNGHGNVVFISGVIAALPGIATFLVASRFGALGDKIGTHKIIVAGFIAASIFFFLTAFVRNTVELGILRFLVGFSDACLFPQVQTMLTKNSPAAVTGRIFSWNQSAMYIGNIVGPLLGSFVSGMFNYSMVFIVTTVIVLINLLLFRINVIRNLQ
>NC_015214.1|WP_013641614.1|596824_597907_+|M42-family-peptidase
MEKAQEIEMLKEFSDANATSGFEEEFVKLFTSYAEKTANIETDGMLNVYASKKENKGNRPVIQLDAHSDAVGFITQAVRPNGLIKFVPLGGWVKYNIPALKVKVRNRDGEYIPGVVATKPPHFMTAAERNNVPDVDDMSIDVGSSSREETIKDYKIDTGCPIFVDVKCEYHEKSGLFFGKDFDDRFGAGAMIDVLDNLKGEETNFDVVAALSSQEEVGLRGAYVTARKVKPDLCIVLESCPADDTFTPDWLSQTGLKRGPMLRDMDTTFLPNPKFQQYACDLADKINIPYTRSVRTGGGQDGAAIYYENGAPTIVIGIPVRYEHSPYCFSSYKDFKASVDLATAVIRDITQEKLDSFKKF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

247164 : 291359

Streptococcus_phage(15.38%)

protease,tRNA,integrase,transposase

attL 279015:279070|attR 286857:286912

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_080890046.1\|247164_248394_-\|transposase	IS110-like element ISLhe4 family transposase	A0A1X9I619	Streptococcus_phage	3.0e-65	38.1
WP_013437097.1\|248781_249306_+	methylated-DNA--[protein]-cysteine S-methyltransferase	A0A0G2Y1B6	Acanthamoeba_polyphaga_mimivirus	4.6e-23	42.3
WP_013437098.1\|249459_250341_-	hypothetical protein	NA	NA	NA	NA
WP_013437099.1\|250542_251058_-	hypothetical protein	NA	NA	NA	NA
WP_013437100.1\|251213_251534_-	hypothetical protein	NA	NA	NA	NA
WP_013641449.1\|251520_252045_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_013437102.1\|252306_252588_+	hypothetical protein	NA	NA	NA	NA
WP_013641450.1\|252644_253880_+	serine hydroxymethyltransferase	A0A240F3L3	Aeromonas_phage	1.2e-101	54.0
WP_013641451.1\|253971_255573_+	APC family permease	NA	NA	NA	NA
WP_013641452.1\|255605_256436_-	HAD family hydrolase	NA	NA	NA	NA
WP_013641453.1\|256554_258177_+	alpha-glucosidase	NA	NA	NA	NA
WP_013437106.1\|258287_258533_+	type B 50S ribosomal protein L31	NA	NA	NA	NA
WP_004897277.1\|258751_259975_-\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	3.4e-93	47.7
WP_013641455.1\|260315_261683_+	UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D- alanine ligase	NA	NA	NA	NA
WP_013437108.1\|261696_263190_+	DEAD/DEAH box helicase	A0A0N9Q9J4	Chrysochromulina_ericina_virus	1.1e-66	38.5
WP_013641456.1\|263269_263626_+	holo-ACP synthase	NA	NA	NA	NA
WP_013437110.1\|263628_264759_+	alanine racemase	A0A0P0YM39	Yellowstone_lake_mimivirus	9.4e-29	28.6
WP_013641457.1\|264832_265540_-	CBS domain-containing protein	NA	NA	NA	NA
WP_013437112.1\|265709_266681_-	L-lactate dehydrogenase	NA	NA	NA	NA
WP_013437113.1\|266814_267372_+\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA
WP_013641458.1\|267373_270868_+	transcription-repair coupling factor	NA	NA	NA	NA
WP_011254102.1\|270883_271126_+	RNA-binding S4 domain-containing protein	NA	NA	NA	NA
WP_013437115.1\|271200_271575_+	septum formation initiator family protein	NA	NA	NA	NA
WP_013437116.1\|271574_271937_+	S1 RNA-binding domain-containing protein	NA	NA	NA	NA
WP_041808263.1\|271977_273222_+\|tRNA	tRNA lysidine(34) synthetase TilS	A0A0N7G7K4	Chrysochromulina_ericina_virus	2.9e-15	26.2
WP_013641460.1\|273316_275485_+\|protease	ATP-dependent zinc metalloprotease FtsH	E5EQU5	Bathycoccus_sp._RCC1105_virus	3.9e-108	47.6
WP_013437119.1\|275538_276429_+	Hsp33 family molecular chaperone HslO	NA	NA	NA	NA
WP_013641461.1\|276508_277534_+\|tRNA	tRNA dihydrouridine synthase DusB	NA	NA	NA	NA
WP_013641462.1\|277550_279098_+\|tRNA	lysine--tRNA ligase	A0A2K9KZX5	Tupanvirus	2.0e-82	36.9
279015:279070	attL	NA	NA	NA	NA
WP_013641463.1\|279336_280497_+	adenine-specific methyltransferase EcoRI family protein	A0A1B0XVT8	Campylobacter_phage	3.5e-23	33.5
WP_013641464.1\|280498_281659_+	DUF262 domain-containing protein	NA	NA	NA	NA
WP_013641465.1\|282053_282431_+	hypothetical protein	NA	NA	NA	NA
WP_041808264.1\|282513_283497_+	chromosome partitioning protein ParA	NA	NA	NA	NA
WP_013641467.1\|283515_284025_+	hypothetical protein	NA	NA	NA	NA
WP_013641468.1\|284185_285211_+	hypothetical protein	S4TF11	uncultured_marine_virus	1.4e-07	29.5
WP_013641469.1\|285226_285427_+\|transposase	transposase	NA	NA	NA	NA
WP_013641470.1\|285492_286725_+\|integrase	site-specific integrase	H7BUX8	unidentified_phage	1.0e-84	40.9
WP_013641471.1\|287009_287465_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
286857:286912	attR	NA	NA	NA	NA
WP_013437122.1\|288307_288763_+	GAF domain-containing protein	NA	NA	NA	NA
WP_013641472.1\|288869_291359_+\|protease	ATP-dependent Clp protease ATP-binding subunit	H6X3M6	Enterobacteria_phage	7.4e-119	37.3

DBSCAN-SWA_2

1004226 : 1074643

unidentified_phage(18.18%)

protease,tRNA,integrase,transposase

attL 1006420:1006434|attR 1018333:1018347

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013437788.1\|1004226_1005543_+\|tRNA	methylenetetrahydrofolate--tRNA-(uracil(54)- C(5))-methyltransferase (FADH(2)-oxidizing) TrmFO	NA	NA	NA	NA
WP_013641828.1\|1005542_1006451_+	tyrosine recombinase XerC	A0A142K830	Mycobacterium_phage	4.4e-13	30.6
1006420:1006434	attL	NA	NA	NA	NA
WP_013437789.1\|1006460_1006985_+	HslU--HslV peptidase proteolytic subunit	NA	NA	NA	NA
WP_013437790.1\|1006996_1008394_+\|protease	ATP-dependent protease ATPase subunit HslU	A0A1B2IB03	Erwinia_phage	2.0e-28	25.0
WP_013641829.1\|1008533_1009430_+	aldose 1-epimerase family protein	NA	NA	NA	NA
WP_013641830.1\|1009526_1010795_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_013437793.1\|1010791_1011649_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_013437794.1\|1011691_1012501_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_013437795.1\|1012705_1013095_+	CrcB family protein	NA	NA	NA	NA
WP_013437796.1\|1013096_1013474_+	fluoride efflux transporter CrcB	NA	NA	NA	NA
WP_013641831.1\|1013515_1014916_-	dipeptidase PepV	NA	NA	NA	NA
WP_013641832.1\|1015094_1015583_+	pyridoxamine 5'-phosphate oxidase family protein	NA	NA	NA	NA
WP_081456854.1\|1015864_1015999_+	YSIRK-type signal peptide-containing protein	NA	NA	NA	NA
WP_013437802.1\|1016146_1016344_+	hypothetical protein	NA	NA	NA	NA
WP_158304738.1\|1016349_1016694_+	hypothetical protein	NA	NA	NA	NA
WP_013437804.1\|1016858_1018331_-	APC family permease	NA	NA	NA	NA
WP_013641833.1\|1018568_1020662_+	putative ornithine decarboxylase	NA	NA	NA	NA
1018333:1018347	attR	NA	NA	NA	NA
WP_013437806.1\|1020680_1021943_+	methionine gamma-lyase family protein	NA	NA	NA	NA
WP_013437807.1\|1022049_1022721_-	TrkA family potassium uptake protein	NA	NA	NA	NA
WP_013641834.1\|1022713_1024054_-	Trk family potassium uptake protein	NA	NA	NA	NA
WP_013641835.1\|1024165_1025932_+	DNA helicase RecQ	A0A1V0SBK0	Catovirus	7.4e-81	41.1
WP_013437810.1\|1026024_1026477_+	Trp operon repressor	NA	NA	NA	NA
WP_013641836.1\|1026620_1027616_+	homocysteine S-methyltransferase	NA	NA	NA	NA
WP_013641838.1\|1027835_1028468_-	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_148226137.1\|1028716_1029805_+	serine hydrolase	NA	NA	NA	NA
WP_013641840.1\|1029874_1030696_+	bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase	NA	NA	NA	NA
WP_013437815.1\|1030705_1031263_+	ECF transporter S component	NA	NA	NA	NA
WP_013641841.1\|1031338_1032544_+	L,D-transpeptidase	NA	NA	NA	NA
WP_013641842.1\|1032785_1033139_+	hypothetical protein	NA	NA	NA	NA
WP_013641844.1\|1033804_1033975_+	hypothetical protein	NA	NA	NA	NA
WP_013641845.1\|1034162_1035608_+	amino acid permease	NA	NA	NA	NA
WP_013641846.1\|1035684_1036314_+	hypothetical protein	NA	NA	NA	NA
WP_013437823.1\|1036364_1036808_+	hypothetical protein	NA	NA	NA	NA
WP_013641847.1\|1036856_1037969_-	glycosyltransferase	NA	NA	NA	NA
WP_013437825.1\|1038036_1038897_+	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_013641848.1\|1039021_1040089_+	YSIRK signal domain/LPXTG anchor domain surface protein	NA	NA	NA	NA
WP_013641849.1\|1040153_1041086_-	2-dehydropantoate 2-reductase	NA	NA	NA	NA
WP_013437830.1\|1041219_1041864_+	nitroreductase family protein	NA	NA	NA	NA
WP_013641850.1\|1041920_1042451_+	hypothetical protein	NA	NA	NA	NA
WP_013641851.1\|1042544_1043582_+	hypothetical protein	NA	NA	NA	NA
WP_013641852.1\|1043583_1044159_+	AAA family ATPase	C1KFF1	Lactobacillus_virus	2.5e-09	22.4
WP_013641853.1\|1044192_1044837_+	hypothetical protein	NA	NA	NA	NA
WP_013641854.1\|1044805_1046290_+	fibronectin type III domain-containing protein	NA	NA	NA	NA
WP_013641855.1\|1046424_1047315_+	proline iminopeptidase-family hydrolase	NA	NA	NA	NA
WP_013641856.1\|1048283_1049111_+	restriction endonuclease	NA	NA	NA	NA
WP_013641857.1\|1049301_1053723_+	Eco57I restriction-modification methylase domain-containing protein	A0A1V0SII8	Klosneuvirus	7.1e-32	23.0
WP_013641858.1\|1053722_1054697_+	hypothetical protein	NA	NA	NA	NA
WP_013641859.1\|1054698_1055379_+	hypothetical protein	NA	NA	NA	NA
WP_013641860.1\|1055605_1057657_+	ATP-dependent DNA helicase	A0A127AW80	Bacillus_phage	4.9e-28	25.4
WP_013641863.1\|1059284_1060322_-	C39 family peptidase	NA	NA	NA	NA
WP_013641865.1\|1060940_1061990_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	6.8e-50	35.2
WP_013641867.1\|1062671_1062851_+	hypothetical protein	NA	NA	NA	NA
WP_013641869.1\|1063534_1064254_+	Fic family protein	NA	NA	NA	NA
WP_013641870.1\|1064346_1065000_-	XRE family transcriptional regulator	NA	NA	NA	NA
WP_013641872.1\|1065369_1066359_-	ABC transporter ATP-binding protein	F2Y302	Organic_Lake_phycodnavirus	1.8e-07	35.7
WP_013641875.1\|1068057_1068609_-	ABC transporter ATP-binding protein	NA	NA	NA	NA
WP_013438435.1\|1069894_1070944_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	8.9e-50	35.2
WP_081456856.1\|1071142_1072906_+	DNA mismatch repair protein MutS	E3T5Q7	Cafeteria_roenbergensis_virus	6.4e-16	28.4
WP_179943692.1\|1073130_1074459_-\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	2.5e-41	27.7
WP_013641879.1\|1074412_1074643_-\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_3

1252781 : 1305938

Lactobacillus_prophage(34.38%)

tRNA,integrase,terminase,tail,holin,head,portal

attL 1269649:1269668|attR 1305964:1305983

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013642029.1\|1252781_1254845_-\|tRNA	glycine--tRNA ligase subunit beta	NA	NA	NA	NA
WP_013438076.1\|1254837_1255755_-\|tRNA	glycine--tRNA ligase subunit alpha	NA	NA	NA	NA
WP_013438077.1\|1256014_1256767_-	DNA repair protein RecO	NA	NA	NA	NA
WP_013642030.1\|1256766_1257672_-	GTPase Era	NA	NA	NA	NA
WP_013642031.1\|1257671_1258196_-	rRNA maturation RNase YbeY	NA	NA	NA	NA
WP_013438080.1\|1258198_1259158_-	PhoH family protein	H6X2N1	Pseudomonas_phage	1.0e-47	46.8
WP_013642032.1\|1259189_1259633_-	GatB/YqeY domain-containing protein	A0A292GL36	Xanthomonas_phage	9.0e-12	32.9
WP_013438082.1\|1261320_1261644_-	metal-sulfur cluster assembly factor	NA	NA	NA	NA
WP_013642033.1\|1261643_1263047_-	Fe-S cluster assembly protein SufB	NA	NA	NA	NA
WP_013642034.1\|1263049_1263490_-	SUF system NifU family Fe-S cluster assembly protein	A0A0K1LSF9	Mycobacterium_phage	9.3e-09	32.1
WP_013642035.1\|1263476_1264709_-	SufS family cysteine desulfurase	Q2XUY6	environmental_halophage	6.9e-102	44.0
WP_013642036.1\|1264674_1265898_-	Fe-S cluster assembly protein SufD	NA	NA	NA	NA
WP_013642037.1\|1265907_1266609_-	Fe-S cluster assembly ATPase SufC	A0A285PWH2	Cedratvirus	2.3e-09	26.7
WP_002880182.1\|1266958_1267135_-	30S ribosomal protein S21	NA	NA	NA	NA
WP_013438084.1\|1267311_1268148_+	kinase/pyrophosphorylase	NA	NA	NA	NA
WP_013438086.1\|1268921_1269449_+	peptide-methionine (S)-S-oxide reductase MsrA	NA	NA	NA	NA
1269649:1269668	attL	NA	NA	NA	NA
WP_013642038.1\|1269857_1270736_-	lysin	Q38373	Lactococcus_phage	4.1e-80	50.5
WP_013642039.1\|1270725_1271148_-\|holin	phage holin	NA	NA	NA	NA
WP_013642040.1\|1271137_1271341_-	hypothetical protein	NA	NA	NA	NA
WP_013642041.1\|1271330_1271570_-	hypothetical protein	NA	NA	NA	NA
WP_013642042.1\|1271586_1271988_-	hypothetical protein	Q6SEB9	Lactobacillus_prophage	1.5e-50	70.7
WP_013642043.1\|1272000_1275225_-	SGNH/GDSL hydrolase family protein	NA	NA	NA	NA
WP_013642044.1\|1275237_1275720_-	hypothetical protein	Q6SEC1	Lactobacillus_prophage	6.2e-06	56.0
WP_013642045.1\|1275719_1278152_-	peptidoglycan DD-metalloendopeptidase family protein	Q6SEC2	Lactobacillus_prophage	5.1e-165	42.4
WP_148226126.1\|1278151_1279060_-	hypothetical protein	Q6SEC3	Lactobacillus_prophage	4.5e-42	37.7
WP_013642047.1\|1279059_1281738_-\|tail	phage tail tape measure protein	A0A0A1ENQ9	Lactobacillus_phage	1.1e-109	62.4
WP_013642048.1\|1281737_1282043_-	hypothetical protein	A0A0P0I7N9	Lactobacillus_phage	9.6e-13	44.8
WP_013642049.1\|1282090_1282477_-\|tail	tail assembly chaperone	A0A0P0IQQ6	Lactobacillus_phage	2.0e-15	39.8
WP_013642050.1\|1282487_1283138_-\|tail	phage major tail protein, TP901-1 family	NA	NA	NA	NA
WP_013642051.1\|1283138_1283525_-	hypothetical protein	NA	NA	NA	NA
WP_013642052.1\|1283514_1283898_-	HK97 gp10 family phage protein	B5SP35	Lactococcus_phage	3.9e-19	44.5
WP_013642053.1\|1283890_1284202_-	hypothetical protein	NA	NA	NA	NA
WP_049770877.1\|1284185_1284545_-\|head,tail	phage head-tail connector protein	Q6SED1	Lactobacillus_prophage	8.9e-42	73.3
WP_013642055.1\|1284630_1285572_-	hypothetical protein	Q6SED2	Lactobacillus_prophage	1.1e-155	88.3
WP_013642056.1\|1285586_1286150_-	DUF4355 domain-containing protein	Q6SED3	Lactobacillus_prophage	5.8e-64	70.2
WP_013642057.1\|1286246_1286495_-	hypothetical protein	Q5ULN6	Lactobacillus_virus	4.4e-16	50.6
WP_013642058.1\|1286554_1287541_-	hypothetical protein	A0A0A1EKX3	Lactobacillus_phage	1.1e-68	44.2
WP_013642059.1\|1287524_1288955_-\|portal	phage portal protein	Q6SED7	Lactobacillus_prophage	2.0e-148	56.5
WP_013642060.1\|1288966_1290235_-\|terminase	PBSX family phage terminase large subunit	Q9AZ91	Lactobacillus_prophage	3.5e-218	85.3
WP_041808214.1\|1290221_1290647_-\|terminase	terminase small subunit	A7J290	Streptococcus_phage	1.8e-33	57.4
WP_013642062.1\|1290713_1291160_-	hypothetical protein	NA	NA	NA	NA
WP_013642063.1\|1291189_1291612_-	super-infection exclusion protein B	NA	NA	NA	NA
WP_148226138.1\|1292685_1293180_-	hypothetical protein	NA	NA	NA	NA
WP_081456862.1\|1293185_1293377_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_013642067.1\|1293459_1293855_-	VRR-NUC domain-containing protein	A0A0A1ENT6	Lactobacillus_phage	1.2e-34	59.1
WP_013642070.1\|1294064_1294229_-	hypothetical protein	NA	NA	NA	NA
WP_013642071.1\|1294216_1294456_-	hypothetical protein	NA	NA	NA	NA
WP_013642072.1\|1294448_1294637_-	hypothetical protein	NA	NA	NA	NA
WP_041808217.1\|1294776_1294974_-	hypothetical protein	NA	NA	NA	NA
WP_013642074.1\|1294970_1295417_-	hypothetical protein	NA	NA	NA	NA
WP_013642075.1\|1295413_1295644_-	hypothetical protein	NA	NA	NA	NA
WP_013642076.1\|1295640_1296375_-	helix-turn-helix domain-containing protein	A0A2H4JEL5	uncultured_Caudovirales_phage	4.2e-30	59.5
WP_013642077.1\|1296376_1297174_-	ERF family protein	Q6SE93	Lactobacillus_prophage	2.8e-56	46.0
WP_013642078.1\|1297176_1298058_-	DUF1351 domain-containing protein	A0A1S5SE30	Streptococcus_phage	9.3e-08	24.5
WP_013642079.1\|1298078_1298450_-	hypothetical protein	NA	NA	NA	NA
WP_013642080.1\|1298514_1298685_-	hypothetical protein	NA	NA	NA	NA
WP_013642081.1\|1298701_1298926_-	hypothetical protein	NA	NA	NA	NA
WP_013642082.1\|1298948_1299104_-	hypothetical protein	NA	NA	NA	NA
WP_013642083.1\|1299093_1299393_-	hypothetical protein	NA	NA	NA	NA
WP_118027135.1\|1299398_1299593_-	helix-turn-helix transcriptional regulator	Q6SE98	Lactobacillus_prophage	8.2e-10	50.0
WP_013642085.1\|1299670_1299892_+	DUF2188 domain-containing protein	NA	NA	NA	NA
WP_013642086.1\|1299888_1300125_-	hypothetical protein	NA	NA	NA	NA
WP_013642087.1\|1300111_1300921_-	phage repressor protein/antirepressor Ant	L0P8P6	Lactobacillus_phage	6.1e-99	68.4
WP_013642088.1\|1300980_1301187_-	helix-turn-helix transcriptional regulator	X2CXM8	Lactobacillus_phage	6.9e-07	46.7
WP_013642089.1\|1301358_1301727_+	helix-turn-helix transcriptional regulator	X2CXD8	Lactobacillus_phage	1.4e-13	43.5
WP_013642090.1\|1301730_1302171_+	ImmA/IrrE family metallo-endopeptidase	E9LUL3	Lactobacillus_phage	5.3e-12	38.2
WP_013642091.1\|1302197_1302515_+	hypothetical protein	NA	NA	NA	NA
WP_013642092.1\|1302540_1303260_+	hypothetical protein	NA	NA	NA	NA
WP_081456882.1\|1303479_1303794_+	hypothetical protein	NA	NA	NA	NA
WP_013642094.1\|1303819_1304623_+	DUF1828 domain-containing protein	NA	NA	NA	NA
WP_013642095.1\|1304816_1305938_+\|integrase	site-specific integrase	A0A0M9JJ77	Lactobacillus_phage	1.6e-73	43.2
1305964:1305983	attR	NA	NA	NA	NA

DBSCAN-SWA_4

1465398 : 1523265

Bacillus_phage(26.67%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_179943692.1\|1465398_1466727_-\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	2.5e-41	27.7
WP_013641879.1\|1466680_1466911_-\|transposase	transposase	NA	NA	NA	NA
WP_081456857.1\|1466975_1467326_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_004897518.1\|1467319_1467496_-	hypothetical protein	NA	NA	NA	NA
WP_041808222.1\|1467725_1469858_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_041808224.1\|1469938_1471195_-	YSIRK-type signal peptide-containing protein	NA	NA	NA	NA
WP_013642197.1\|1472633_1474271_-	ATPase	W8CYF6	Bacillus_phage	1.2e-29	32.5
WP_013642198.1\|1474270_1474951_-	response regulator transcription factor	W8CYM9	Bacillus_phage	3.3e-29	37.1
WP_013642199.1\|1475070_1475709_-	phosphate signaling complex protein PhoU	NA	NA	NA	NA
WP_013642200.1\|1475708_1476476_-	phosphate ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.5e-14	29.7
WP_013642201.1\|1476479_1477355_-	phosphate ABC transporter permease PstA	NA	NA	NA	NA
WP_013642202.1\|1477359_1478265_-	phosphate ABC transporter permease subunit PstC	NA	NA	NA	NA
WP_013642203.1\|1478283_1479174_-	phosphate ABC transporter substrate-binding protein	M1U9L0	Synechococcus_phage	8.8e-06	23.8
WP_013642204.1\|1479870_1480968_-\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	4.0e-85	44.9
WP_013642205.1\|1481234_1481834_-	SHOCT domain-containing protein	Q38183	Lactococcus_phage	2.0e-06	27.4
WP_013642206.1\|1481906_1482704_-	TIGR02452 family protein	G3MBH6	Bacillus_virus	1.1e-20	30.9
WP_013642207.1\|1482797_1483013_+	hypothetical protein	NA	NA	NA	NA
WP_013642209.1\|1483390_1485772_+	Xaa-Pro dipeptidyl-peptidase	NA	NA	NA	NA
WP_013438288.1\|1485830_1486268_-	peptide-methionine (R)-S-oxide reductase MsrB	NA	NA	NA	NA
WP_013438289.1\|1486317_1486599_-	hypothetical protein	NA	NA	NA	NA
WP_013438292.1\|1486725_1487589_-	sugar transporter	NA	NA	NA	NA
WP_013642211.1\|1487958_1488300_-	hypothetical protein	NA	NA	NA	NA
WP_013642212.1\|1488409_1488862_-	hypothetical protein	NA	NA	NA	NA
WP_013438294.1\|1488980_1492169_-	carbamoyl-phosphate synthase large subunit	NA	NA	NA	NA
WP_118026958.1\|1492161_1493253_-	glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit	R4TGJ8	Halovirus	1.3e-54	35.3
WP_013438296.1\|1493259_1494537_-	dihydroorotase	NA	NA	NA	NA
WP_013438297.1\|1494536_1495493_-	aspartate carbamoyltransferase catalytic subunit	A0A1J0F9B8	Only_Syngen_Nebraska_virus	3.2e-22	32.1
WP_013438298.1\|1495638_1496181_-	bifunctional pyr operon transcriptional regulator/uracil phosphoribosyltransferase PyrR	NA	NA	NA	NA
WP_013438299.1\|1496355_1497279_-	dihydroorotate dehydrogenase	NA	NA	NA	NA
WP_013438300.1\|1497532_1498240_+	orotidine-5'-phosphate decarboxylase	NA	NA	NA	NA
WP_013642214.1\|1498241_1498880_+	orotate phosphoribosyltransferase	S4VS55	Pandoravirus	2.6e-28	31.9
WP_013642216.1\|1499403_1502025_+	cation-translocating P-type ATPase	M1HX51	Paramecium_bursaria_Chlorella_virus	1.8e-83	30.4
WP_013642217.1\|1502121_1503456_+	ClC family H(+)/Cl(-) exchange transporter	NA	NA	NA	NA
WP_014565993.1\|1503496_1503775_+	hypothetical protein	NA	NA	NA	NA
WP_130898834.1\|1503702_1503858_+\|protease	matrixin family metalloprotease	NA	NA	NA	NA
WP_013642219.1\|1503908_1504427_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_013438307.1\|1504492_1504789_-	hypothetical protein	NA	NA	NA	NA
WP_013438308.1\|1504890_1505184_-	hypothetical protein	NA	NA	NA	NA
WP_013438309.1\|1505395_1506058_+	serine dehydratase	NA	NA	NA	NA
WP_013438310.1\|1506071_1506953_+	L-serine ammonia-lyase, iron-sulfur-dependent, subunit alpha	NA	NA	NA	NA
WP_013642220.1\|1506952_1507276_+	metal-sulfur cluster assembly factor	NA	NA	NA	NA
WP_013642221.1\|1507290_1507524_+	hypothetical protein	NA	NA	NA	NA
WP_013642223.1\|1508519_1509380_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_013642224.1\|1509392_1510133_-	amino acid ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	7.0e-17	28.5
WP_013438314.1\|1510142_1510817_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_013438315.1\|1510797_1511457_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_013642225.1\|1511604_1511838_+	hypothetical protein	NA	NA	NA	NA
WP_013641474.1\|1511885_1513268_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	1.4e-58	47.1
WP_013642226.1\|1513334_1514189_-	DNA/RNA non-specific endonuclease	NA	NA	NA	NA
WP_041808226.1\|1514188_1514854_-	hypothetical protein	NA	NA	NA	NA
WP_013642228.1\|1514856_1515186_-	hypothetical protein	NA	NA	NA	NA
WP_013642230.1\|1515880_1517626_-	oligopeptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_013642231.1\|1517976_1518615_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_013642232.1\|1518758_1519166_-	ASCH domain-containing protein	NA	NA	NA	NA
WP_013642233.1\|1519258_1520206_-	restriction endonuclease	NA	NA	NA	NA
WP_004897277.1\|1522041_1523265_+\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	3.4e-93	47.7

DBSCAN-SWA_5

1632481 : 1640969

Synechococcus_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013642315.1\|1632481_1633078_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	6.2e-32	38.3
WP_013642316.1\|1633087_1634125_-	phosphoribosylformylglycinamidine cyclo-ligase	Q58MH8	Prochlorococcus_phage	6.5e-61	41.5
WP_013438443.1\|1634126_1635578_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	4.1e-61	34.4
WP_013438444.1\|1635553_1637782_-	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	2.7e-144	39.7
WP_013438445.1\|1637778_1638450_-	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_013642317.1\|1638446_1638701_-	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_013642318.1\|1638701_1639418_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	G8EYA2	Synechococcus_phage	1.3e-39	38.7
WP_013438404.1\|1639688_1640969_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	1.3e-42	33.5

DBSCAN-SWA_6

1769251 : 1812736

Bacillus_phage(30.0%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013642400.1\|1769251_1769938_+\|protease	matrixin family metalloprotease	NA	NA	NA	NA
WP_013642401.1\|1770009_1770660_+	histidine phosphatase family protein	A0A1X9IGJ2	Lactococcus_phage	6.2e-09	39.6
WP_013642402.1\|1770709_1772512_-	FtsX-like permease family protein	NA	NA	NA	NA
WP_013438565.1\|1772524_1773274_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.6e-35	39.9
WP_013642403.1\|1773420_1774695_-	hypothetical protein	NA	NA	NA	NA
WP_013642404.1\|1774789_1775491_+	hypothetical protein	NA	NA	NA	NA
WP_013438568.1\|1775514_1775907_-	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_013642405.1\|1776022_1776322_-	hypothetical protein	NA	NA	NA	NA
WP_013438570.1\|1776376_1776517_-	hypothetical protein	NA	NA	NA	NA
WP_013642406.1\|1776614_1777610_-	asparaginase	NA	NA	NA	NA
WP_013642407.1\|1777629_1778400_-	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_013642408.1\|1778527_1779865_-	6-phospho-alpha-glucosidase	NA	NA	NA	NA
WP_013642409.1\|1780553_1781054_+	hypothetical protein	NA	NA	NA	NA
WP_013438575.1\|1781086_1781650_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_013642410.1\|1782241_1782394_+	hypothetical protein	NA	NA	NA	NA
WP_013438435.1\|1782611_1783661_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	8.9e-50	35.2
WP_148226142.1\|1783825_1784449_-	DNA polymerase III	NA	NA	NA	NA
WP_013642412.1\|1784668_1786069_-	KAP family P-loop domain-containing protein	R9TRQ8	Vibrio_phage	5.6e-23	30.0
WP_013642413.1\|1786390_1787446_-	Abi family protein	NA	NA	NA	NA
WP_013642414.1\|1787784_1788567_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_013642415.1\|1788556_1789717_-	MFS transporter	NA	NA	NA	NA
WP_013642416.1\|1789734_1791054_-	glycoside hydrolase family 32 protein	S6ATV4	Bacillus_phage	1.5e-30	26.6
WP_013642417.1\|1791106_1792633_-	sucrose-6-phosphate hydrolase	S6ATV4	Bacillus_phage	1.0e-22	25.8
WP_013642418.1\|1792649_1794152_-	PTS transporter subunit EIIC	NA	NA	NA	NA
WP_148226130.1\|1794275_1795145_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_013642420.1\|1795479_1795671_-	hypothetical protein	NA	NA	NA	NA
WP_013642421.1\|1795788_1796709_-	hypothetical protein	NA	NA	NA	NA
WP_013642422.1\|1797041_1797527_-	hypothetical protein	NA	NA	NA	NA
WP_013642423.1\|1797715_1798519_-	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_013642424.1\|1798540_1799179_-	lipolytic protein G-D-S-L family	NA	NA	NA	NA
WP_013642425.1\|1799178_1800657_-	DUF4127 family protein	NA	NA	NA	NA
WP_013642426.1\|1800658_1801417_-	HAD-IIB family hydrolase	NA	NA	NA	NA
WP_013642427.1\|1801413_1802715_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_013642428.1\|1802717_1803404_-	N-acetylmannosamine-6-phosphate 2-epimerase	NA	NA	NA	NA
WP_148226131.1\|1803909_1804938_-\|transposase	IS30 family transposase	A0A2K9V2S9	Faecalibacterium_phage	6.5e-45	32.8
WP_013642430.1\|1805272_1807003_+\|transposase	IS1182 family transposase	A0ZS58	Staphylococcus_virus	1.8e-95	38.7
WP_013642432.1\|1807512_1808118_-	hypothetical protein	NA	NA	NA	NA
WP_013642433.1\|1808154_1808676_-	hypothetical protein	NA	NA	NA	NA
WP_013642434.1\|1808733_1808895_-	hypothetical protein	NA	NA	NA	NA
WP_013642435.1\|1808913_1809297_-	hypothetical protein	NA	NA	NA	NA
WP_013642436.1\|1809411_1810287_-	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	3.9e-75	49.7
WP_013641778.1\|1810626_1810803_+	hypothetical protein	NA	NA	NA	NA
WP_179943697.1\|1810796_1811030_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_179943692.1\|1811223_1812552_-\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	2.5e-41	27.7
WP_013641879.1\|1812505_1812736_-\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_7

1856847 : 1946701

103

Bacillus_phage(27.27%)

protease,transposase,bacteriocin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013642468.1\|1856847_1857678_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_013642469.1\|1857750_1859265_-	L-lactate permease	NA	NA	NA	NA
WP_013438647.1\|1859617_1859983_+	pyridoxamine 5'-phosphate oxidase family protein	NA	NA	NA	NA
WP_046433828.1\|1860052_1860379_-	DUF4767 domain-containing protein	NA	NA	NA	NA
WP_000945966.1\|1860498_1862118_-	recombinase family protein	C7F8K5	Bacillus_phage	1.1e-25	26.9
WP_001205019.1\|1862967_1863762_-	replication initiator protein A	M1PFC4	Streptococcus_phage	7.5e-09	34.0
WP_000998386.1\|1863834_1864221_-	cysteine-rich VLP protein	NA	NA	NA	NA
WP_009249723.1\|1864210_1865878_-	relaxase/mobilization nuclease domain-containing protein	NA	NA	NA	NA
WP_001126628.1\|1865849_1866248_-	plasmid mobilization relaxosome protein MobC	NA	NA	NA	NA
WP_129974465.1\|1866903_1867053_+	hypothetical protein	NA	NA	NA	NA
WP_001909500.1\|1867217_1867415_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_013642473.1\|1867417_1869340_-	tetracycline resistance ribosomal protection protein Tet(W)	E4ZFJ7	Streptococcus_phage	0.0e+00	99.7
WP_162467432.1\|1869898_1870189_-	hypothetical protein	NA	NA	NA	NA
WP_013642475.1\|1870256_1870550_-	hypothetical protein	NA	NA	NA	NA
WP_013642476.1\|1870650_1871445_-	metal ABC transporter permease	NA	NA	NA	NA
WP_013642477.1\|1871444_1872092_-	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	8.0e-17	28.6
WP_013438653.1\|1872126_1873017_-	zinc ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_013438654.1\|1873257_1873536_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_013642479.1\|1874087_1876091_-	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_013438658.1\|1876114_1877029_-	1-phosphofructokinase	NA	NA	NA	NA
WP_004897518.1\|1877953_1878130_+	hypothetical protein	NA	NA	NA	NA
WP_081456857.1\|1878123_1878474_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_013641879.1\|1878538_1878769_+\|transposase	transposase	NA	NA	NA	NA
WP_179943692.1\|1878722_1880051_+\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	2.5e-41	27.7
WP_013642481.1\|1880359_1881574_-	ABC transporter permease	NA	NA	NA	NA
WP_013642482.1\|1881566_1882463_-	ABC transporter ATP-binding protein	F2Y1V5	Organic_Lake_phycodnavirus	3.3e-05	30.5
WP_013642483.1\|1882499_1882739_-	hypothetical protein	NA	NA	NA	NA
WP_013642484.1\|1882998_1883421_-	hypothetical protein	NA	NA	NA	NA
WP_013642485.1\|1883447_1883642_-	hypothetical protein	NA	NA	NA	NA
WP_003549779.1\|1883774_1883984_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_013642486.1\|1883998_1884538_-	hypothetical protein	NA	NA	NA	NA
WP_013642487.1\|1884542_1884725_-	hypothetical protein	NA	NA	NA	NA
WP_005721007.1\|1884891_1885107_-	hypothetical protein	NA	NA	NA	NA
WP_005721006.1\|1885176_1885371_-\|bacteriocin	bacteriocin	NA	NA	NA	NA
WP_013642488.1\|1885388_1885679_-	hypothetical protein	NA	NA	NA	NA
WP_005721002.1\|1886232_1886430_-	hypothetical protein	NA	NA	NA	NA
WP_013642490.1\|1886816_1887413_-	hypothetical protein	NA	NA	NA	NA
WP_013642491.1\|1887423_1889586_-	peptide cleavage/export ABC transporter	W8CYL7	Bacillus_phage	4.0e-44	27.6
WP_013642492.1\|1889746_1890148_-	hypothetical protein	NA	NA	NA	NA
WP_013642493.1\|1890174_1890429_-	hypothetical protein	NA	NA	NA	NA
WP_013642494.1\|1890725_1891892_-\|transposase	IS256 family transposase	A0A220NQR7	Corynebacterium_phage	6.2e-36	28.8
WP_013642495.1\|1892091_1892331_-	hypothetical protein	NA	NA	NA	NA
WP_013642496.1\|1892626_1892902_-	hypothetical protein	NA	NA	NA	NA
WP_013642497.1\|1892960_1893158_-\|bacteriocin	bacteriocin	NA	NA	NA	NA
WP_013642498.1\|1893167_1893410_-\|bacteriocin	bacteriocin lactacin F subunit LafA	NA	NA	NA	NA
WP_013642499.1\|1893650_1893863_-	hypothetical protein	NA	NA	NA	NA
WP_158083624.1\|1893868_1895029_-	glycosyltransferase	NA	NA	NA	NA
WP_013642501.1\|1895078_1895255_-	hypothetical protein	NA	NA	NA	NA
WP_013642502.1\|1895398_1896616_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_013642503.1\|1896825_1896975_+	hypothetical protein	NA	NA	NA	NA
WP_013642504.1\|1897022_1897823_-	response regulator transcription factor	NA	NA	NA	NA
WP_179943698.1\|1897815_1899108_-	GHKL domain-containing protein	NA	NA	NA	NA
WP_013642507.1\|1899408_1899555_-\|bacteriocin	bacteriocin	NA	NA	NA	NA
WP_013642508.1\|1899588_1899861_-	hypothetical protein	NA	NA	NA	NA
WP_013642509.1\|1899903_1900077_-	hypothetical protein	NA	NA	NA	NA
WP_013642510.1\|1900207_1901419_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_013086945.1\|1901579_1901747_-	hypothetical protein	NA	NA	NA	NA
WP_013642511.1\|1901876_1903076_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_013642512.1\|1903213_1903432_-	hypothetical protein	NA	NA	NA	NA
WP_013086947.1\|1903447_1903855_-	hypothetical protein	NA	NA	NA	NA
WP_013642513.1\|1904024_1904210_-	hypothetical protein	NA	NA	NA	NA
WP_013642514.1\|1904374_1906678_-	glycoside hydrolase family 31 protein	NA	NA	NA	NA
WP_013642515.1\|1907032_1908364_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A288TXV8	Enterococcus_phage	1.5e-62	38.0
WP_013438667.1\|1908739_1908964_-	hypothetical protein	NA	NA	NA	NA
WP_013438668.1\|1909039_1909363_-\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_013642516.1\|1909442_1910672_-	alpha-hydroxy-acid oxidizing protein	NA	NA	NA	NA
WP_013438670.1\|1910997_1911162_-	hypothetical protein	NA	NA	NA	NA
WP_013642517.1\|1911484_1911775_-\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_013642518.1\|1911847_1912597_-	aspartate/glutamate racemase family protein	NA	NA	NA	NA
WP_013438673.1\|1912608_1914180_-	UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2, 6-diaminopimelate ligase	NA	NA	NA	NA
WP_013642519.1\|1914228_1915383_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	6.8e-27	30.4
WP_013438675.1\|1915386_1916073_-	response regulator transcription factor	W8CYM9	Bacillus_phage	1.3e-36	37.2
WP_041808373.1\|1916255_1918115_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.6e-46	26.6
WP_013642521.1\|1918124_1919849_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.9e-37	26.7
WP_013642522.1\|1919968_1920745_-	DUF1129 family protein	NA	NA	NA	NA
WP_013438679.1\|1920753_1921854_-	redox-regulated ATPase YchF	NA	NA	NA	NA
WP_013438680.1\|1921910_1922174_-	DUF951 domain-containing protein	NA	NA	NA	NA
WP_013438681.1\|1922166_1923051_-	ParB/RepB/Spo0J family partition protein	I3NLC2	Bifidobacterium_phage	6.4e-17	33.8
WP_013438682.1\|1923028_1923808_-	ParA family protein	Q8JL10	Natrialba_phage	1.1e-25	31.5
WP_013642523.1\|1923822_1924659_-	nucleoid occlusion protein	S5VSZ7	Leptospira_phage	6.1e-17	34.2
WP_013438684.1\|1924675_1925398_-	16S rRNA (guanine(527)-N(7))-methyltransferase RsmG	NA	NA	NA	NA
WP_013438685.1\|1925558_1926095_+	CvpA family protein	NA	NA	NA	NA
WP_013642524.1\|1926142_1927072_-	FAD:protein FMN transferase	NA	NA	NA	NA
WP_013642525.1\|1927077_1927869_-	tyrosine-protein phosphatase	NA	NA	NA	NA
WP_013438688.1\|1927965_1928514_-	NAD(P)H-dependent oxidoreductase	A0A2P0ZL82	Lactobacillus_phage	4.1e-30	40.4
WP_013438689.1\|1928527_1929067_-	NAD(P)H-dependent oxidoreductase	A0A2P0ZL82	Lactobacillus_phage	3.2e-27	38.5
WP_013438690.1\|1929216_1929840_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_013438691.1\|1929950_1930193_-	hypothetical protein	NA	NA	NA	NA
WP_013642526.1\|1930282_1931695_+	C69 family dipeptidase	NA	NA	NA	NA
WP_013642527.1\|1931735_1932410_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.4e-32	38.0
WP_013438694.1\|1932411_1933473_-	ABC transporter permease	NA	NA	NA	NA
WP_013642528.1\|1933473_1934001_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_013438696.1\|1934113_1934713_-	histidine phosphatase family protein	NA	NA	NA	NA
WP_013438697.1\|1934852_1935596_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_013438698.1\|1935592_1936354_-	peroxide stress protein YaaA	NA	NA	NA	NA
WP_013438699.1\|1936406_1937045_+	hypothetical protein	NA	NA	NA	NA
WP_013438700.1\|1937076_1937871_-	DUF4931 domain-containing protein	NA	NA	NA	NA
WP_013642529.1\|1938015_1939242_+	L,D-transpeptidase	NA	NA	NA	NA
WP_013438702.1\|1939325_1939523_+	hypothetical protein	NA	NA	NA	NA
WP_013642530.1\|1939885_1940557_-	membrane protein	NA	NA	NA	NA
WP_013438707.1\|1942252_1944787_-	M1 family metallopeptidase	A0A0P0IY26	Acinetobacter_phage	3.9e-67	25.5
WP_013642531.1\|1944987_1945350_+	hypothetical protein	A0A0E3XCL7	Enterococcus_phage	3.0e-21	68.6
WP_013641421.1\|1945651_1946701_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	8.9e-50	35.2

DBSCAN-SWA_8

1996653 : 2062253

Moraxella_phage(16.67%)

protease,transposase,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013438746.1\|1996653_1998783_-\|protease	ATP-dependent Clp protease ATP-binding subunit	A0A223W0B1	Agrobacterium_phage	1.7e-116	40.6
WP_013642558.1\|1999098_1999971_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_013642559.1\|1999963_2001271_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_013642560.1\|2001356_2002058_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	7.6e-37	37.4
WP_013642561.1\|2002067_2004608_+	ABC transporter permease	NA	NA	NA	NA
WP_013642562.1\|2004656_2004893_+	hypothetical protein	NA	NA	NA	NA
WP_081456873.1\|2004947_2006564_-	polysaccharide biosynthesis protein	NA	NA	NA	NA
WP_013642564.1\|2006853_2007828_+	SLAP domain-containing protein	Q6SE63	Lactobacillus_prophage	6.5e-63	54.4
WP_013642565.1\|2007901_2008582_-	DUF975 family protein	NA	NA	NA	NA
WP_013642566.1\|2008848_2009247_-	hypothetical protein	NA	NA	NA	NA
WP_013642567.1\|2009341_2010283_-	serine hydrolase	NA	NA	NA	NA
WP_013642568.1\|2010282_2011569_-	D-alanyl-lipoteichoic acid biosynthesis protein DltD	NA	NA	NA	NA
WP_003625019.1\|2011561_2011801_-	D-alanine--poly(phosphoribitol) ligase subunit DltC	NA	NA	NA	NA
WP_013642569.1\|2011834_2013073_-	D-alanyl-lipoteichoic acid biosynthesis protein DltB	A0A125RNP0	Pseudomonas_phage	3.1e-25	27.9
WP_013642570.1\|2013072_2014587_-	D-alanine--poly(phosphoribitol) ligase subunit DltA	A0A2K9KZV5	Tupanvirus	9.0e-35	28.1
WP_013438768.1\|2014602_2014755_-	teichoic acid D-Ala incorporation-associated protein DltX	NA	NA	NA	NA
WP_013642571.1\|2014906_2015203_-	hypothetical protein	NA	NA	NA	NA
WP_041808249.1\|2015221_2016358_-	hypothetical protein	NA	NA	NA	NA
WP_013438771.1\|2016947_2017418_+	CBS domain-containing protein	NA	NA	NA	NA
WP_013642573.1\|2017559_2019416_+	cadmium-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	6.8e-69	29.9
WP_013642574.1\|2019570_2020740_+	cation:proton antiporter	NA	NA	NA	NA
WP_081456874.1\|2020910_2021021_+\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_013642575.1\|2021173_2021590_-	DUF4097 family beta strand repeat protein	NA	NA	NA	NA
WP_049770887.1\|2021617_2021827_-	hypothetical protein	NA	NA	NA	NA
WP_013642577.1\|2021826_2023401_-	ABC transporter ATP-binding protein	A0A1V0SE00	Indivirus	3.4e-13	28.7
WP_013642578.1\|2023504_2024371_+	Rgg/GadR/MutR family transcriptional regulator	NA	NA	NA	NA
WP_013642579.1\|2024506_2025013_+	CHAP domain-containing protein	NA	NA	NA	NA
WP_013642580.1\|2025117_2025495_+	helix-turn-helix transcriptional regulator	A0A139ZPI6	Marinitoga_camini_virus	3.3e-07	40.3
WP_013642581.1\|2025558_2026218_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_013642582.1\|2026307_2027411_+	YdcF family protein	NA	NA	NA	NA
WP_013642583.1\|2027434_2029774_+	ABC transporter ATP-binding protein/permease	G9BWD6	Planktothrix_phage	7.9e-30	38.0
WP_013438783.1\|2029818_2030424_-	ECF transporter S component	NA	NA	NA	NA
WP_013642584.1\|2030543_2031584_+	BMP family ABC transporter substrate-binding protein	A0A0A7DN02	Lactobacillus_phage	1.6e-70	42.0
WP_013642585.1\|2031693_2032521_-	aldo/keto reductase	NA	NA	NA	NA
WP_013642586.1\|2032641_2033361_+	glucosamine-6-phosphate deaminase	NA	NA	NA	NA
WP_013642588.1\|2034481_2035129_+	deoxynucleoside kinase	Q5ULP7	Lactobacillus_virus	2.0e-47	47.9
WP_013642589.1\|2035153_2035840_+	deoxynucleoside kinase	C1KFI3	Lactobacillus_virus	4.9e-57	53.0
WP_013642590.1\|2035910_2036711_-	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_013438790.1\|2036934_2038242_+	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	2.6e-38	28.5
WP_013642591.1\|2038449_2039181_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_013438797.1\|2039361_2040669_+	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	1.1e-44	31.9
WP_013642592.1\|2040970_2042281_+	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	5.9e-51	33.3
WP_013438799.1\|2042375_2043110_+	DUF4097 family beta strand repeat protein	NA	NA	NA	NA
WP_013438800.1\|2043157_2043412_+	hypothetical protein	NA	NA	NA	NA
WP_013642593.1\|2043778_2045407_+	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_013642594.1\|2045437_2046700_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_013642595.1\|2046862_2047303_+	CopY/TcrY family copper transport repressor	NA	NA	NA	NA
WP_013438804.1\|2047314_2047692_+	cupredoxin domain-containing protein	NA	NA	NA	NA
WP_013438805.1\|2047691_2047979_+	cupredoxin domain-containing protein	NA	NA	NA	NA
WP_013642596.1\|2047978_2049907_+	copper-translocating P-type ATPase	A0A218MNH6	uncultured_virus	1.2e-95	37.2
WP_013642597.1\|2049903_2050551_-	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_013642599.1\|2052177_2052633_-	hypothetical protein	NA	NA	NA	NA
WP_013642600.1\|2052659_2053805_-	galactonate dehydratase	Q6A202	Oenococcus_phage	1.1e-53	34.0
WP_179943699.1\|2053806_2055207_-	PTS galactitol transporter subunit IIC	NA	NA	NA	NA
WP_013642602.1\|2055261_2055546_-	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_013642603.1\|2055558_2056020_-	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_013642604.1\|2056035_2056653_-	bifunctional 4-hydroxy-2-oxoglutarate aldolase/2-dehydro-3-deoxy-phosphogluconate aldolase	NA	NA	NA	NA
WP_013642605.1\|2056659_2058705_-	BglG family transcription antiterminator	NA	NA	NA	NA
WP_013642607.1\|2059989_2061270_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	1.5e-43	33.8
WP_013642608.1\|2061536_2062253_+\|transposase	IS110 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NC_015213

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_015213_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_015213_1

5416-5563

Orphan

Consensus_repeat	Method
TAGTAAAAATTATCAACTTTTATCAA	CRISPRCasFinder

2 spacers

The CRISPR arrays of NC_015213_1

>merge|NC_015213|1|5416-5563|CRISPRCasFinder
TAGTAAAAATTATCAACTTTTATCAACCGTTGCCAATAGTTAATATTTTTTATCAAAAATCTAGTAAAAAATATCAACTTTTATCAATTATTATCAACGGTTAGCAATAATTGATAACTAATTGATAAAAGTTGGTAACATTTATCAA

>NC_015213|1|1|5416-5563|CRISPRCasFinder
TAGTAAAAATTATCAACTTTTATCAA	CCGTTGCCAATAGTTAATATTTTTTATCAAAAATC
TAGTAAAAAATATCAACTTTTATCAA	TTATTATCAACGGTTAGCAATAATTGATAACTAAT
TGATAAAAGTTGGTAACATTTATCAA

>NC_015213.1|WP_013641316.1|3390_4464_-|hypothetical-protein
MPKNLKNRFRTELIRQRKNARKFGGREKLKKLHDGKYTDYSHIYSDRSYMAHLGRARKFADFCREKGVRDFDQITPEFAKSYLFFERDRGLSASTIGSDALALNHIMVGGGYWKNFQRLVKSKITGMPRRSTKIYQQREKPLNSTEWRERYPSYYHKYQGQIDTIRAFGLRRRELVGGSSYHGKDGLGKNSLYWSKNGRIMAVTIGKGGKYRQIECRLDLQPQMQKLYGDYIKPPSQMPKNKAEYMRVMRSNKPFYAPYSHSIPSHIFRSDYAQFKLRELASKTFTGQRVYSYAKRIKSPQSGKYHYVRAVKSHDLSKQYQIGIYKAPYGAFYKLSEYMGHNRLDVLQSYLGEGREN
>NC_015213.1|WP_013641314.1|2207_2291_-|23S-rRNA-methyltransferase-attenuation-leader-peptide
MLVFKMRNVDKTSTVLKQTKNSDYADK
>NC_015213.1|WP_013641313.1|1345_2083_-|23S-rRNA-(adenine(2058)-N(6))-methyltransferase-Erm(B)
MNKNIKYSQNFLTSEKVLNQIIKQLNLKETDTVYEIGTGKGHLTTKLAKISKQVTSIELDSHLFNLSSEKLKLNTRVTLIHQDILQFQFPNKQRYKIVGSIPYNLSTQIIKKVVFESHASDIYLIVEEGFYKRTLDIHRTLGLLLHTQVSIQQLLKLPAECFHPKPKVNSVLIKLTRHTTDVPDKYWKLYTYFVSKWVNREYRQLFTKNQFHQAMKHAKVNNLSTVTYEQVLSIFNSYLLFNGRK
>NC_015213.1|WP_013641312.1|710_1208_+|hypothetical-protein
MAENVRKTKYEIMIDVMQALGVSSFDLHEVEKYLRKIGAKADDRGTYEGSSCKAVVDHFKLVKEISKSDKAMITSLRRQVKDLQEQNKQLTAELVILNHIKADVKSIKADLIKRSDKAKPTNEHQEKPTYTSVSGARMNNYPYEPTNNATESRSQHQQIHPTTIN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_015213_1	1.1\|5442\|35\|NC_015213\|CRISPRCasFinder	5442-5476	35	NC_015213	Lactobacillus amylovorus plasmid pRKC30SC1, complete sequence	5442-5476	0	1.0
NC_015213_1	1.2\|5503\|35\|NC_015213\|CRISPRCasFinder	5503-5537	35	NC_015213	Lactobacillus amylovorus plasmid pRKC30SC1, complete sequence	5503-5537	0	1.0
NC_015213_1	1.1\|5442\|35\|NC_015213\|CRISPRCasFinder	5442-5476	35	NZ_LR214986	Mycoplasma cynos strain NCTC10142 plasmid 13	131034-131068	9	0.743
NC_015213_1	1.1\|5442\|35\|NC_015213\|CRISPRCasFinder	5442-5476	35	NZ_CP036355	Bacillus sp. SYJ plasmid unnamed1, complete sequence	187306-187340	9	0.743

1. spacer 1.1|5442|35|NC_015213|CRISPRCasFinder matches to NC_015213 (Lactobacillus amylovorus plasmid pRKC30SC1, complete sequence) position: , mismatch: 0, identity: 1.0

ccgttgccaatagttaatattttttatcaaaaatc	CRISPR spacer
ccgttgccaatagttaatattttttatcaaaaatc	Protospacer
***********************************

2. spacer 1.2|5503|35|NC_015213|CRISPRCasFinder matches to NC_015213 (Lactobacillus amylovorus plasmid pRKC30SC1, complete sequence) position: , mismatch: 0, identity: 1.0

ttattatcaacggttagcaataattgataactaat	CRISPR spacer
ttattatcaacggttagcaataattgataactaat	Protospacer
***********************************

3. spacer 1.1|5442|35|NC_015213|CRISPRCasFinder matches to NZ_LR214986 (Mycoplasma cynos strain NCTC10142 plasmid 13) position: , mismatch: 9, identity: 0.743

ccgttgccaatagttaatattttttatcaaaaatc	CRISPR spacer
aatttttcaatagttaagaatttttatcaaaaaat	Protospacer
   ** .********** * ************* .

4. spacer 1.1|5442|35|NC_015213|CRISPRCasFinder matches to NZ_CP036355 (Bacillus sp. SYJ plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.743

ccgttgccaatagttaatattttttatcaaaaatc	CRISPR spacer
tgtcttcccttatttaatactttttatcaaaaatc	Protospacer
.  .* **  ** ******.***************

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_015214

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NC_015213

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection