CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NC_007971	Cupriavidus metallidurans CH34 plasmid pMOL30, complete sequence	0 crisprs	NA	0	1
NC_007972	Cupriavidus metallidurans CH34 plasmid pMOL28, complete sequence	0 crisprs	NA	0	2
NC_007973	Cupriavidus metallidurans CH34, complete genome	0 crisprs	csa3,DinG,PD-DExK,RT,DEDDh,WYL,cas3	0	8
NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	1 crisprs	WYL,DEDDh,cas3,csa3	1	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_007974_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_007974_1

458453-458535

Orphan

Consensus_repeat	Method
GACAAGTATGGCTATGAATTCCGCAC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_007974_1

>merge|NC_007974|1|458453-458535|CRISPRCasFinder
GACAAGTATGGCTATGAATTCCGCACCGGCGAGTCCGCGGGGACCCGGGTGCCGGCAGACAAGTATGGCTACGAATTCCGCAC

>NC_007974|1|1|458453-458535|CRISPRCasFinder
GACAAGTATGGCTATGAATTCCGCAC	CGGCGAGTCCGCGGGGACCCGGGTGCCGGCA
GACAAGTATGGCTACGAATTCCGCAC

Protein	Signature genes	Signature genes Name	Protein_function
NC_007974.2\|WP_011518426.1\|459279_459906_+\|LysE-family-translocator	unknown	unknown	gnl\|CDD\|224199
NC_007974.2\|WP_011518419.1\|451342_452614_+\|YeaH/YhbH-family-protein	unknown	unknown	gnl\|CDD\|377280
NC_007974.2\|WP_152560261.1\|455764_458026_-\|mechanosensitive-ion-channel	unknown	unknown	gnl\|CDD\|366370
NC_007974.2\|WP_024568962.1\|447531_448446_+\|SDR-family-NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|187611
NC_007974.2\|WP_011518427.1\|459933_460608_-\|histidine-phosphatase-family-protein	unknown	unknown	gnl\|CDD\|366010
NC_007974.2\|WP_011518434.1\|468159_469476_+\|DUF1254-domain-containing-protein	unknown	unknown	gnl\|CDD\|227659
NC_007974.2\|WP_029310285.1\|461907_462585_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|366102
NC_007974.2\|WP_011518416.1\|446492_447395_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176113
NC_007974.2\|WP_011518428.1\|460794_461793_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270234
NC_007974.2\|WP_011518433.1\|466806_468120_+\|DUF1254-domain-containing-protein	unknown	unknown	gnl\|CDD\|227659
NC_007974.2\|WP_011518432.1\|465792_466779_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270296
NC_007974.2\|WP_035822869.1\|462749_463556_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|224332
NC_007974.2\|WP_011518413.1\|442604_443984_-\|MmgE/PrpD-family-protein	unknown	unknown	gnl\|CDD\|377179
NC_007974.2\|WP_011518421.1\|454211_455390_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225360
NC_007974.2\|WP_011518431.1\|463638_465750_+\|acetate--CoA-ligase-family-protein	unknown	unknown	gnl\|CDD\|223972
NC_007974.2\|WP_011518420.1\|452651_454190_+\|SpoVR-family-protein	unknown	unknown	gnl\|CDD\|236973
NC_007974.2\|WP_008647020.1\|449323_451246_+\|PrkA-family-serine-protein-kinase	unknown	unknown	gnl\|CDD\|185352
NC_007974.2\|WP_011518414.1\|443992_445162_-\|acyl-CoA/acyl-ACP-dehydrogenase	unknown	unknown	gnl\|CDD\|224871
NC_007974.2\|WP_152560190.1\|445444_446470_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein-BugD	unknown	unknown	gnl\|CDD\|270294
NC_007974.2\|WP_049799794.1\|458958_459240_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NC_007974.2\|WP_011518426.1\|459279_459906_+\|LysE-family-translocator	gnl\|CDD\|224199	COG1280, RhtB, Putative threonine efflux protein [Amino acid transport and metabolism].	2.29951e-42
NC_007974.2\|WP_011518419.1\|451342_452614_+\|YeaH/YhbH-family-protein	gnl\|CDD\|377280	pfam04285, DUF444, Protein of unknown function (DUF444). Bacterial protein of unknown function. One family member is predicted to contain a von Willebrand factor (vWF) type A domain (Smart:VWA).	0
NC_007974.2\|WP_152560261.1\|455764_458026_-\|mechanosensitive-ion-channel	gnl\|CDD\|366370	pfam00924, MS_channel, Mechanosensitive ion channel. Two members of this protein family of M. jannaschii have been functionally characterized. Both proteins form mechanosensitive (MS) ion channels upon reconstitution into liposomes and functional examination by the patch-clamp technique. Therefore this family are likely to also be MS channel proteins.	2.07066e-39
NC_007974.2\|WP_024568962.1\|447531_448446_+\|SDR-family-NAD(P)-dependent-oxidoreductase	gnl\|CDD\|187611	cd05353, hydroxyacyl-CoA-like_DH_SDR_c-like, (3R)-hydroxyacyl-CoA dehydrogenase-like, classical(c)-like SDRs. Beta oxidation of fatty acids in eukaryotes occurs by a four-reaction cycle, that may take place in mitochondria or in peroxisomes. (3R)-hydroxyacyl-CoA dehydrogenase is part of rat peroxisomal multifunctional MFE-2, it is a member of the NAD-dependent SDRs, but contains an additional small C-terminal domain that completes the active site pocket and participates in dimerization. The atypical, additional C-terminal extension allows for more extensive dimerization contact than other SDRs. MFE-2 catalyzes the second and third reactions of the peroxisomal beta oxidation cycle. Proteins in this subgroup have a typical catalytic triad, but have a His in place of the usual upstream Asn. This subgroup also contains members identified as 17-beta-hydroxysteroid dehydrogenases, including human peroxisomal 17-beta-hydroxysteroid dehydrogenase type 4 (17beta-HSD type 4, aka MFE-2, encoded by HSD17B4 gene) which is involved in fatty acid beta-oxidation and steroid metabolism. This subgroup also includes two SDR domains of the Neurospora crassa and Saccharomyces cerevisiae multifunctional beta-oxidation protein (MFP, aka Fox2). SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRS are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes have a 3-glycine N-terminal NAD(P)(H)-binding pattern (typically, TGxxxGxG in classical SDRs and TGxxGxxG in extended SDRs), while substrate binding is in the C-terminal region. A critical catalytic Tyr residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering), is often found in a conserved YXXXK pattern. In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) or additional Ser, contributing to the active site. Substrates for these enzymes include sugars, steroids, alcohols, and aromatic compounds. The standard reaction mechanism is a proton relay involving the conserved Tyr and Lys, as well as Asn (or Ser). Some SDR family members, including 17 beta-hydroxysteroid dehydrogenase contain an additional helix-turn-helix motif that is not generally found among SDRs.	2.06905e-95
NC_007974.2\|WP_011518427.1\|459933_460608_-\|histidine-phosphatase-family-protein	gnl\|CDD\|366010	pfam00300, His_Phos_1, Histidine phosphatase superfamily (branch 1). The histidine phosphatase superfamily is so named because catalysis centers on a conserved His residue that is transiently phosphorylated during the catalytic cycle. Other conserved residues contribute to a 'phosphate pocket' and interact with the phospho group of substrate before, during and after its transfer to the His residue. Structure and sequence analyses show that different families contribute different additional residues to the 'phosphate pocket' and, more surprisingly, differ in the position, in sequence and in three dimensions, of a catalytically essential acidic residue. The superfamily may be divided into two main branches. The larger branch 1 contains a wide variety of catalytic functions, the best known being fructose 2,6-bisphosphatase (found in a bifunctional protein with 2-phosphofructokinase) and cofactor-dependent phosphoglycerate mutase. The latter is an unusual example of a mutase activity in the superfamily: the vast majority of members appear to be phosphatases. The bacterial regulatory protein phosphatase SixA is also in branch 1 and has a minimal, and possible ancestral-like structure, lacking the large domain insertions that contribute to binding of small molecules in branch 1 members.	1.06418e-23
NC_007974.2\|WP_011518434.1\|468159_469476_+\|DUF1254-domain-containing-protein	gnl\|CDD\|227659	COG5361, COG5361, Uncharacterized conserved protein [Function unknown].	1.60378e-71
NC_007974.2\|WP_029310285.1\|461907_462585_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|366102	pfam00440, TetR_N, Bacterial regulatory proteins, tetR family.	1.28057e-11
NC_007974.2\|WP_011518416.1\|446492_447395_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176113	cd08421, PBP2_LTTR_like_1, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold. LysR-transcriptional regulators comprise the largest family of prokaryotic transcription factor. Homologs of some of LTTRs with similar domain organizations are also found in the archaea and eukaryotic organisms. The LTTRs are composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal substrate-binding domain, which is structurally homologous to the type 2 periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcriptional repressor undergoes a conformational change upon substrate binding which in turn changes the DNA binding affinity of the repressor. The genes controlled by the LTTRs have diverse functional roles including amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to a name a few. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.83746e-86
NC_007974.2\|WP_011518428.1\|460794_461793_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270234	cd07012, PBP2_Bug_TTT, Bug (Bordetella uptake gene) protein family of periplasmic solute-binding receptors; contains the type 2 periplasmic binding fold. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) proteins present in a number of bacterial species, but mainly in proteobacteria. In eubacteria, at least three families of periplasmic binding-protein dependent transporters are known: the ATP-binding cassette (ABC) transporters, the tripartite ATP-independent periplasmic transporters, and the tripartite tricarboxylate transporters (TTT). Bug proteins are the PBP components of the TTT. Their expansive expansion in proteobacteria indicates a large functional diversity. The best studied examples are Bordetella pertussis BugD, which is an aspartic acid transporter, and BugE, which is glutamate transporter.	1.08498e-116
NC_007974.2\|WP_011518433.1\|466806_468120_+\|DUF1254-domain-containing-protein	gnl\|CDD\|227659	COG5361, COG5361, Uncharacterized conserved protein [Function unknown].	2.20103e-52
NC_007974.2\|WP_011518432.1\|465792_466779_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270296	cd13578, PBP2_Bug27, Aromatic solutes transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. Bug27 binds non-carboxylated solute nicotinamide, in contrast to BugD (aspartic acid transporter) and BugE (glutamate transporter) which both bind aliphatic carboxylated ligands. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity.	1.56372e-125
NC_007974.2\|WP_035822869.1\|462749_463556_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|224332	COG1414, IclR, Transcriptional regulator [Transcription].	2.62949e-31
NC_007974.2\|WP_011518413.1\|442604_443984_-\|MmgE/PrpD-family-protein	gnl\|CDD\|377179	pfam03972, MmgE_PrpD, MmgE/PrpD family. This family includes 2-methylcitrate dehydratase EC:4.2.1.79 (PrpD) that is required for propionate catabolism. It catalyzes the third step of the 2-methylcitric acid cycle.	1.91556e-152
NC_007974.2\|WP_011518421.1\|454211_455390_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|225360	COG2771, CsgD, DNA-binding HTH domain-containing proteins [Transcription].	4.2466e-12
NC_007974.2\|WP_011518431.1\|463638_465750_+\|acetate--CoA-ligase-family-protein	gnl\|CDD\|223972	COG1042, COG1042, Acyl-CoA synthetase (NDP forming) [Energy production and conversion].	2.29661e-114
NC_007974.2\|WP_011518420.1\|452651_454190_+\|SpoVR-family-protein	gnl\|CDD\|236973	PRK11767, PRK11767, SpoVR family protein; Provisional.	0
NC_007974.2\|WP_008647020.1\|449323_451246_+\|PrkA-family-serine-protein-kinase	gnl\|CDD\|185352	PRK15455, PRK15455, PrkA family serine protein kinase; Provisional.	0
NC_007974.2\|WP_011518414.1\|443992_445162_-\|acyl-CoA/acyl-ACP-dehydrogenase	gnl\|CDD\|224871	COG1960, CaiA, Acyl-CoA dehydrogenases [Lipid metabolism].	9.72873e-110
NC_007974.2\|WP_152560190.1\|445444_446470_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein-BugD	gnl\|CDD\|270294	cd13576, PBP2_BugD_Asp, Aspartic acid transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity. The best studied examples are Bordetella pertussis BugD, which is an aspartic acid transporter, and BugE, which is glutamate transporter.	4.69106e-132

>NC_007974.2|WP_152560261.1|455764_458026_-|mechanosensitive-ion-channel
MAMFLAGAAQSAGLSLAAMTQKANAQPASAPPASAPLAQSLDQVINTLQNEGERQALVKQLQAVRTGLDASAAGAAGAASAAGASAPSPGLIGAVAQAIQEMDNAPHKNSGAMHYWKWRMEFAREELHDALTIKNTRKAIVSWTEFGTVFAGWAITGWLLRELARRLRQNRLRRPRDHQLPKIPSWIDVSLYFVRGIGPWIVAFGLTVLLAYQVFGRTPASVGAVLVAYAILAGAVMSAVCQVIFTLFQSAHRAHAVRDLITHSPILLFITGSLAALGEVNSDPRVIAALGLNLTALISTLSNILAAILIGVFAVRFRRAIGQLISFRPFAIRQEYPAMMDLLRLAGDAWYLPVLAVVAASVIGTIMATGHADEFLRRAVITVALFVTATLLTLVVGRSPKATVRAPRLRDRRRSAYVQRFGRFGAALIRVVIWITFLELNARIWQTSLIRIAQSTAAGRHITESLLGVVGVVLLAWLAWLLIDTAITQTLSPTHGRAAQPSLRAKTILPLVRNASFVSVLVVAMIAVLANLGVNVTPLLAGAGVVGLAIGFGAQTLVQDLITGLFIVVEDTIAIGDSIELPDHVGVVEAMTIRTVRLRDGKGAVHTLPYSQIKAVKNLSRGYAFAVFNISIAYQSDFERALELVRETGAEVARDHRYSRNLLSGLDILGLDRFDPTGQVVLAQFKTRPLTQYEITRAFNIRLKRNFDANGIRLAVPFVTVQVDGSGTEEEIATAAAAGAGADLVTRKAGKPA
>NC_007974.2|WP_011518421.1|454211_455390_-|helix-turn-helix-transcriptional-regulator
MGEHPSTDDVFHRLVDCIYESAMDVAAMPAALDLFSRYTGTGSPSYLIWDKLAARARLGVTPHGCFTSAGSMPDNMRALPPHLTTTGATRACATMSVDGATAMLAEPEAAAATSIYDCSGLAQGIRLFDTSDVCVLMSATPASCDAFAHCQQRVAQVMPHWARAARMQHRNFELSGLASLGLASLDTLDFGVMVLQADMRVRYANSWAEALVQADTNLALDNGVLRARAESMQSVLAGLLESAVHGGRNGTVAGSWMHITSGGQPVPIIVMPLVSRQPVEGPWQLPMAMMLLGNSESRSVLDAGVLTSLFGLSRKESIIAIRLAAGETLTEIAEREFLSPHTVRVHIRDTLRKTGTHRQSELVRLLHLLPGVDLERAGVSSTARPRDTRRRH
>NC_007974.2|WP_011518420.1|452651_454190_+|SpoVR-family-protein
MAYLSTGSEWTFELIQRYDREIARIAGDFGLDTYPNQIEIITAEQMLDAYASSGLPVGYNHWSYGKHFLASERGYQRGYMGLAYEIVINSNPCIAYLMEENTMPMQALTIAHACYGHNSFFKGNYLFRTWTNADAIIDYLLFAKNYVAECEQRYGEQEVELLLDSCHALQNYGVDRYKRPKKLSITEEQARQAERESYLQMQVNDLWRTLPKHRPHALRQEEEALELEAIFPPEPQENLLYFIEKNAPKLQPWQREIVRIVRKIAQYFYPQRQTKVMNEGWATFWHYTIIHQLYEEKLVNDAFMLELLQAHTNVIYQPPYHSQYYSGLNPYTLGFLMFQDIRRMCENPTEEDRRWAPEIAGSDWRQTLDFAMRNFKDESFLLQFLSPRVIRELKLFSVLDDDREGKLRVTAIHDDEGYREIRHLLANQYDLSNMEPNIQVTNVDIGGDRSLTLRHLQNDRRPLAQNFDEVVRHVTRLWGFTVRLEVAYEDGRRELKYECKPERRHQPQRRAA
>NC_007974.2|WP_011518419.1|451342_452614_+|YeaH/YhbH-family-protein
MATVIDRRENGGNKSAVNQQRFIKRYREQIRQAVAKAVSGRKIMDIEQSGQVSIPVKDISEPIFHHGQGGRREWIHPGNKKFVRGDSFDRQQQGGGGGGSRASDSGEGEDDFVFTLSREDFLNFFFEDMALPDLAKRHLAKIAEVRKVRAGFSIDGTPSNLSILRTMRSSLGRRIALSSPYLKRLRELELEYNDEVEKDPYSEKAEALMERMRHLRAQVDRVPFIEKLDLRYNNRVLKKRPQAQAVMFCLMDVSGSMDESRKDLAKRFFMLLYLFLKRNYERIDVVFIRHHTVAKEVDEEDFFHSRESGGTVVSSALKLMVEVIHDRYPPSQWNIYCAQASDGDNWAGDSELCGRLLRESILPLVQYYAYVEVASEEPQNLWEEYLTVKGEFEHFAMQRIIGADEIYPVLHDLFQKRAAWPGR
>NC_007974.2|WP_008647020.1|449323_451246_+|PrkA-family-serine-protein-kinase
MDIFGHYATRFEARKEEEYSIQEYLEICKKDPTAYATAAERMLSAIGQPELVDTHHDPRLSRLFFNKVIRVYPAFRDFYGMEDTIEQIVSFFKHAAQGLEERKQILYLLGPPGGGKSSLAEKLKALMEEIPIYALKGSPIHESPLGLFSADEDGKIMEEDYGIPVRYLNTIPSPWAVKRLNEFNGDITKFRVVKLRPSVLAQIAISKTEPGDENNQDISSLVGKVDIRKLEDFPQDDPDAYSYSGGLCLANRGLLEFVEMFKAPIKVLHPLLTATQEGNYKGTEGFGAIPFDGVILAHSNEAEWTTFKADKNNEAFLDRIYIVKVPYCLRVSDEVKIYDKLLRSSSLSAAPCSPNTLKMMAQFAVLTRIKEPENSNIFSKMRVYDGESLKDVDPKAKSYQEYRDYAGIDEGMNGLSTRFAFKVLSKVFNFDNTEVAANPVHLLYVLEQQIEREQFPPEQEAKLMSYIKEYLTTPYVEFIGKEIQTAYLESYSEYGQNIFDRYVVFADLWIQDQEYRDPNTGEILDRNALNDELEKVEKPAGISNPKDFRNEIVNFVLRARANNGGKNPVWTSYEKLRMVIEKRMFSTTEDLLPVISFNAKSSREDQDKHENFINRMVEKGYTPKQVRLLVEWYLRVRKSS
>NC_007974.2|WP_024568962.1|447531_448446_+|SDR-family-NAD(P)-dependent-oxidoreductase
MSGMMEGKVVVVTGAGGGIGRGIALGMAAAGARVVVNDLGVSMSGEGGDAGPAQRVVEEIRAAGGQAVANTDSVSTWAGGNAIVQCALDTFGRIDAVVNNAGNLRDRMFFKMNEEEWRSVIDVHLHGTFFVSRAAANYFKDQESGAYVNMTSTSGLIGNLGQANYSAAKLGIAALSKSIALDMARFNVRSNCIAPFAWSRMTSSIPAETPAEKERVARLQKMEAGKIAPVAVFLASDAAKDVNAQIFAVRANEIMLMSQSRPVRSVHTGEGWTPETVAEIAMPAMRGSFFKLDRSPDVINWDPI
>NC_007974.2|WP_011518416.1|446492_447395_-|LysR-family-transcriptional-regulator
MHYDLTDLRLFLNVGETENITRAAERSFLSLPAASARIKQLEEAFQTQLLIRQVKGVRLTPAGDALLRHAREVFRELECLHSDLRPYAKGVKGRVRLLANTTATNSFLAHALSRFLSENPDVDIELEEHLSADIVSAIGTGAADLGIVAGEVATADLDTMQLCSDELIVIAPVNHPLPAFKTLRFAELLDSCRFVGLNQSSAIQSFLDRIASGMGKRISLRIQVGSFDAVCRMVEAGAGIAIVPNSCARRYASRKVLRFIRLEDDWARRELQLVRRPGRELPQFAETLIQYLVDAAREPV
>NC_007974.2|WP_152560190.1|445444_446470_+|tripartite-tricarboxylate-transporter-substrate-binding-protein-BugD
MTTFPQLPAIGTGKWRGMTWAALALAAVAVAVPGQGRANDAYPSKPIVMVVPFAAGGPTDVVARSVAAAMSKTLGQSVVVENRLGAGGTVSAAYVAKAAPDGYTILIHHNGMATAPALYSKLPYKPLTDFSFVGQVADVPMTLLGRHDLPPNNLPELVTYIQKNQNKVNLANAGLGAVSQLCGMLFQKAIGVDVQTIPYQGTAPAMTALLGGQVDVLCDQTTQTLTHIKADKVKLYGVTTAERIPALPNAPTLREGGLKGFEVKVWHGIYAPKGTPPAVINKLNGALRAALKDPAVAARMQDLGAVIVPEDKQTPEGLRTWLASEIDKWSPIIKAAGVKAD
>NC_007974.2|WP_011518414.1|443992_445162_-|acyl-CoA/acyl-ACP-dehydrogenase
MHAAQDQDLIYPEIREAVRDLCKQFDSAYWQRIEEHSAFPEEFVQALTHAGWLSALIPEAYGGSGLPLTAASVIMEEINRNGGNSGACHGQMYVMGCLLRHGSEAQKQRWLPGIASGELRMQSMAVTEPTTGTDTTKLKTTAVRRGDKYVINGQKVWISRVQHSDLMLLLARTTPLDQVKKKSEGLSVFVVDLREAIGNGLTVQPIRNMVNHETNELFFDNLEIPAENLIGEEGKGLKYILDGLNAERILIAAECIGDGYWFVERASSYARERIVFDRPIGQNQGVQFPIARSFVNVEAASLMRYKAAQLFDAGKPCGKEANMAKLLAADASWEAANVCLQTHGGFGFAAEYDIERKFRETRLYQVAPISTNLILSFVAEHVLELPRSF
>NC_007974.2|WP_011518413.1|442604_443984_-|MmgE/PrpD-family-protein
MSDIDTRYPTRQLCEFLARFTLADVPSPVVERTKDLFLDWIASAIAGKDAPAVRRIQEFAAAMGPATGQAEVFVDRRRTSPYFAALINGASSHVVEQDDVHNGSVLHPAAVVFPAVVAAAQAEGKTGAEVLLASIAGYEAGIRIGEFMGRSHYRVFHTTGTVGTLAAAAAVAKLYGLDAEGINQALGSAGTQAAGLWEFLRDAADSKQLHTAKAAADGLQSAWLARAGFTGARQILEGAQGMAAGMSSDANPAALTDGLGTRWATAETSFKFFASCRHTHPAADALKALMLREGLQADQIAAVTAHVHQGAIDVLGPVVNPATIHQAKFSMGTVLGLVAVHAHAGLGEFEQHSLKDAQVSAFRDKVTMELDEEINAAYPRQWIGRVTVRTTDGRTLQARVDVPKGDPDNTLSRPELEAKAIQLGAFRHGATEAEMRAIIARVWQLDREANVNDWLPAAR
>NC_007974.2|WP_049799794.1|458958_459240_+|hypothetical-protein
MFQNTFAQADAVIVHDAAIAAAIDAAMLRRRDEYAGQPMAWKVFCEASHVATLCEPLRMAFINRVASERGADIALRLKTKAEAIRAAAIAELV
>NC_007974.2|WP_011518426.1|459279_459906_+|LysE-family-translocator
MPPFDTLLPFLGIAVLLSLAPGPDNIFVLLLSAMHGTRAGLTVVLGLCTGLLVHTAVVAVGLAALLAASTVAFTVLKIAGALYLVYLAWQAFRAPVGELSSSQMQVKTGKHMYLRGVIMNLTNPKVVIFFLAFLPQFVSPDRGPVAPQIMVLGFVFILATLLVFGSIAWFSGAFGRVLMRSARMQRAVNWFAGSVFLALAGRLALSQR
>NC_007974.2|WP_011518427.1|459933_460608_-|histidine-phosphatase-family-protein
MATLFLVRHGQASFGAANYDCLSDTGRQQSRWLGEYFRDRGVQFRRVVAGTLVRQQDTASEILAGMGISDLPVASHPGLNEYDGESLYRSFTKGADHRAHQNGDYQDYWRTFRAAFAAWTQDQLTGMPETWGEFGQRMQAALAHATEGASREDALLVVSSGGAIGRAVADLLGAPTQTAIELNLQFRNTGFCELIVGRGTQRLLSFNNVPHLELPERRPAITFA
>NC_007974.2|WP_011518428.1|460794_461793_-|tripartite-tricarboxylate-transporter-substrate-binding-protein
MKQTIPPRRRWVMRAACAAVALLPLATFAQGSYPSKPIRMVVPYPAGGLTDTVARQLAEGLGKRLGQPVVVENRGGAGGIIGTDFVAKSPADGYTLLMTIPGPITANIALYKKLPYDPRTELRPISDVAMARTVLTVNSAVPVKTVTELIAYAKKEPGKLRMGSWGPGTQPHTIQAYMDKTYGVDILHVPYRGEGPMVTDLLAGQVNLTIGSVTTLRQYIAVGKLRPLAVAGTTRAKALPDVPTFTEAGYSDAAYKIVGPTTLLAPAKTPDAIIERLGREVSALVKSPELSAKIDELGAEPIGNTPAEAERAYKAYLPVVLKLTADTGVTLD
>NC_007974.2|WP_029310285.1|461907_462585_-|TetR/AcrR-family-transcriptional-regulator
MQSPITSAPSTSSPFPRVDTTSILQPPRQRRARETEQALLAAGRKLLAERDFAAVSVAQIAAACQVSVGAFYGRFRDKMAFFDALRTLVMEESDASVARYMAEHRWGEVPARQIVEKTMRFLVNGCHNNRGVIRASLKHSSTRPEEWLPHQKNGEEIVERLVALLTPRLPGPAEANEVRVRFAMQMVFGMLVNAVLNNPGPLRLDDERLSGEMTRMVACYLGLES
>NC_007974.2|WP_035822869.1|462749_463556_+|helix-turn-helix-domain-containing-protein
MNTPVEQFIAERRREDPSFGGLLAKGFALLRCFIDDPRPLGNGELAQRLQLPRATVSRICRTLFELGYLDWEPKLDKYFVSAQVLALGYPYMAGLQVRHLARPLMQALANQIEGAVSMGVAYRLDVTYLESCTHMEGTPARPAIGAVRSVLTSAMGRAYLCTLSKTEFEKLMTTARAERPDEYAACYETLCHCIAHYPKRGFTLNEGDAGADVHGVGVYSRVVYMNRPLLFNCAIPGMRVKRGSMEKRVAPLLREMVRSIENMAGVGR
>NC_007974.2|WP_011518431.1|463638_465750_+|acetate--CoA-ligase-family-protein
MQDLQPLLRPRSIAVIGASTQPEKVGGMPIRLLGELGYAGRVFPVNPGADTVQGLRAFPTVEAIGEPVDLAIVAVPALAAPDVMAQLGRAGTRAAVVFTSGFAEVANGSGLQHALATQAKTHGVQLLGPNCLGAMNLGERMFATFSPIPLTGVPPVGGVGLVSQSGAFGAYAFALAREAGLGLSHWVTTGNEAGLQVADVIEWLAHDPQTQVILAYIEGARDGMRLRQALAAARAAGKPVVIAKVGTTVAGASAAQSHTASLAGEDAVYQAVFDEYGVHRAHTLEAFFRLGYTLARGRRPARWHSPTGMAADAVAPVAIVTVSGGVGIMMADSAESQGLPRPPMPDAAAAALREAVPFASTSNPIDVTGQVVAQPKVLADALAGVARSGAYGSVAAFLAGGGNAPRVWSLLEQTVDDLASDPQAAPLMIAGVISDEKRAWLEARGCLVFREPAHTIEAVAALAKAAAMTESAQSPVAPAQLLSVPELPADAKALSEADAMALLLQAGVPVAPHGLARDADEAVRVAESIGYPVVVKLCSPDILHKSDVGGVVLNLSDADAVRAAFERVRRAAGTARFDGALVARMVRGWGEIMVGVRRDPVFGLVALAGIGGTAVEIFRQMSFGLAPVSRERARAMLTQSRAAALCAGHRGHPPLDLDAVADVIVNVSRAADAIGDRLDTLEINPFIVSADGLVAADAVITLR
>NC_007974.2|WP_011518432.1|465792_466779_+|tripartite-tricarboxylate-transporter-substrate-binding-protein
MRSKLRRALLGMTLVLAGVCMTTGAVNAARVYPDRPIRLVVPFPAGGGTDVIGRMLAARLSNTLKTTVVVDNVVGATGTIGTAQVARAAPDGYTLVLGISATHAIAPSIFPKLPYDPLRDFVPIGRIAIGGNVLVANPSFPAHDLRALIAMAKQPNADLTYGSWGQGSGGHLAGESLNVSAGIHLRHIPYKGVAPMLTDVMGGTLPVAMSDLAGTLPLIRSGKVRALAVSGSERSVALPDVPTFAESGVRFRLDSWFALFAPSRTPAPIVEQLDRAMQEAMQDSGLQAQIASLGMRYAPVSRAQFTNQMREDTRTWAALVKSSGAALE
>NC_007974.2|WP_011518433.1|466806_468120_+|DUF1254-domain-containing-protein
MNHPASPMFPAPVHTSPQEAMVAAAALPLVIYGYPLIETLRTCRLQTSVDAPTRYGRAPMNMLSASARQWTHEDRDIVTPANDLLYFCGWLNLADGPATIRVPALPDADRYYVIELLDAHTNNFANLGPRNVPKEGADIEIVGPGQRGSGGQTVESPTSLVWIIGRVLVTGADDLARAYAFEQGFQMVKSAGPAQPPSVAQWQESDDEAVDFFQNLYRAMRDFPPTQQELGLFTLLRKVGLRLEDDPDIGSMRPSIVNGLRSAYAQAMALIEAHTRSQGHKAWGYSLRLGTYGDDWLLRACTAMKGLGALRADEAVYAMADFDADGERLHGNQAYELRFPPGMLPPADAFWSVSLYGEDRFFTANELGRYAVGDRTPGLRKEPDGTLVIPIGHARPAEDANWLPAPSSHFYLILRLYHPSEAFRAGQYTIPAVRRVG
>NC_007974.2|WP_011518434.1|468159_469476_+|DUF1254-domain-containing-protein
MTQQENTAQQRARDAVIHTLPLYEMARMRAATCPRRDHTGRFAGDGPESTLRWVNHVIRPRQLLGPQHRQVVTPNNDTLYTNAWIDLSRGPVVLEVPDFNGRYYVLGLLDFYTNPFGYIGSRTTGTSAGRFLLHGPDWLGTVPAGMRAVACPTNAVWMIGRLLVDGEADLPVVHALQDAIALRQLDGSLAAFAFDVAMQPEEHLGDARRFAEVVNRVVGENPPLGAEAAEIAAFAEVGIGHGIVPTPQQIDLLDAALRGVLADLAEPQPSDMGGGWAMSVDVRESFGSNYLQRALVARNYIGALGVQEAMYVMADRGGDGEPLDGRHAYRLDFAADNLPDVGAFWSLTMYDKGDCMLVPNDISRYSLGDRSPSLTRGADGSLSLYLSATPPRDEALRGNWLPAPPGPFYVALRLYVPQPSHLNRTYRYPAIQLLEVPA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_007974_1	1.1\|458479\|31\|NC_007974\|CRISPRCasFinder	458479-458509	31	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	458479-458509	0	1.0
NC_007974_1	1.1\|458479\|31\|NC_007974\|CRISPRCasFinder	458479-458509	31	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	588742-588772	0	1.0
NC_007974_1	1.1\|458479\|31\|NC_007974\|CRISPRCasFinder	458479-458509	31	NZ_CP029831	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed7, complete sequence	92699-92729	7	0.774
NC_007974_1	1.1\|458479\|31\|NC_007974\|CRISPRCasFinder	458479-458509	31	NZ_CP007517	Rubrobacter radiotolerans strain RSPS-4 plasmid 3, complete sequence	30464-30494	9	0.71

1. spacer 1.1|458479|31|NC_007974|CRISPRCasFinder matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 0, identity: 1.0

cggcgagtccgcggggacccgggtgccggca	CRISPR spacer
cggcgagtccgcggggacccgggtgccggca	Protospacer
*******************************

2. spacer 1.1|458479|31|NC_007974|CRISPRCasFinder matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 0, identity: 1.0

cggcgagtccgcggggacccgggtgccggca	CRISPR spacer
cggcgagtccgcggggacccgggtgccggca	Protospacer
*******************************

3. spacer 1.1|458479|31|NC_007974|CRISPRCasFinder matches to NZ_CP029831 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed7, complete sequence) position: , mismatch: 7, identity: 0.774

cggcgagtccgcggggacccgggtgccggca	CRISPR spacer
ggcccggtccgccgggaccggggtgccggcc	Protospacer
 * * .****** ****** **********

4. spacer 1.1|458479|31|NC_007974|CRISPRCasFinder matches to NZ_CP007517 (Rubrobacter radiotolerans strain RSPS-4 plasmid 3, complete sequence) position: , mismatch: 9, identity: 0.71

cggcgagtccgcggggacccgggtgccggca	CRISPR spacer
gctggtgttcgcgggcacccgggtgccggtg	Protospacer
    * **.****** *************..

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

2156821 : 2224536

Tetraselmis_virus(25.0%)

transposase,holin,integrase

attL 2183529:2183546|attR 2222346:2222363

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011519821.1\|2156821_2158426_+\|holin	choline dehydrogenase	A0A1V0S9J5	Catovirus	2.9e-52	31.7
WP_011519822.1\|2158499_2160488_+	MBL fold metallo-hydrolase	A0A2P0VMX1	Tetraselmis_virus	3.2e-149	42.6
WP_104669947.1\|2160950_2162675_+	arylsulfatase	A0A2P0VMN7	Tetraselmis_virus	6.2e-149	53.7
WP_011519824.1\|2162830_2163739_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_011519825.1\|2163892_2165197_+	MFS transporter	Q6JIH2	Burkholderia_virus	1.6e-72	41.4
WP_011519826.1\|2165249_2166431_+	amidohydrolase	NA	NA	NA	NA
WP_085960506.1\|2166420_2167296_-	zinc/iron-chelating domain-containing protein	NA	NA	NA	NA
WP_011519828.1\|2167289_2168105_-	metal ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_011519829.1\|2168097_2169156_-	formylglycine-generating enzyme family protein	NA	NA	NA	NA
WP_011519830.1\|2169175_2171158_-	arylsulfatase	NA	NA	NA	NA
WP_029306975.1\|2171533_2172445_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_011519833.1\|2172793_2173948_+	acyl-CoA dehydrogenase	NA	NA	NA	NA
WP_062794226.1\|2174440_2174707_+	hypothetical protein	NA	NA	NA	NA
WP_008641308.1\|2174810_2175065_+	hypothetical protein	NA	NA	NA	NA
WP_011519835.1\|2175134_2175509_-	hypothetical protein	NA	NA	NA	NA
WP_011519836.1\|2175610_2175898_-	hypothetical protein	NA	NA	NA	NA
WP_035820417.1\|2176222_2177122_+	lysophospholipid acyltransferase family protein	NA	NA	NA	NA
WP_029309719.1\|2177191_2178007_-	crotonase/enoyl-CoA hydratase family protein	NA	NA	NA	NA
WP_011519839.1\|2178172_2179351_-	acetyl-CoA C-acyltransferase	NA	NA	NA	NA
WP_008641302.1\|2179427_2180210_-	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_011519840.1\|2180292_2181264_-	nitronate monooxygenase	NA	NA	NA	NA
WP_011519841.1\|2181341_2182454_-	CoA transferase	NA	NA	NA	NA
WP_152560162.1\|2182600_2185216_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
2183529:2183546	attL	NA	NA	NA	NA
WP_011519843.1\|2185409_2186573_-	acyl-CoA dehydrogenase	NA	NA	NA	NA
WP_011519844.1\|2186770_2188318_+	long-chain-fatty-acid--CoA ligase	A0A2H4PQM9	Staphylococcus_phage	9.2e-35	25.3
WP_011519845.1\|2188366_2190004_-	long-chain-fatty-acid--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	2.0e-27	26.3
WP_011519846.1\|2190174_2190690_-	thioesterase	NA	NA	NA	NA
WP_029309720.1\|2190942_2191251_-	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
WP_011519848.1\|2191255_2191846_-	glycerol-3-phosphate responsive antiterminator	NA	NA	NA	NA
WP_011519849.1\|2191849_2193403_-	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_011519850.1\|2193399_2195079_-	glycerol-3-phosphate dehydrogenase/oxidase	NA	NA	NA	NA
WP_011519851.1\|2195101_2196622_-	glycerol kinase	NA	NA	NA	NA
WP_011519852.1\|2196626_2198081_-	MFS transporter	NA	NA	NA	NA
WP_011519853.1\|2198144_2198534_-	hypothetical protein	NA	NA	NA	NA
WP_011519854.1\|2198540_2198831_-	hypothetical protein	NA	NA	NA	NA
WP_011519855.1\|2199205_2199673_+	ester cyclase	NA	NA	NA	NA
WP_049799811.1\|2199958_2200213_+	hypothetical protein	NA	NA	NA	NA
WP_011519857.1\|2200209_2200857_+	prolyl 4-hydroxylase	NA	NA	NA	NA
WP_085960481.1\|2200894_2202081_-\|transposase	IS3-like element ISRme13 family transposase	A0A0P0I4A4	Acinetobacter_phage	3.2e-56	39.7
WP_035823017.1\|2202139_2202595_-	hypothetical protein	NA	NA	NA	NA
WP_085960507.1\|2202651_2203793_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	3.6e-89	60.6
WP_029309851.1\|2203817_2204621_-	ATP-binding protein	NA	NA	NA	NA
WP_011519860.1\|2204604_2206782_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_152560201.1\|2206781_2207684_-\|transposase	transposase	NA	NA	NA	NA
WP_049799813.1\|2208083_2208641_-	hypothetical protein	NA	NA	NA	NA
WP_152560200.1\|2208866_2209337_+	hypothetical protein	NA	NA	NA	NA
WP_152560199.1\|2209572_2209920_-	hypothetical protein	NA	NA	NA	NA
WP_011519869.1\|2210919_2211411_-	hypothetical protein	NA	NA	NA	NA
WP_152560198.1\|2211550_2211859_-	hypothetical protein	NA	NA	NA	NA
WP_152560197.1\|2211961_2213053_-	hypothetical protein	NA	NA	NA	NA
WP_157139117.1\|2213661_2214321_-	hypothetical protein	NA	NA	NA	NA
WP_011519875.1\|2215440_2216169_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_011519876.1\|2216281_2216845_-	hydrolyase	NA	NA	NA	NA
WP_011519877.1\|2216858_2217701_-	fumarate hydratase	NA	NA	NA	NA
WP_011519878.1\|2217706_2218876_-	mandelate racemase/muconate lactonizing enzyme family protein	NA	NA	NA	NA
WP_011519879.1\|2218886_2219870_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_008651547.1\|2221997_2222270_-	hypothetical protein	NA	NA	NA	NA
WP_008651548.1\|2222266_2223100_-	AAA family ATPase	NA	NA	NA	NA
2222346:2222363	attR	NA	NA	NA	NA
WP_008651549.1\|2223096_2224536_-\|transposase	IS481 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NC_007972

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

6170 : 64483

Salmonella_phage(22.22%)

transposase,integrase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_008649488.1\|6170_7367_-\|integrase	site-specific integrase	A0A160DFH7	Gordonia_phage	1.0e-04	27.2
WP_011239987.1\|7592_8423_+	hypothetical protein	NA	NA	NA	NA
WP_029306646.1\|8961_9165_-	hypothetical protein	NA	NA	NA	NA
WP_029306645.1\|9308_9872_+	hypothetical protein	NA	NA	NA	NA
WP_029306644.1\|9852_10077_+	hypothetical protein	NA	NA	NA	NA
WP_011514918.1\|10168_10978_+	TIGR02391 family protein	A0A1S5SBU1	Streptococcus_phage	1.5e-25	33.5
WP_011514919.1\|11026_12466_+	DUF4263 domain-containing protein	NA	NA	NA	NA
WP_152560224.1\|12530_16325_-	hypothetical protein	NA	NA	NA	NA
WP_011514921.1\|16530_17799_+	DUF5623 domain-containg protein	NA	NA	NA	NA
WP_011514922.1\|17873_18146_+	hypothetical protein	NA	NA	NA	NA
WP_029306746.1\|19278_19764_+	hypothetical protein	NA	NA	NA	NA
WP_150982636.1\|19885_20917_+	hypothetical protein	NA	NA	NA	NA
WP_011514926.1\|20974_21325_-	hypothetical protein	NA	NA	NA	NA
WP_124682078.1\|22385_22931_+\|transposase	transposase	NA	NA	NA	NA
WP_008651549.1\|23042_24482_+\|transposase	IS481 family transposase	O12274	Simian_T-lymphotropic_virus	4.1e-05	37.8
WP_008651548.1\|24478_25312_+	AAA family ATPase	NA	NA	NA	NA
WP_008651547.1\|25308_25581_+	hypothetical protein	NA	NA	NA	NA
WP_012435589.1\|28608_28965_-	cupin domain-containing protein	NA	NA	NA	NA
WP_011514928.1\|29098_29659_-	hypothetical protein	NA	NA	NA	NA
WP_011342942.1\|30065_30350_-	type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family	NA	NA	NA	NA
WP_011342941.1\|30346_30625_-	hypothetical protein	NA	NA	NA	NA
WP_003131969.1\|31225_31660_-	mercury resistance transcriptional regulator MerR	NA	NA	NA	NA
WP_006224622.1\|31731_32082_+	mercuric ion transporter MerT	NA	NA	NA	NA
WP_003131987.1\|32094_32370_+	mercury resistance system periplasmic binding protein MerP	NA	NA	NA	NA
WP_003158917.1\|32441_34127_+	mercury(II) reductase	A0A2K5B2C5	Erysipelothrix_phage	2.1e-40	29.3
WP_000995360.1\|34144_34510_+	mercury resistance co-regulator MerD	NA	NA	NA	NA
WP_003132004.1\|34506_34743_+	broad-spectrum mercury transporter MerE	NA	NA	NA	NA
WP_003132006.1\|34739_35729_+	DUF3330 domain-containing protein	NA	NA	NA	NA
WP_011239984.1\|35858_36419_+	recombinase family protein	A0A1B0V7I5	Salmonella_phage	1.5e-51	89.4
WP_011239983.1\|36421_39391_+\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	0.0e+00	72.9
WP_011514870.1\|39447_39882_+	hypothetical protein	NA	NA	NA	NA
WP_150982641.1\|40164_40980_+	hypothetical protein	A0A1V0SKX7	Klosneuvirus	2.6e-20	31.4
WP_011239982.1\|41063_41486_+	DNA-binding protein	NA	NA	NA	NA
WP_011514872.1\|41850_42804_+	DNA-binding protein	NA	NA	NA	NA
WP_011239980.1\|42800_44288_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_011514873.1\|44475_45522_-	YncE family protein	NA	NA	NA	NA
WP_011514874.1\|45538_46465_-	DUF1259 domain-containing protein	NA	NA	NA	NA
WP_011239977.1\|46522_47764_-	MFS transporter	NA	NA	NA	NA
WP_011514875.1\|47786_48095_-	hypothetical protein	NA	NA	NA	NA
WP_128646515.1\|48114_48435_-	hypothetical protein	NA	NA	NA	NA
WP_011239976.1\|48532_48955_-	chromate resistance protein	NA	NA	NA	NA
WP_011239975.1\|48951_49293_-	rhodanese family chromate resistance protein ChrE	NA	NA	NA	NA
WP_011239974.1\|49310_49904_-	superoxide dismutase [Fe]	NA	NA	NA	NA
WP_011514877.1\|49923_51129_-	chromate transporter	NA	NA	NA	NA
WP_011514878.1\|51171_52146_-	chromate resistance protein	NA	NA	NA	NA
WP_029310258.1\|52426_52795_+	regulatory protein ChrI	NA	NA	NA	NA
WP_128646513.1\|52903_53035_-	YHYH domain-containing protein	NA	NA	NA	NA
WP_011239971.1\|53309_53597_+	cobalt/nickel resistance anti-sigma factor CnrY	NA	NA	NA	NA
WP_011239970.1\|53593_54040_+	periplasmic nickel sensor CnrX	NA	NA	NA	NA
WP_011239969.1\|54036_54612_+	nickel resistance ECF sigma factor CnrH	NA	NA	NA	NA
WP_011239968.1\|54684_55941_+	nickel efflux RND transporter outer membrane subunit CnrC	NA	NA	NA	NA
WP_011239967.1\|55937_57125_+	nickel efflux RND transporter periplasmic adaptor subunit CnrB	NA	NA	NA	NA
WP_011239966.1\|57121_60352_+	nickel efflux RND transporter permease subunit CnrA	S5VTK5	Leptospira_phage	8.3e-54	21.6
WP_011239965.1\|60397_61453_+	nickel diffusion facilitator CnrT	NA	NA	NA	NA
WP_011239964.1\|61543_64483_-\|transposase	Tn3 family transposase	A0A125RQ78	Bacillus_phage	1.1e-33	20.7

DBSCAN-SWA_2

98747 : 138475

Acidithiobacillus_phage(25.0%)

transposase,integrase

attL 124238:124259|attR 137101:137122

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011239934.1\|98747_99893_+\|integrase	tyrosine-type recombinase/integrase	A8ATJ6	Listeria_phage	9.5e-05	27.1
WP_011514892.1\|99867_101526_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_029309944.1\|101522_103436_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_011514894.1\|103432_103933_+	hypothetical protein	NA	NA	NA	NA
WP_029309942.1\|104234_105677_-	hypothetical protein	NA	NA	NA	NA
WP_011514896.1\|105676_110101_-	ATP-binding protein	NA	NA	NA	NA
WP_011514897.1\|110769_112299_+	RHS repeat protein	NA	NA	NA	NA
WP_011239931.1\|112303_113059_-	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	4.0e-84	62.7
WP_011239930.1\|113066_114620_-\|transposase	IS21-like element ISRme9 family transposase	K4I413	Acidithiobacillus_phage	8.3e-161	54.6
WP_124682111.1\|114632_114854_+	hypothetical protein	NA	NA	NA	NA
WP_080709891.1\|114869_116249_+	RHS repeat protein	NA	NA	NA	NA
WP_011514931.1\|116258_116474_+	hypothetical protein	NA	NA	NA	NA
WP_029309940.1\|116587_117253_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_011514900.1\|117593_120413_+	RHS repeat protein	NA	NA	NA	NA
WP_011514935.1\|120425_120641_+	hypothetical protein	NA	NA	NA	NA
WP_029309938.1\|121116_122067_+	phage Gp37/Gp68 family protein	Q8W6R4	Burkholderia_virus	2.0e-88	54.9
WP_011514902.1\|122351_122597_+	hypothetical protein	NA	NA	NA	NA
WP_008648655.1\|122691_123282_+	hypothetical protein	NA	NA	NA	NA
WP_011239925.1\|123335_124226_+	DNA/RNA non-specific endonuclease	H6X497	Enterobacteria_phage	6.9e-19	35.6
124238:124259	attL	NA	NA	NA	NA
WP_029306690.1\|124316_125234_-	hypothetical protein	NA	NA	NA	NA
WP_011514905.1\|126003_126750_+	hypothetical protein	NA	NA	NA	NA
WP_011239922.1\|127142_128279_-	hypothetical protein	NA	NA	NA	NA
WP_011239921.1\|128892_130047_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_011239920.1\|131175_132201_+	PRTRC system protein D	NA	NA	NA	NA
WP_008649401.1\|132899_133112_-	hypothetical protein	NA	NA	NA	NA
WP_011514906.1\|133208_134276_-	zinc-binding protein	A0A0H5AWB1	Pseudomonas_phage	2.8e-19	28.9
WP_011239918.1\|134541_135114_-	single-stranded DNA-binding protein	C5IHK5	Burkholderia_virus	2.4e-49	70.6
WP_035821539.1\|135125_135824_-	hypothetical protein	NA	NA	NA	NA
WP_008649407.1\|135915_136347_-	hypothetical protein	NA	NA	NA	NA
WP_011514908.1\|136445_136754_-	hypothetical protein	NA	NA	NA	NA
WP_011239917.1\|137455_138475_-\|transposase	IS30-like element IS1086 family transposase	W5R8L2	Staphylococcus_phage	4.9e-45	36.4
137101:137122	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NC_007973

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

303017 : 344119

Tupanvirus(14.29%)

transposase,integrase,protease,tRNA

attL 312076:312093|attR 345889:345906

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011515176.1\|303017_303614_-\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA
WP_011515177.1\|303788_304400_-	50S ribosomal protein L25/general stress protein Ctc	NA	NA	NA	NA
WP_008650936.1\|304570_305524_-	ribose-phosphate pyrophosphokinase	A0A2K9L2G2	Tupanvirus	2.4e-41	33.8
WP_011515178.1\|305763_306642_-	4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase	NA	NA	NA	NA
WP_011515179.1\|306638_307253_-	lipoprotein localization protein LolB	NA	NA	NA	NA
WP_011515180.1\|307338_309246_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_011515181.1\|309516_310410_+	bifunctional DNA-formamidopyrimidine glycosylase/DNA-(apurinic or apyrimidinic site) lyase	NA	NA	NA	NA
WP_029306757.1\|310742_312686_+	GTPase	NA	NA	NA	NA
312076:312093	attL	NA	NA	NA	NA
WP_029306756.1\|312816_313968_+	A/G-specific adenine glycosylase	NA	NA	NA	NA
WP_011515184.1\|313989_314643_-\|protease	ATP-dependent protease	NA	NA	NA	NA
WP_011515185.1\|314689_315580_-	RNase adapter RapZ	A0A1P8D5W0	Corynebacterium_phage	1.1e-08	37.4
WP_017511023.1\|315694_316036_-	hypothetical protein	NA	NA	NA	NA
WP_008650955.1\|316241_317213_-	HPr kinase/phosphorylase	NA	NA	NA	NA
WP_017511024.1\|317281_317737_-	PTS IIA-like nitrogen regulatory protein PtsN	NA	NA	NA	NA
WP_008650960.1\|318213_318567_-	ribosome-associated translation inhibitor RaiA	NA	NA	NA	NA
WP_011515189.1\|318617_320096_-	RNA polymerase factor sigma-54	NA	NA	NA	NA
WP_011515190.1\|320219_321011_-	LPS export ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.5e-20	28.0
WP_011515191.1\|321036_321681_-	lipopolysaccharide transport periplasmic protein LptA	NA	NA	NA	NA
WP_011515192.1\|321743_322370_-	LPS export ABC transporter periplasmic protein LptC	NA	NA	NA	NA
WP_011515193.1\|322373_323357_-	KpsF/GutQ family sugar-phosphate isomerase	A0A2P0VNK5	Tetraselmis_virus	2.0e-35	33.7
WP_029306755.1\|323507_325487_+	potassium transporter	NA	NA	NA	NA
WP_011515195.1\|325476_325905_-	ribbon-helix-helix domain-containing protein	NA	NA	NA	NA
WP_011515196.1\|325963_326593_-	DJ-1/PfpI family protein	NA	NA	NA	NA
WP_011515197.1\|326668_327241_+	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	1.6e-29	44.5
WP_011515198.1\|327520_329197_+	Na/Pi cotransporter family protein	NA	NA	NA	NA
WP_011515199.1\|329250_332118_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	6.2e-303	54.8
WP_011515200.1\|332392_333649_+	MFS transporter	NA	NA	NA	NA
WP_011515201.1\|333924_334470_+	single-stranded DNA-binding protein	C5IHK5	Burkholderia_virus	2.3e-49	85.3
WP_011515202.1\|334702_335569_+	hypothetical protein	NA	NA	NA	NA
WP_011515203.1\|335756_336953_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_029310226.1\|336949_337462_+	hypothetical protein	NA	NA	NA	NA
WP_008651547.1\|337640_337913_-	hypothetical protein	NA	NA	NA	NA
WP_008651548.1\|337909_338743_-	AAA family ATPase	NA	NA	NA	NA
WP_008651549.1\|338739_340179_-\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_124682078.1\|340290_340836_-\|transposase	transposase	NA	NA	NA	NA
WP_049799649.1\|340995_342111_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_152560155.1\|342421_344119_+\|integrase	integrase	NA	NA	NA	NA
345889:345906	attR	NA	NA	NA	NA

DBSCAN-SWA_2

803083 : 811926

Bacillus_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011515573.1\|803083_804457_+	UDP-glucose/GDP-mannose dehydrogenase family protein	A0A127AXI2	Bacillus_phage	3.5e-70	35.4
WP_011515574.1\|804536_805481_+	D-glycero-beta-D-manno-heptose-7-phosphate kinase	A0A2H4N7X4	Lake_Baikal_phage	3.8e-15	27.5
WP_011515575.1\|805507_806503_+	ADP-glyceromanno-heptose 6-epimerase	R9S880	Prochlorococcus_phage	3.1e-28	33.4
WP_011515576.1\|806712_807093_+	helix-hairpin-helix domain-containing protein	NA	NA	NA	NA
WP_011515577.1\|807190_808639_+	nitrate reductase	Q9KX94	Enterobacteria_phage	1.3e-144	64.4
WP_029309853.1\|808749_809652_+	cysteine synthase CysM	C3U2M1	Lactococcus_phage	8.2e-52	41.2
WP_029308328.1\|809731_810838_-	lytic murein transglycosylase B	NA	NA	NA	NA
WP_008643671.1\|811002_811926_+	histone deacetylase family protein	A0A2K9KZC4	Tupanvirus	1.6e-39	33.3

DBSCAN-SWA_3

1334904 : 1426241

Bacillus_phage(11.11%)

transposase,integrase,tRNA

attL 1341162:1341178|attR 1416185:1416200

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011515992.1\|1334904_1335654_-\|tRNA	leucyl/phenylalanyl-tRNA--protein transferase	NA	NA	NA	NA
WP_008652183.1\|1335713_1336298_-	NUDIX hydrolase	NA	NA	NA	NA
WP_011515993.1\|1336647_1337310_-	RES family NAD+ phosphorylase	NA	NA	NA	NA
WP_011515994.1\|1337371_1337761_-	DUF2384 domain-containing protein	NA	NA	NA	NA
WP_011515995.1\|1337866_1339114_-	benzoyl-CoA 2,3-epoxidase subunit BoxA	NA	NA	NA	NA
WP_011515996.1\|1339140_1340565_-	benzoyl-CoA 2,3-epoxidase subunit BoxB	NA	NA	NA	NA
WP_011515997.1\|1340606_1342283_-	benzoyl-CoA-dihydrodiol lyase	NA	NA	NA	NA
1341162:1341178	attL	NA	NA	NA	NA
WP_011515998.1\|1342403_1343354_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
1341162:1341178	attL	NA	NA	NA	NA
WP_011515999.1\|1343602_1345252_+	benzoate-CoA ligase family protein	A0A2K9KZV5	Tupanvirus	1.1e-12	21.6
WP_011516000.1\|1345253_1346069_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_011516001.1\|1346154_1347348_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_008652164.1\|1347373_1348240_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_011516002.1\|1348255_1349320_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_011516003.1\|1349316_1350084_+	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	2.8e-16	29.3
WP_008646845.1\|1350080_1350797_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	5.6e-11	27.0
WP_008646843.1\|1351168_1353067_+	potassium transporter Kup	M1IBC2	Acanthocystis_turfacea_Chlorella_virus	6.5e-59	29.8
WP_011516006.1\|1353159_1355523_-	RNA-binding transcriptional accessory protein	NA	NA	NA	NA
WP_011516007.1\|1355700_1356477_+	hypothetical protein	NA	NA	NA	NA
WP_008646837.1\|1356534_1356738_+	DUF465 domain-containing protein	NA	NA	NA	NA
WP_035822143.1\|1356817_1359010_+	ATP-dependent DNA helicase	A0A127AW80	Bacillus_phage	3.0e-84	31.4
WP_011516010.1\|1359444_1360644_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_011516011.1\|1360640_1361717_+	DUF1016 domain-containing protein	A0A0U2BZN7	Salmonella_phage	1.8e-21	39.7
WP_011516012.1\|1362582_1363842_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_011516013.1\|1363838_1364831_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_011516014.1\|1364827_1365838_+\|integrase	tyrosine-type recombinase/integrase	A0A0K2CP59	Brevibacillus_phage	2.9e-21	28.3
WP_011516015.1\|1366464_1366857_+	hypothetical protein	NA	NA	NA	NA
WP_041240053.1\|1367565_1368390_+	DUF945 domain-containing protein	K4F5L3	Cronobacter_phage	1.8e-42	40.9
WP_011516017.1\|1368468_1370520_+	ParB N-terminal domain-containing protein	NA	NA	NA	NA
WP_011516018.1\|1370727_1371246_-	N-acetyltransferase	NA	NA	NA	NA
WP_041240055.1\|1372073_1372388_+	DUF736 domain-containing protein	NA	NA	NA	NA
WP_011516021.1\|1372452_1372758_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_021161698.1\|1373001_1373352_+	DUF2958 domain-containing protein	NA	NA	NA	NA
WP_011516023.1\|1373578_1374580_-\|transposase	IS481-like element ISRme14 family transposase	NA	NA	NA	NA
WP_021161697.1\|1374706_1375468_+	DUF2285 domain-containing protein	NA	NA	NA	NA
WP_003107109.1\|1375551_1375833_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_011516026.1\|1375859_1376717_+	replication initiator protein A	NA	NA	NA	NA
WP_011516027.1\|1376970_1377609_+	AAA family ATPase	B0ZSI1	Halomonas_phage	3.3e-31	40.1
WP_011516028.1\|1377605_1377878_+	hypothetical protein	NA	NA	NA	NA
WP_011516029.1\|1377874_1378408_+	DUF2840 domain-containing protein	NA	NA	NA	NA
WP_011516030.1\|1378404_1378992_+	peptidase	NA	NA	NA	NA
WP_041240063.1\|1379428_1381414_+	relaxase/mobilization nuclease and DUF3363 domain-containing protein	NA	NA	NA	NA
WP_029310270.1\|1381451_1381925_-	cytochrome c	NA	NA	NA	NA
WP_011516033.1\|1381973_1383101_-	lipid A deacylase LpxR family protein	NA	NA	NA	NA
WP_011515352.1\|1383233_1384484_-\|transposase	IS256-like element IS1090 family transposase	A0A218MNI5	uncultured_virus	4.0e-41	42.8
WP_011516034.1\|1384633_1385440_-	AAA family ATPase	A0A2L1IVB6	Escherichia_phage	4.6e-78	57.5
WP_011516035.1\|1385439_1386450_-\|transposase	IS21-like element ISRme20 family transposase	A0A2L1IVA1	Escherichia_phage	8.2e-85	49.4
WP_011516036.1\|1386617_1387484_-	TIGR00730 family Rossman fold protein	A0A1D8KU27	Synechococcus_phage	2.3e-11	32.4
WP_011516037.1\|1387483_1388893_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_010792188.1\|1388900_1389104_-	DUF2892 domain-containing protein	NA	NA	NA	NA
WP_011516038.1\|1389123_1390662_-	efflux transporter outer membrane subunit	NA	NA	NA	NA
1389872:1389888	attR	NA	NA	NA	NA
WP_011516039.1\|1390658_1391777_-	ABC transporter permease	NA	NA	NA	NA
1389872:1389888	attR	NA	NA	NA	NA
WP_011516040.1\|1391781_1392951_-	ABC transporter permease	NA	NA	NA	NA
WP_011516041.1\|1393468_1394701_+\|integrase	tyrosine-type recombinase/integrase	A0A142F1N9	Bacillus_phage	4.3e-11	27.5
WP_011516042.1\|1394697_1395645_+\|integrase	tyrosine-type recombinase/integrase	U3PCM7	Lactobacillus_phage	3.5e-05	27.5
WP_011516043.1\|1395641_1396637_+\|integrase	tyrosine-type recombinase/integrase	A0A2D2W391	Mycobacterium_phage	4.0e-07	25.5
WP_049799681.1\|1396400_1398221_-\|transposase	IS66 family transposase	S5VLC8	Leptospira_phage	8.0e-46	35.1
WP_080710364.1\|1398243_1398606_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_029309997.1\|1398602_1398920_-	hypothetical protein	NA	NA	NA	NA
WP_152560238.1\|1399237_1399627_+	hypothetical protein	NA	NA	NA	NA
WP_011516048.1\|1401176_1402289_-	hydrogenase expression/formation protein HypE	NA	NA	NA	NA
WP_011516049.1\|1402285_1403449_-	hydrogenase formation protein HypD	NA	NA	NA	NA
WP_011516050.1\|1403457_1403685_-	HypC/HybG/HupF family hydrogenase formation chaperone	NA	NA	NA	NA
WP_011516051.1\|1403675_1404815_-	carbamoyltransferase HypF	NA	NA	NA	NA
WP_011516052.1\|1404828_1405866_-	hydrogenase nickel incorporation protein HypB	NA	NA	NA	NA
WP_011516053.1\|1405889_1406237_-	hydrogenase maturation nickel metallochaperone HypA	NA	NA	NA	NA
WP_152560294.1\|1406229_1407441_-	hydrogenase formation protein	NA	NA	NA	NA
WP_029310280.1\|1407412_1407898_-	[NiFe]-hydrogenase assembly chaperone HybE	NA	NA	NA	NA
WP_011516056.1\|1407890_1408121_-	rubredoxin	NA	NA	NA	NA
WP_011516057.1\|1408126_1408990_-	hydrogenase expression/formation protein	NA	NA	NA	NA
WP_011516058.1\|1409021_1409471_-	hydrogenase	NA	NA	NA	NA
WP_011516059.1\|1409486_1409789_-	HypC/HybG/HupF family hydrogenase formation chaperone	NA	NA	NA	NA
WP_011516060.1\|1409790_1410456_-	HyaD/HybD family hydrogenase maturation endopeptidase	NA	NA	NA	NA
WP_080710402.1\|1410477_1410825_-	HigA family addiction module antidote protein	M9MUN2	Rhodococcus_phage	6.9e-07	42.0
WP_011516062.1\|1410944_1411676_-	Ni/Fe-hydrogenase, b-type cytochrome subunit	NA	NA	NA	NA
WP_049799686.1\|1411713_1412316_-	HupE/UreJ family protein	NA	NA	NA	NA
WP_011516064.1\|1412447_1414307_-	nickel-dependent hydrogenase large subunit	NA	NA	NA	NA
WP_011516065.1\|1414327_1415422_-	hydrogenase small subunit	NA	NA	NA	NA
WP_029310277.1\|1415596_1415956_+	hypothetical protein	NA	NA	NA	NA
WP_011516068.1\|1416783_1417749_+\|transposase	IS481-like element ISRme14 family transposase	NA	NA	NA	NA
WP_080710382.1\|1418612_1419044_+\|transposase	transposase	NA	NA	NA	NA
WP_011516070.1\|1419137_1420982_-	sigma-54-dependent Fis family transcriptional regulator	NA	NA	NA	NA
WP_011516071.1\|1421154_1421985_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_049799775.1\|1422720_1424049_-	aromatic hydrocarbon degradation protein	NA	NA	NA	NA
WP_011516074.1\|1424193_1425255_-	alcohol dehydrogenase catalytic domain-containing protein	NA	NA	NA	NA
WP_085960479.1\|1425424_1426241_+\|transposase	IS5-like element ISRme6 family transposase	NA	NA	NA	NA

DBSCAN-SWA_4

1611194 : 1668018

uncultured_virus(33.33%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003049965.1\|1611194_1614110_+\|transposase	Tn3-like element IS1071 family transposase	NA	NA	NA	NA
WP_011516241.1\|1614222_1615083_-	class II fructose-bisphosphate aldolase family protein	NA	NA	NA	NA
WP_011516242.1\|1615993_1616368_-	hypothetical protein	NA	NA	NA	NA
WP_011516243.1\|1616383_1616680_-	hypothetical protein	NA	NA	NA	NA
WP_011516244.1\|1616688_1619046_-	nitric oxide reductase activation protein NorD	NA	NA	NA	NA
WP_011516245.1\|1619058_1619862_-	CbbQ/NirQ/NorQ/GpvN family protein	NA	NA	NA	NA
WP_011516246.1\|1620011_1620368_-	ribulose bisphosphate carboxylase small subunit	NA	NA	NA	NA
WP_011516247.1\|1620445_1621867_-	form I ribulose bisphosphate carboxylase large subunit	NA	NA	NA	NA
WP_011516248.1\|1621991_1622873_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_011515352.1\|1623051_1624302_+\|transposase	IS256-like element IS1090 family transposase	A0A218MNI5	uncultured_virus	4.0e-41	42.8
WP_003049965.1\|1625590_1628506_-\|transposase	Tn3-like element IS1071 family transposase	NA	NA	NA	NA
WP_011516252.1\|1629951_1630875_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_155877857.1\|1630980_1631145_+	hypothetical protein	NA	NA	NA	NA
WP_011516253.1\|1631162_1631861_+	ribulose-phosphate 3-epimerase	NA	NA	NA	NA
WP_155877856.1\|1631870_1632014_+	hypothetical protein	NA	NA	NA	NA
WP_011516254.1\|1632040_1633138_+	class 1 fructose-bisphosphatase	A0A1V0SKX4	Klosneuvirus	6.7e-48	34.5
WP_011516255.1\|1633170_1634055_+	phosphoribulokinase	NA	NA	NA	NA
WP_011516256.1\|1634054_1636109_+	transketolase	NA	NA	NA	NA
WP_011516257.1\|1636110_1636842_+	HAD-IA family hydrolase	NA	NA	NA	NA
WP_011516258.1\|1636838_1637846_+	type I glyceraldehyde-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_011516259.1\|1637842_1639033_+	phosphoglycerate kinase	NA	NA	NA	NA
WP_011516260.1\|1639029_1639848_+	HAD-IA family hydrolase	NA	NA	NA	NA
WP_011516261.1\|1639907_1640945_+	fructose-bisphosphate aldolase class II	NA	NA	NA	NA
WP_011516262.1\|1640959_1642378_+	pyruvate kinase	NA	NA	NA	NA
WP_011516263.1\|1642413_1643232_+	triose-phosphate isomerase	NA	NA	NA	NA
WP_011516264.1\|1643231_1643891_+	ribose-5-phosphate isomerase RpiA	NA	NA	NA	NA
WP_011516265.1\|1644016_1645825_+	NADP oxidoreductase	NA	NA	NA	NA
WP_011516266.1\|1645821_1646532_+	2Fe-2S iron-sulfur cluster binding domain-containing protein	NA	NA	NA	NA
WP_041240501.1\|1646582_1647158_+	NADP oxidoreductase	NA	NA	NA	NA
WP_011516268.1\|1647175_1648642_+	Ni/Fe hydrogenase subunit alpha	NA	NA	NA	NA
WP_110070725.1\|1648652_1649132_+\|protease	hydrogenase maturation protease	NA	NA	NA	NA
WP_011516270.1\|1649144_1649648_+	cyclic nucleotide-binding domain-containing protein	NA	NA	NA	NA
WP_082219896.1\|1649657_1649789_+	hypothetical protein	NA	NA	NA	NA
WP_011516271.1\|1650746_1651775_-\|transposase	IS30-like element IS1088 family transposase	W5R8L2	Staphylococcus_phage	3.0e-42	35.6
WP_041240119.1\|1652236_1652542_+	NAD(P) transhydrogenase subunit alpha	NA	NA	NA	NA
WP_011516272.1\|1652538_1653912_+	NAD(P)(+) transhydrogenase (Re/Si-specific) subunit beta	NA	NA	NA	NA
WP_011516273.1\|1653973_1654810_+	nickel transporter	NA	NA	NA	NA
WP_041240122.1\|1654909_1655209_+	hypothetical protein	NA	NA	NA	NA
WP_146209070.1\|1655199_1655568_+	hypothetical protein	NA	NA	NA	NA
WP_011516275.1\|1655560_1655902_+	hydrogenase maturation nickel metallochaperone HypA	NA	NA	NA	NA
WP_011516276.1\|1655935_1656916_+	hydrogenase nickel incorporation protein HypB	NA	NA	NA	NA
WP_011516277.1\|1656929_1659287_+	carbamoyltransferase HypF	NA	NA	NA	NA
WP_041240127.1\|1659291_1659528_+	HypC/HybG/HupF family hydrogenase formation chaperone	NA	NA	NA	NA
WP_011516279.1\|1659524_1660667_+	hydrogenase formation protein HypD	NA	NA	NA	NA
WP_011516280.1\|1660740_1661790_+	hydrogenase expression/formation protein HypE	NA	NA	NA	NA
WP_011516281.1\|1661888_1663628_+	hydrogenase maturation protein	NA	NA	NA	NA
WP_011516282.1\|1663624_1664554_+	response regulator	NA	NA	NA	NA
WP_157139102.1\|1664543_1664885_-	Dabb family protein	NA	NA	NA	NA
WP_003049965.1\|1665102_1668018_+\|transposase	Tn3-like element IS1071 family transposase	NA	NA	NA	NA

DBSCAN-SWA_5

2162058 : 2175276

Pseudomonas_phage(50.0%)

transposase,integrase,tRNA

attL 2168337:2168396|attR 2178054:2181521

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011516711.1\|2162058_2163114_-\|tRNA	tRNA dihydrouridine(20/20a) synthase DusA	NA	NA	NA	NA
WP_029307598.1\|2163680_2164088_+	hypothetical protein	NA	NA	NA	NA
WP_085959070.1\|2164458_2165656_+\|transposase	IS3-like element IS1087B family transposase	A0A1B0Z042	Pseudomonas_phage	6.5e-97	61.9
WP_152560283.1\|2165672_2165960_+	hypothetical protein	NA	NA	NA	NA
WP_011516719.1\|2166476_2166923_+	phosphate-starvation-inducible PsiE family protein	NA	NA	NA	NA
WP_029310228.1\|2167505_2168345_+\|integrase	integrase arm-type DNA-binding domain-containing protein	NA	NA	NA	NA
2168337:2168396	attL	NA	NA	NA	NA
WP_008651547.1\|2168523_2168796_-	hypothetical protein	NA	NA	NA	NA
WP_008651548.1\|2168792_2169626_-	AAA family ATPase	NA	NA	NA	NA
WP_008651549.1\|2169622_2171062_-\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_124682078.1\|2171173_2171719_-\|transposase	transposase	NA	NA	NA	NA
WP_157139104.1\|2171805_2172324_+\|integrase	tyrosine-type recombinase/integrase	K7PHM9	Enterobacterial_phage	2.9e-17	37.3
WP_011516721.1\|2172320_2172926_+	hypothetical protein	NA	NA	NA	NA
WP_029310384.1\|2173105_2173426_+	hypothetical protein	NA	NA	NA	NA
WP_011516723.1\|2173433_2173736_+	hypothetical protein	NA	NA	NA	NA
WP_011516724.1\|2173738_2174605_+	hypothetical protein	NA	NA	NA	NA
WP_124682078.1\|2174730_2175276_+\|transposase	transposase	NA	NA	NA	NA
2178054:2181521	attR	NA	NA	NA	NA

DBSCAN-SWA_6

3085379 : 3149401

Staphylococcus_phage(11.76%)

tRNA,integrase,protease,transposase

attL 3074074:3074089|attR 3116369:3116384

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3074074:3074089	attL	NA	NA	NA	NA
WP_008651549.1\|3085379_3086819_-\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_124682078.1\|3086930_3087476_-\|transposase	transposase	NA	NA	NA	NA
WP_029310335.1\|3087566_3088193_-	relaxase/mobilization nuclease domain-containing protein	NA	NA	NA	NA
WP_011517401.1\|3088189_3088540_-	hypothetical protein	NA	NA	NA	NA
WP_011239917.1\|3089496_3090516_-\|transposase	IS30-like element IS1086 family transposase	W5R8L2	Staphylococcus_phage	4.9e-45	36.4
WP_011517403.1\|3090664_3091069_+	hypothetical protein	NA	NA	NA	NA
WP_011517406.1\|3095087_3095672_-	exonuclease domain-containing protein	A0A1V0SGV7	Hokovirus	2.8e-05	26.0
WP_157139111.1\|3095668_3096700_-\|integrase	tyrosine-type recombinase/integrase	W6MYA3	Pseudomonas_phage	1.8e-42	37.8
WP_011517408.1\|3097334_3098084_+	M48 family metallopeptidase	NA	NA	NA	NA
WP_008644124.1\|3098203_3099019_-	N-formylglutamate deformylase	NA	NA	NA	NA
WP_011517409.1\|3099068_3100478_-	formimidoylglutamate deiminase	NA	NA	NA	NA
WP_011517410.1\|3100474_3101722_-	imidazolonepropionase	NA	NA	NA	NA
WP_011517411.1\|3101718_3102294_-	HutD family protein	NA	NA	NA	NA
WP_011517412.1\|3102290_3103997_-	urocanate hydratase	NA	NA	NA	NA
WP_011517413.1\|3104065_3105634_-	histidine ammonia-lyase	A0A1V0S940	Catovirus	3.0e-65	35.0
WP_011517414.1\|3105743_3106511_-	histidine utilization repressor	NA	NA	NA	NA
WP_008644773.1\|3106515_3107295_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	9.3e-36	39.8
WP_011517415.1\|3107291_3108167_-	ABC transporter permease	G3M9Y4	Bacillus_virus	6.8e-27	30.0
WP_011517416.1\|3108183_3109137_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_029310124.1\|3109466_3110492_-	sugar nucleotide-binding protein	NA	NA	NA	NA
WP_011517418.1\|3110502_3111558_+	CDP-6-deoxy-delta-3,4-glucoseen reductase	A0A1D8KP97	Synechococcus_phage	5.0e-08	37.8
WP_008644896.1\|3111835_3113023_+	acetylornithine transaminase	A0A1V0SKB7	Klosneuvirus	3.7e-28	26.8
WP_011517419.1\|3113135_3113852_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.9e-15	28.8
WP_011517420.1\|3113868_3114645_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.9e-17	25.6
WP_008644903.1\|3114658_3115813_-	ABC transporter ATP-binding protein	NA	NA	NA	NA
WP_008644904.1\|3115826_3116762_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
3116369:3116384	attR	NA	NA	NA	NA
WP_011517421.1\|3116979_3118185_-	branched-chain amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_011517422.1\|3118859_3119852_-	4-hydroxy-3-methylbut-2-enyl diphosphate reductase	NA	NA	NA	NA
WP_008644907.1\|3119851_3120343_-	peptidylprolyl isomerase	NA	NA	NA	NA
WP_008644908.1\|3120725_3120959_+	50S ribosomal protein L28	NA	NA	NA	NA
WP_008644909.1\|3120972_3121143_+	50S ribosomal protein L33	NA	NA	NA	NA
WP_011517424.1\|3121324_3122932_+	L-aspartate oxidase	NA	NA	NA	NA
WP_011517425.1\|3122959_3123823_-	carboxylating nicotinate-nucleotide diphosphorylase	NA	NA	NA	NA
WP_011517426.1\|3123819_3124974_-	quinolinate synthase NadA	NA	NA	NA	NA
WP_029310125.1\|3125115_3126306_-	aminotransferase	NA	NA	NA	NA
WP_011517428.1\|3126601_3127972_-	mechanosensitive ion channel	NA	NA	NA	NA
WP_011517429.1\|3127971_3129372_-	RsmB/NOP family class I SAM-dependent RNA methyltransferase	NA	NA	NA	NA
WP_011517430.1\|3129368_3130031_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	4.1e-24	34.6
WP_011517431.1\|3130317_3131526_+\|transposase	IS4-like element ISBvi1 family transposase	NA	NA	NA	NA
WP_011517433.1\|3131732_3132392_+	response regulator transcription factor	NA	NA	NA	NA
WP_085960482.1\|3132457_3134248_-	hybrid sensor histidine kinase/response regulator	B5LWN8	Feldmannia_species_virus	6.7e-05	37.7
WP_011517436.1\|3135680_3137381_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	1.0e-220	66.3
WP_017511836.1\|3137504_3138488_+	bifunctional riboflavin kinase/FAD synthetase	NA	NA	NA	NA
WP_011517438.1\|3138607_3141487_+\|tRNA	isoleucine--tRNA ligase	K7YVP8	Megavirus	6.6e-79	26.5
WP_011517439.1\|3141486_3142023_+	lipoprotein signal peptidase	NA	NA	NA	NA
WP_011517440.1\|3142144_3143344_+	bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC	Q9HH70	Methanothermobacter_phage	5.2e-38	30.9
WP_011517441.1\|3143362_3144382_+	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_011517442.1\|3144486_3144981_+	dUTP diphosphatase	A0A289ZTC1	Serratia_phage	6.7e-40	53.2
WP_011517443.1\|3145032_3145878_-	VOC family protein	NA	NA	NA	NA
WP_035821925.1\|3145892_3146879_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_008644941.1\|3147103_3149401_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	3.4e-171	43.2

DBSCAN-SWA_7

3168129 : 3178527

Roseobacter_phage(14.29%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011517460.1\|3168129_3169719_+	polynucleotide adenylyltransferase PcnB	A0A1B0V011	Roseobacter_phage	4.5e-21	31.2
WP_011517461.1\|3169720_3170242_+	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
WP_011517462.1\|3170265_3170907_+	deoxynucleoside kinase	A0A1J0F9Q3	Only_Syngen_Nebraska_virus	6.3e-06	27.0
WP_011517463.1\|3171043_3171865_+	3-methyl-2-oxobutanoate hydroxymethyltransferase	A0A0P0BXC9	Ostreococcus_lucimarinus_virus	1.5e-36	33.3
WP_011517464.1\|3171872_3172571_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_011517465.1\|3172567_3173257_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.9e-16	32.5
WP_049799786.1\|3173287_3175183_-	aminodeoxychorismate synthase component I	S4VT78	Pandoravirus	1.1e-50	34.9
WP_008641963.1\|3175266_3176406_-	molecular chaperone DnaJ	A0A0P0YMJ9	Yellowstone_lake_phycodnavirus	1.2e-23	35.5
WP_011517467.1\|3176580_3178527_-	molecular chaperone DnaK	A0A1V0SH73	Hokovirus	1.4e-144	49.5

DBSCAN-SWA_8

3707689 : 3713754

uncultured_Caudovirales_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_008646124.1\|3707689_3708277_-	phosphoheptose isomerase	A0A067XQR2	Caulobacter_phage	2.0e-14	34.0
WP_011517863.1\|3708307_3708712_-	YraN family protein	NA	NA	NA	NA
WP_011517864.1\|3708764_3709664_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	4.8e-36	40.6
WP_029306876.1\|3709748_3710402_-	septal ring lytic transglycosylase RlpA family protein	F5B3X9	Synechococcus_phage	1.9e-18	53.9
WP_017510795.1\|3710800_3711451_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_011517867.1\|3711454_3712102_+	exonuclease	A0A2L0UZL4	Agrobacterium_phage	7.7e-36	40.5
WP_008646132.1\|3712309_3712540_+	hypothetical protein	NA	NA	NA	NA
WP_011517868.1\|3712631_3712991_-	arsenate reductase (glutaredoxin)	A0A2H4J8T1	uncultured_Caudovirales_phage	8.1e-19	44.4
WP_029306874.1\|3713193_3713754_+	N-acetyltransferase	A0A2H4J136	uncultured_Caudovirales_phage	1.2e-21	39.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NC_007971

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

50916 : 121533

Bacillus_phage(15.38%)

integrase,transposase

attL 56002:56061|attR 123097:123805

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011229325.1\|50916_52092_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_011514811.1\|52229_54167_-	J domain-containing protein	E3T4P7	Cafeteria_roenbergensis_virus	6.1e-12	27.0
WP_035884213.1\|54328_54541_-	hypothetical protein	NA	NA	NA	NA
WP_011229327.1\|54663_55194_+	hypothetical protein	NA	NA	NA	NA
56002:56061	attL	NA	NA	NA	NA
WP_011229329.1\|56710_57547_+	hypothetical protein	NA	NA	NA	NA
WP_041240742.1\|57534_57810_-	hypothetical protein	NA	NA	NA	NA
WP_011514812.1\|57921_58980_-	porin	NA	NA	NA	NA
WP_011514813.1\|59114_60359_-	MBL fold metallo-hydrolase	S4VRL9	Pandoravirus	1.3e-15	28.9
WP_011229331.1\|60630_61962_-	amidohydrolase family protein	NA	NA	NA	NA
WP_011514814.1\|61983_62766_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_011514815.1\|62765_63644_-	fumarylacetoacetate hydrolase family protein	NA	NA	NA	NA
WP_011229334.1\|63810_64506_+	FadR family transcriptional regulator	NA	NA	NA	NA
WP_011229335.1\|64954_65329_-	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_011229337.1\|65625_65973_-	mercury transporter MerT	NA	NA	NA	NA
WP_011229338.1\|66050_66449_+	Hg(II)-responsive transcriptional regulator	NA	NA	NA	NA
WP_155877860.1\|66877_69130_-	c-type cytochrome	NA	NA	NA	NA
WP_011229340.1\|69698_71186_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_011514817.1\|71182_72121_-	transcriptional regulator	NA	NA	NA	NA
WP_011229342.1\|72985_73393_-	hypothetical protein	NA	NA	NA	NA
WP_011229343.1\|73501_73960_-	MgtC/SapB family protein	G3MA03	Bacillus_virus	3.2e-12	36.2
WP_011229344.1\|74210_74861_+	heavy metal efflux RND transporter CzcN	NA	NA	NA	NA
WP_004635335.1\|74890_75070_+	hypothetical protein	NA	NA	NA	NA
WP_011229345.1\|75175_75523_+	CDF family cobalt-zinc-cadmium transporter CzcI	NA	NA	NA	NA
WP_011514819.1\|75598_76855_+	heavy metal efflux RND transporter CzcC	NA	NA	NA	NA
WP_004635340.1\|76872_78435_+	heavy metal efflux RND transporter CzcB	NA	NA	NA	NA
WP_011229347.1\|78451_81643_+	heavy metal efflux RND transporter CzcA	S5VTK5	Leptospira_phage	4.0e-77	24.4
WP_004635344.1\|81693_82644_+	cation transporter	A0A1V0SED0	Indivirus	6.3e-10	28.3
WP_011229348.1\|82645_83323_+	heavy metal homeostasis two-component system response regulator CzcR	W8CYM9	Bacillus_phage	5.8e-34	34.2
WP_011229349.1\|83327_84758_+	sensor histidine kinase CzcS	W8CYF6	Bacillus_phage	1.8e-13	21.9
WP_011514820.1\|84866_85268_+	copper-binding periplasmic protein CzcE	NA	NA	NA	NA
WP_008646716.1\|85566_85845_-	hypothetical protein	NA	NA	NA	NA
WP_011229350.1\|86027_87095_-	porin	NA	NA	NA	NA
WP_085960481.1\|87211_88398_-\|transposase	IS3-like element ISRme13 family transposase	A0A0P0I4A4	Acinetobacter_phage	3.2e-56	39.7
WP_008650726.1\|88682_89105_+	flagellar basal body rod protein FlgB	NA	NA	NA	NA
WP_011514822.1\|89604_92094_+	heavy metal translocating P-type ATPase	E4ZFI9	Streptococcus_phage	3.9e-112	39.0
WP_008650724.1\|92151_92454_-	zinc ribbon domain-containing protein	NA	NA	NA	NA
WP_008650723.1\|92686_93808_-	glycosyltransferase family 2 protein	U5P087	Shigella_phage	3.3e-74	48.3
WP_008650722.1\|93804_94188_-	GtrA family protein	NA	NA	NA	NA
WP_008650720.1\|94184_95792_-	glycosyl transferase	NA	NA	NA	NA
WP_008650714.1\|97226_97472_+	hypothetical protein	NA	NA	NA	NA
WP_080709916.1\|99634_100159_-	cytochrome c	NA	NA	NA	NA
WP_080672773.1\|102454_102823_+	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_080672772.1\|102798_103014_+	hypothetical protein	NA	NA	NA	NA
WP_011229360.1\|104784_105795_-\|transposase	IS30-like element ISRme10 family transposase	Q9MBM9	Staphylococcus_prophage	1.2e-40	34.3
WP_011229361.1\|105879_106143_+	hypothetical protein	NA	NA	NA	NA
WP_104670213.1\|109990_110296_-	hypothetical protein	NA	NA	NA	NA
WP_017514740.1\|110748_110949_+	hypothetical protein	NA	NA	NA	NA
WP_011229366.1\|111023_112100_-	signal peptidase II	NA	NA	NA	NA
WP_011229367.1\|112096_114496_-	heavy metal translocating P-type ATPase	E4ZFI9	Streptococcus_phage	6.2e-147	48.1
WP_008645748.1\|114582_115020_+	Cd(II)/Pb(II)-responsive transcriptional regulator	NA	NA	NA	NA
WP_008645747.1\|115141_117070_+	c-type cytochrome	NA	NA	NA	NA
WP_008651547.1\|118337_118610_-	hypothetical protein	NA	NA	NA	NA
WP_008651548.1\|118606_119440_-	AAA family ATPase	NA	NA	NA	NA
WP_008651549.1\|119436_120876_-\|transposase	IS481 family transposase	O12274	Simian_T-lymphotropic_virus	4.1e-05	37.8
WP_124682078.1\|120987_121533_-\|transposase	transposase	NA	NA	NA	NA
123097:123805	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_007974

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NC_007972

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NC_007973

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

4. NC_007971

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection