CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number
NC_014550	Glutamicibacter arilaitensis Re117, complete genome	3 crisprs	WYL,csa3,RT,cas3,DinG,DEDDh,PD-DExK	15	4	10
NC_014548	Glutamicibacter arilaitensis Re117 plasmid pRE117-2, complete sequence	0 crisprs	NA	0	0	0
NC_014549	Glutamicibacter arilaitensis Re117 plasmid pRE117-1, complete sequence	0 crisprs	NA	0	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_014550_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_014550_1

1186309-1186482

Orphan

Consensus_repeat	Method
GGTTCCGCTGTTGGCTCA	CRT

4 spacers

The CRISPR arrays of NC_014550_1

>merge|NC_014550|1|1186309-1186482|CRT
GGTTCCTCTGTCGGCTCGGCTGTTGGTTCCGCTGTTGGTTCCGCTGTTGGCTCAGCCGTTGGTTCCTCGGTCGGTTCCGCTGTTGGCTCAGCCGTTGGTTCCTCGGTCGGTTCCTCGGTCGGTTCCGCTGTTGGCTCAGCCGTTGGTTCCTCGGTCGGTTCCGCTGTTGGCTCA

>NC_014550|1|1|1186309-1186482|CRT
GGTTCCTCTGTCGGCTCG	GCTGTTGGTTCCGCTGTT
GGTTCCGCTGTTGGCTCA	GCCGTTGGTTCCTCGGTC
GGTTCCGCTGTTGGCTCA	GCCGTTGGTTCCTCGGTCGGTTCCTCGGTC
GGTTCCGCTGTTGGCTCA	GCCGTTGGTTCCTCGGTC
GGTTCCGCTGTTGGCTCA

Protein	Signature genes	Signature genes Name	Protein_function
NC_014550.1\|WP_013348413.1\|1174412_1175423_-\|NAD-dependent-epimerase/dehydratase-family-protein	unknown	unknown	gnl\|CDD\|187552
NC_014550.1\|WP_013348430.1\|1197582_1197993_-\|hypothetical-protein	unknown	unknown	unknown
NC_014550.1\|WP_013348419.1\|1183247_1183841_+\|hypothetical-protein	unknown	unknown	unknown
NC_014550.1\|WP_157867103.1\|1194749_1195142_+\|hypothetical-protein	unknown	unknown	unknown
NC_014550.1\|WP_081461210.1\|1195323_1196688_+\|insulinase-family-protein	unknown	unknown	gnl\|CDD\|223685
NC_014550.1\|WP_013348415.1\|1178004_1179030_-\|3-oxoacyl-ACP-synthase-III	unknown	unknown	gnl\|CDD\|181732
NC_014550.1\|WP_013348410.1\|1172040_1173015_+\|thiamine-pyrophosphate-dependent-dehydrogenase-E1-component-subunit-alpha	unknown	unknown	gnl\|CDD\|238958
NC_014550.1\|WP_013348420.1\|1183932_1184976_-\|NAD(P)-dependent-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|176186
NC_014550.1\|WP_041648582.1\|1190326_1191586_-\|DUF2254-domain-containing-protein	unknown	unknown	gnl\|CDD\|378351
NC_014550.1\|WP_041649466.1\|1175419_1178011_-\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|236443
NC_014550.1\|WP_013348426.1\|1194128_1194620_+\|S-ribosylhomocysteine-lyase	unknown	unknown	gnl\|CDD\|179399
NC_014550.1\|WP_146040949.1\|1186628_1187417_-\|hypothetical-protein	unknown	unknown	unknown
NC_014550.1\|WP_013348411.1\|1173032_1174058_+\|alpha-ketoacid-dehydrogenase-subunit-beta	unknown	unknown	gnl\|CDD\|223101
NC_014550.1\|WP_013348423.1\|1188016_1190254_+\|polyribonucleotide-nucleotidyltransferase	unknown	unknown	gnl\|CDD\|131743
NC_014550.1\|WP_157867104.1\|1196758_1197412_-\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|223669
NC_014550.1\|WP_013348417.1\|1181594_1182569_+\|ADP-ribosylglycohydrolase-family-protein	unknown	unknown	gnl\|CDD\|377122
NC_014550.1\|WP_013348412.1\|1174054_1174288_+\|biotin-attachment-protein	unknown	unknown	gnl\|CDD\|133458
NC_014550.1\|WP_013348425.1\|1193447_1194008_-\|purine-nucleoside-phosphorylase	unknown	unknown	gnl\|CDD\|235538
NC_014550.1\|WP_013348431.1\|1198188_1198947_+\|4-hydroxy-tetrahydrodipicolinate-reductase	unknown	unknown	gnl\|CDD\|234595
NC_014550.1\|WP_013348418.1\|1182591_1182903_-\|DUF1883-domain-containing-protein	unknown	unknown	gnl\|CDD\|378107

Protein	Function_ID	Function_description	E-value
NC_014550.1\|WP_013348413.1\|1174412_1175423_-\|NAD-dependent-epimerase/dehydratase-family-protein	gnl\|CDD\|187552	cd05241, 3b-HSD-like_SDR_e, 3beta-hydroxysteroid dehydrogenases (3b-HSD)-like, extended (e) SDRs. Extended SDR family domains belonging to this subgroup have the characteristic active site tetrad and a fairly well-conserved NAD(P)-binding motif. 3b-HSD catalyzes the NAD-dependent conversion of various steroids, such as pregnenolone to progesterone, or androstenediol to testosterone. This subgroup includes an unusual bifunctional 3b-HSD/C-4 decarboxylase from Arabidopsis thaliana, and Saccharomyces cerevisiae ERG26, a 3b-HSD/C-4 decarboxylase, involved in the synthesis of ergosterol, the major sterol of yeast. It also includes human 3 beta-HSD/HSD3B1 and C(27) 3beta-HSD/ [3beta-hydroxy-delta(5)-C(27)-steroid oxidoreductase; HSD3B7]. C(27) 3beta-HSD/HSD3B7 is a membrane-bound enzyme of the endoplasmic reticulum, that catalyzes the isomerization and oxidation of 7alpha-hydroxylated sterol intermediates, an early step in bile acid biosynthesis. Mutations in the human NSDHL (NAD(P)H steroid dehydrogenase-like protein) cause CHILD syndrome (congenital hemidysplasia with ichthyosiform nevus and limb defects), an X-linked dominant, male-lethal trait. Mutations in the human gene encoding C(27) 3beta-HSD underlie a rare autosomal recessive form of neonatal cholestasis. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid sythase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	6.49438e-47
NC_014550.1\|WP_013348423.1\|1188016_1190254_+\|polyribonucleotide-nucleotidyltransferase	gnl\|CDD\|131743	TIGR02696, polyribonucleotide_nucleotidyltransferase, guanosine pentaphosphate synthetase I/polynucleotide phosphorylase. Sohlberg, et al. present characterization of two proteins from Streptomyces coelicolor. The protein in this family was shown to have poly(A) polymerase activity and may be responsible for polyadenylating RNA in this species. Reference 2 showed that a nearly identical plasmid-encoded protein from Streptomyces antibioticus is a bifunctional enzyme that acts also as a guanosine pentaphosphate synthetase.	0
NC_014550.1\|WP_081461210.1\|1195323_1196688_+\|insulinase-family-protein	gnl\|CDD\|223685	COG0612, PqqL, Predicted Zn-dependent peptidases [General function prediction only].	7.30834e-109
NC_014550.1\|WP_013348415.1\|1178004_1179030_-\|3-oxoacyl-ACP-synthase-III	gnl\|CDD\|181732	PRK09258, PRK09258, 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed.	0
NC_014550.1\|WP_013348410.1\|1172040_1173015_+\|thiamine-pyrophosphate-dependent-dehydrogenase-E1-component-subunit-alpha	gnl\|CDD\|238958	cd02000, TPP_E1_PDC_ADC_BCADC, Thiamine pyrophosphate (TPP) family, E1 of PDC_ADC_BCADC subfamily, TPP-binding module; composed of proteins similar to the E1 components of the human pyruvate dehydrogenase complex (PDC), the acetoin dehydrogenase complex (ADC) and the branched chain alpha-keto acid dehydrogenase/2-oxoisovalerate dehydrogenase complex (BCADC). PDC catalyzes the irreversible oxidative decarboxylation of pyruvate to produce acetyl-CoA in the bridging step between glycolysis and the citric acid cycle. ADC participates in the breakdown of acetoin while BCADC participates in the breakdown of branched chain amino acids. BCADC catalyzes the oxidative decarboxylation of 4-methyl-2-oxopentanoate, 3-methyl-2-oxopentanoate and 3-methyl-2-oxobutanoate (branched chain 2-oxo acids derived from the transamination of leucine, valine and isoleucine).	6.54644e-123
NC_014550.1\|WP_013348420.1\|1183932_1184976_-\|NAD(P)-dependent-alcohol-dehydrogenase	gnl\|CDD\|176186	cd05283, CAD1, Cinnamyl alcohol dehydrogenases (CAD). Cinnamyl alcohol dehydrogenases (CAD), members of the medium chain dehydrogenase/reductase family, reduce cinnamaldehydes to cinnamyl alcohols in the last step of monolignal metabolism in plant cells walls. CAD binds 2 zinc ions and is NADPH- dependent. CAD family members are also found in non-plant species, e.g. in yeast where they have an aldehyde reductase activity. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines.	0
NC_014550.1\|WP_041648582.1\|1190326_1191586_-\|DUF2254-domain-containing-protein	gnl\|CDD\|378351	pfam10011, DUF2254, Predicted membrane protein (DUF2254). Members of this family of bacterial proteins comprises various hypothetical and putative membrane proteins. Their exact function, has not, as yet, been defined.	1.66202e-96
NC_014550.1\|WP_041649466.1\|1175419_1178011_-\|alpha/beta-fold-hydrolase	gnl\|CDD\|236443	PRK09274, PRK09274, peptide synthase; Provisional.	1.36458e-111
NC_014550.1\|WP_013348426.1\|1194128_1194620_+\|S-ribosylhomocysteine-lyase	gnl\|CDD\|179399	PRK02260, PRK02260, S-ribosylhomocysteine lyase.	4.27513e-85
NC_014550.1\|WP_013348431.1\|1198188_1198947_+\|4-hydroxy-tetrahydrodipicolinate-reductase	gnl\|CDD\|234595	PRK00048, PRK00048, dihydrodipicolinate reductase; Provisional.	3.80146e-95
NC_014550.1\|WP_013348411.1\|1173032_1174058_+\|alpha-ketoacid-dehydrogenase-subunit-beta	gnl\|CDD\|223101	COG0022, AcoB, Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, beta subunit [Energy production and conversion].	1.08435e-157
NC_014550.1\|WP_157867104.1\|1196758_1197412_-\|alpha/beta-fold-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	2.30532e-16
NC_014550.1\|WP_013348417.1\|1181594_1182569_+\|ADP-ribosylglycohydrolase-family-protein	gnl\|CDD\|377122	pfam03747, ADP_ribosyl_GH, ADP-ribosylglycohydrolase. This family includes enzymes that ADP-ribosylations, for example ADP-ribosylarginine hydrolase EC:3.2.2.19 cleaves ADP-ribose-L-arginine. The family also includes dinitrogenase reductase activating glycohydrolase. Most surprisingly the family also includes jellyfish crystallins, these proteins appear to have lost the presumed active site residues.	1.99641e-44
NC_014550.1\|WP_013348412.1\|1174054_1174288_+\|biotin-attachment-protein	gnl\|CDD\|133458	cd06849, lipoyl_domain, Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases. 2-oxo acid dehydrogenase multienzyme complexes, like pyruvate dehydrogenase (PDH), 2-oxoglutarate dehydrogenase (OGDH) and branched-chain 2-oxo acid dehydrogenase (BCDH), contain at least three different enzymes, 2-oxo acid dehydrogenase (E1), dihydrolipoyl acyltransferase (E2) and dihydrolipoamide dehydrogenase (E3) and play a key role in redox regulation. E2, the central component of the complex, catalyzes the transfer of the acyl group of CoA from E1 to E3 via reductive acetylation of a lipoyl group covalently attached to a lysine residue.	1.56636e-15
NC_014550.1\|WP_013348425.1\|1193447_1194008_-\|purine-nucleoside-phosphorylase	gnl\|CDD\|235538	PRK05634, PRK05634, nucleosidase; Provisional.	2.61669e-31
NC_014550.1\|WP_013348418.1\|1182591_1182903_-\|DUF1883-domain-containing-protein	gnl\|CDD\|378107	pfam08980, DUF1883, Domain of unknown function (DUF1883). This domain is found in a set of hypothetical bacterial proteins.	1.31379e-39

>NC_014550.1|WP_013348420.1|1183932_1184976_-|NAD(P)-dependent-alcohol-dehydrogenase
MTTMVNAYAAPSATEGLVPTQIERRELGPHDILIDIKFSGICHSDIHTVRGEWGPPTFPLVPGHEIAGIVAEIGSAVSKHKIGDRVGVGCLVNSCMECENCLAGDQQFCEQSVGTYGSTDRDGTMTQGGYATHVVVTENFALKIPEGINLDVAAPLLCAGITTFSPLKHWGAGPGKKVAVVGLGGLGHMAVKIASAMGAEVTVLSQSLKKKDDGLKLGASDYRATSDESTFKDLHKHYDLIINTVSASINISDYLGLLRVNGTMVNVGAPAEPLPVNAFALIGGRRSFAGSQIGGIEETQEMLDFCAEHGLGAEIEVISADQINDAYERVLKSDVRYRFVIDTATLA
>NC_014550.1|WP_013348419.1|1183247_1183841_+|hypothetical-protein
MDILSGIDLEQLRMWIWILAIGFAVGMGLWRRHQLALVGFASTLLFATLNAGAGIYVLKRLGDSRWTVGDPPMSAPELSNVPFAGQYLEPLESSLESITGRVNSFWEFSQALPVALDFFTRSGWALVVAIPLIVIVLVRSYRTASRRRKDLQNLNGTVAQLQSELAAIKLALPAESYLALPPENEEQPRQQRTRRKQ
>NC_014550.1|WP_013348418.1|1182591_1182903_-|DUF1883-domain-containing-protein
MTEPEFAEYSWDFLERGSILVVILSGPAHLRLMDPENFAAFQDGEEFDAFGGLARRAPYRIKVPHSGPWFLAIDVAGLNVRGVRHEVSVVPPQKLEQRRSGKD
>NC_014550.1|WP_013348417.1|1181594_1182569_+|ADP-ribosylglycohydrolase-family-protein
MAYPLQAQDRIRGVLTGMASGDALGAGYEFNAPMPESAEISMIGGGLGNFAPGEWTDDTSMAIVIARGLLGSGGRFDAAASDYMIREWAKWAVQAPDVGNQTRAVLSHAQRVASEGGRTEPNTADALSGSEELHRRTGRSGGNGSLMRTAPVALAYLSEPPAAAFHAAVEISKLTHFDDEAAEACGLWTVAIQHAILTGELEIRAGLPLLNPERAMTWEQRIEQAENRQPREFSRNGWVVEAFQGAWSAITNAKETSKEHHLVSALEAAVRGGVDTDTVAAIAGSLLGAARGYSSIPLPWMEIVHGWPSLRIQHLLDISTELAG
>NC_014550.1|WP_013348415.1|1178004_1179030_-|3-oxoacyl-ACP-synthase-III
MNGNATFKHHNVALLSVNSVLAPEVVSSAEFDERLAPSLKRLRLSKKLLERVSGVKERRWWSDGVEFDDAAILAGKKALAQAGVDASEIGLLINTSVTRRNLEPSVASKVHNGLGLPSSAMNFDVANACLGFVNGMSLAANMIDSGQIKYALIVAGEDAKPTQETTFQRLNAETSTRDDYMREFATLTLGSGAAAAVIGPADAHPEAHRIVGGVSRAGTEHHELCVGGPSGMYTDTKGLLDNGLELVVDAWDEAHQSGWNWKSMDRYVTHQVSKSYTNAIIKAVGLVKDRVPITFSKWGNVGPASLPMTLSQEADSLKKGDRVLCMGVGSGLNTAMMEIAW
>NC_014550.1|WP_041649466.1|1175419_1178011_-|alpha/beta-fold-hydrolase
MVTELFPGVNAIYSKYLDVPSTSQVDSPGTEHRWHFLDNNEELEQRGIKPVGTLVCVHGNPTWSYIWRSLLNHVSEHQLPWRVVAVDQLDMGFSERTGKFRRLADRVNDLNDLTQALDLTGKITTVGHDWGGIISLGWAVAHPDQLENVVLTNTAIHPAGFELPSALKLASHPAVHGWGTKTSPAFLQVTHALAQPALAPAVRKAFMAPYTSADKREGVANFVADIPFSQEHPSRPALDEISEAVRSLKVPALMLWGPKDPVFSDRYLRDLMSRLPHAQVHRFEGSSHLVGEDNDIATPIFQWLAGEQNSKNISRAEALGEYRPMLAELDSRTEDQTTAVVDINPARSLSWAELGERVNALAAGLQQIGVKAGDRVNLLVPPGIELTTLIYACLRLGAVIVVADAGLGTKGMGRAIKGAGPSYLVGIDRALTGARLFGWPGIKIAAEDLPTAKRKLLGVAHTLPELYAAGGKASAQELAFEPATPDADAAVLFTSGSTGPAKGVVYTHRELAAMRDTLRETYNLKAGSALVAGFAPFALLGPALGATSVTPDMDVTAPRTLTAAALADAALAVDATTVFASPAALANVLETQDALNPAQRETLEGVSLMLSAGAPIPEHLLAKVQDLVPNARVHTPYGMTEALPVTDIDLPGIRAAGAGNGVCVGTAVAGATVAIAPIDALGVAGDQPEYTPNATGEILVRAPHVKDRYDRLWITEQLSTSIPGWHRTGDVGHLDEAGRLWVEGRLGHVLRTSKGAITPVAAEHAVESVAGAGRAALVGVGPAGTQAAVVVMETVPPARKPGPAANDLARQVRTAVGATGTEVAAVLVVPNLPTDIRHNSKIDRAALADWATATLAGGRIRKP
>NC_014550.1|WP_013348413.1|1174412_1175423_-|NAD-dependent-epimerase/dehydratase-family-protein
MNSSENTGTARRVLVTGASGMLGGAVAQLLRDKGHHVRTFQRGASASATDEVRGSLADQQAVAAAVESMDAVIHLAAKVSFTGAWEDFVATNITGTSNLLEASKDAGVKDFVFVSSPSVAHFGDSLAGAGAGQADPDKAHGSYARSKAAAELQALGADSPAFRVTAIRPHVVWGPGDTQLVERVIQRAKAGRLPLLDQGAALIDTTYIDNAAAAIVRGLERMDHAHGRALVVTNGEPRPVGELIAGICQAGGAPAPKLNVPGWLARGAGSVIEKLWLAAGSRNLVHDEPPMTRFLAEQLSTAHWFDQRETHEVLDWKPEVGIDEGLQKLAEHYRAS
>NC_014550.1|WP_013348412.1|1174054_1174288_+|biotin-attachment-protein
MSQVLFPVLSEKDPDAEGTVATWFVDSGATVAEGELIAEVAVDKIDMEINAPAAGVLTHLVEEGAVVIQNSAIASIA
>NC_014550.1|WP_013348411.1|1173032_1174058_+|alpha-ketoacid-dehydrogenase-subunit-beta
MATDATGTRRLNTAKATVEAIAREMERDENVFVMGEDVGPYGGIFSSTTGLLERFGPERIIDTPISETGFIGAAIGAATEGMRPIVELMFVDFFGVCMDQIYNHMAKIHYESGGNVKVPLVLTTAVGGGYSDGAQHSQCLWGTFAHLPGMKVVVPSNPADAAGLMTAAIRDDNPVVFMYHKGIQGLAWMKKNRRSIGPVPGGDHVVEIGKAAVPRSGKDVTIVTLSLSVHHALDVAEELAGEGVDVEVIDLRSIVPMDTQAIIDSVTKTGHLVIVDEDYQSFGLSGEIAARIAEHDPTILKAPIGRVANPDLPIPYARTLEYTVLPTPARIKEAVLKQVGR
>NC_014550.1|WP_013348410.1|1172040_1173015_+|thiamine-pyrophosphate-dependent-dehydrogenase-E1-component-subunit-alpha
MDSNTQRELYQQMVMIRTYEETILREYHADKKPVFDIGAGLIPGEMHLAAGQEPVAAGVCAHATEGDSVTATHRPHHFALAHGVEINAMTAEIFGRVDGLGRGRGGHMHLFDPKAKFSCSGIIGEGLPVAVGQALAMKRRGTNNVAIAVAGEGAANQGAFHESLNLAALWKLPVIFVVEDNDWGISVPRSQSTSVPSNAVRAAAYGIPGVRVEDNAVESVYEEAGKAFERARNGGGPSLLEVSTLRLWGHFEGDAQGYRSDLEGVPGRDPIPTYEQTLRDARVIDDSFVEQTRSEAVKRVEAAVEFAKSSPEPDPSTAGDYVFA
>NC_014550.1|WP_146040949.1|1186628_1187417_-|hypothetical-protein
MSQIQHCAPLLDSEGFIVYQTRKSIVRKARLPLAVVAAGSLALGGVVGGTTMFTPAVAAPQTTSSQVAAEQAAYPIYNDEEFTLVDKGQEFWTFNYDESDPANGVVVLTDNTGLVSSGDKVWLSSSSVPNTGSTQEAKHENGQVVLNGPLDSPDGYSTWPDQLRQVSFSVSTGPEVGPDMVQHGGVPYVPEQGISLVTNEVGQKYAVPFLPVGTEVWSFDIPSGLSWLSQATVSINYYSDAADAPNGGFIDVELTDVDISDG
>NC_014550.1|WP_013348423.1|1188016_1190254_+|polyribonucleotide-nucleotidyltransferase
MEGPEIQFAEAQIDNGRYGTRTIRFETGRIAKQAAGSAMVYIDDETALLSATTAGKHPREGFDFFPLTVDVEERMYAAGRIPGSFFRREGRPSTEAILACRLMDRPLRPAFVKGLRNEVQVVVTVLSIEPDELYDVVAINASSMSTQLSGLPFSGPIGGVRVALVDDGNGAQWVAFPKHSELKNAVFNMVVAGRIAGDDVAIMMVEAEATDNAWELIKERGAQAPTEEVVAEGLEAAKPFIKVLCEAQADLAARAAKETVEFPVFRDYEEDAYTAVEAAASTRLAEIYTIADKQERDNAAGEFKDEIVAQLTAEGSAFAERAGEISKAFGAVTKHIVRQRILTEQVRIDGRGLADIRQLSAEVEVLPRVHGSAIFERGETQIMGVTTLNMLKMEQQIDSLSPVKSKRYMHNYNFPPYSTGETGRVGSPKRREIGHGALAERALVPVLPSREEFPYAIRQVSEALGSNGSTSMGSVCASTLSLLNAGVPLKAAVAGIAMGLVSDTVDGETRYAALTDILGAEDAMGDMDFKVAGTSEFVTAIQLDTKLDGIPASVLAAALTQAREARLHILNVLNQAIDAPDELNVNAPRIISVKIPVDKIGEVIGPKGKMINQIQEDTGADISIEDDGTVLIGATNGESAEAARSAINAIANPQVPEVGERYLGTVVKLTTFGAFVSLTPGKDGLLHISELRKINGGKRVEDVEDVVGVGQKLQVEITKIDDRGKLSLAPVVEDEEEAEEAVAAE
>NC_014550.1|WP_041648582.1|1190326_1191586_-|DUF2254-domain-containing-protein
MTYVRESLRGIWFRATVFTIAGIVLAMSAPLLSGLIPEGLSNAFGNDAAGTLLQILASSMLAVTTFSLTTMVSAYSTATQIGTPRSIQLLIADRTSQNALSTYVGAFAFSIVGIIALSIGVYSDSERAFLLLGTILVIAMVLVTLLRWISFLTIFGRMSDIIDRVGKASSKAMQEYASQPLLGGQHWVQPPASAIPVEGTGSGFIVKVHVAELQRIAESEGCQIWVERRTGSRIFAQHPVAYLSKPVSQESHQAVQRAFTIAAHRTFEQDPRLGLTSLSEISSKALSPGINDPGTVIEVLAATHKVLDIALTAKATETPSAPLVHVRQLDPRDLLEDAFRATSRDGAANVEVMMRIQKELGALIAIADSSWDEALKALAVDSLRRAELCLELEEDLREVRLMHRQALSSNGISKDAGQG
>NC_014550.1|WP_013348425.1|1193447_1194008_-|purine-nucleoside-phosphorylase
MSDQKSLLVFAHADEAVAFADVEHLISGVGKVNASVALAGALASGDIKNVVVLGTAGVVGHAGEDRPSLDTIYQITKLIQHDFPLPSADVDPTGEVLLPDNKVTMATGDVFVSDGEQRIHIKSLGASLVDMEGYAYASICQRFNVPLQIFKIPSDYADDSASIDEWDEIAKQKSVQLREFYDKHLS
>NC_014550.1|WP_013348426.1|1194128_1194620_+|S-ribosylhomocysteine-lyase
MSDIELAEVESFALDHTKVKAPYVRKIAVEHGPKGDAITNYDIRFVQPNHGEIPTAGLHTIEHTMAGLLRTRMEGLIDFSPFGCRTGFHMILWGEPTPEVVAAAIKSSLEDIAEKVTWEDVPGTEAVSCGNYRDHSLHSAREWAKVILEQGISLDAFDRSKLA
>NC_014550.1|WP_157867103.1|1194749_1195142_+|hypothetical-protein
MNSMRKVHSLAAVLAAIAISISGCANFDAVRTSTISEECQSAIQKQNEAWSDPETPEKQIKEAEQASLGACKNLDEWSSAVSSNPGSMGYQELDTEAAANTVYLSCASNDPERQTPVCADAAQRGYLDAS
>NC_014550.1|WP_081461210.1|1195323_1196688_+|insulinase-family-protein
MIPLPLHSVETTQFSPIDPADPTLVHRGEGGSEVRRSILPGGVRVLTEAMPGQRSTTVGFWVPVGSRDEEAGHYGSTHFLEHLLFKGTAKRTALEIAQSFDAVGGESNAATAKESTCYYARVLDTDLPMALDVIADMVTSAVIDPQELEQERGVIIEELAMDADDAMDVAHERFVANVLGDHPLGRPIGGTPEEIMEISREAVMEHYRAHYRPGELIITAAGSLEHDKLCELVLKALTEAGWELDPMAVPEPRRMGEPAKINSKAGLEVINRPGEQANIIIGCAGITGHDDRRQVLAVLNAVLGGGMSSRLFQEIREKRGLVYSTYSFSAAYTDAGYFGMYAGCAPAKAAQVIGLLGAELDRLAKDGITESELAQAKGQLSGGTVLALEDPGSRMSRLGRAEMITGEFQDIDEALARVNAVSAQDVQDLARELAAKDRVITVVGPFENEAALGL
>NC_014550.1|WP_157867104.1|1196758_1197412_-|alpha/beta-fold-hydrolase
MVLIHGLGASSRYFTPLANIVAKKYRVIVPELPGHGKNLDGGRPVTVVRFAHEVALAMRELEVENAIVLGHSMGAQLAIELARAWPDLVKHLIIAAPAVNDREATLVRQARRIIEDFQHELNSVKAILLVDYLRCGIPWWAKSCAQMLEYSTIEMLRTVRCSIDVVCGTRDPLSPPEFGLRLVAKAPQANLTVMRQGAHGFNFSHAPELADLIDAVP
>NC_014550.1|WP_013348430.1|1197582_1197993_-|hypothetical-protein
MGQKIKRFGFGVGTALTVAFAITSCGLASEPTALSDEDQASIVELVQEQGTVIEAPTCSVEVFRIEDSTTYGWASCAPSSNESADAMAQVDAFPFRIDGQDLRRPDDGSKFDEDVKELFPEDLRSAINQHATGAGS
>NC_014550.1|WP_013348431.1|1198188_1198947_+|4-hydroxy-tetrahydrodipicolinate-reductase
MSAQIKVAVLGAAGRMGSEAVKAVTEAADMELVAELGRGDDLSQILESGATHIVDLSVPASTVSNVRFAVENGLHAVVGTTGWDDERRANLEALLAEHPEAGVLIAPNFALGSVLASAFAATAAKYFESVEIIELHHPNKVDAPSGTAVRTAELIAKSREAAGVPASPDATETQIDGARGAVVDGINVHSVRLRGLVAHQEVLFGGPGEQLTLRHDSYDRASFMPGVFLGLRTVASRPGLTYGLDGYLELGK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_014550_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_014550_2

2979503-2981140

Unclear

Consensus_repeat	Method
CATCGGTGTTCGCATCAG	CRT

38 spacers

cas3

The CRISPR arrays of NC_014550_2

>merge|NC_014550|2|2979503-2981140|CRT
CATCGGTGTTCGCATCAGCGTTATCCGCAGTGTTCACATCGGTGTTCGCGTCAGTATTCGCATCCGTGTTGGCATCGGTGTTCGCATCAGCGTTATCCGCAGTGTTCACATCGGTGTTCACATCCGTGTTGGCATCGGTGTTCGCATCAGCGTTATCCGCAGTGTTCACATCGGTGTTCGCATCCGTGTTGGCATCGGTGTTCACATCCGTGTTGGCATCGGTGTTCGCATCAGCGTTATCCGCAGTGTTCACATCGGTGTTCGCGTCAGTATTCGCATCCGTGTTGGCATCGGTGTTCACATCCGTGTTGGCATCGGTGTTCGCATCAGCGTTATCCGCAGTGTTCACATCGGTGTTCGCGTCAGTATTCGCATCCGTGTTGGCATCGGTGTTCGCATCAGCGTTTTCCGCAGTGTTCACATCGGTGTTCGCGTCAGTATTCGCATCCGTGTTGGCATCGGTGTTCGCATCAGCGTTATCCGCAGTGTTCACATCGGTGTTCGCGTCAGTATTCGCATCCGTGTTGGCATCGGTGTTCGCATCAGCGTTATCCGCAGTGTTCACATCGGTGTTCGCGTCAGTGTTCGCATCCGTGTTGGCATCGGTGTTCGCATCAGCGTTATCCGCAGTGTTCACATCGGTGTTCACATCGGTGTTCACATCCGTGTTGGCATCGGTGTTCGCATCAGCGTTATCCGCAGTGTTCACATCGGTGTTCGCATCCGTGTTGGCATCGGTGTTCGCATCAGTGTTATCATCAGTGTTCACATCAGTGTTCGCATCAGTGTTATCATCAGTGTTCACATCAGTGTTCGCATCAGTGTTCGCATCAGTGTTGGCATCAGTGTTCGCATCAGTGTTCTCATCAGTGTTCACATCAGTGTTCACATCAGTGTTCGCATCAGTGTTCGCATCAGTGTTCGCATCAGTGTTCGCATCAGTGTTCTCATCAGTGTTCACATCAGTGTTCGCATCAGTGTTCGCATCAGTGTTGGCATCAGTGTTCGCATCAGTGTTATCATCAGTGTTCACATCAGTGTTCGCATCAGTGTTCGCATCAGTGTTGGCATCAGTGTTCGCATCAGTGTTATCATCAGTGTTCACATCAGTGTTCGCATCAGTGTTCGCATCCGTGTTGGCATCGGTGTTCGCATCAGTGTTATCATCAGTGTTCACATCGGTGTTCGCATCAGTGTTCGCATCCGTGTTGGCATCGGTGTTCGCATCAGTGTTATCATCAGTGTTCACATCGGTGTTCGCATCAGTGTTCGCATCCGTGTTGGCATCGGTGTTCGCATCAGCGTTATCATCAGTGTTCACATCGGTGTTCGCATCCGTGTTGGCATCGGTGTTCGCATCAGCGTTATCCGCAGTGTTCACATCGGTGTTCGCATCAGTGTTGGCATCGGTGTTCGCATCAGCGTTATCCGCAGTGTTCACATCGGTGTTCGCATCGGTGTTCGCATCAGCGTTATCCGCAGTGTTCACATCGGTGTTCACATCCGTGTTGGCATCGGTGTTCGCATCAGCGTTATCCGCAGTGTTCACATCGGTGTTCGCGTCAGTATTCGCATCCGTGTTGGCATCGGTGTTCGCATCAGCGTTATCCGCAGTGTTCACATCGGTGTTCGCTTCGG

>NC_014550|2|2|2979503-2981140|CRT
CATCGGTGTTCGCATCAG	CGTTATCCGCAGTGTTCACATCGGTGTTCGCGTCAGTATTCGCATCCGTGTTGG
CATCGGTGTTCGCATCAG	CGTTATCCGCAGTGTTCA
CATCGGTGTTCACATCCG	TGTTGGCATCGGTGTTCGCATCAGCGTTATCCGCAGTGTTCA
CATCGGTGTTCGCATCCG	TGTTGGCATCGGTGTTCACATCCGTGTTGG
CATCGGTGTTCGCATCAG	CGTTATCCGCAGTGTTCA
CATCGGTGTTCGCGTCAG	TATTCGCATCCGTGTTGGCATCGGTGTTCACATCCGTGTTGG
CATCGGTGTTCGCATCAG	CGTTATCCGCAGTGTTCA
CATCGGTGTTCGCGTCAG	TATTCGCATCCGTGTTGG
CATCGGTGTTCGCATCAG	CGTTTTCCGCAGTGTTCA
CATCGGTGTTCGCGTCAG	TATTCGCATCCGTGTTGG
CATCGGTGTTCGCATCAG	CGTTATCCGCAGTGTTCA
CATCGGTGTTCGCGTCAG	TATTCGCATCCGTGTTGG
CATCGGTGTTCGCATCAG	CGTTATCCGCAGTGTTCA
CATCGGTGTTCGCGTCAG	TGTTCGCATCCGTGTTGG
CATCGGTGTTCGCATCAG	CGTTATCCGCAGTGTTCA
CATCGGTGTTCACATCGG	TGTTCACATCCGTGTTGG
CATCGGTGTTCGCATCAG	CGTTATCCGCAGTGTTCA
CATCGGTGTTCGCATCCG	TGTTGGCATCGGTGTTCGCATCAGTGTTATCATCAGTGTTCA
CATCAGTGTTCGCATCAG	TGTTATCATCAGTGTTCA
CATCAGTGTTCGCATCAG	TGTTCGCATCAGTGTTGG
CATCAGTGTTCGCATCAG	TGTTCTCATCAGTGTTCACATCAGTGTTCA
CATCAGTGTTCGCATCAG	TGTTCGCATCAGTGTTCG
CATCAGTGTTCGCATCAG	TGTTCTCATCAGTGTTCA
CATCAGTGTTCGCATCAG	TGTTCGCATCAGTGTTGG
CATCAGTGTTCGCATCAG	TGTTATCATCAGTGTTCA
CATCAGTGTTCGCATCAG	TGTTCGCATCAGTGTTGG
CATCAGTGTTCGCATCAG	TGTTATCATCAGTGTTCA
CATCAGTGTTCGCATCAG	TGTTCGCATCCGTGTTGG
CATCGGTGTTCGCATCAG	TGTTATCATCAGTGTTCA
CATCGGTGTTCGCATCAG	TGTTCGCATCCGTGTTGG
CATCGGTGTTCGCATCAG	TGTTATCATCAGTGTTCA
CATCGGTGTTCGCATCAG	TGTTCGCATCCGTGTTGG
CATCGGTGTTCGCATCAG	CGTTATCATCAGTGTTCACATCGGTGTTCGCATCCGTGTTGG
CATCGGTGTTCGCATCAG	CGTTATCCGCAGTGTTCA
CATCGGTGTTCGCATCAG	TGTTGGCATCGGTGTTCGCATCAGCGTTATCCGCAGTGTTCACATCGGTGTTCG
CATCGGTGTTCGCATCAG	CGTTATCCGCAGTGTTCACATCGGTGTTCACATCCGTGTTGG
CATCGGTGTTCGCATCAG	CGTTATCCGCAGTGTTCACATCGGTGTTCGCGTCAGTATTCGCATCCGTGTTGG
CATCGGTGTTCGCATCAG	CGTTATCCGCAGTGTTCA
CATCGGTGTTCGCTTCGG

Protein	Signature genes	Signature genes Name	Protein_function
NC_014550.1\|WP_013349994.1\|2990936_2991476_+\|DUF1697-domain-containing-protein	unknown	unknown	gnl\|CDD\|377954
NC_014550.1\|WP_013349977.1\|2967468_2968158_+\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|188483
NC_014550.1\|WP_013349996.1\|2992188_2993445_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340897
NC_014550.1\|WP_013349983.1\|2974847_2976230_+\|NAD-dependent-succinate-semialdehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|143418
NC_014550.1\|WP_013349978.1\|2968260_2969493_+\|acyl-CoA-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|173840
NC_014550.1\|WP_013349976.1\|2966875_2967307_-\|DoxX-family-membrane-protein	unknown	unknown	unknown
NC_014550.1\|WP_013349979.1\|2969558_2972117_-\|ATP-dependent-helicase-HrpB	cas3	cd09639_cas3_CAS-I	gnl\|CDD\|273901
NC_014550.1\|WP_041648986.1\|2976331_2977405_-\|HTTM-domain-containing-protein	unknown	unknown	gnl\|CDD\|214802
NC_014550.1\|WP_013349992.1\|2988504_2988915_+\|RNA-binding-S4-domain-containing-protein	unknown	unknown	gnl\|CDD\|224109
NC_014550.1\|WP_013349993.1\|2988911_2990861_-\|S9-family-peptidase	unknown	unknown	gnl\|CDD\|224423
NC_014550.1\|WP_013349987.1\|2983441_2984107_+\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|225107
NC_014550.1\|WP_013349981.1\|2973051_2973213_+\|hypothetical-protein	unknown	unknown	unknown
NC_014550.1\|WP_013349995.1\|2991535_2992192_+\|TRIC-cation-channel-family-protein	unknown	unknown	gnl\|CDD\|225415
NC_014550.1\|WP_013349989.1\|2984938_2985439_-\|ferritin	unknown	unknown	gnl\|CDD\|153113
NC_014550.1\|WP_173362811.1\|2973546_2974575_+\|L-glyceraldehyde-3-phosphate-reductase	unknown	unknown	gnl\|CDD\|381376
NC_014550.1\|WP_102599145.1\|2988158_2988461_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|375250
NC_014550.1\|WP_041648984.1\|2972113_2972905_-\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|274729
NC_014550.1\|WP_146040882.1\|2977395_2978154_-\|hypothetical-protein	unknown	unknown	unknown
NC_014550.1\|WP_146041039.1\|2984124_2984664_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|310737
NC_014550.1\|WP_041648994.1\|2985584_2988029_-\|RNA-binding-transcriptional-accessory-protein	unknown	unknown	gnl\|CDD\|225094

Protein	Function_ID	Function_description	E-value
NC_014550.1\|WP_013349977.1\|2967468_2968158_+\|TetR-family-transcriptional-regulator	gnl\|CDD\|188483	TIGR03968, transcriptional_regulator_TetR_family, mycofactocin system transcriptional regulator. Members of this family are TetR family putative transcriptional regulators that occur in genome contexts near proteins of the mycofactocin system. These include the precursor peptide (TIGR03969), a radical SAM peptide maturase (TIGR03962), and a putative carrier protein (TIGR03967). [Regulatory functions, DNA interactions].	1.50575e-13
NC_014550.1\|WP_013349996.1\|2992188_2993445_-\|MFS-transporter	gnl\|CDD\|340897	cd17339, MFS_NIMT_CynX_like, 2-nitroimidazole and cyanate transporters and similar proteins of the Major Facilitator Superfamily of transporters. This family is composed of Escherichia coli 2-nitroimidazole transporter (NIMT) and cyanate transport protein CynX, and similar proteins. NIMT, also called YeaN, confers resistance to 2-nitroimidazole, the antibacterial and antifungal antibiotic, by mediating the active efflux of this compound. CynX is part of an active transport system that transports exogenous cyanate into E. coli cells. The NIMT/CynX-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.07833e-88
NC_014550.1\|WP_013349983.1\|2974847_2976230_+\|NAD-dependent-succinate-semialdehyde-dehydrogenase	gnl\|CDD\|143418	cd07100, ALDH_SSADH1_GabD1, Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 1-like. Succinate-semialdehyde dehydrogenase 1 (SSADH1, GabD1, EC=1.2.1.16) catalyzes the NADP(+)-dependent oxidation of succinate semialdehyde (SSA) to succinate. SSADH activity in Mycobacterium tuberculosis (Mtb) is encoded by both gabD1 (Rv0234c) and gabD2 (Rv1731). The Mtb GabD1 SSADH1 reportedly is an enzyme of the gamma-aminobutyrate shunt, which forms a functional link between two TCA half-cycles by converting alpha-ketoglutarate to succinate.	0
NC_014550.1\|WP_013349978.1\|2968260_2969493_+\|acyl-CoA-dehydrogenase-family-protein	gnl\|CDD\|173840	cd01151, GCD, Glutaryl-CoA dehydrogenase. Glutaryl-CoA dehydrogenase (GCD). GCD is an acyl-CoA dehydrogenase, which catalyzes the oxidative decarboxylation of glutaryl-CoA to crotonyl-CoA and carbon dioxide in the catabolism of lysine, hydroxylysine, and tryptophan. It uses electron transfer flavoprotein (ETF) as an electron acceptor. GCD is a homotetramer. GCD deficiency leads to a severe neurological disorder in humans.	1.69568e-134
NC_014550.1\|WP_173362811.1\|2973546_2974575_+\|L-glyceraldehyde-3-phosphate-reductase	gnl\|CDD\|381376	cd19150, AKR_AKR14A1, Escherichia coli L-glyceraldehyde 3-phosphate reductase (GPR/YghZ/AKR14A1) and similar proteins. Escherichia coli L-glyceraldehyde 3-phosphate reductase (GPR/YghZ), also called GAP reductase, is a founding member of aldo-keto reductase family 14 member A1 (AKR14A1). It catalyzes the stereospecific, NADPH-dependent reduction of L-glyceraldehyde 3-phosphate (L-GAP). It is also involved in the stress response as a methylglyoxal reductase which converts the toxic metabolite methylglyoxal to acetol in vitro and in vivo.	1.30942e-180
NC_014550.1\|WP_013349979.1\|2969558_2972117_-\|ATP-dependent-helicase-HrpB	gnl\|CDD\|273901	TIGR01970, ATP-dependent_RNA_helicase_HrpB, ATP-dependent helicase HrpB. This model represents HrpB, one of two related but uncharacterized DEAH-box ATP-dependent helicases in many Proteobacteria, but also in a few species of other lineages. The member from Rhizobium meliloti has been designated HelO. HrpB is typically about 800 residues in length, while its paralog HrpA (TIGR01967), also uncharacterized, is about 1300 amino acids long. Related characterized eukarotic proteins are RNA helicases associated with pre-mRNA processing. [Unknown function, Enzymes of unknown specificity].	1.32242e-178
NC_014550.1\|WP_041648986.1\|2976331_2977405_-\|HTTM-domain-containing-protein	gnl\|CDD\|214802	smart00752, HTTM, Horizontally Transferred TransMembrane Domain. Sequence analysis of vitamin K dependent gamma-carboxylases (VKGC) revealed the presence of a novel domain, HTTM (Horizontally Transferred TransMembrane) in its N-terminus. In contrast to most known domains, HTTM contains four transmembrane regions. Its occurrence in eukaryotes, bacteria and archaea is more likely caused by horizontal gene transfer than by early invention. The conservation of VKGC catalytic sites indicates an enzymatic function also for the other family members.	1.41892e-46
NC_014550.1\|WP_013349992.1\|2988504_2988915_+\|RNA-binding-S4-domain-containing-protein	gnl\|CDD\|224109	COG1188, COG1188, Ribosome-associated heat shock protein implicated in the recycling of the 50S subunit (S4 paralog) [Translation, ribosomal structure and biogenesis].	8.38808e-28
NC_014550.1\|WP_013349993.1\|2988911_2990861_-\|S9-family-peptidase	gnl\|CDD\|224423	COG1506, DAP2, Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism].	3.69971e-62
NC_014550.1\|WP_013349987.1\|2983441_2984107_+\|response-regulator-transcription-factor	gnl\|CDD\|225107	COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription].	4.37444e-40
NC_014550.1\|WP_013349995.1\|2991535_2992192_+\|TRIC-cation-channel-family-protein	gnl\|CDD\|225415	COG2860, COG2860, Predicted membrane protein [Function unknown].	5.14238e-43
NC_014550.1\|WP_013349989.1\|2984938_2985439_-\|ferritin	gnl\|CDD\|153113	cd01055, Nonheme_Ferritin, nonheme-containing ferritins. Nonheme Ferritin domain, found in archaea and bacteria, is a member of a broad superfamily of ferritin-like diiron-carboxylate proteins. The ferritin protein shell is composed of 24 protein subunits arranged in 432 symmetry. Each protein subunit, a four-helix bundle with a fifth short terminal helix, contains a dinuclear ferroxidase center (H type). Unique to this group of proteins is a third metal site in the ferroxidase center. Iron storage involves the uptake of iron (II) at the protein shell, its oxidation by molecular oxygen at the ferroxidase centers, and the movement of iron (III) into the cavity for deposition as ferrihydrite.	2.78147e-62
NC_014550.1\|WP_102599145.1\|2988158_2988461_+\|hypothetical-protein	gnl\|CDD\|375250	pfam17681, GCP_N_terminal, Gamma tubulin complex component N-terminal. This is the N-terminal domain found in components of the gamma-tubulin complex proteins (GCPs). Family members include spindle pole body (SBP) components such as Spc97 and Spc98 which function as the microtubule-organizing center in yeast. Furthermore, family members such as human GCP4 (Gamma-tubulin complex component 4) have been structurally elucidated. Functional studies have shown that the N-terminal domain defines the functional identity of GCPs, suggesting that all GCPs are incorporated into the helix of gamma-tubulin small complexes (gTURCs) via lateral interactions between their N-terminal domains. Thereby, they define the direct neighbors and position the GCPs within the helical wall of gTuRC. Sequence alignment of human GCPs based on the GCP4 structure helped delineate conserved regions in the N- and C-terminal domains. In addition to the conserved sequences, the N-terminal domains carry specific insertions of various sizes depending on the GCP, i.e. internal insertions or N-terminal extensions. These insertions may equally contribute to the function of individual GCPs as they have been implied in specific interactions with regulatory or structural proteins. For instance, GCP6 carries a large internal insertion phosphorylated by Plk4 and containing a domain of interaction with keratins, whereas the N-terminal extension of GCP3 interacts with the recruitment protein MOZART1.	0.000695653
NC_014550.1\|WP_146041039.1\|2984124_2984664_-\|hypothetical-protein	gnl\|CDD\|310737	pfam06347, SH3_4, Bacterial SH3 domain. This family consists of several hypothetical bacterial proteins of unknown function. These are composed of SH3-like domains.	4.93006e-05
NC_014550.1\|WP_013349994.1\|2990936_2991476_+\|DUF1697-domain-containing-protein	gnl\|CDD\|377954	pfam08002, DUF1697, Protein of unknown function (DUF1697). This family contains many hypothetical bacterial proteins.	1.5053e-34
NC_014550.1\|WP_041648984.1\|2972113_2972905_-\|alpha/beta-fold-hydrolase	gnl\|CDD\|274729	TIGR03695, menH_SHCHC, 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase. This protein catalyzes the formation of SHCHC, or (1 R,6 R)-2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate, by elmination of pyruvate from 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate (SEPHCHC). Note that SHCHC synthase activity previously was attributed to MenD, which in fact is SEPHCHC synthase. [Biosynthesis of cofactors, prosthetic groups, and carriers, Menaquinone and ubiquinone].	1.19027e-32
NC_014550.1\|WP_041648994.1\|2985584_2988029_-\|RNA-binding-transcriptional-accessory-protein	gnl\|CDD\|225094	COG2183, Tex, Transcriptional accessory protein [Transcription].	0

>NC_014550.1|WP_146040882.1|2977395_2978154_-|hypothetical-protein
MMRQQKTKPKLFTVLVLLIAGVAALGHVGATLAFTGPSTPIKSSLQPELNKYFLGPLDQGWSLFAPGPYSQDEYFTMRACLSSAEICAKGSKHGAKFSEWRDVTAEEMESRAGNMFANRESKQSKSIHGRLWSAASNLTADSRSQIARPFIQGTPVFGVDLNSDEAREKYSATALSNLRAYKRMEDTAVGFASLYAIEQWGGASMVEIKLRREPIVPFAQRNDENSTTKTRETYIGWRDTKEFSQAAVLVWS
>NC_014550.1|WP_041648986.1|2976331_2977405_-|HTTM-domain-containing-protein
MELKHQTSSAPSIGGWISKNRAFFPNALTWVYRWFTANRHAPYGLAVMRMASGLFILGWLIANIPVATKIWGPGSEYLEPYRSVLGYKWPLDILRDAGLGFFVFWYVMAIVLAIVFVVGWQTRFVTPLFFIFYTAINAQNTPVSDGGNYFIRIMLIYLIFADLSKHWSVDSWLRRRAGKTKKEIEAVTVLHNLALCLVVAQLCMVYLEAGLYKVQGKLWQNGTAMYYPVSSEAYGVFPWLSDLITTNSWIVALTTYVTVVAQIAFPFMLFHKISRRIALVTILGMHIGIAVVMGLPFFSGIMASADAVLVSSATWLTIQRWLYGVWNDRFRTKKPSLKISEKIEINEKSAEKVSSNA
>NC_014550.1|WP_013349983.1|2974847_2976230_+|NAD-dependent-succinate-semialdehyde-dehydrogenase
MSAPTYKVLNPATGEVVEEFNAATDDQVQQALTAAQSAYESWQDVDITERAKIVSKVGALFAERAAELGKIMTTEMGKPLSEAVGEAEFCQEIFEYFATEGPTLAADQEIKSFSGGKAIVQKRPVGPLLGIMPWNFPLYQVARFAAPNLMLGNTIILKHAESCPRSALAIQEIMDEAGVPAGVYNNLFATHDQISTIIADSRVQGVSLTGSERAGAIIGEQAGRNLKKAVLELGGSDPFVVLDSDDVSGIVDTAWGYRIDNTGQACNSNKRMIVMDDIYDEFVSELTKRAEGLKPGDPMEEAEGTFAPLSSRQAAEALHEQVQDAVAKGATLHAGGVLHDGPSAYYSPAVLTGITKDMRAYYEELFGPVAVVYKVSSDEEATELANDTIYGLGGSVHSTDVERASKVAQKLQSGMTNVNAASAEGAEMPFGGVKRSGFGRELGPLGMDEFVNKRLFYVGE
>NC_014550.1|WP_173362811.1|2973546_2974575_+|L-glyceraldehyde-3-phosphate-reductase
MHRPYTAAADRYEHYGYRRVGDSGLRLPPLSLGLWWNFGDNRPFDTQREILRHAFDNGINHFDLANNYGPPAGSAEENFGRMMAKDFKPYRNELVISSKAGYDMWPGPHGTFGSRKYLLASCEASLQKMNLDYVDIFYSHRFDPKTPLEETIGALDTLVRQGKATYVGISSYSAERTAEAVAIAKDLGTPLVIHQPSYNILNPWVEHGLLQTLQEERMGAIAFTPLAQGLLTDKYLETTDVVRQGGRRSLEAQLTEENLTKVRRLNEVAQKRGQSLAQMALAWLLRDGAATSVLIGASSTKQLDENLGALENVDFTEAELAEIAKIAQGDAGIDWWRASAIG
>NC_014550.1|WP_013349981.1|2973051_2973213_+|hypothetical-protein
MSEQTGAGLAGGAEEEKQRLAAEEKKRHDEHDEELVEEWEDESFPASDPPSNY
>NC_014550.1|WP_041648984.1|2972113_2972905_-|alpha/beta-fold-hydrolase
MPMINNPADGSEIFFDDDQDGGEPILFLHGSALSRSIWRGLGYTKALGEGHRTIRMDLRGHGKSAKSHDVADYTMDKVVGDIQAVLDHLGIERIHIVGYSFGARTGLHMAMHHPEQVISLIMLGGTYEITDGEIGKLFFPGYLEVLRNGDIEGFVIGQEKNGRLDPSTRLAFKSNDPLALAAYYEAAETLQNIDLADLAKIRIPTLLLIGTRDQPRFDQNKIMVRTLPDARMVVLPERTHGSTLFPIEPVVNAIQSFWTGRQR
>NC_014550.1|WP_013349979.1|2969558_2972117_-|ATP-dependent-helicase-HrpB
MNPVRFDLEKISSGLAFGPSREELYASVAAHPAQPLVIQAPPGSGKTTIVPPTVANALEQAGLTGKIMVTQPRRVAARAAARRLAQLDGSALGERVGFAVRGERRASAQTQIEFVTAGLMLRKLLADPDLDGVSAVIIDEVHERSIDTDLLLAMVNQVSELRDDLSLIVMSATLHAQELSQLLAREKPAAVLSAQTAQHEVQEAFDSFPGTRNTEHGLKDEYLRHVATVAVKHSATANAAGSTPVDTLVFVPGVREVERVCSQVAATGGQALALHSQISSKEQDQILSEPAAGSAARIIVATSIAESSVTVPRVHLVVDAGYAREPRRDSSRGFSGLMTVVASRSAATQRAGRAGRLGPGKVVRTLDPKSFAAAPAHSTPEIRTGDLAAAGLSLAAWGTPRGEGLSMWEAPPAATMAHDEQVLRALDAVDDSGQITSLGEQMMKIPTDPRTARALLEGNQIFGTRAAAEAVALLSSSERIASADLNELLSAVRRSSHPANRAWKHEAQRLEKLLGVAGNSAGRQPASAAQGLAGVCALAYPQWIARKVGHEEYLLASGTRAALPRGSQLVHEEFIAVAEVSRTGSKSMIRRAIGIDFETVLELLPQLHQKRETAELVDGKISARQVESFGAIELAAHPIKATEELGKEAVANAIAIQGLGFFGTHDKFEALRRRMDTAHRLLGEPYIAVDDQSLIASAGNWLQPVLRQVASGKNVAKVDLYSALRTLLPWEHVHDFDALVPERLQVPSGSRISVAYPEIGQSGPAVVSVKLQECFGMDTSPRLVNGKLAVQFHLLSPGGHPLAVTDDLVSFFNGPYAQVRAEMRGRYPKHPWPENPWDHVATAKTKNRLNRQ
>NC_014550.1|WP_013349978.1|2968260_2969493_+|acyl-CoA-dehydrogenase-family-protein
MTQPETGFEFPAGVVEPEYDLWSGDVNIDPTGVFAEVGEADNAWRAKARKFILDEVKKNIHEYWDKADYPLHLIKKLGDADLLRDGLNLEGYEQMSPLAAGLVNMEMARGDGSVSTIVGVQGGLAVRSVLYCGSDEQIQKYALPMLRGELPGAFALTEPTHGSDSVSLETRAAKVQGGYRLSGEKKWIGNGSIGGVSIVWARDEQGKVRGFIVHQDAEGYSATTIENKLSLRAIWQAHIRMENVFVPDEDVMPNAQSFKDTSRVLFATRLGVAWSAVGHATACYESAVNYAKQRVQFGRPLAQSQIVQERLARMQSELATMQVLVMQATKREGAGDLTGPQASLAKYTATRTARVIASNARDLLGGNGILTSNRVARHFADVEAIHTYEGTETVQALIMGRDITGFSAFA
>NC_014550.1|WP_013349977.1|2967468_2968158_+|TetR-family-transcriptional-regulator
MIASSAVPPAALDLLITQGFDATSVDELAAAAGISRSTFFRRFGSKENMVFADQEMIITHVQTTLAASSVDAITTLIDAAHVVFDQYTVNPEGAALRHKLLSSVPSLRERELVSTHRYERAFYGFLNRRELAKTATEKSLCLGVSAGLVAIHNDHLRSWLKDATSTDRTKLANDVRQFLNRFADLLDPEQKTAAQKPAAPTVVVSVLDAGADEQSILQAVSRALSEHGK
>NC_014550.1|WP_013349976.1|2966875_2967307_-|DoxX-family-membrane-protein
MGISIANAALRLVSGAFILNSGINKLRIDEASAAGLQQMAANGVPQLAEVEPAVFGKALSIGEISLGSALLLPLIPTRLAGLGLGAFSGALLASYLRTPGMTESDGIRPTADGTALAKDVWLAGIAVALIFGRKGAKKIKKAK
>NC_014550.1|WP_013349987.1|2983441_2984107_+|response-regulator-transcription-factor
MSHIRIHLADSDHFSRAGIAGVLAEANDMVIEHVSDCMSEAVQAAIDLKPDIVILESSLNGTDLLSSIREITEKTPTTKIVVLATRYRRDEISQAYDAGTSGLISKSSISSELPSALRMLTAGYQLFAQPEDGWEPTARIVRRSTQQTAVRKLSERDRSLARLVAAGLTNSQIARIAHISEGSVKLHLARIMEELDVTNRVQLAVIATESGLVSSADLQIA
>NC_014550.1|WP_146041039.1|2984124_2984664_-|hypothetical-protein
MHQTYGWLPNVYLEAIPAVFDEPVISEDEDELAEPVLSRYSLIEATHVTTATLNLRKGSGTGYPVLKVIDQGSKVRSMLQQGLWSQVQCGKLLGWVPSMYLQQVPSRPAKGGLIAVPNQRALTTIGLNARRGPGDHYSLVRILPADTAVVIVARQGAWRRIDRDGEEMWIPASQLRTVY
>NC_014550.1|WP_013349989.1|2984938_2985439_-|ferritin
MELTGKLAEAFSTQVTLELTAATVYRQLAVEMEVLSLPGIAGWFRAQAGEEIVHAEKFMTHMTDRSAHPKIGEQPAPTLNVKSVADAFAASLAHEQKVSEAIRELYRLAQTEGDIDSIPLLHWFIDEQVEEEATVGEILDRVRMIGNDGSGLLRLDAELGSRSSAS
>NC_014550.1|WP_041648994.1|2985584_2988029_-|RNA-binding-transcriptional-accessory-protein
MHNGSVTSEQKNTANDSATKQRIIAQLAQELSVESKVATWQITAAIELLDSGSTVPFIARYRKEVTGMLSDSQLRLLEERLRYLRELEERRATVLEAIAEAGKLTDQLAEAIAQASTKAELEDLYLPFKSKRRTKAQIAREAGLEPLADLLLSDPMTDPVQAAADYLNAEAGFSTDQDVLSGARSIVTERVSQDVVLAGELRERLWNTGKIGASAASGATAEGQGKYSDYLDYVADLDRLPSHRVLALLRGEREGVLNLQLAEADPRDEAALDEARSGYENAIASSLGLNVPTGAPAAKWISQTVRLAWKARLLTRFESDLRSRLFEAAEDESVKIFAANLRDVLLAAPAGNKAVLGLDPGLRTGVKVAVVDLTGKSVETATIYPHAPANKWNESLAVLIKLAKKHGTSLIAVGNGTAGRETDRLAAEVIKELGGAGVDRVIVSEAGASVYSASELASQELPDMDVSLRGAVSIARRLQDPLAELVKIDPKSIGVGQYQHDVTASKLDRALDAVVEDCVNAVGVDVNTASPALLARVAGVGPLLSRNIVDHRNANGPFATRKDLLKVPRLGAKAFEQCAGFLRITGGKEKLDASSVHPEAYALAKTLQSSAEAQGRRLEELNLQEFVTEQFGEPTIRDVIAELRRPARDPRGEFVTATLKEGVETIKDVMPGMIMEGTVSNVAAFGAFVDLGVHQDGLIHVSAMSNKFISDPREMVSSGQIVKVKVLEVDTVRKRISLTLRLDDELPAAGAEARNSGPGERKGPGAGRSARSGQKRTGQNRTGQNRKAQPAQGKPAAPGNTAMAEALRRAGLGK
>NC_014550.1|WP_102599145.1|2988158_2988461_+|hypothetical-protein
MALLSTGCAFVEDTANGAASQLTDAASKEIVRQACAPVQDGTIDASELRVLSSIVKSVQGGGLPQELVDVLQELANSGDQAPEALQERLVEICDDATVSN
>NC_014550.1|WP_013349992.1|2988504_2988915_+|RNA-binding-S4-domain-containing-protein
MVQIPTSGKVRLDAWLWAVRIYKTRSAATTACRAGHVRLNGDPVKASQTVVPGDRIRVRKDGFDRELEVSALISKRVGAPVAVKCYIDHTPPRERLIIPQVPIRERGAGRPTKKDRREMDRLRDSWQAPDSGVDLP
>NC_014550.1|WP_013349993.1|2988911_2990861_-|S9-family-peptidase
MPQHLPFGSWPSTISAQEVAAGTKPLGGACFFADKLIVQEGRPAEGGRITLMEYGTDGTPGAELIAAPFNVRSRVHEYGGSSWMLIEGATPTVVFANFADQRVYSQTAGGHDAIELTAASGENADPKLRFAEFTPGPEGTVLAIMEDLRAEPVRHIVQIPLDGSAANDLGKIRILSRPARFVAAPRLNPAGTRLSWISWEHPNMPWDSTQLHLADFSEQGILEDTVIAGGEEISVMQPEWLDDDQLAFISDASGWWNPYLYQDSSARTTRLVDRPAEFAGPLWQVGTSWYLVENAHTLLCSYGTGTTKLARLHSDTGGLEDLALPFTRIRPFALRDGWLLAGTSSMTQGEEITLINLETLDHHAVTRAIAKLPEPSMLPEVEEFECKNLSGQSVHALLYRPAQEGYAGMEGELPPFVTFVHGGPTSQASPTLSATVAYYTSRGIGVVDVNYGGSTGYGREYRNRLRGAWGVVDVADTVAVINALVAQGIADPARIGIEGGSAGGWTVLCALTFSDVFTAGISRYGVSDLVGLVQDTHDFESQYMFSLVGPYPEAADLYEKRAPINHVSKISCPVLLLQGDEDKVVPPAQSQVVADALAERGIAHAYILFEGEQHGFRKSQNIIKALESSLAFYAQIFKFQTDVPSIELS
>NC_014550.1|WP_013349994.1|2990936_2991476_+|DUF1697-domain-containing-protein
MTRYAVFLRGVNVGGVKVLMKDLTQLLLDAGFTEVKTLLASGNVVLSVQITDPLAIQEQCNALLASHYQRPIPTLVYTVEEIQQLSAAFPLPLPQPAGEHHGYYTLCETAQDAQEIGTAIDGLENHGEYAIQGRAVAWIVRKGESTTNPIGKLMDAQAKQRIVSTRNHNTLVKVAKLLI
>NC_014550.1|WP_013349995.1|2991535_2992192_+|TRIC-cation-channel-family-protein
MYILIELIGIFFFAVAGSLMAARRGFDLLGSAFLGGVCGLGGGVVRDLILNQSPATFAHPIYFIPPVLAALCVYAFTPSVQKLHRLVQLFDAAGLGLFCVTGTLKALENDFNPVTAVLLGVITSVGGGLMRDVISNVTPDLFNPRDIYALAAMVGAALTAVVWHLGIMNVAVGAGIAGLAFAIRVASIRFGWSVPLAAGHWHRPNPTPPASDGPQRHF
>NC_014550.1|WP_013349996.1|2992188_2993445_-|MFS-transporter
MKKDSVVSPRAGRVGALLGILLLALSLRAAVVSVSPLLSRIETDIQFTEFTTGLLAMLAPIAFAVFGLLTPRLIKSFGLETTLMISLGLAVSGQIARIFMPEVYSFLALSIVTLAGYGMGNVVLPPLVKKYFPDRIGMVTSGYVTMLAIGTWMAPQFSVPLADLTSWQMSIGSWAALSGIVLIPWLVQLFADRGVDRPDNPVHASGHPQPIAKINPWKSKVAWGLAIFLAGNSAQTYVYFTWLPPYLQNRGLDELAAGNMLALFAILGLPVSLLVPLWVPRLKHPIFAVLIFTACWVSGHLGIYLSPTQNTAVWICLAGLGQGTFAIALLMMNLRSRTTYGSGVLSGFAQGLGYAGAAVVPMLFGVVQKATDSWGAAFSMLGVCVIVMLIGAFIINSPRTIEDDSPGTEDLGKLERIN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_014550_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_014550_3

3603149-3604006

Orphan

Consensus_repeat	Method
GTCGGCTCNACCGTAGGN	CRT

14 spacers

The CRISPR arrays of NC_014550_3

>merge|NC_014550|3|3603149-3604006|CRT
CTCGGCTCAGCCGTAGGCTCCTGAGTCGGTTCAACCGTTGGTTCAGGGGTTGGTTCCGGAGTCGGCTCGACCGTAGGCTCTTGAGTCGGCTCGACCGTAGGCTCTTGAGTCGGCTCGACCGTAGGCTCTTGAGTCGGCTCGACCGTAGGCTCTTGAGTCGGCTCGACCGTAGGCTCTGGAGTCGGCTCGACCGTAGGCTCCACCGTAGGTTCAGCGGTTGGTTCCGGAGTCGGCTCGACCGCAGGCTCCACCGTAGGCTCTTGAGTCGGCTCGACCGTAGGCTCTTGAGTCGGCTCGACCGTAGGCTCCACCGTAGGTTCAGCGGTTGGTTCCGGAGTCGGCTCGACCGCAGGCTCCACCGTAGGCTCCACCGTAGGTTCAGCGGTTGGTTCCGGAGTCGGCTCGACCGTAGGCTCTTGAGTCGGCTCGACCGTAGGCTCTTGAGTCGGCTCGACCGTAGGCTCCACCGTAGGTTCTGGAGTCGGCTCCACCGTAGGTTCTGGAGTCGGCTCCACCGTAGGTTCAGCGGTTGGTTCCGGAGTCGGCTCGACCGTAGGCTCCACCGTAGGTTCTGGAGTCGGCTCCACCGTAGGTTCAGCGGTTGGTTCCGGAGTCGGCTCCACCGTAGGCTCCACCGTAGGTTCTGGAGTCGGCTCCACCGTAGGTTCAGGGGTTGGTTCCGGAGTCGGCTCCACCGTAGGTTCCGAGGTTAGTTCTGGAGTCGGCTCCACCGTTGGTTCCGGAGTCGGCTCGACCGTAGGCTCCACCGTAGGTTCTGGAGTCGGCTCCACCGTAGGTTCTGGAGTCGGCTCCACCGTAGGTTCAGGGGTTGGTTCCGGAGTCGGCTCCACCGTAGGT

>NC_014550|3|3|3603149-3604006|CRT
CTCGGCTCAGCCGTAGGC	TCCTGAGTCGGTTCAACCGTTGGTTCAGGGGTTGGTTCCGGA
GTCGGCTCGACCGTAGGC	TCTTGAGTCGGCTCGACCGTAGGCTCTTGAGTCGGCTCGACCGTAGGCTCTTGA
GTCGGCTCGACCGTAGGC	TCTTGAGTCGGCTCGACCGTAGGCTCTGGA
GTCGGCTCGACCGTAGGC	TCCACCGTAGGTTCAGCGGTTGGTTCCGGA
GTCGGCTCGACCGCAGGC	TCCACCGTAGGCTCTTGA
GTCGGCTCGACCGTAGGC	TCTTGAGTCGGCTCGACCGTAGGCTCCACCGTAGGTTCAGCGGTTGGTTCCGGA
GTCGGCTCGACCGCAGGC	TCCACCGTAGGCTCCACCGTAGGTTCAGCGGTTGGTTCCGGA
GTCGGCTCGACCGTAGGC	TCTTGAGTCGGCTCGACCGTAGGCTCTTGA
GTCGGCTCGACCGTAGGC	TCCACCGTAGGTTCTGGA
GTCGGCTCCACCGTAGGT	TCTGGAGTCGGCTCCACCGTAGGTTCAGCGGTTGGTTCCGGAGTCGGCTCGACC
GTAGGCTCCACCGTAGGT	TCTGGAGTCGGCTCCACCGTAGGTTCAGCGGTTGGTTCCGGAGTCGGCTCCACC
GTAGGCTCCACCGTAGGT	TCTGGAGTCGGCTCCACCGTAGGTTCAGGGGTTGGTTCCGGA
GTCGGCTCCACCGTAGGT	TCCGAGGTTAGTTCTGGAGTCGGCTCCACCGTTGGTTCCGGAGTCGGCTCGACCGTAGGCTCCACCGTAGGTTCTGGA
GTCGGCTCCACCGTAGGT	TCTGGAGTCGGCTCCACCGTAGGTTCAGGGGTTGGTTCCGGA
GTCGGCTCCACCGTAGGT

Protein	Signature genes	Signature genes Name	Protein_function
NC_014550.1\|WP_013350521.1\|3602198_3602729_-\|ASCH-domain-containing-protein	unknown	unknown	gnl\|CDD\|119345
NC_014550.1\|WP_013350524.1\|3607014_3608379_-\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|133045
NC_014550.1\|WP_041649142.1\|3591038_3592475_-\|IS1380-like-element-ISAar12-family-transposase	unknown	unknown	gnl\|CDD\|379340
NC_014550.1\|WP_013350530.1\|3621164_3621479_-\|hypothetical-protein	unknown	unknown	unknown
NC_014550.1\|WP_013350529.1\|3620019_3621045_-\|hypothetical-protein	unknown	unknown	unknown
NC_014550.1\|WP_013350518.1\|3598229_3599102_-\|formyltetrahydrofolate-deformylase	unknown	unknown	gnl\|CDD\|235676
NC_014550.1\|WP_013347368.1\|3611988_3613296_-\|ISL3-like-element-ISAar19-family-transposase	unknown	unknown	gnl\|CDD\|376574
NC_014550.1\|WP_013350520.1\|3601799_3602096_-\|antibiotic-biosynthesis-monooxygenase	unknown	unknown	gnl\|CDD\|225209
NC_014550.1\|WP_157867263.1\|3593129_3594242_-\|carboxypeptidase	unknown	unknown	gnl\|CDD\|349430
NC_014550.1\|WP_013350523.1\|3605710_3607018_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|251441
NC_014550.1\|WP_013350517.1\|3596536_3598138_+\|PucR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|377939
NC_014550.1\|WP_013350531.1\|3621737_3623120_-\|allantoinase-AllB	unknown	unknown	gnl\|CDD\|238640
NC_014550.1\|WP_157867187.1\|3609295_3610204_-\|PIG-L-family-deacetylase	unknown	unknown	gnl\|CDD\|225031
NC_014550.1\|WP_049862691.1\|3613521_3618159_-\|carboxypeptidase-regulatory-like-domain-containing-protein	unknown	unknown	gnl\|CDD\|375050
NC_014550.1\|WP_081461190.1\|3601426_3601729_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|341047
NC_014550.1\|WP_041649143.1\|3594274_3594769_-\|hypothetical-protein	unknown	unknown	unknown
NC_014550.1\|WP_013350519.1\|3599542_3600211_+\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224715
NC_014550.1\|WP_081461191.1\|3618738_3619938_-\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|99777
NC_014550.1\|WP_013350525.1\|3608375_3609296_-\|ATP-grasp-domain-containing-protein	unknown	unknown	gnl\|CDD\|237195
NC_014550.1\|WP_013350516.1\|3594761_3596309_-\|sodium/proline-symporter	unknown	unknown	gnl\|CDD\|271369

Protein	Function_ID	Function_description	E-value
NC_014550.1\|WP_013350521.1\|3602198_3602729_-\|ASCH-domain-containing-protein	gnl\|CDD\|119345	cd06553, ASCH_Ef3133_like, ASC-1 homology domain, subfamily similar to Enterococcus faecalis Ef3133. The ASCH domain, a small beta-barrel domain found in all three kingdoms of life, resembles the RNA-binding PUA domain and may also interact with RNA. ASCH has been proposed to function as an RNA-binding domain during coactivation, RNA-processing and the regulation of prokaryotic translation.	6.75154e-45
NC_014550.1\|WP_013350524.1\|3607014_3608379_-\|glycosyltransferase-family-2-protein	gnl\|CDD\|133045	cd06423, CESA_like, CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.	6.93434e-54
NC_014550.1\|WP_041649142.1\|3591038_3592475_-\|IS1380-like-element-ISAar12-family-transposase	gnl\|CDD\|379340	pfam13701, DDE_Tnp_1_4, Transposase DDE domain group 1. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis.	5.0441e-60
NC_014550.1\|WP_013350518.1\|3598229_3599102_-\|formyltetrahydrofolate-deformylase	gnl\|CDD\|235676	PRK06027, purU, formyltetrahydrofolate deformylase; Reviewed.	4.37909e-168
NC_014550.1\|WP_013347368.1\|3611988_3613296_-\|ISL3-like-element-ISAar19-family-transposase	gnl\|CDD\|376574	pfam01610, DDE_Tnp_ISL3, Transposase. Transposase proteins are necessary for efficient DNA transposition. Contains transposases for IS204, IS1001, IS1096 and IS1165.	7.8308e-78
NC_014550.1\|WP_013350520.1\|3601799_3602096_-\|antibiotic-biosynthesis-monooxygenase	gnl\|CDD\|225209	COG2329, COG2329, Uncharacterized enzyme involved in biosynthesis of extracellular polysaccharides [General function prediction only].	1.21168e-21
NC_014550.1\|WP_157867263.1\|3593129_3594242_-\|carboxypeptidase	gnl\|CDD\|349430	cd03857, M14-like, Peptidase M14-like domain; uncharacterized subfamily. Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs). The M14 family are zinc-binding carboxypeptidases (CPs) which hydrolyze single, C-terminal amino acids from polypeptide chains, and have a recognition site for the free C-terminal carboxyl group, which is a key determinant of specificity. Two major subfamilies of the M14 family, defined based on sequence and structural homology, are the A/B and N/E subfamilies. Enzymes belonging to the A/B subfamily are normally synthesized as inactive precursors containing preceding signal peptide, followed by an N-terminal pro-region linked to the enzyme; these proenzymes are called procarboxypeptidases. The A/B enzymes can be further divided based on their substrate specificity; Carboxypeptidase A-like (CPA-like) enzymes favor hydrophobic residues while carboxypeptidase B-like (CPB-like) enzymes only cleave the basic residues lysine or arginine. The A forms have slightly different specificities, with Carboxypeptidase A1 (CPA1) preferring aliphatic and small aromatic residues, and CPA2 preferring the bulky aromatic side chains. Enzymes belonging to the N/E subfamily enzymes are not produced as inactive precursors and instead rely on their substrate specificity and subcellular compartmentalization to prevent inappropriate cleavage. They contain an extra C-terminal transthyretin-like domain, thought to be involved in folding or formation of oligomers. MCPs can also be classified based on their involvement in specific physiological processes; the pancreatic MCPs participate only in alimentary digestion and include carboxypeptidase A and B (A/B subfamily), while others, namely regulatory MCPs or the N/E subfamily, are involved in more selective reactions, mainly in non-digestive tissues and fluids, acting on blood coagulation/fibrinolysis, inflammation and local anaphylaxis, pro-hormone and neuropeptide processing, cellular response and others. Another MCP subfamily, is that of succinylglutamate desuccinylase /aspartoacylase, which hydrolyzes N-acetyl-L-aspartate (NAA), and deficiency in which is the established cause of Canavan disease. Another subfamily (referred to as subfamily C) includes an exceptional type of activity in the MCP family, that of dipeptidyl-peptidase activity of gamma-glutamyl-(L)-meso-diaminopimelate peptidase I which is involved in bacterial cell wall metabolism.	5.51306e-51
NC_014550.1\|WP_013350523.1\|3605710_3607018_-\|hypothetical-protein	gnl\|CDD\|251441	pfam02638, GHL10, Glycosyl hydrolase-like 10. This is family of bacterial glycosyl-hydrolase-like proteins falling into the family GHL10 as described above,.	0.00464921
NC_014550.1\|WP_013350517.1\|3596536_3598138_+\|PucR-family-transcriptional-regulator	gnl\|CDD\|377939	pfam07905, PucR, Purine catabolism regulatory protein-like family. The bacterial proteins found in this family are similar to the purine catabolism regulatory protein expressed by Bacillus subtilis (PucR). PucR is thought to be a transcriptional activator involved in the induction of the purine degradation pathway, and may contain a LysR-like DNA-binding domain. It is similar to LysR-type regulators in that it represses its own expression. The other members of this family are also annotated as being putative regulatory proteins.	3.24894e-30
NC_014550.1\|WP_013350531.1\|3621737_3623120_-\|allantoinase-AllB	gnl\|CDD\|238640	cd01315, L-HYD_ALN, L-Hydantoinases (L-HYDs) and Allantoinase (ALN); L-Hydantoinases are a member of the dihydropyrimidinase family, which catalyzes the reversible hydrolytic ring opening of dihydropyrimidines and hydantoins (five-membered cyclic diamides used in biotechnology). But L-HYDs differ by having an L-enantio specificity and by lacking activity on possible natural substrates such as dihydropyrimidines. Allantoinase catalyzes the hydrolytic cleavage of the five-member ring of allantoin (5-ureidohydantoin) to form allantoic acid.	0
NC_014550.1\|WP_157867187.1\|3609295_3610204_-\|PIG-L-family-deacetylase	gnl\|CDD\|225031	COG2120, COG2120, Uncharacterized proteins, LmbE homologs [Function unknown].	1.94577e-36
NC_014550.1\|WP_049862691.1\|3613521_3618159_-\|carboxypeptidase-regulatory-like-domain-containing-protein	gnl\|CDD\|375050	pfam17210, SdrD_B, SdrD B-like domain. This family corresponds to the B-like domain from the SdrD protein. This domain has three calcium binding sites within a greek key beta sandwich fold.	6.87013e-30
NC_014550.1\|WP_081461190.1\|3601426_3601729_+\|hypothetical-protein	gnl\|CDD\|341047	cd17504, MFS_MMR_MDR_like, Methylenomycin A resistance protein (also called MMR peptide)-like multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This subfamily is composed of putative multidrug resistance (MDR) transporters including Chlamydia trachomatis antiseptic resistance protein QacA_2, and Serratia sp. DD3 Bmr3. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. This subfamily belongs to the Methylenomycin A resistance protein (also called MMR peptide) and similar multidrug resistance (MDR) transporters (MMR-like MDR transporter) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	3.19719e-08
NC_014550.1\|WP_013350519.1\|3599542_3600211_+\|GntR-family-transcriptional-regulator	gnl\|CDD\|224715	COG1802, GntR, Transcriptional regulators [Transcription].	2.19749e-35
NC_014550.1\|WP_081461191.1\|3618738_3619938_-\|response-regulator-transcription-factor	gnl\|CDD\|99777	cd06170, LuxR_C_like, C-terminal DNA-binding domain of LuxR-like proteins. This domain contains a helix-turn-helix motif and binds DNA. Proteins belonging to this group are response regulators; some act as transcriptional activators, others as transcriptional repressors. Many are active as homodimers. Many are two domain proteins in which the DNA binding property of the C-terminal DNA binding domain is modulated by modifications of the N-terminal domain. For example in the case of Lux R which participates in the regulation of gene expression in response to fluctuations in cell-population density (quorum-sensing), a signaling molecule, the pheromone Acyl HSL (N-acyl derivatives of homoserine lactone), binds to the N-terminal domain and leads to LuxR dimerization. For others phophorylation of the N-terminal domain leads to multimerization, for example Escherichia coli NarL and Sinorhizobium melilot FixJ. NarL controls gene expression of many respiratory-related operons when environmental nitrate or nitrite is present under anerobic conditions. FixJ is involved in the transcriptional activation of nitrogen fixation genes. The group also includes small proteins which lack an N-terminal signaling domain, such as Bacillus subtilis GerE. GerE is dimeric and acts in conjunction with sigmaK as an activator or a repressor modulating the expression of various genes in particular those encoding the spore-coat. These LuxR family regulators may share a similar organization of their target binding sites. For example the LuxR dimer binds the lux box, a 20bp inverted repeat, GerE dimers bind two 12bp consensus sequences in inverted orientation having the central four bases overlap, and the NarL dimer binds two 7bp inverted repeats separated by 2 bp.	4.58948e-14
NC_014550.1\|WP_013350525.1\|3608375_3609296_-\|ATP-grasp-domain-containing-protein	gnl\|CDD\|237195	PRK12767, PRK12767, carbamoyl phosphate synthase-like protein; Provisional.	2.3304e-34
NC_014550.1\|WP_013350516.1\|3594761_3596309_-\|sodium/proline-symporter	gnl\|CDD\|271369	cd11475, SLC5sbd_PutP, Na(+)/proline cotransporter PutP and related proteins; solute binding domain. Escherichia coli PutP catalyzes the Na+-coupled uptake of proline with a stoichiometry of 1:1. The putP gene is part of the put operon; this operon in addition encodes a proline dehydrogenase, allowing the use of proline as a source of nitrogen and/or carbon. This subfamily also includes the Bacillus subtilis Na+/proline cotransporter (OpuE) which has an osmoprotective instead of catabolic role. Expression of the opuE gene is under osmotic control and different sigma factors contribute to its regulation; it is also a putative CcpA-activated gene. This subfamily belongs to the solute carrier 5 (SLC5) transporter family.	2.84386e-146

>NC_014550.1|WP_013350521.1|3602198_3602729_-|ASCH-domain-containing-protein
MTENCAPELPPVDAEAAEQMWFEYLASKGIPRADAPHHIAESFGDHPALADELLNEMLHGTKRATSSLASDYVYYNERVPQPEDHCIVCDGQGQPRAILRVLSVERSSFFEVDAQFAAAEGEGDLSLEYWRAEHEKFWRRTQKSIGIDWKPEDTGKAGGELILERFEICWPEAHVD
>NC_014550.1|WP_013350520.1|3601799_3602096_-|antibiotic-biosynthesis-monooxygenase
MSIVVINVLSVPGEAGTELEKRFAARKHVVDSSPGFEGFKLLRPVNGGDKYFVYTQWATREDFENWREQRADAAHSGAAGQKPVASGAELLEFEIVEL
>NC_014550.1|WP_081461190.1|3601426_3601729_+|hypothetical-protein
MLVFGIGMGASYAAMPALIARSVAAQELGSSVSFNQVLRTVGSSFGTAISAAIIATHPGLLGEASPEGINMTFLLGALLCIVLGAALLADSARRRLRKNR
>NC_014550.1|WP_013350519.1|3599542_3600211_+|GntR-family-transcriptional-regulator
MPRPIELTSAAAEPGSMAARAYNALRDRLVLLEIAPTHPIHEPQLAEELGVGRTPMREALKRLETDHLVVSYPRRGTFATAVDFHELNYISEMRQVLEPLAARNAAANKDPQIRQELAGYLEQIDTLDPALDQRSLLLLDVRIHRLIYKAAANKHLEETLVRLDNLVTRIWCLVIDQMPPIAEHISEHSALLRAILDGDAQLAARLVSEHVAHFEQALRRAP
>NC_014550.1|WP_013350518.1|3598229_3599102_-|formyltetrahydrofolate-deformylase
MTEPNNKYVLTLTCAERPGIVHAVTGLLLKHHGDIRELKQHDDQRSGTLFMRIEFDVAEARDAPAEIAELESSLGKLADEHQATWGLRPSGKKKRVVVMVSKFGHCLHDLLFRARMGELPVEIAAVVSNHPDHRQQVEWNGIPFFHVPVTAQSKPEAEAKLMDLVDRFEVDLVVLARYMQVLSDDLTRKLTGRAINIHHSFLPSFKGAKPYHQAFERGVKTVGATAHYVNSELDEGPIITQRVQEVDHSYEPEHLVAAGRDTECKALSDAVRWHCEDRVFLSGSRTVVLR
>NC_014550.1|WP_013350517.1|3596536_3598138_+|PucR-family-transcriptional-regulator
MTLVEKTRDARTNCPDQSIATMDQLLQLPAVLAGNPQLFADQASLNRHVGWVHVLENSDPRTYLRGQELVLTTGIGWGPETCFEQYVTELVELDSAGLLLELGTHCPAVPAALIQSCKEHSFPLVALHEPVAFVEITVALHQLLFTSQTRRIEAGGEVTAHFTALMQLGAPAETILRDCARLLNATVVLEDSGYNVLRHASAVPMPADFFEHWQDRSRSLHVTGNAGRQVIPVQIHGRHFGSLIAPDTATHPAGSLHVLTMAGIALGTELLRKQEPASLAFDTACELLDDLMLRKDADSDLLAGKFEASGFPVHHRQLRGFAIPLASCADLRAAARQIERTIGKDLRPVIGARNAPASKLFGFFSAIPGKLPPDWPQTLHLDEVAGYFDGPLYLGAAVNDFGLLADSIRQAIGGCELSLAANQPVVLAEEYPLALLAHELRHEPAMQRLPQQVLAPILALDPARRTECLRVLRAYLASPTNRSQAATRCQLSRSVFYQRLGLLESLLDMDLNDAQSLTILSLGLAVYQQSVAA
>NC_014550.1|WP_013350516.1|3594761_3596309_-|sodium/proline-symporter
MSIEILFLVIYFVAMAGIGVWAMKRGKQDAEGFLLGGRSLGPGVTALRLQSSSMSGYMFMGAGSMGYTQGYFSMWYALGDLGGGILNLSVLGRRMRKLSQILGSITSIEYLEHRYPSKWIRLIAAPVALFCMFFYVLAQFIAGGRGLEMVSGVSFPVALAIAIGVIVLYTFLGGYLAVAYTDFVQAIIMVVGMVWILVATLIAIGGFTKGNEAVGAINPNLLTMWGADLGYQGQWGVILGALLVFSIGYMGWPHVVVSHMAMKKPSVARTAGAYSLIFNLLFIPGPYLVGMFALILLPNLANPETAIFEVADAVLPTFAVGIVMAAIMAAIMSTADALLLQAGTIASQDIYARFISKKMSDRQMVWVSRVTVLALAIIGFAIAAFEPPAVAAVVIFSTTVLGSAFVPSYVCAVWWKKANTVGAISSMIAGTAVSVLWQVSGAPETTGIDPMVTGILASTLAMVIGSLATQKSNPVPEHIGRALEETAKIGPIPKKMLIGQDSLLAGQAEMAARDE
>NC_014550.1|WP_041649143.1|3594274_3594769_-|hypothetical-protein
MNELVLETLVGAQDAQRILAAKAPGMKVVSAKLRHHPFAGFIFDVPQLAGQTGQAHALVDYYSGKAFVSDPWQVQEGASAQALDQVADPRWNTIDFDTARKRAAALLSTAALRRARLAWRGGIKEQRSVAKVWKPNWVIEAKLEGTSYRVMVDGLNGGYFFIGS
>NC_014550.1|WP_157867263.1|3593129_3594242_-|carboxypeptidase
MIRPITGRHRKFNEEYFKALPTRVLKKSSCIFAGSALLLGLGLAPANAVGEGPNHNGNETVNTSILHTHESMAAELRKQDAKQSAMELEVIGHSAKGRELFLAKYLSDPANPTIMFLTQQHGNEQLTTEGALEVIKHLGTGRMAKVLEDVNILVVPMLNPDGAMGDVDFPLDDYIASGDRHLTRYNANNVDINRDHVAKTQPEIQALHNNVLSAYDIDYMIDLHHQGTRSAVDGKLVSGSILYPTTEDVSEEVREGSKRLGAVVYQNVDPTGWGHLGKYVGGTANTIARNGIAAEYGISTLLFEMRGMSDHYRSDYVLGQKPNGYLRQQTILTLESTIKAVADGSVETMDTSFWDSLPEQASLPGEENDE
>NC_014550.1|WP_041649142.1|3591038_3592475_-|IS1380-like-element-ISAar12-family-transposase
MNNNTGLYPYVPTMTTNQALVSHAGLTTLSDLLNALGFRKLCDNRLSQFVPALAVHRPGKMIADLSLMLAAGGEQVSDTDQLRTTQGLFGPVASDPTFSRFFSRISKHPGAFDYAFATMHRQVRAKLWAAAGKRNPAIRASRTNPLTIDIDASLVNVHSDKEGAKGNYKGGYGYSPMIAMADYGKTNGTGEVLAVRLRPGNKAANSAKDHISILTEALEQLPDEFYDEQTTLIGEKIMVRTDSAGATREFLKHVDSLGLQFSTSYTLPVVKERFVRWINQKKYWEPALTADGEHRNNAWVIDASKVIELNDYPPGTRIYLRAEPLHPGAKASLFDTDGNRVTAFLTNSPRYDPAFLDARHRARGRCENRIKSLKAAGLGKLPFASFAANQAWANLAMFALNLTLWLQLVVLPAGHQAGSWDLKRWRYRVWSMAGKLTKSGRQPRLLINDQTPEARLVTLLKEQINGLRQRWGVGSLRT
>NC_014550.1|WP_013350523.1|3605710_3607018_-|hypothetical-protein
MSTAKNQHQRRKLAVAAIAGLAIIFSLAAYYMTGFQTSTAHQPAPTPDPKVVAPLPPQRACQDSPRADGASSPGDDFSMHLTKTGSQHPQFSRVVNVGFEDITAEDPARIPEIARRLDSVNATGVSLSIGRLDWVAFPWPAQRDVESSEVAQTGRDYVAEAISAFRCDAQGKRRAIYLNIDTLLGRELERQPSLAGINTEGHPSKNWASISAWKEGGLETRLVGLVSEAVRRYAPDGINVTELMFPSYTFGDDDLKNFEKFSERSDWPRSADGTIDSTSEQIYLWRSKTVTSIMKKVADSLDETGPVLTMDVRSPANEDPRGRPDSGQDYGQLLQVVDRLNIWNFRGIASSNRFSTNELVQRYIKQEPEKYSLEIGLWEGEGAMGSSSVSKELRNAEDHSLLHVSITPTSLMDDSIWSVLEGAWSQLPDARQDAG
>NC_014550.1|WP_013350524.1|3607014_3608379_-|glycosyltransferase-family-2-protein
MSSALVLGYYTLTTVILSVGVLKLLLIPLALLFECRRGLLFTRSGKLSALPPGSRANAVIRPRRQTRASRHFGLTPDYKVSVIIPAYNEEVVLRACVESIVRNKGNLAEVVIVDDGSTDGTARLMHELAQEHRLVRAISQENAGKGAALNRGIAVATGEILVFVDADGIFSPVTIPWLLTGFRDGKVGAVCGDDRPVNLDRVLTKMLSVLSHLGTGVVRRALSLIHCLPVVSGNIGAFRADLVRELGGFRTDTVGEDLELTWRFYGAGYRVVFEPRAIVLAESPSTLQALWKQRVRWARGLLQSIKIHWRMHGNLRFGPFGVFLLFNFLTMVVVPLAQILVLAGLLYFIPAGLITFGGGEEATLIGRTAMVIGWIGIGVTLASVVLGIALNTAWRDLANLWTLPLWPFYATGMGLTMLAAVAFEIRGRPAKWNKLQRTGVISSGEFSAILGSRS
>NC_014550.1|WP_013350525.1|3608375_3609296_-|ATP-grasp-domain-containing-protein
MKILVTGVGGPAGSSLARQLHARGHSVIGADMVPTIDPLLDAFHQVPAASDQQYPTRLQEIVLEHSVELVIPTVSEELPVLSAARIRELLELAGARLLISSEESVLISDDKYYTMLTLRGDNVPVPDFARINAGNSEALAQFSPEEQIIIKPRVSRGGRGVRLVTAGDLGAGRVSAGTRDVVQRFAPGREFAPMIFRNPDTGDIEACVVVEKTELREGLVGNAVSVRRCELDDPIAAHVARIVRSAVQSLELVGPVDMDVRLGGDGQPVVLEVNARFGANSQSAPELLDAALRLAGVASTAQAGCA
>NC_014550.1|WP_157867187.1|3609295_3610204_-|PIG-L-family-deacetylase
MTLAIFGIVASITAVFSALSRRGRRWLVRDFTHYKTIIIAWITGNLVLIAAACLHLLSQEQSEIGAVVAIMMAISLLIFCLTMLALQRRPQNNTRPRRFLAVGAHPDDVELACGATIAKLVDAGHDVRIVVMSQGESGGHAPRRIQEARRGAGYLGAQSHTVWSFCDTRLSENSNLMVAAIEEEIAAFEPDVVLTHSATDIHQDHEAVHRAVMRAGRRLPSILCFESPSVGNDFSPSFFVDVENYTNVKVEAIKLHADQRNKPYMTRARIESMANFRGNQVKQQRAEGFEVMRLVSTTVGDF
>NC_014550.1|WP_013347368.1|3611988_3613296_-|ISL3-like-element-ISAar19-family-transposase
MLNPTFTAPDLTTFTNLDGLGLTAIGQHLSAAKAEILCHVTNPIPWCQTCGAAGIPRDTVTRRLAHEPLGWRPTVLVIKHRRYRCANCQRVWREELSQAVAPRQKISRTGLRWALVGLVCHHLSVSRIAEGLGVTWNTANEAVLAEGQRLLIDDPTRFDGVKVLGVDEHVWRHTRTGDKYVTVIVDLTAVRDGTGTARLIDMVPGRSKAVFKTWLADQEEQWKQGIEVVAMDGFTGFKTAAVEELPHAVEVLDPFHVVKLGSEALDQTRQRIQREQHGRRGRKDDPLYKCRRTLTTGLSLATEKQKTKLEDLFKEPEYEPVQLVWSVYQKMVDAYRQPKPEVGRWALEQLINEVGTKVPKGLPELKKLGGTLRRRKTDILAYFDHIGSSNGPTEALNGRLEHLRGIALGFKNLAHYIARSLLETGGFRRRLHPQS
>NC_014550.1|WP_049862691.1|3613521_3618159_-|carboxypeptidase-regulatory-like-domain-containing-protein
MLAVLLSFGSVMGMGGTIAAAATPGISVDVNLGNEKFDGTSVVTENQQLTMMLQYDGTKVVPGSTVAIKLGANVSVASVPAGNDAVKSIQQDPNDPNTVLVTFADPWPAGSGQGVLALDFVVNPVENSSLDKISWSVDGEESSLEVIIKNGGDEFANVNDGSSKHISKNGNLNKFMKYDPDTQKVSVDPAVIGAPVEYTLTVGTNAANPGYAISDVLPETMSYIAGSFTAAQSTWDENGLNKAQSAVEFAPVVNGSTFAGELDLPGPSQTVITYKAAVADESARAALEAQLQAEADKVNKENGGSYRVNLKNTATLGEADREATMSIGGNIAGTVSGLPGPNSGGLKKSANWSSQNVDPAEDGTLDPAQDITYTIASDLRSWDGSNVKKTLTDNVIISDALPTQATWNTGDPSFVTATGIELEQIAPVALAAFAGDDYVGTYFVEGQKMHINIGKGTDLNVSVSAKATIHTVSGLSKGWTDVPGQSKYQLANRAEWKLNTEYGPGKNGYNNVVNLLAQESNEEGFNAPNYFKKRSDAAMVEIDPGTSAPVKYTFTVGAGKGIDLTKSTIIDYVDTKVFEVSDLEQIASQITATYEWWRTMAPEDFTVSLNDQQQLVIKLSEAGAGKVAEWGIDKQFSLDLTLNTKEFAGKQTLQIKNKATLFGEDGKALYWSEAVSEATSYGDEAEIRKSVRDSPNQDWTQNLRAEVDPDGKLVQPKYVYNVALIPHGNYTGVKIFDVVDVLPAGMKFLGFVPDSSVDSHINASMDVQDLKGNVQARYDAPSADAPSGTVVLYQKQGTVLDASQGAASVNVLVEIVDFEADVAIENIIGSTKATITPTDGYPLSISKVDAEDTLNVISDENARFQILDAEGTVVVDDVFVMDGALRVASGEEIKNVTVPAPGTYKVKEVVAPAGYELSEELLEVTVAADGSSEAAVFYNVPGEAPAKTFAVGDYVWVDGNKDGVQGDAEVLEGVKVALLDGNGEVVSETATDANGRYIFDELPAGDYQVKFELTEEQAAKYEFTSQDAGEDDATDSDADPQTGLTIKFTLDEQNTALTKEYSDQEVKATEGIDPTWDAGVVLKQEPKVSVGDYVWVDENKDGIQDDAEPGIENVVLTLVGPEGEPVIDVNGDPVGPTTTDENGFYTFENLPVLEDGQSYTVIIDQEASKEPLAPYVPTVENGTDREGDSSTWEAKSEGLTNDGDRDPTLDFGFVVKPVPTEPVEPTEPTVDPTEPTVDPTEPVEPTEPTVDPTEPTVDPTEPTVDPTEPTVDPTEPTVDPTEPTVDPTEPTVDPTEPTVDPTEPTVDPTEPTVDPTEPTVDPTEPTVDPTEPTVDPTEPTVDPTEPTVDPTEPTVDPTEPTVDPTEPTVDPTEPTVDPTEPTVDPTEPVEPTEPTVDPTEPTVDPTEPTVDPTEPTVDPTEPTVDPTEPTVEPTEPTDPVEPTDSTDPAEPTDSTDPAEPTDSTDPAEPTDSTVGSTEPSESDEAEENVVQKSTPTEDSSEAPQSSEKDDKLADTGFTAMYVLIAGLLLAAAGVLMSRRSNRRHG
>NC_014550.1|WP_081461191.1|3618738_3619938_-|response-regulator-transcription-factor
MLYLRMNGMYVQSGEAALRMRNALHKAYAANAVRPTLAALAQAQAGNSLFMAGLGTEAQQSYELALESARRTGNAFLLSGSAGKLALLHALKGNAAAAAGYLSEHEQHLSQVSRDIASVDREAILARACLALRTLDAELVRFELSKLPRTPDMNELWPVHAYLLAAEKIILGLPSAAEKLILQLRRQRSASSRAPLARGLLDDILAAVALLERSYFSEEFDRSAIDPALLAVKNLVDGDPDAAMAQLRHGRESMGLRVGSNLAKYAEIIARSAAGPTGESVAMIRLIHEDSGGLYEIAMLKLIPGWTAIGSLLELAPEFDHRLTRLAGEQHSGPVARPALTPREREVLWHLREGKSRKEIAEETFRSENTIKTQIRSLYRKLGATSLEQMLLQARTLGL
>NC_014550.1|WP_013350529.1|3620019_3621045_-|hypothetical-protein
MVETTRVHPALPRFLRWADPESRLLLVSAAPETGRTWFARSWIGDRKGVVHDFSEHPYEALEELEKISLQLAQDPQLHAAVVLAPGHTVWHLTLTAKILFAQQRDLLLDQAEIAAMLGDGAGSWEAAAEVYSNCGGWLGAVQLLVRDPRLADPARQKLRAALSTWLAHHDPEWDLSEAAILPVFDQSTVEIFYSHFRSDPHTLNDLVQAGLLQEHPEQGWLMPSMVRALLRERIQAAGAQRMELLEEASLEAVTSVHGLQATADAAIEQQRWSVLNRLVTGHWNELLLLDFAKFIELAQRIPPFISGKNAYFGLGLRILDEFTGNDSGLQAPHLADEYQKD
>NC_014550.1|WP_013350530.1|3621164_3621479_-|hypothetical-protein
MIANTAASMLTQDVDELSLGEVVQASVVLGLVVMAVLLAFGIKTYVHWRRQLRNEKRTGYASPAHFARPGEPANQGRAPRIDVLSPLGDLRRPGTLNRGFEDSQ
>NC_014550.1|WP_013350531.1|3621737_3623120_-|allantoinase-AllB
MSINEAVGRTSSPTATETTYDLVLRGQQVLTAQGIAPREIGVRDGKIVTVQDLGAGLAAERVIEVASDEVLLPGLVDTHVHVNEPGRTEWEGFESATKAAAAGGVTTIVDMPLNSIPPTVNLEALDIKRAAASKNAYVNVGFWGGAIPGNKKDLRELHEAGVFGFKCFLLHSGVDEFPSLSVGEMEEDMAELASFDSLMIVHAEDSDIIGNSPQPVGGKYAGFLDSRPRDAENTAIAQVIERARKTGVRAHVLHLSSSDALQMIREAKAEGVLLTVETCPHYLTLLAEEIPDGATAFKCCPPIRENDNRELLWKGLEEGVIDCIVSDHSPSTIDLKDVENGDFGVAWGGVASLQLGLPLIWSEAKKRGLKLEQVVQWMGVNPSKLAGLSAKGSIEEGKDADFAVFAPEDTFEVDVQKLHHKNPISPYQGKTLSGVVRRSIIAGADVDFQKPTGQLIRRES

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NC_014550_2	2.2\|2979593\|18\|NC_014550\|CRT	2979593-2979610	18	NC_014550.1	2978495-2978512	0	1.0
NC_014550_2	2.2\|2979593\|18\|NC_014550\|CRT	2979593-2979610	18	NC_014550.1	2978591-2978608	0	1.0
NC_014550_2	2.2\|2979593\|18\|NC_014550\|CRT	2979593-2979610	18	NC_014550.1	2978687-2978704	0	1.0
NC_014550_2	2.2\|2979593\|18\|NC_014550\|CRT	2979593-2979610	18	NC_014550.1	2978747-2978764	0	1.0
NC_014550_2	2.2\|2979593\|18\|NC_014550\|CRT	2979593-2979610	18	NC_014550.1	2978795-2978812	0	1.0
NC_014550_2	2.3\|2979629\|42\|NC_014550\|CRT	2979629-2979670	42	NC_014550.1	2979497-2979538	0	1.0
NC_014550_2	2.5\|2979737\|18\|NC_014550\|CRT	2979737-2979754	18	NC_014550.1	2978495-2978512	0	1.0
NC_014550_2	2.5\|2979737\|18\|NC_014550\|CRT	2979737-2979754	18	NC_014550.1	2978591-2978608	0	1.0
NC_014550_2	2.5\|2979737\|18\|NC_014550\|CRT	2979737-2979754	18	NC_014550.1	2978687-2978704	0	1.0
NC_014550_2	2.5\|2979737\|18\|NC_014550\|CRT	2979737-2979754	18	NC_014550.1	2978747-2978764	0	1.0
NC_014550_2	2.5\|2979737\|18\|NC_014550\|CRT	2979737-2979754	18	NC_014550.1	2978795-2978812	0	1.0
NC_014550_2	2.7\|2979833\|18\|NC_014550\|CRT	2979833-2979850	18	NC_014550.1	2978495-2978512	0	1.0
NC_014550_2	2.7\|2979833\|18\|NC_014550\|CRT	2979833-2979850	18	NC_014550.1	2978591-2978608	0	1.0
NC_014550_2	2.7\|2979833\|18\|NC_014550\|CRT	2979833-2979850	18	NC_014550.1	2978687-2978704	0	1.0
NC_014550_2	2.7\|2979833\|18\|NC_014550\|CRT	2979833-2979850	18	NC_014550.1	2978747-2978764	0	1.0
NC_014550_2	2.7\|2979833\|18\|NC_014550\|CRT	2979833-2979850	18	NC_014550.1	2978795-2978812	0	1.0
NC_014550_2	2.11\|2979977\|18\|NC_014550\|CRT	2979977-2979994	18	NC_014550.1	2978495-2978512	0	1.0
NC_014550_2	2.11\|2979977\|18\|NC_014550\|CRT	2979977-2979994	18	NC_014550.1	2978591-2978608	0	1.0
NC_014550_2	2.11\|2979977\|18\|NC_014550\|CRT	2979977-2979994	18	NC_014550.1	2978687-2978704	0	1.0
NC_014550_2	2.11\|2979977\|18\|NC_014550\|CRT	2979977-2979994	18	NC_014550.1	2978747-2978764	0	1.0
NC_014550_2	2.11\|2979977\|18\|NC_014550\|CRT	2979977-2979994	18	NC_014550.1	2978795-2978812	0	1.0
NC_014550_2	2.13\|2980049\|18\|NC_014550\|CRT	2980049-2980066	18	NC_014550.1	2978495-2978512	0	1.0
NC_014550_2	2.13\|2980049\|18\|NC_014550\|CRT	2980049-2980066	18	NC_014550.1	2978591-2978608	0	1.0
NC_014550_2	2.13\|2980049\|18\|NC_014550\|CRT	2980049-2980066	18	NC_014550.1	2978687-2978704	0	1.0
NC_014550_2	2.13\|2980049\|18\|NC_014550\|CRT	2980049-2980066	18	NC_014550.1	2978747-2978764	0	1.0
NC_014550_2	2.13\|2980049\|18\|NC_014550\|CRT	2980049-2980066	18	NC_014550.1	2978795-2978812	0	1.0
NC_014550_2	2.15\|2980121\|18\|NC_014550\|CRT	2980121-2980138	18	NC_014550.1	2978495-2978512	0	1.0
NC_014550_2	2.15\|2980121\|18\|NC_014550\|CRT	2980121-2980138	18	NC_014550.1	2978591-2978608	0	1.0
NC_014550_2	2.15\|2980121\|18\|NC_014550\|CRT	2980121-2980138	18	NC_014550.1	2978687-2978704	0	1.0
NC_014550_2	2.15\|2980121\|18\|NC_014550\|CRT	2980121-2980138	18	NC_014550.1	2978747-2978764	0	1.0
NC_014550_2	2.15\|2980121\|18\|NC_014550\|CRT	2980121-2980138	18	NC_014550.1	2978795-2978812	0	1.0
NC_014550_2	2.17\|2980193\|18\|NC_014550\|CRT	2980193-2980210	18	NC_014550.1	2978495-2978512	0	1.0
NC_014550_2	2.17\|2980193\|18\|NC_014550\|CRT	2980193-2980210	18	NC_014550.1	2978591-2978608	0	1.0
NC_014550_2	2.17\|2980193\|18\|NC_014550\|CRT	2980193-2980210	18	NC_014550.1	2978687-2978704	0	1.0
NC_014550_2	2.17\|2980193\|18\|NC_014550\|CRT	2980193-2980210	18	NC_014550.1	2978747-2978764	0	1.0
NC_014550_2	2.17\|2980193\|18\|NC_014550\|CRT	2980193-2980210	18	NC_014550.1	2978795-2978812	0	1.0
NC_014550_2	2.34\|2980865\|18\|NC_014550\|CRT	2980865-2980882	18	NC_014550.1	2978495-2978512	0	1.0
NC_014550_2	2.34\|2980865\|18\|NC_014550\|CRT	2980865-2980882	18	NC_014550.1	2978591-2978608	0	1.0
NC_014550_2	2.34\|2980865\|18\|NC_014550\|CRT	2980865-2980882	18	NC_014550.1	2978687-2978704	0	1.0
NC_014550_2	2.34\|2980865\|18\|NC_014550\|CRT	2980865-2980882	18	NC_014550.1	2978747-2978764	0	1.0
NC_014550_2	2.34\|2980865\|18\|NC_014550\|CRT	2980865-2980882	18	NC_014550.1	2978795-2978812	0	1.0
NC_014550_2	2.35\|2980901\|54\|NC_014550\|CRT	2980901-2980954	54	NC_014550.1	2979497-2979550	0	1.0
NC_014550_2	2.38\|2981105\|18\|NC_014550\|CRT	2981105-2981122	18	NC_014550.1	2978495-2978512	0	1.0
NC_014550_2	2.38\|2981105\|18\|NC_014550\|CRT	2981105-2981122	18	NC_014550.1	2978591-2978608	0	1.0
NC_014550_2	2.38\|2981105\|18\|NC_014550\|CRT	2981105-2981122	18	NC_014550.1	2978687-2978704	0	1.0
NC_014550_2	2.38\|2981105\|18\|NC_014550\|CRT	2981105-2981122	18	NC_014550.1	2978747-2978764	0	1.0
NC_014550_2	2.38\|2981105\|18\|NC_014550\|CRT	2981105-2981122	18	NC_014550.1	2978795-2978812	0	1.0
NC_014550_1	1.2\|1186363\|18\|NC_014550\|CRT	1186363-1186380	18	NC_014550.1	1186303-1186320	1	0.944
NC_014550_1	1.4\|1186447\|18\|NC_014550\|CRT	1186447-1186464	18	NC_014550.1	1186303-1186320	1	0.944
NC_014550_2	2.3\|2979629\|42\|NC_014550\|CRT	2979629-2979670	42	NC_014550.1	2978471-2978512	1	0.976
NC_014550_2	2.3\|2979629\|42\|NC_014550\|CRT	2979629-2979670	42	NC_014550.1	2978723-2978764	1	0.976
NC_014550_2	2.3\|2979629\|42\|NC_014550\|CRT	2979629-2979670	42	NC_014550.1	2978771-2978812	1	0.976
NC_014550_2	2.9\|2979905\|18\|NC_014550\|CRT	2979905-2979922	18	NC_014550.1	2978495-2978512	1	0.944
NC_014550_2	2.9\|2979905\|18\|NC_014550\|CRT	2979905-2979922	18	NC_014550.1	2978591-2978608	1	0.944
NC_014550_2	2.9\|2979905\|18\|NC_014550\|CRT	2979905-2979922	18	NC_014550.1	2978687-2978704	1	0.944
NC_014550_2	2.9\|2979905\|18\|NC_014550\|CRT	2979905-2979922	18	NC_014550.1	2978747-2978764	1	0.944
NC_014550_2	2.9\|2979905\|18\|NC_014550\|CRT	2979905-2979922	18	NC_014550.1	2978795-2978812	1	0.944
NC_014550_2	2.22\|2980409\|18\|NC_014550\|CRT	2980409-2980426	18	NC_014550.1	2978471-2978488	1	0.944
NC_014550_2	2.22\|2980409\|18\|NC_014550\|CRT	2980409-2980426	18	NC_014550.1	2978711-2978728	1	0.944
NC_014550_2	2.22\|2980409\|18\|NC_014550\|CRT	2980409-2980426	18	NC_014550.1	2978723-2978740	1	0.944
NC_014550_2	2.22\|2980409\|18\|NC_014550\|CRT	2980409-2980426	18	NC_014550.1	2978771-2978788	1	0.944
NC_014550_2	2.35\|2980901\|54\|NC_014550\|CRT	2980901-2980954	54	NC_014550.1	2978723-2978776	2	0.963

1. spacer 2.2|2979593|18|NC_014550|CRT matches to position: 2978495-2978512, mismatch: 0, identity: 1.0

cgttatccgcagtgttca	CRISPR spacer
cgttatccgcagtgttca	Protospacer
******************

2. spacer 2.2|2979593|18|NC_014550|CRT matches to position: 2978591-2978608, mismatch: 0, identity: 1.0

cgttatccgcagtgttca	CRISPR spacer
cgttatccgcagtgttca	Protospacer
******************

3. spacer 2.2|2979593|18|NC_014550|CRT matches to position: 2978687-2978704, mismatch: 0, identity: 1.0

cgttatccgcagtgttca	CRISPR spacer
cgttatccgcagtgttca	Protospacer
******************

4. spacer 2.2|2979593|18|NC_014550|CRT matches to position: 2978747-2978764, mismatch: 0, identity: 1.0

cgttatccgcagtgttca	CRISPR spacer
cgttatccgcagtgttca	Protospacer
******************

5. spacer 2.2|2979593|18|NC_014550|CRT matches to position: 2978795-2978812, mismatch: 0, identity: 1.0

cgttatccgcagtgttca	CRISPR spacer
cgttatccgcagtgttca	Protospacer
******************

6. spacer 2.3|2979629|42|NC_014550|CRT matches to position: 2979497-2979538, mismatch: 0, identity: 1.0

tgttggcatcggtgttcgcatcagcgttatccgcagtgttca	CRISPR spacer
tgttggcatcggtgttcgcatcagcgttatccgcagtgttca	Protospacer
******************************************

7. spacer 2.5|2979737|18|NC_014550|CRT matches to position: 2978495-2978512, mismatch: 0, identity: 1.0

cgttatccgcagtgttca	CRISPR spacer
cgttatccgcagtgttca	Protospacer
******************

8. spacer 2.5|2979737|18|NC_014550|CRT matches to position: 2978591-2978608, mismatch: 0, identity: 1.0

cgttatccgcagtgttca	CRISPR spacer
cgttatccgcagtgttca	Protospacer
******************

9. spacer 2.5|2979737|18|NC_014550|CRT matches to position: 2978687-2978704, mismatch: 0, identity: 1.0

cgttatccgcagtgttca	CRISPR spacer
cgttatccgcagtgttca	Protospacer
******************

10. spacer 2.5|2979737|18|NC_014550|CRT matches to position: 2978747-2978764, mismatch: 0, identity: 1.0

cgttatccgcagtgttca	CRISPR spacer
cgttatccgcagtgttca	Protospacer
******************

11. spacer 2.5|2979737|18|NC_014550|CRT matches to position: 2978795-2978812, mismatch: 0, identity: 1.0

cgttatccgcagtgttca	CRISPR spacer
cgttatccgcagtgttca	Protospacer
******************

12. spacer 2.7|2979833|18|NC_014550|CRT matches to position: 2978495-2978512, mismatch: 0, identity: 1.0

cgttatccgcagtgttca	CRISPR spacer
cgttatccgcagtgttca	Protospacer
******************

13. spacer 2.7|2979833|18|NC_014550|CRT matches to position: 2978591-2978608, mismatch: 0, identity: 1.0

cgttatccgcagtgttca	CRISPR spacer
cgttatccgcagtgttca	Protospacer
******************

14. spacer 2.7|2979833|18|NC_014550|CRT matches to position: 2978687-2978704, mismatch: 0, identity: 1.0

cgttatccgcagtgttca	CRISPR spacer
cgttatccgcagtgttca	Protospacer
******************

15. spacer 2.7|2979833|18|NC_014550|CRT matches to position: 2978747-2978764, mismatch: 0, identity: 1.0

cgttatccgcagtgttca	CRISPR spacer
cgttatccgcagtgttca	Protospacer
******************

16. spacer 2.7|2979833|18|NC_014550|CRT matches to position: 2978795-2978812, mismatch: 0, identity: 1.0

cgttatccgcagtgttca	CRISPR spacer
cgttatccgcagtgttca	Protospacer
******************

17. spacer 2.11|2979977|18|NC_014550|CRT matches to position: 2978495-2978512, mismatch: 0, identity: 1.0

cgttatccgcagtgttca	CRISPR spacer
cgttatccgcagtgttca	Protospacer
******************

18. spacer 2.11|2979977|18|NC_014550|CRT matches to position: 2978591-2978608, mismatch: 0, identity: 1.0

cgttatccgcagtgttca	CRISPR spacer
cgttatccgcagtgttca	Protospacer
******************

19. spacer 2.11|2979977|18|NC_014550|CRT matches to position: 2978687-2978704, mismatch: 0, identity: 1.0

cgttatccgcagtgttca	CRISPR spacer
cgttatccgcagtgttca	Protospacer
******************

20. spacer 2.11|2979977|18|NC_014550|CRT matches to position: 2978747-2978764, mismatch: 0, identity: 1.0

cgttatccgcagtgttca	CRISPR spacer
cgttatccgcagtgttca	Protospacer
******************

21. spacer 2.11|2979977|18|NC_014550|CRT matches to position: 2978795-2978812, mismatch: 0, identity: 1.0

cgttatccgcagtgttca	CRISPR spacer
cgttatccgcagtgttca	Protospacer
******************

22. spacer 2.13|2980049|18|NC_014550|CRT matches to position: 2978495-2978512, mismatch: 0, identity: 1.0

cgttatccgcagtgttca	CRISPR spacer
cgttatccgcagtgttca	Protospacer
******************

23. spacer 2.13|2980049|18|NC_014550|CRT matches to position: 2978591-2978608, mismatch: 0, identity: 1.0

cgttatccgcagtgttca	CRISPR spacer
cgttatccgcagtgttca	Protospacer
******************

24. spacer 2.13|2980049|18|NC_014550|CRT matches to position: 2978687-2978704, mismatch: 0, identity: 1.0

cgttatccgcagtgttca	CRISPR spacer
cgttatccgcagtgttca	Protospacer
******************

25. spacer 2.13|2980049|18|NC_014550|CRT matches to position: 2978747-2978764, mismatch: 0, identity: 1.0

cgttatccgcagtgttca	CRISPR spacer
cgttatccgcagtgttca	Protospacer
******************

26. spacer 2.13|2980049|18|NC_014550|CRT matches to position: 2978795-2978812, mismatch: 0, identity: 1.0

cgttatccgcagtgttca	CRISPR spacer
cgttatccgcagtgttca	Protospacer
******************

27. spacer 2.15|2980121|18|NC_014550|CRT matches to position: 2978495-2978512, mismatch: 0, identity: 1.0

cgttatccgcagtgttca	CRISPR spacer
cgttatccgcagtgttca	Protospacer
******************

28. spacer 2.15|2980121|18|NC_014550|CRT matches to position: 2978591-2978608, mismatch: 0, identity: 1.0

cgttatccgcagtgttca	CRISPR spacer
cgttatccgcagtgttca	Protospacer
******************

29. spacer 2.15|2980121|18|NC_014550|CRT matches to position: 2978687-2978704, mismatch: 0, identity: 1.0

cgttatccgcagtgttca	CRISPR spacer
cgttatccgcagtgttca	Protospacer
******************

30. spacer 2.15|2980121|18|NC_014550|CRT matches to position: 2978747-2978764, mismatch: 0, identity: 1.0

cgttatccgcagtgttca	CRISPR spacer
cgttatccgcagtgttca	Protospacer
******************

31. spacer 2.15|2980121|18|NC_014550|CRT matches to position: 2978795-2978812, mismatch: 0, identity: 1.0

cgttatccgcagtgttca	CRISPR spacer
cgttatccgcagtgttca	Protospacer
******************

32. spacer 2.17|2980193|18|NC_014550|CRT matches to position: 2978495-2978512, mismatch: 0, identity: 1.0

cgttatccgcagtgttca	CRISPR spacer
cgttatccgcagtgttca	Protospacer
******************

33. spacer 2.17|2980193|18|NC_014550|CRT matches to position: 2978591-2978608, mismatch: 0, identity: 1.0

cgttatccgcagtgttca	CRISPR spacer
cgttatccgcagtgttca	Protospacer
******************

34. spacer 2.17|2980193|18|NC_014550|CRT matches to position: 2978687-2978704, mismatch: 0, identity: 1.0

cgttatccgcagtgttca	CRISPR spacer
cgttatccgcagtgttca	Protospacer
******************

35. spacer 2.17|2980193|18|NC_014550|CRT matches to position: 2978747-2978764, mismatch: 0, identity: 1.0

cgttatccgcagtgttca	CRISPR spacer
cgttatccgcagtgttca	Protospacer
******************

36. spacer 2.17|2980193|18|NC_014550|CRT matches to position: 2978795-2978812, mismatch: 0, identity: 1.0

cgttatccgcagtgttca	CRISPR spacer
cgttatccgcagtgttca	Protospacer
******************

37. spacer 2.34|2980865|18|NC_014550|CRT matches to position: 2978495-2978512, mismatch: 0, identity: 1.0

cgttatccgcagtgttca	CRISPR spacer
cgttatccgcagtgttca	Protospacer
******************

38. spacer 2.34|2980865|18|NC_014550|CRT matches to position: 2978591-2978608, mismatch: 0, identity: 1.0

cgttatccgcagtgttca	CRISPR spacer
cgttatccgcagtgttca	Protospacer
******************

39. spacer 2.34|2980865|18|NC_014550|CRT matches to position: 2978687-2978704, mismatch: 0, identity: 1.0

cgttatccgcagtgttca	CRISPR spacer
cgttatccgcagtgttca	Protospacer
******************

40. spacer 2.34|2980865|18|NC_014550|CRT matches to position: 2978747-2978764, mismatch: 0, identity: 1.0

cgttatccgcagtgttca	CRISPR spacer
cgttatccgcagtgttca	Protospacer
******************

41. spacer 2.34|2980865|18|NC_014550|CRT matches to position: 2978795-2978812, mismatch: 0, identity: 1.0

cgttatccgcagtgttca	CRISPR spacer
cgttatccgcagtgttca	Protospacer
******************

42. spacer 2.35|2980901|54|NC_014550|CRT matches to position: 2979497-2979550, mismatch: 0, identity: 1.0

tgttggcatcggtgttcgcatcagcgttatccgcagtgttcacatcggtgttcg	CRISPR spacer
tgttggcatcggtgttcgcatcagcgttatccgcagtgttcacatcggtgttcg	Protospacer
******************************************************

43. spacer 2.38|2981105|18|NC_014550|CRT matches to position: 2978495-2978512, mismatch: 0, identity: 1.0

cgttatccgcagtgttca	CRISPR spacer
cgttatccgcagtgttca	Protospacer
******************

44. spacer 2.38|2981105|18|NC_014550|CRT matches to position: 2978591-2978608, mismatch: 0, identity: 1.0

cgttatccgcagtgttca	CRISPR spacer
cgttatccgcagtgttca	Protospacer
******************

45. spacer 2.38|2981105|18|NC_014550|CRT matches to position: 2978687-2978704, mismatch: 0, identity: 1.0

cgttatccgcagtgttca	CRISPR spacer
cgttatccgcagtgttca	Protospacer
******************

46. spacer 2.38|2981105|18|NC_014550|CRT matches to position: 2978747-2978764, mismatch: 0, identity: 1.0

cgttatccgcagtgttca	CRISPR spacer
cgttatccgcagtgttca	Protospacer
******************

47. spacer 2.38|2981105|18|NC_014550|CRT matches to position: 2978795-2978812, mismatch: 0, identity: 1.0

cgttatccgcagtgttca	CRISPR spacer
cgttatccgcagtgttca	Protospacer
******************

48. spacer 1.2|1186363|18|NC_014550|CRT matches to position: 1186303-1186320, mismatch: 1, identity: 0.944

gccgttggttcctcggtc	CRISPR spacer
gccgttggttcctctgtc	Protospacer
************** ***

49. spacer 1.4|1186447|18|NC_014550|CRT matches to position: 1186303-1186320, mismatch: 1, identity: 0.944

gccgttggttcctcggtc	CRISPR spacer
gccgttggttcctctgtc	Protospacer
************** ***

50. spacer 2.3|2979629|42|NC_014550|CRT matches to position: 2978471-2978512, mismatch: 1, identity: 0.976

tgttggcatcggtgttcgcatcagcgttatccgcagtgttca	CRISPR spacer
tgttcgcatcggtgttcgcatcagcgttatccgcagtgttca	Protospacer
**** *************************************

51. spacer 2.3|2979629|42|NC_014550|CRT matches to position: 2978723-2978764, mismatch: 1, identity: 0.976

tgttggcatcggtgttcgcatcagcgttatccgcagtgttca	CRISPR spacer
tgttcgcatcggtgttcgcatcagcgttatccgcagtgttca	Protospacer
**** *************************************

52. spacer 2.3|2979629|42|NC_014550|CRT matches to position: 2978771-2978812, mismatch: 1, identity: 0.976

tgttggcatcggtgttcgcatcagcgttatccgcagtgttca	CRISPR spacer
tgttcgcatcggtgttcgcatcagcgttatccgcagtgttca	Protospacer
**** *************************************

53. spacer 2.9|2979905|18|NC_014550|CRT matches to position: 2978495-2978512, mismatch: 1, identity: 0.944

cgttttccgcagtgttca	CRISPR spacer
cgttatccgcagtgttca	Protospacer
**** *************

54. spacer 2.9|2979905|18|NC_014550|CRT matches to position: 2978591-2978608, mismatch: 1, identity: 0.944

cgttttccgcagtgttca	CRISPR spacer
cgttatccgcagtgttca	Protospacer
**** *************

55. spacer 2.9|2979905|18|NC_014550|CRT matches to position: 2978687-2978704, mismatch: 1, identity: 0.944

cgttttccgcagtgttca	CRISPR spacer
cgttatccgcagtgttca	Protospacer
**** *************

56. spacer 2.9|2979905|18|NC_014550|CRT matches to position: 2978747-2978764, mismatch: 1, identity: 0.944

cgttttccgcagtgttca	CRISPR spacer
cgttatccgcagtgttca	Protospacer
**** *************

57. spacer 2.9|2979905|18|NC_014550|CRT matches to position: 2978795-2978812, mismatch: 1, identity: 0.944

cgttttccgcagtgttca	CRISPR spacer
cgttatccgcagtgttca	Protospacer
**** *************

58. spacer 2.22|2980409|18|NC_014550|CRT matches to position: 2978471-2978488, mismatch: 1, identity: 0.944

tgttcgcatcagtgttcg	CRISPR spacer
tgttcgcatcggtgttcg	Protospacer
**********.*******

59. spacer 2.22|2980409|18|NC_014550|CRT matches to position: 2978711-2978728, mismatch: 1, identity: 0.944

tgttcgcatcagtgttcg	CRISPR spacer
tgttcgcatcggtgttcg	Protospacer
**********.*******

60. spacer 2.22|2980409|18|NC_014550|CRT matches to position: 2978723-2978740, mismatch: 1, identity: 0.944

tgttcgcatcagtgttcg	CRISPR spacer
tgttcgcatcggtgttcg	Protospacer
**********.*******

61. spacer 2.22|2980409|18|NC_014550|CRT matches to position: 2978771-2978788, mismatch: 1, identity: 0.944

tgttcgcatcagtgttcg	CRISPR spacer
tgttcgcatcggtgttcg	Protospacer
**********.*******

62. spacer 2.35|2980901|54|NC_014550|CRT matches to position: 2978723-2978776, mismatch: 2, identity: 0.963

tgttggcatcggtgttcgcatcagcgttatccgcagtgttcacatcggtgttcg	CRISPR spacer
tgttcgcatcggtgttcgcatcagcgttatccgcagtgttcacatccgtgttcg	Protospacer
**** ***************************************** *******

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_014550_1	1.3\|1186399\|30\|NC_014550\|CRT	1186399-1186428	30	JN968479	Haloarcula hispanica icosahedral virus 2, complete genome	30026-30055	5	0.833
NC_014550_2	2.4\|2979689\|30\|NC_014550\|CRT	2979689-2979718	30	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	668238-668267	5	0.833
NC_014550_2	2.4\|2979689\|30\|NC_014550\|CRT	2979689-2979718	30	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	1144835-1144864	5	0.833
NC_014550_1	1.3\|1186399\|30\|NC_014550\|CRT	1186399-1186428	30	NZ_CP031166	Euzebya sp. DY32-46 plasmid pEDY32-46I, complete sequence	61789-61818	7	0.767
NC_014550_1	1.3\|1186399\|30\|NC_014550\|CRT	1186399-1186428	30	NC_013859	Azospirillum sp. B510 plasmid pAB510e, complete sequence	162888-162917	7	0.767
NC_014550_1	1.3\|1186399\|30\|NC_014550\|CRT	1186399-1186428	30	CP000664	Rhodobacter sphaeroides ATCC 17025 plasmid pRSPA03, complete sequence	113293-113322	7	0.767
NC_014550_2	2.4\|2979689\|30\|NC_014550\|CRT	2979689-2979718	30	NZ_CP016613	Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence	1430804-1430833	7	0.767
NC_014550_2	2.4\|2979689\|30\|NC_014550\|CRT	2979689-2979718	30	NZ_CP021449	Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence	976675-976704	7	0.767
NC_014550_2	2.4\|2979689\|30\|NC_014550\|CRT	2979689-2979718	30	NZ_CP049790	Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence	856075-856104	7	0.767
NC_014550_2	2.4\|2979689\|30\|NC_014550\|CRT	2979689-2979718	30	NZ_CP049788	Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence	619336-619365	7	0.767
NC_014550_2	2.4\|2979689\|30\|NC_014550\|CRT	2979689-2979718	30	NZ_CP016915	Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence	1451584-1451613	7	0.767
NC_014550_2	2.4\|2979689\|30\|NC_014550\|CRT	2979689-2979718	30	NZ_CP016905	Ralstonia solanacearum strain KACC 10709 plasmid unnamed1	1847927-1847956	7	0.767
NC_014550_2	2.4\|2979689\|30\|NC_014550\|CRT	2979689-2979718	30	NZ_CP022482	Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence	1822441-1822470	7	0.767
NC_014550_2	2.4\|2979689\|30\|NC_014550\|CRT	2979689-2979718	30	CP023015	Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence	787509-787538	7	0.767
NC_014550_2	2.4\|2979689\|30\|NC_014550\|CRT	2979689-2979718	30	NZ_CP022781	Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence	768583-768612	7	0.767
NC_014550_2	2.4\|2979689\|30\|NC_014550\|CRT	2979689-2979718	30	NZ_CP052129	Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence	899558-899587	7	0.767
NC_014550_2	2.4\|2979689\|30\|NC_014550\|CRT	2979689-2979718	30	NZ_CP052111	Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence	759399-759428	7	0.767
NC_014550_2	2.4\|2979689\|30\|NC_014550\|CRT	2979689-2979718	30	NZ_CP052113	Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence	759399-759428	7	0.767
NC_014550_2	2.4\|2979689\|30\|NC_014550\|CRT	2979689-2979718	30	CP023013	Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence	1199218-1199247	7	0.767
NC_014550_2	2.4\|2979689\|30\|NC_014550\|CRT	2979689-2979718	30	NZ_CP049794	Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence	1815774-1815803	7	0.767
NC_014550_2	2.4\|2979689\|30\|NC_014550\|CRT	2979689-2979718	30	NZ_CP022766	Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence	1267656-1267685	7	0.767
NC_014550_2	2.4\|2979689\|30\|NC_014550\|CRT	2979689-2979718	30	NZ_CP015116	Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence	1455023-1455052	7	0.767
NC_014550_2	2.4\|2979689\|30\|NC_014550\|CRT	2979689-2979718	30	NZ_CP016555	Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence	1024729-1024758	7	0.767
NC_014550_2	2.4\|2979689\|30\|NC_014550\|CRT	2979689-2979718	30	NZ_CP049792	Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence	1590935-1590964	7	0.767
NC_014550_2	2.4\|2979689\|30\|NC_014550\|CRT	2979689-2979718	30	NZ_CP052069	Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence	1200111-1200140	7	0.767
NC_014550_2	2.4\|2979689\|30\|NC_014550\|CRT	2979689-2979718	30	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	1710608-1710637	7	0.767
NC_014550_2	2.4\|2979689\|30\|NC_014550\|CRT	2979689-2979718	30	NZ_CP022769	Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence	1276299-1276328	7	0.767
NC_014550_2	2.4\|2979689\|30\|NC_014550\|CRT	2979689-2979718	30	NZ_CP015851	Ralstonia solanacearum strain YC40-M plasmid, complete sequence	1384377-1384406	7	0.767
NC_014550_2	2.4\|2979689\|30\|NC_014550\|CRT	2979689-2979718	30	NZ_CP022773	Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence	990267-990296	7	0.767
NC_014550_2	2.4\|2979689\|30\|NC_014550\|CRT	2979689-2979718	30	NZ_CP022783	Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence	1205199-1205228	7	0.767
NC_014550_2	2.4\|2979689\|30\|NC_014550\|CRT	2979689-2979718	30	NZ_CP022791	Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence	1240337-1240366	7	0.767
NC_014550_2	2.4\|2979689\|30\|NC_014550\|CRT	2979689-2979718	30	NZ_CP022795	Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence	1201942-1201971	7	0.767
NC_014550_2	2.4\|2979689\|30\|NC_014550\|CRT	2979689-2979718	30	NZ_CP052071	Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence	1387825-1387854	7	0.767
NC_014550_2	2.4\|2979689\|30\|NC_014550\|CRT	2979689-2979718	30	NZ_CP009763	Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence	1170800-1170829	7	0.767
NC_014550_2	2.4\|2979689\|30\|NC_014550\|CRT	2979689-2979718	30	NZ_CP022779	Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence	1276288-1276317	7	0.767
NC_014550_2	2.4\|2979689\|30\|NC_014550\|CRT	2979689-2979718	30	NZ_CP052075	Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence	1387792-1387821	7	0.767
NC_014550_2	2.4\|2979689\|30\|NC_014550\|CRT	2979689-2979718	30	NZ_CP052085	Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence	1257998-1258027	7	0.767
NC_014550_2	2.4\|2979689\|30\|NC_014550\|CRT	2979689-2979718	30	NZ_CP052095	Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence	1285604-1285633	7	0.767
NC_014550_2	2.4\|2979689\|30\|NC_014550\|CRT	2979689-2979718	30	NZ_CP052105	Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence	1386597-1386626	7	0.767
NC_014550_2	2.4\|2979689\|30\|NC_014550\|CRT	2979689-2979718	30	NZ_CP052077	Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence	1180670-1180699	7	0.767
NC_014550_2	2.4\|2979689\|30\|NC_014550\|CRT	2979689-2979718	30	NZ_CP052087	Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence	1257998-1258027	7	0.767
NC_014550_2	2.4\|2979689\|30\|NC_014550\|CRT	2979689-2979718	30	NZ_CP052097	Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence	1285604-1285633	7	0.767
NC_014550_2	2.4\|2979689\|30\|NC_014550\|CRT	2979689-2979718	30	NZ_CP052115	Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence	1386634-1386663	7	0.767
NC_014550_2	2.4\|2979689\|30\|NC_014550\|CRT	2979689-2979718	30	NZ_CP052127	Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence	1257998-1258027	7	0.767
NC_014550_2	2.4\|2979689\|30\|NC_014550\|CRT	2979689-2979718	30	NZ_CP052079	Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence	1180693-1180722	7	0.767
NC_014550_2	2.4\|2979689\|30\|NC_014550\|CRT	2979689-2979718	30	NZ_CP052089	Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence	1258002-1258031	7	0.767
NC_014550_2	2.4\|2979689\|30\|NC_014550\|CRT	2979689-2979718	30	NZ_CP052093	Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence	1285604-1285633	7	0.767
NC_014550_2	2.4\|2979689\|30\|NC_014550\|CRT	2979689-2979718	30	NZ_CP052101	Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence	1285604-1285633	7	0.767
NC_014550_2	2.4\|2979689\|30\|NC_014550\|CRT	2979689-2979718	30	NZ_CP052099	Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence	1285604-1285633	7	0.767
NC_014550_2	2.4\|2979689\|30\|NC_014550\|CRT	2979689-2979718	30	NZ_CP052107	Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence	1386634-1386663	7	0.767
NC_014550_2	2.4\|2979689\|30\|NC_014550\|CRT	2979689-2979718	30	NZ_CP052117	Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence	1386623-1386652	7	0.767
NC_014550_2	2.4\|2979689\|30\|NC_014550\|CRT	2979689-2979718	30	NZ_CP052125	Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence	1180693-1180722	7	0.767
NC_014550_2	2.4\|2979689\|30\|NC_014550\|CRT	2979689-2979718	30	NZ_CP022793	Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence	1198203-1198232	7	0.767
NC_014550_2	2.4\|2979689\|30\|NC_014550\|CRT	2979689-2979718	30	NZ_CP022785	Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence	1178867-1178896	7	0.767
NC_014550_2	2.4\|2979689\|30\|NC_014550\|CRT	2979689-2979718	30	NZ_CP022787	Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence	1226544-1226573	7	0.767
NC_014550_2	2.4\|2979689\|30\|NC_014550\|CRT	2979689-2979718	30	NZ_CP022756	Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence	1272981-1273010	7	0.767
NC_014550_2	2.4\|2979689\|30\|NC_014550\|CRT	2979689-2979718	30	NZ_CP052121	Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence	1386623-1386652	7	0.767
NC_014550_2	2.4\|2979689\|30\|NC_014550\|CRT	2979689-2979718	30	NZ_CP052123	Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence	1180693-1180722	7	0.767
NC_014550_2	2.4\|2979689\|30\|NC_014550\|CRT	2979689-2979718	30	NZ_CP052131	Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence	1257997-1258026	7	0.767
NC_014550_2	2.4\|2979689\|30\|NC_014550\|CRT	2979689-2979718	30	NZ_CP052073	Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence	1387790-1387819	7	0.767
NC_014550_2	2.4\|2979689\|30\|NC_014550\|CRT	2979689-2979718	30	NZ_CP052081	Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence	1180693-1180722	7	0.767
NC_014550_2	2.4\|2979689\|30\|NC_014550\|CRT	2979689-2979718	30	NZ_CP052083	Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence	1180693-1180722	7	0.767
NC_014550_2	2.4\|2979689\|30\|NC_014550\|CRT	2979689-2979718	30	NZ_CP052109	Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence	1386634-1386663	7	0.767
NC_014550_2	2.4\|2979689\|30\|NC_014550\|CRT	2979689-2979718	30	NZ_CP052091	Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence	1285605-1285634	7	0.767
NC_014550_2	2.4\|2979689\|30\|NC_014550\|CRT	2979689-2979718	30	NZ_CP052103	Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence	1386645-1386674	7	0.767
NC_014550_2	2.4\|2979689\|30\|NC_014550\|CRT	2979689-2979718	30	NZ_CP052119	Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence	1386623-1386652	7	0.767
NC_014550_2	2.4\|2979689\|30\|NC_014550\|CRT	2979689-2979718	30	NC_017580	Shewanella baltica OS117 plasmid pSBAL11702, complete sequence	65167-65196	8	0.733
NC_014550_3	3.3\|3603299\|30\|NC_014550\|CRT	3603299-3603328	30	MN694733	Marine virus AFVG_250M925, complete genome	20840-20869	8	0.733
NC_014550_3	3.3\|3603299\|30\|NC_014550\|CRT	3603299-3603328	30	MN694340	Marine virus AFVG_250M926, complete genome	19100-19129	8	0.733
NC_014550_3	3.3\|3603299\|30\|NC_014550\|CRT	3603299-3603328	30	MN693955	Marine virus AFVG_250M927, complete genome	21012-21041	8	0.733
NC_014550_3	3.3\|3603299\|30\|NC_014550\|CRT	3603299-3603328	30	MN693622	Marine virus AFVG_250M928, complete genome	21015-21044	8	0.733
NC_014550_3	3.4\|3603347\|30\|NC_014550\|CRT	3603347-3603376	30	MH067967	Arthrobacter sp. strain ANT_H19B plasmid pA19BH1, complete sequence	16326-16355	8	0.733
NC_014550_2	2.4\|2979689\|30\|NC_014550\|CRT	2979689-2979718	30	NZ_CP022492	Salmonella enterica subsp. enterica serovar Saintpaul strain SA20031783 plasmid unnamed1, complete sequence	80928-80957	9	0.7
NC_014550_2	2.4\|2979689\|30\|NC_014550\|CRT	2979689-2979718	30	NZ_CP019182	Salmonella enterica subsp. enterica serovar Inverness str. ATCC 10720 plasmid pATCC10720, complete sequence	56549-56578	9	0.7
NC_014550_2	2.4\|2979689\|30\|NC_014550\|CRT	2979689-2979718	30	CP053403	Salmonella enterica strain 2010K-2057 plasmid unnamed1, complete sequence	95334-95363	9	0.7

1. spacer 1.3|1186399|30|NC_014550|CRT matches to JN968479 (Haloarcula hispanica icosahedral virus 2, complete genome) position: , mismatch: 5, identity: 0.833

--gccgttggttcctcggtcggttcctcggtc	CRISPR spacer
cagtcgt--gttcgtcggtcggttcgtcggtc	Protospacer
  *.***  **** *********** ******

2. spacer 2.4|2979689|30|NC_014550|CRT matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 5, identity: 0.833

tgttg-gcatcggtgttcacatccgtgttgg	CRISPR spacer
-gttgcgcatcggtgttcacctccgtgcggc	Protospacer
 **** ************** ******. *

3. spacer 2.4|2979689|30|NC_014550|CRT matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 5, identity: 0.833

tgttg-gcatcggtgttcacatccgtgttgg	CRISPR spacer
-gttgcgcatcggtgttcacctccgtgcggc	Protospacer
 **** ************** ******. *

4. spacer 1.3|1186399|30|NC_014550|CRT matches to NZ_CP031166 (Euzebya sp. DY32-46 plasmid pEDY32-46I, complete sequence) position: , mismatch: 7, identity: 0.767

gccgttggttcctcggtcggttcctcggtc	CRISPR spacer
cctacggggtcctcggtcgggtcctcggtc	Protospacer
 *... ** *********** *********

5. spacer 1.3|1186399|30|NC_014550|CRT matches to NC_013859 (Azospirillum sp. B510 plasmid pAB510e, complete sequence) position: , mismatch: 7, identity: 0.767

gccgttggttcctcggtcggttcctcggtc	CRISPR spacer
cgcaggcgtttctcggtcggttcctcggtc	Protospacer
  *.   ***.*******************

6. spacer 1.3|1186399|30|NC_014550|CRT matches to CP000664 (Rhodobacter sphaeroides ATCC 17025 plasmid pRSPA03, complete sequence) position: , mismatch: 7, identity: 0.767

gccgttggttcctcggtcggttcctcggtc	CRISPR spacer
gcgcgcggttcctcgatcggttcctgggtt	Protospacer
**   .*********.********* ***.

7. spacer 2.4|2979689|30|NC_014550|CRT matches to NZ_CP016613 (Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

tgttggcatcggtgttcacatccgtgttgg-	CRISPR spacer
cgttggcatcggtcttcacat-cgaacaggc	Protospacer
.************ ******* ** .. **

8. spacer 2.4|2979689|30|NC_014550|CRT matches to NZ_CP021449 (Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence) position: , mismatch: 7, identity: 0.767

tgttggcatcggtgttcacatccgtgttgg-	CRISPR spacer
cgttggcatcggtcttcacat-cgaacaggc	Protospacer
.************ ******* ** .. **

9. spacer 2.4|2979689|30|NC_014550|CRT matches to NZ_CP049790 (Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

tgttggcatcggtgttcacatccgtgttgg-	CRISPR spacer
cgttggcatcggtcttcacat-cgaacaggc	Protospacer
.************ ******* ** .. **

10. spacer 2.4|2979689|30|NC_014550|CRT matches to NZ_CP049788 (Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

tgttggcatcggtgttcacatccgtgttgg-	CRISPR spacer
cgttggcatcggtcttcacat-cgaacaggc	Protospacer
.************ ******* ** .. **

11. spacer 2.4|2979689|30|NC_014550|CRT matches to NZ_CP016915 (Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

tgttggcatcggtgttcacatccgtgttgg-	CRISPR spacer
cgttggcatcggtcttcacat-cgaacaggc	Protospacer
.************ ******* ** .. **

12. spacer 2.4|2979689|30|NC_014550|CRT matches to NZ_CP016905 (Ralstonia solanacearum strain KACC 10709 plasmid unnamed1) position: , mismatch: 7, identity: 0.767

tgttggcatcggtgttcacatccgtgttgg-	CRISPR spacer
cgttggcatcggtcttcacat-cgaacaggc	Protospacer
.************ ******* ** .. **

13. spacer 2.4|2979689|30|NC_014550|CRT matches to NZ_CP022482 (Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence) position: , mismatch: 7, identity: 0.767

tgttggcatcggtgttcacatccgtgttgg-	CRISPR spacer
cgttggcatcggtcttcacat-cgaacaggc	Protospacer
.************ ******* ** .. **

14. spacer 2.4|2979689|30|NC_014550|CRT matches to CP023015 (Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

tgttggcatcggtgttcacatccgtgttgg-	CRISPR spacer
cgttggcatcggtcttcacat-cgaacaggc	Protospacer
.************ ******* ** .. **

15. spacer 2.4|2979689|30|NC_014550|CRT matches to NZ_CP022781 (Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

tgttggcatcggtgttcacatccgtgttgg-	CRISPR spacer
cgttggcatcggtcttcacat-cgaacaggc	Protospacer
.************ ******* ** .. **

16. spacer 2.4|2979689|30|NC_014550|CRT matches to NZ_CP052129 (Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

tgttggcatcggtgttcacatccgtgttgg-	CRISPR spacer
cgttggcatcggtcttcacat-cgaacaggc	Protospacer
.************ ******* ** .. **

17. spacer 2.4|2979689|30|NC_014550|CRT matches to NZ_CP052111 (Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

tgttggcatcggtgttcacatccgtgttgg-	CRISPR spacer
cgttggcatcggtcttcacat-cgaacaggc	Protospacer
.************ ******* ** .. **

18. spacer 2.4|2979689|30|NC_014550|CRT matches to NZ_CP052113 (Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

tgttggcatcggtgttcacatccgtgttgg-	CRISPR spacer
cgttggcatcggtcttcacat-cgaacaggc	Protospacer
.************ ******* ** .. **

19. spacer 2.4|2979689|30|NC_014550|CRT matches to CP023013 (Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

tgttggcatcggtgttcacatccgtgttgg-	CRISPR spacer
cgttggcatcggtcttcacat-cgaacaggc	Protospacer
.************ ******* ** .. **

20. spacer 2.4|2979689|30|NC_014550|CRT matches to NZ_CP049794 (Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

tgttggcatcggtgttcacatccgtgttgg-	CRISPR spacer
cgttggcatcggtcttcacat-cgaacaggc	Protospacer
.************ ******* ** .. **

21. spacer 2.4|2979689|30|NC_014550|CRT matches to NZ_CP022766 (Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

tgttggcatcggtgttcacatccgtgttgg-	CRISPR spacer
cgttggcatcggtcttcacat-cgaacaggc	Protospacer
.************ ******* ** .. **

22. spacer 2.4|2979689|30|NC_014550|CRT matches to NZ_CP015116 (Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

tgttggcatcggtgttcacatccgtgttgg-	CRISPR spacer
cgttggcatcggtcttcacat-cgaacaggc	Protospacer
.************ ******* ** .. **

23. spacer 2.4|2979689|30|NC_014550|CRT matches to NZ_CP016555 (Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence) position: , mismatch: 7, identity: 0.767

tgttggcatcggtgttcacatccgtgttgg-	CRISPR spacer
cgttggcatcggtcttcacat-cgaacaggc	Protospacer
.************ ******* ** .. **

24. spacer 2.4|2979689|30|NC_014550|CRT matches to NZ_CP049792 (Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

tgttggcatcggtgttcacatccgtgttgg-	CRISPR spacer
cgttggcatcggtcttcacat-cgaacaggc	Protospacer
.************ ******* ** .. **

25. spacer 2.4|2979689|30|NC_014550|CRT matches to NZ_CP052069 (Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

tgttggcatcggtgttcacatccgtgttgg-	CRISPR spacer
cgttggcatcggtcttcacat-cgaacaggc	Protospacer
.************ ******* ** .. **

26. spacer 2.4|2979689|30|NC_014550|CRT matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 7, identity: 0.767

tgttggcatcggtgttcacatccgtgttgg-	CRISPR spacer
cgttggcatcggtcttcacat-cgaacaggc	Protospacer
.************ ******* ** .. **

27. spacer 2.4|2979689|30|NC_014550|CRT matches to NZ_CP022769 (Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

tgttggcatcggtgttcacatccgtgttgg-	CRISPR spacer
cgttggcatcggtcttcacat-cgaacaggc	Protospacer
.************ ******* ** .. **

28. spacer 2.4|2979689|30|NC_014550|CRT matches to NZ_CP015851 (Ralstonia solanacearum strain YC40-M plasmid, complete sequence) position: , mismatch: 7, identity: 0.767

tgttggcatcggtgttcacatccgtgttgg-	CRISPR spacer
cgttggcatcggtcttcacat-cgaacaggc	Protospacer
.************ ******* ** .. **

29. spacer 2.4|2979689|30|NC_014550|CRT matches to NZ_CP022773 (Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

tgttggcatcggtgttcacatccgtgttgg-	CRISPR spacer
cgttggcatcggtcttcacat-cgaacaggc	Protospacer
.************ ******* ** .. **

30. spacer 2.4|2979689|30|NC_014550|CRT matches to NZ_CP022783 (Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

tgttggcatcggtgttcacatccgtgttgg-	CRISPR spacer
cgttggcatcggtcttcacat-cgaacaggc	Protospacer
.************ ******* ** .. **

31. spacer 2.4|2979689|30|NC_014550|CRT matches to NZ_CP022791 (Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

tgttggcatcggtgttcacatccgtgttgg-	CRISPR spacer
cgttggcatcggtcttcacat-cgaacaggc	Protospacer
.************ ******* ** .. **

32. spacer 2.4|2979689|30|NC_014550|CRT matches to NZ_CP022795 (Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

tgttggcatcggtgttcacatccgtgttgg-	CRISPR spacer
cgttggcatcggtcttcacat-cgaacaggc	Protospacer
.************ ******* ** .. **

33. spacer 2.4|2979689|30|NC_014550|CRT matches to NZ_CP052071 (Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

tgttggcatcggtgttcacatccgtgttgg-	CRISPR spacer
cgttggcatcggtcttcacat-cgaacaggc	Protospacer
.************ ******* ** .. **

34. spacer 2.4|2979689|30|NC_014550|CRT matches to NZ_CP009763 (Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

tgttggcatcggtgttcacatccgtgttgg-	CRISPR spacer
cgttggcatcggtcttcacat-cgaacaggc	Protospacer
.************ ******* ** .. **

35. spacer 2.4|2979689|30|NC_014550|CRT matches to NZ_CP022779 (Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

tgttggcatcggtgttcacatccgtgttgg-	CRISPR spacer
cgttggcatcggtcttcacat-cgaacaggc	Protospacer
.************ ******* ** .. **

36. spacer 2.4|2979689|30|NC_014550|CRT matches to NZ_CP052075 (Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

tgttggcatcggtgttcacatccgtgttgg-	CRISPR spacer
cgttggcatcggtcttcacat-cgaacaggc	Protospacer
.************ ******* ** .. **

37. spacer 2.4|2979689|30|NC_014550|CRT matches to NZ_CP052085 (Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

tgttggcatcggtgttcacatccgtgttgg-	CRISPR spacer
cgttggcatcggtcttcacat-cgaacaggc	Protospacer
.************ ******* ** .. **

38. spacer 2.4|2979689|30|NC_014550|CRT matches to NZ_CP052095 (Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

tgttggcatcggtgttcacatccgtgttgg-	CRISPR spacer
cgttggcatcggtcttcacat-cgaacaggc	Protospacer
.************ ******* ** .. **

39. spacer 2.4|2979689|30|NC_014550|CRT matches to NZ_CP052105 (Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

tgttggcatcggtgttcacatccgtgttgg-	CRISPR spacer
cgttggcatcggtcttcacat-cgaacaggc	Protospacer
.************ ******* ** .. **

40. spacer 2.4|2979689|30|NC_014550|CRT matches to NZ_CP052077 (Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

tgttggcatcggtgttcacatccgtgttgg-	CRISPR spacer
cgttggcatcggtcttcacat-cgaacaggc	Protospacer
.************ ******* ** .. **

41. spacer 2.4|2979689|30|NC_014550|CRT matches to NZ_CP052087 (Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

tgttggcatcggtgttcacatccgtgttgg-	CRISPR spacer
cgttggcatcggtcttcacat-cgaacaggc	Protospacer
.************ ******* ** .. **

42. spacer 2.4|2979689|30|NC_014550|CRT matches to NZ_CP052097 (Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

tgttggcatcggtgttcacatccgtgttgg-	CRISPR spacer
cgttggcatcggtcttcacat-cgaacaggc	Protospacer
.************ ******* ** .. **

43. spacer 2.4|2979689|30|NC_014550|CRT matches to NZ_CP052115 (Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

tgttggcatcggtgttcacatccgtgttgg-	CRISPR spacer
cgttggcatcggtcttcacat-cgaacaggc	Protospacer
.************ ******* ** .. **

44. spacer 2.4|2979689|30|NC_014550|CRT matches to NZ_CP052127 (Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

tgttggcatcggtgttcacatccgtgttgg-	CRISPR spacer
cgttggcatcggtcttcacat-cgaacaggc	Protospacer
.************ ******* ** .. **

45. spacer 2.4|2979689|30|NC_014550|CRT matches to NZ_CP052079 (Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

tgttggcatcggtgttcacatccgtgttgg-	CRISPR spacer
cgttggcatcggtcttcacat-cgaacaggc	Protospacer
.************ ******* ** .. **

46. spacer 2.4|2979689|30|NC_014550|CRT matches to NZ_CP052089 (Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

tgttggcatcggtgttcacatccgtgttgg-	CRISPR spacer
cgttggcatcggtcttcacat-cgaacaggc	Protospacer
.************ ******* ** .. **

47. spacer 2.4|2979689|30|NC_014550|CRT matches to NZ_CP052093 (Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

tgttggcatcggtgttcacatccgtgttgg-	CRISPR spacer
cgttggcatcggtcttcacat-cgaacaggc	Protospacer
.************ ******* ** .. **

48. spacer 2.4|2979689|30|NC_014550|CRT matches to NZ_CP052101 (Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

tgttggcatcggtgttcacatccgtgttgg-	CRISPR spacer
cgttggcatcggtcttcacat-cgaacaggc	Protospacer
.************ ******* ** .. **

49. spacer 2.4|2979689|30|NC_014550|CRT matches to NZ_CP052099 (Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

tgttggcatcggtgttcacatccgtgttgg-	CRISPR spacer
cgttggcatcggtcttcacat-cgaacaggc	Protospacer
.************ ******* ** .. **

50. spacer 2.4|2979689|30|NC_014550|CRT matches to NZ_CP052107 (Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

tgttggcatcggtgttcacatccgtgttgg-	CRISPR spacer
cgttggcatcggtcttcacat-cgaacaggc	Protospacer
.************ ******* ** .. **

51. spacer 2.4|2979689|30|NC_014550|CRT matches to NZ_CP052117 (Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

tgttggcatcggtgttcacatccgtgttgg-	CRISPR spacer
cgttggcatcggtcttcacat-cgaacaggc	Protospacer
.************ ******* ** .. **

52. spacer 2.4|2979689|30|NC_014550|CRT matches to NZ_CP052125 (Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

tgttggcatcggtgttcacatccgtgttgg-	CRISPR spacer
cgttggcatcggtcttcacat-cgaacaggc	Protospacer
.************ ******* ** .. **

53. spacer 2.4|2979689|30|NC_014550|CRT matches to NZ_CP022793 (Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

tgttggcatcggtgttcacatccgtgttgg-	CRISPR spacer
cgttggcatcggtcttcacat-cgaacaggc	Protospacer
.************ ******* ** .. **

54. spacer 2.4|2979689|30|NC_014550|CRT matches to NZ_CP022785 (Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

tgttggcatcggtgttcacatccgtgttgg-	CRISPR spacer
cgttggcatcggtcttcacat-cgaacaggc	Protospacer
.************ ******* ** .. **

55. spacer 2.4|2979689|30|NC_014550|CRT matches to NZ_CP022787 (Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

tgttggcatcggtgttcacatccgtgttgg-	CRISPR spacer
cgttggcatcggtcttcacat-cgaacaggc	Protospacer
.************ ******* ** .. **

56. spacer 2.4|2979689|30|NC_014550|CRT matches to NZ_CP022756 (Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

tgttggcatcggtgttcacatccgtgttgg-	CRISPR spacer
cgttggcatcggtcttcacat-cgaacaggc	Protospacer
.************ ******* ** .. **

57. spacer 2.4|2979689|30|NC_014550|CRT matches to NZ_CP052121 (Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

tgttggcatcggtgttcacatccgtgttgg-	CRISPR spacer
cgttggcatcggtcttcacat-cgaacaggc	Protospacer
.************ ******* ** .. **

58. spacer 2.4|2979689|30|NC_014550|CRT matches to NZ_CP052123 (Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

tgttggcatcggtgttcacatccgtgttgg-	CRISPR spacer
cgttggcatcggtcttcacat-cgaacaggc	Protospacer
.************ ******* ** .. **

59. spacer 2.4|2979689|30|NC_014550|CRT matches to NZ_CP052131 (Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

tgttggcatcggtgttcacatccgtgttgg-	CRISPR spacer
cgttggcatcggtcttcacat-cgaacaggc	Protospacer
.************ ******* ** .. **

60. spacer 2.4|2979689|30|NC_014550|CRT matches to NZ_CP052073 (Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

tgttggcatcggtgttcacatccgtgttgg-	CRISPR spacer
cgttggcatcggtcttcacat-cgaacaggc	Protospacer
.************ ******* ** .. **

61. spacer 2.4|2979689|30|NC_014550|CRT matches to NZ_CP052081 (Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

tgttggcatcggtgttcacatccgtgttgg-	CRISPR spacer
cgttggcatcggtcttcacat-cgaacaggc	Protospacer
.************ ******* ** .. **

62. spacer 2.4|2979689|30|NC_014550|CRT matches to NZ_CP052083 (Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

tgttggcatcggtgttcacatccgtgttgg-	CRISPR spacer
cgttggcatcggtcttcacat-cgaacaggc	Protospacer
.************ ******* ** .. **

63. spacer 2.4|2979689|30|NC_014550|CRT matches to NZ_CP052109 (Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

tgttggcatcggtgttcacatccgtgttgg-	CRISPR spacer
cgttggcatcggtcttcacat-cgaacaggc	Protospacer
.************ ******* ** .. **

64. spacer 2.4|2979689|30|NC_014550|CRT matches to NZ_CP052091 (Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

tgttggcatcggtgttcacatccgtgttgg-	CRISPR spacer
cgttggcatcggtcttcacat-cgaacaggc	Protospacer
.************ ******* ** .. **

65. spacer 2.4|2979689|30|NC_014550|CRT matches to NZ_CP052103 (Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

tgttggcatcggtgttcacatccgtgttgg-	CRISPR spacer
cgttggcatcggtcttcacat-cgaacaggc	Protospacer
.************ ******* ** .. **

66. spacer 2.4|2979689|30|NC_014550|CRT matches to NZ_CP052119 (Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

tgttggcatcggtgttcacatccgtgttgg-	CRISPR spacer
cgttggcatcggtcttcacat-cgaacaggc	Protospacer
.************ ******* ** .. **

67. spacer 2.4|2979689|30|NC_014550|CRT matches to NC_017580 (Shewanella baltica OS117 plasmid pSBAL11702, complete sequence) position: , mismatch: 8, identity: 0.733

tgttggcatcggtgttcacatccgtgttgg	CRISPR spacer
gaatggcatcggtgatcacatacgtgtgca	Protospacer
 . *********** ****** *****  .

68. spacer 3.3|3603299|30|NC_014550|CRT matches to MN694733 (Marine virus AFVG_250M925, complete genome) position: , mismatch: 8, identity: 0.733

tcttgagtcggctcgaccgtaggctctgga	CRISPR spacer
atcggaactggctcgactgtaggctctgga	Protospacer
 .. **...********.************

69. spacer 3.3|3603299|30|NC_014550|CRT matches to MN694340 (Marine virus AFVG_250M926, complete genome) position: , mismatch: 8, identity: 0.733

tcttgagtcggctcgaccgtaggctctgga	CRISPR spacer
atcggaactggctcgactgtaggctctgga	Protospacer
 .. **...********.************

70. spacer 3.3|3603299|30|NC_014550|CRT matches to MN693955 (Marine virus AFVG_250M927, complete genome) position: , mismatch: 8, identity: 0.733

tcttgagtcggctcgaccgtaggctctgga	CRISPR spacer
atcggaactggctcgactgtaggctctgga	Protospacer
 .. **...********.************

71. spacer 3.3|3603299|30|NC_014550|CRT matches to MN693622 (Marine virus AFVG_250M928, complete genome) position: , mismatch: 8, identity: 0.733

tcttgagtcggctcgaccgtaggctctgga	CRISPR spacer
atcggaactggctcgactgtaggctctgga	Protospacer
 .. **...********.************

72. spacer 3.4|3603347|30|NC_014550|CRT matches to MH067967 (Arthrobacter sp. strain ANT_H19B plasmid pA19BH1, complete sequence) position: , mismatch: 8, identity: 0.733

tccaccgtaggttcagcggttggttccgga	CRISPR spacer
acgggcgaaggttcagcggttcgttccgcc	Protospacer
 * . ** ************* ******

73. spacer 2.4|2979689|30|NC_014550|CRT matches to NZ_CP022492 (Salmonella enterica subsp. enterica serovar Saintpaul strain SA20031783 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.7

tgttggcatcggtgttcacatccgtgttgg	CRISPR spacer
caatggcatccgtgttcacatccggcgcga	Protospacer
.. ******* *************   .*.

74. spacer 2.4|2979689|30|NC_014550|CRT matches to NZ_CP019182 (Salmonella enterica subsp. enterica serovar Inverness str. ATCC 10720 plasmid pATCC10720, complete sequence) position: , mismatch: 9, identity: 0.7

tgttggcatcggtgttcacatccgtgttgg	CRISPR spacer
cgatggcatccgtgttcacatccggcgcaa	Protospacer
.* ******* *************   ...

75. spacer 2.4|2979689|30|NC_014550|CRT matches to CP053403 (Salmonella enterica strain 2010K-2057 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.7

tgttggcatcggtgttcacatccgtgttgg	CRISPR spacer
cgatggcatccgtgttcacatccggcgcaa	Protospacer
.* ******* *************   ...

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

234174 : 299575

Mycobacterium_phage(25.0%)

transposase,protease

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_102598715.1\|234174_235652_-\|transposase	IS3-like element ISAar44 family transposase	NA	NA	NA	NA
WP_076611951.1\|236584_237794_+\|transposase	IS3-like element ISAar37 family transposase	A0A0P0I4A4	Acinetobacter_phage	6.7e-33	32.9
WP_013347620.1\|238985_239363_+	hypothetical protein	NA	NA	NA	NA
WP_013347621.1\|239477_239909_+	SRPBCC family protein	NA	NA	NA	NA
WP_049862530.1\|239879_240506_-	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_013347622.1\|240508_241813_-	MFS transporter	NA	NA	NA	NA
WP_081461065.1\|241940_242117_-	HPr family phosphocarrier protein	NA	NA	NA	NA
WP_013347623.1\|242255_243563_+\|transposase	ISL3-like element ISAar23 family transposase	A0A2H4PDF8	Mycobacterium_phage	8.5e-151	61.5
WP_081461066.1\|243499_243676_-	HPr family phosphocarrier protein	NA	NA	NA	NA
WP_013347624.1\|243729_245412_-	phosphoenolpyruvate--protein phosphotransferase	NA	NA	NA	NA
WP_013347625.1\|247408_248386_-	1-phosphofructokinase family hexose kinase	NA	NA	NA	NA
WP_013347626.1\|248382_249159_-	DeoR/GlpR transcriptional regulator	NA	NA	NA	NA
WP_013347627.1\|249526_250525_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_013347628.1\|250546_251188_-	hypothetical protein	NA	NA	NA	NA
WP_013347629.1\|251278_251899_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_041648296.1\|252130_252400_-	hypothetical protein	NA	NA	NA	NA
WP_146041009.1\|252686_252884_-	hypothetical protein	NA	NA	NA	NA
WP_013347623.1\|253765_255073_-\|transposase	ISL3-like element ISAar23 family transposase	A0A2H4PDF8	Mycobacterium_phage	8.5e-151	61.5
WP_041648300.1\|255192_255918_-	hypothetical protein	NA	NA	NA	NA
WP_013347632.1\|256981_257416_+	hypothetical protein	NA	NA	NA	NA
WP_013347633.1\|257495_257723_-	hypothetical protein	NA	NA	NA	NA
WP_013347634.1\|258308_258803_-	CoA-binding protein	NA	NA	NA	NA
WP_013347635.1\|258802_260176_-	O-acetylhomoserine aminocarboxypropyltransferase/cysteine synthase	A0A0B5JD48	Pandoravirus	3.1e-10	25.6
WP_013347636.1\|260497_261058_+	histidine phosphatase family protein	NA	NA	NA	NA
WP_013347637.1\|261178_261676_+	RNA polymerase sigma factor	NA	NA	NA	NA
WP_013347638.1\|261672_262299_+	methylated-DNA--[protein]-cysteine S-methyltransferase	A0A167R6J9	Powai_lake_megavirus	2.6e-12	32.1
WP_013347639.1\|262396_264577_-	catalase/peroxidase HPI	NA	NA	NA	NA
WP_013347640.1\|264679_265108_-	transcriptional repressor	NA	NA	NA	NA
WP_157867201.1\|265843_267661_+	BCCT family transporter	A0A2I7QNT1	Vibrio_phage	9.4e-23	27.4
WP_081461068.1\|267726_269802_-	acetate--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	8.4e-68	34.9
WP_013347643.1\|269752_270580_-	ABC transporter permease	G3M9Y4	Bacillus_virus	1.0e-16	24.0
WP_013347644.1\|270586_271609_-	aliphatic sulfonate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_013347645.1\|271694_272516_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	7.0e-26	36.2
WP_013347646.1\|272996_274328_+	acyl-CoA dehydrogenase family protein	NA	NA	NA	NA
WP_013347647.1\|274381_275785_+	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_013347648.1\|275861_277685_-	gamma-glutamyltransferase	NA	NA	NA	NA
WP_013347649.1\|277899_278763_-	NAD(P)H-binding protein	NA	NA	NA	NA
WP_013347650.1\|279256_280276_+	methionine ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.9e-29	37.2
WP_013347651.1\|280272_280968_+	ABC transporter permease	NA	NA	NA	NA
WP_013347652.1\|280997_281909_+	metal ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_041648309.1\|282418_284050_+	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_013347654.1\|284061_285018_+	ABC transporter permease	NA	NA	NA	NA
WP_013347655.1\|285032_285920_+	ABC transporter permease	NA	NA	NA	NA
WP_013347656.1\|285948_287571_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.6e-21	33.9
WP_013347657.1\|287609_288851_+	acyl-CoA dehydrogenase family protein	NA	NA	NA	NA
WP_013347658.1\|288853_290272_+	NtaA/DmoA family FMN-dependent monooxygenase	NA	NA	NA	NA
WP_013347659.1\|291017_294218_+	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_041648316.1\|294330_295839_+	SpaH/EbpB family LPXTG-anchored major pilin	NA	NA	NA	NA
WP_065763541.1\|295981_296908_+	class C sortase	NA	NA	NA	NA
WP_013347662.1\|296955_297372_+	MmcQ/YjbR family DNA-binding protein	NA	NA	NA	NA
WP_013347663.1\|297376_297700_+	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
WP_013347665.1\|298138_299575_+\|transposase	IS1380-like element ISAar8 family transposase	A0A222ZN33	Mycobacterium_phage	4.6e-81	40.2

DBSCAN-SWA_2

766061 : 807022

Synechococcus_phage(20.0%)

transposase,holin,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013348066.1\|766061_767339_-\|transposase	ISL3-like element ISAar15 family transposase	NA	NA	NA	NA
WP_013348067.1\|767419_768499_-\|transposase	IS110-like element ISAar16 family transposase	NA	NA	NA	NA
WP_013348068.1\|768890_769151_+	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_041648446.1\|769231_769780_-	flavin reductase family protein	NA	NA	NA	NA
WP_013348070.1\|769766_770807_-	methionine synthase	NA	NA	NA	NA
WP_013348071.1\|770825_771818_-	DUF1852 domain-containing protein	NA	NA	NA	NA
WP_013348073.1\|773294_774608_+	O-acetylhomoserine aminocarboxypropyltransferase/cysteine synthase	NA	NA	NA	NA
WP_013348074.1\|774604_775828_+	cystathionine gamma-synthase	NA	NA	NA	NA
WP_041649335.1\|776415_776934_-	gamma carbonic anhydrase family protein	NA	NA	NA	NA
WP_013348076.1\|777082_777448_-	hypothetical protein	NA	NA	NA	NA
WP_013348077.1\|777450_778293_-	formyltetrahydrofolate deformylase	M4QRX9	Synechococcus_phage	1.1e-10	34.7
WP_013348078.1\|779556_780420_+	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase	NA	NA	NA	NA
WP_013348079.1\|780558_781944_-	MHS family MFS transporter	Q6JIH2	Burkholderia_virus	4.3e-44	30.0
WP_013348080.1\|782071_782971_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_013348081.1\|783003_783360_+	VOC family protein	NA	NA	NA	NA
WP_013348082.1\|783307_783970_-	response regulator transcription factor	NA	NA	NA	NA
WP_013348083.1\|783966_785130_-	signal transduction histidine kinase	NA	NA	NA	NA
WP_157867084.1\|785248_786022_+	GAP family protein	NA	NA	NA	NA
WP_013348085.1\|786091_786589_+	hypothetical protein	NA	NA	NA	NA
WP_013348086.1\|786691_787531_+	exodeoxyribonuclease III	NA	NA	NA	NA
WP_013348087.1\|787539_788556_+\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_013348088.1\|788555_789068_+	2'-5' RNA ligase family protein	NA	NA	NA	NA
WP_013348089.1\|789113_790568_-	catalase	A0A2K9L572	Tupanvirus	2.0e-87	42.5
WP_013348066.1\|791661_792939_-\|transposase	ISL3-like element ISAar15 family transposase	NA	NA	NA	NA
WP_013348067.1\|793019_794099_-\|transposase	IS110-like element ISAar16 family transposase	NA	NA	NA	NA
WP_041648459.1\|794638_795628_+	YcaO-like family protein	NA	NA	NA	NA
WP_013347368.1\|795610_796918_-\|transposase	ISL3-like element ISAar19 family transposase	A0A2H4PDF8	Mycobacterium_phage	2.1e-149	60.1
WP_157867085.1\|797248_798226_+	hypothetical protein	NA	NA	NA	NA
WP_041648465.1\|798550_799813_+	MFS transporter	NA	NA	NA	NA
WP_013348091.1\|799878_800661_-	succinate dehydrogenase iron-sulfur subunit	NA	NA	NA	NA
WP_013348092.1\|800660_802448_-	succinate dehydrogenase flavoprotein subunit	NA	NA	NA	NA
WP_013348093.1\|802505_802949_-	succinate dehydrogenase hydrophobic membrane anchor subunit	NA	NA	NA	NA
WP_102598273.1\|802952_803366_-	succinate dehydrogenase, cytochrome b556 subunit	NA	NA	NA	NA
WP_013348095.1\|803612_804728_+	mannose-1-phosphate guanylyltransferase	NA	NA	NA	NA
WP_013348096.1\|804877_807022_+\|holin	choline BCCT transporter BetT	A0A2I7QNT1	Vibrio_phage	1.6e-16	25.4

DBSCAN-SWA_3

849700 : 911127

Mycobacterium_phage(25.0%)

transposase,integrase

attL 849009:849068|attR 895341:896032

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
849009:849068	attL	NA	NA	NA	NA
WP_157867086.1\|849700_850504_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_013348133.1\|850570_851245_-	DUF4245 domain-containing protein	NA	NA	NA	NA
WP_013348134.1\|851401_852436_+	class II fructose-bisphosphatase	NA	NA	NA	NA
WP_162094117.1\|852540_853740_-	mannose-6-phosphate isomerase, class I	NA	NA	NA	NA
WP_102598434.1\|853816_855250_-	LCP family protein	NA	NA	NA	NA
WP_013348137.1\|855441_855972_-	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	7.7e-18	44.6
WP_081461089.1\|856045_857206_-	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_013348139.1\|857382_857952_+	GtrA family protein	NA	NA	NA	NA
WP_013348140.1\|857948_858677_-	hypothetical protein	NA	NA	NA	NA
WP_028268477.1\|859236_859500_+	WhiB family transcriptional regulator	A0A2P1CGA4	Mycobacterium_phage	2.1e-24	67.5
WP_081461090.1\|859445_862970_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_013348143.1\|862969_865567_+	hypothetical protein	NA	NA	NA	NA
WP_162094118.1\|865632_866523_+	COX15/CtaA family protein	NA	NA	NA	NA
WP_013348145.1\|866535_866994_-	metallopeptidase family protein	NA	NA	NA	NA
WP_102598433.1\|867094_867487_+	DUF3499 domain-containing protein	NA	NA	NA	NA
WP_013348148.1\|867697_869299_+	TIGR01906 family membrane protein	NA	NA	NA	NA
WP_013348149.1\|869368_871210_-	long-chain fatty acid--CoA ligase	A0A1V0SBX8	Catovirus	8.6e-48	25.0
WP_013348150.1\|871288_872899_-	phospholipid carrier-dependent glycosyltransferase	NA	NA	NA	NA
WP_013348151.1\|872967_873828_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	NA	NA	NA	NA
WP_013348152.1\|873966_875454_+	NAD-dependent succinate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_013348153.1\|875522_877940_-	transglutaminase	NA	NA	NA	NA
WP_013348154.1\|877929_879255_-	DUF58 domain-containing protein	NA	NA	NA	NA
WP_013348155.1\|879265_880228_-	MoxR family ATPase	NA	NA	NA	NA
WP_081461092.1\|880247_881393_+	TatD family hydrolase	NA	NA	NA	NA
WP_157867211.1\|881750_882815_+	transglycosylase family protein	A0A1I9SA30	Rhodococcus_phage	4.8e-19	54.3
WP_041648488.1\|882915_883800_+	16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA	NA	NA	NA	NA
WP_013348159.1\|883802_884735_+	4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase	NA	NA	NA	NA
WP_013348160.1\|884889_886260_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_049862712.1\|886481_886988_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_013348163.1\|886974_887253_-	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
WP_157867212.1\|887362_889156_-	ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	3.0e-45	26.1
WP_041648491.1\|889551_891009_+	bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU	NA	NA	NA	NA
WP_013348166.1\|891081_892062_+	ribose-phosphate diphosphokinase	A0A2K9L8D8	Tupanvirus	4.0e-44	36.2
WP_157867087.1\|892187_892538_-	hypothetical protein	NA	NA	NA	NA
WP_013348167.1\|892819_893566_+	hypothetical protein	NA	NA	NA	NA
WP_157867086.1\|893904_894708_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_013348132.1\|894920_895337_-	hypothetical protein	NA	NA	NA	NA
WP_013347368.1\|895597_896905_+\|transposase	ISL3-like element ISAar19 family transposase	A0A2H4PDF8	Mycobacterium_phage	2.1e-149	60.1
895341:896032	attR	NA	NA	NA	NA
WP_013348168.1\|897228_900018_-	hypothetical protein	NA	NA	NA	NA
WP_157867088.1\|900014_900677_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	1.2e-15	31.1
WP_013348170.1\|901048_901534_-	hypothetical protein	NA	NA	NA	NA
WP_157867089.1\|902167_903314_+\|transposase	IS3-like element ISAar3 family transposase	NA	NA	NA	NA
WP_013348173.1\|903908_904241_-	hypothetical protein	A0A220NQR3	Corynebacterium_phage	8.3e-10	54.7
WP_013348174.1\|904237_904969_-	ATP-binding protein	A0A059NT77	Lactococcus_phage	4.5e-32	38.8
WP_013348175.1\|904965_906429_-\|transposase	IS21-like element ISAar7 family transposase	NA	NA	NA	NA
WP_157867090.1\|906710_906962_+	recombinase family protein	K7PJT4	Enterobacteria_phage	5.5e-06	43.9
WP_013348176.1\|907396_908152_+	hypothetical protein	NA	NA	NA	NA
WP_013348177.1\|908234_909416_+	hypothetical protein	NA	NA	NA	NA
WP_013348178.1\|909819_911127_-\|transposase	ISL3-like element ISAar20 family transposase	A0A2H4PDF8	Mycobacterium_phage	1.3e-151	62.0

DBSCAN-SWA_4

1436290 : 1499548

Mycobacterium_phage(36.36%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013348643.1\|1436290_1436575_+\|protease	ATP-dependent Clp protease adapter ClpS	NA	NA	NA	NA
WP_013348644.1\|1436577_1437156_+	DUF2017 domain-containing protein	NA	NA	NA	NA
WP_049862592.1\|1437142_1438084_+	glutamate racemase	NA	NA	NA	NA
WP_013348646.1\|1438080_1439022_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_134780461.1\|1439217_1439592_+	hypothetical protein	NA	NA	NA	NA
WP_013348647.1\|1439681_1440416_+	ribonuclease PH	NA	NA	NA	NA
WP_013348648.1\|1440412_1441045_+	RdgB/HAM1 family non-canonical purine NTP pyrophosphatase	NA	NA	NA	NA
WP_013348649.1\|1441125_1442031_-	hypothetical protein	NA	NA	NA	NA
WP_013348650.1\|1442624_1442984_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_013348651.1\|1443013_1443931_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.4e-14	26.4
WP_013348652.1\|1443927_1444623_+	hypothetical protein	NA	NA	NA	NA
WP_013348653.1\|1444813_1445311_+	hypothetical protein	NA	NA	NA	NA
WP_013348654.1\|1445524_1446526_+	exonuclease	A0A1S5SEW3	Streptococcus_phage	3.5e-27	29.7
WP_013348655.1\|1446606_1447542_-	hypothetical protein	NA	NA	NA	NA
WP_013348656.1\|1447593_1448760_+	exonuclease SbcCD subunit D	NA	NA	NA	NA
WP_013348657.1\|1448756_1451828_+	SMC family ATPase	NA	NA	NA	NA
WP_102597894.1\|1451988_1453215_+	MFS transporter	NA	NA	NA	NA
WP_013348659.1\|1453320_1454016_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_013348660.1\|1454279_1455620_+	MHS family MFS transporter	Q6JIH2	Burkholderia_virus	9.0e-47	31.8
WP_013348661.1\|1456545_1457043_+	hypothetical protein	NA	NA	NA	NA
WP_013348662.1\|1457062_1457314_+	hypothetical protein	NA	NA	NA	NA
WP_013348663.1\|1457506_1458514_-	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_041648632.1\|1458627_1460316_-	glycoside hydrolase family 13 protein	NA	NA	NA	NA
WP_013348665.1\|1460582_1461851_+	maltose ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_013348666.1\|1461967_1463563_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_013348667.1\|1463562_1464477_+	sugar ABC transporter permease	NA	NA	NA	NA
WP_013348668.1\|1464578_1465568_+	hypothetical protein	NA	NA	NA	NA
WP_013348669.1\|1465623_1466379_+	TetR/AcrR family transcriptional regulator C-terminal domain-containing protein	NA	NA	NA	NA
WP_013348670.1\|1466479_1468036_+	MFS transporter	A0A0M3UL24	Mycobacterium_phage	9.2e-35	30.3
WP_013348671.1\|1468079_1468496_+	META domain-containing protein	NA	NA	NA	NA
WP_013348672.1\|1468518_1469619_-	acyl-CoA desaturase	A6N231	Microbacterium_phage	7.3e-103	54.9
WP_013348673.1\|1469746_1471387_-	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	1.8e-33	26.4
WP_013348674.1\|1471470_1471836_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_081461114.1\|1471862_1472378_+	MFS transporter	NA	NA	NA	NA
WP_013347743.1\|1472329_1473607_-\|transposase	ISL3-like element ISAar13 family transposase	A0A2R2ZGN7	Clostridioides_phage	4.2e-17	24.0
WP_049862594.1\|1473721_1474510_+	MFS transporter	NA	NA	NA	NA
WP_013348675.1\|1474554_1475217_-	phosphoribosyltransferase	NA	NA	NA	NA
WP_157867113.1\|1475909_1476461_+	hypothetical protein	NA	NA	NA	NA
WP_041649587.1\|1476667_1477765_-	3,4-dihydroxyphenylacetate 2,3-dioxygenase	NA	NA	NA	NA
WP_013348677.1\|1477828_1479322_-	5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase	NA	NA	NA	NA
WP_013348678.1\|1479396_1480056_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_049862595.1\|1480055_1481582_-	fumarylacetoacetate hydrolase family protein	NA	NA	NA	NA
WP_013348680.1\|1481932_1483168_-	ABC transporter permease	NA	NA	NA	NA
WP_013348681.1\|1483164_1483872_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.3e-32	39.6
WP_041648644.1\|1483861_1484815_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_013347368.1\|1484868_1486176_-\|transposase	ISL3-like element ISAar19 family transposase	A0A2H4PDF8	Mycobacterium_phage	2.1e-149	60.1
WP_013348683.1\|1487061_1488360_+\|transposase	IS1380-like element ISAar10 family transposase	A0A222ZN33	Mycobacterium_phage	1.0e-71	38.6
WP_049862596.1\|1488565_1489150_+	cell wall-binding repeat-containing protein	NA	NA	NA	NA
WP_049862597.1\|1489192_1492672_+	hypothetical protein	NA	NA	NA	NA
WP_157867114.1\|1492793_1494641_-	glycosyltransferase	NA	NA	NA	NA
WP_013348684.1\|1494771_1496217_+\|transposase	IS481-like element ISAar22 family transposase	NA	NA	NA	NA
WP_013348685.1\|1496479_1497772_+	CDP-glycerol glycerophosphotransferase family protein	NA	NA	NA	NA
WP_013348686.1\|1498111_1499548_+\|transposase	IS1380-like element ISAar9 family transposase	A0A222ZN33	Mycobacterium_phage	4.8e-78	39.1

DBSCAN-SWA_5

1524301 : 1583089

Streptococcus_phage(28.57%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013348709.1\|1524301_1525747_+\|transposase	IS481-like element ISAar22 family transposase	NA	NA	NA	NA
WP_013348710.1\|1526693_1526972_+	hypothetical protein	NA	NA	NA	NA
WP_013348711.1\|1527041_1528529_-	malate:quinone oxidoreductase	NA	NA	NA	NA
WP_013348712.1\|1528607_1530452_-	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_013348713.1\|1530603_1531536_-	2-hydroxyacid dehydrogenase	M1NSB9	Streptococcus_phage	2.4e-06	25.5
WP_013348714.1\|1532430_1532922_+	thioredoxin-dependent thiol peroxidase	NA	NA	NA	NA
WP_013348715.1\|1533216_1533777_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_013348716.1\|1533801_1535265_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_013348717.1\|1535261_1536092_-	hypothetical protein	NA	NA	NA	NA
WP_013348718.1\|1536207_1536693_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_157867115.1\|1536705_1537809_+	polyprenyl synthetase family protein	NA	NA	NA	NA
WP_013348720.1\|1537814_1538759_+	squalene/phytoene synthase family protein	NA	NA	NA	NA
WP_013348721.1\|1538755_1540348_+	phytoene desaturase	NA	NA	NA	NA
WP_013348722.1\|1540344_1540707_+	lycopene cyclase domain-containing protein	NA	NA	NA	NA
WP_157867225.1\|1540708_1541053_+	lycopene cyclase domain-containing protein	NA	NA	NA	NA
WP_013348724.1\|1541049_1541913_+	prenyltransferase	NA	NA	NA	NA
WP_013348725.1\|1541939_1542455_+	isopentenyl-diphosphate Delta-isomerase	NA	NA	NA	NA
WP_013348726.1\|1542615_1543077_-	hypothetical protein	NA	NA	NA	NA
WP_013348727.1\|1543245_1544316_+\|transposase	IS1595-like element ISAar1 family transposase	NA	NA	NA	NA
WP_041648652.1\|1544885_1546769_+	acetolactate synthase large subunit	A0A0P0CRC5	Ostreococcus_lucimarinus_virus	3.9e-56	30.1
WP_013348729.1\|1546772_1547291_+	acetolactate synthase small subunit	NA	NA	NA	NA
WP_013348730.1\|1547415_1548447_+	ketol-acid reductoisomerase	NA	NA	NA	NA
WP_041649615.1\|1548636_1549245_-	hypothetical protein	NA	NA	NA	NA
WP_013348732.1\|1549492_1550194_+	class I SAM-dependent methyltransferase	A0A1X9I6N4	Streptococcus_phage	6.2e-15	28.4
WP_157867116.1\|1550867_1553306_+	hypothetical protein	NA	NA	NA	NA
WP_013348734.1\|1553302_1555969_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_013348736.1\|1556575_1557883_+\|transposase	ISL3 family transposase	A0A2H4PDF8	Mycobacterium_phage	7.7e-152	62.2
WP_041648661.1\|1558383_1558656_+	hypothetical protein	NA	NA	NA	NA
WP_013347368.1\|1558627_1559935_-\|transposase	ISL3-like element ISAar19 family transposase	A0A2H4PDF8	Mycobacterium_phage	2.1e-149	60.1
WP_157867117.1\|1560185_1560929_+\|transposase	transposase	NA	NA	NA	NA
WP_013348737.1\|1561046_1562405_+	sugar transferase	NA	NA	NA	NA
WP_013348738.1\|1562948_1564556_+	carbohydrate binding domain-containing protein	NA	NA	NA	NA
WP_013348739.1\|1564631_1565600_-	sulfotransferase	NA	NA	NA	NA
WP_013348740.1\|1565592_1566123_-	serine acetyltransferase	NA	NA	NA	NA
WP_013348741.1\|1566119_1567619_-	LPS biosynthesis protein	NA	NA	NA	NA
WP_013348742.1\|1567732_1568680_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_013348743.1\|1568821_1570147_+	hypothetical protein	NA	NA	NA	NA
WP_013348744.1\|1570217_1570901_-	hypothetical protein	NA	NA	NA	NA
WP_013348745.1\|1571098_1572655_+	flippase	NA	NA	NA	NA
WP_013348746.1\|1572682_1573582_+	sulfotransferase domain-containing protein	NA	NA	NA	NA
WP_013348747.1\|1573660_1574947_+	hypothetical protein	NA	NA	NA	NA
WP_013348748.1\|1575227_1579541_+	PKD domain-containing protein	A0A1D8KKY6	Synechococcus_phage	1.9e-05	38.4
WP_013348749.1\|1579671_1581435_+	SLC13 family permease	Q6A201	Oenococcus_phage	1.5e-09	27.2
WP_013348066.1\|1581811_1583089_+\|transposase	ISL3-like element ISAar15 family transposase	NA	NA	NA	NA

DBSCAN-SWA_6

1669331 : 1743521

Mycobacterium_phage(37.5%)

transposase,protease,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_157867122.1\|1669331_1670809_-\|transposase	IS3-like element ISAar44 family transposase	NA	NA	NA	NA
WP_013348814.1\|1672310_1673984_+	Stealth CR1 domain-containing protein	NA	NA	NA	NA
WP_013348815.1\|1674377_1674899_+	DUF177 domain-containing protein	NA	NA	NA	NA
WP_013348816.1\|1674901_1675105_+	50S ribosomal protein L32	NA	NA	NA	NA
WP_041648699.1\|1675108_1675807_+	ribonuclease III	A0A2K9L5P0	Tupanvirus	1.8e-22	28.8
WP_013348818.1\|1675818_1676742_+	bifunctional DNA-formamidopyrimidine glycosylase/DNA-(apurinic or apyrimidinic site) lyase	G3MA33	Bacillus_virus	1.4e-19	29.7
WP_013348819.1\|1676943_1677756_-	serine hydrolase	NA	NA	NA	NA
WP_013348820.1\|1677905_1681478_+	chromosome segregation protein SMC	NA	NA	NA	NA
WP_041648701.1\|1681552_1682788_-	MFS transporter	NA	NA	NA	NA
WP_013348822.1\|1682961_1684143_+	signal recognition particle-docking protein FtsY	D6PHS7	uncultured_phage	1.4e-11	33.8
WP_013348823.1\|1684604_1685252_-	DNA-3-methyladenine glycosylase	NA	NA	NA	NA
WP_013348824.1\|1685590_1686811_+	ammonium transporter	NA	NA	NA	NA
WP_013348825.1\|1687045_1689148_+	catalase	A0A2K9L0T1	Tupanvirus	3.4e-133	48.5
WP_013348826.1\|1689245_1690376_+	YihY/virulence factor BrkB family protein	NA	NA	NA	NA
WP_013348827.1\|1690478_1690955_+	pyridoxamine 5'-phosphate oxidase family protein	NA	NA	NA	NA
WP_013348828.1\|1691083_1691275_-	CsbD family protein	NA	NA	NA	NA
WP_013348829.1\|1691506_1693216_-	MFS transporter	NA	NA	NA	NA
WP_013348830.1\|1693253_1693919_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_013348831.1\|1694273_1695335_+	hypothetical protein	NA	NA	NA	NA
WP_041648703.1\|1695328_1696699_+	bifunctional PIG-L family deacetylase/class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_049862605.1\|1696712_1697426_+	glycosyltransferase	NA	NA	NA	NA
WP_013348834.1\|1697534_1697978_-	hypothetical protein	NA	NA	NA	NA
WP_013348835.1\|1698303_1699731_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_013348836.1\|1699727_1700258_-	hypothetical protein	NA	NA	NA	NA
WP_049862723.1\|1700453_1701164_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_013348838.1\|1701449_1703015_+	signal recognition particle protein	NA	NA	NA	NA
WP_013348840.1\|1703982_1704432_-	hypothetical protein	NA	NA	NA	NA
WP_013348841.1\|1704603_1705167_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_013348842.1\|1705393_1705669_+	hypothetical protein	NA	NA	NA	NA
WP_013348843.1\|1706001_1707195_+	hypothetical protein	NA	NA	NA	NA
WP_013348844.1\|1707339_1708539_+\|transposase	IS4-like element ISAar21 family transposase	NA	NA	NA	NA
WP_013347368.1\|1709201_1710509_-\|transposase	ISL3-like element ISAar19 family transposase	A0A2H4PDF8	Mycobacterium_phage	2.1e-149	60.1
WP_081461126.1\|1710713_1712102_+	glycosyltransferase	NA	NA	NA	NA
WP_013347623.1\|1712721_1714029_+\|transposase	ISL3-like element ISAar23 family transposase	A0A2H4PDF8	Mycobacterium_phage	8.5e-151	61.5
WP_013348847.1\|1715571_1716849_+\|transposase	ISL3-like element ISAar14 family transposase	NA	NA	NA	NA
WP_013348844.1\|1718676_1719876_+\|transposase	IS4-like element ISAar21 family transposase	NA	NA	NA	NA
WP_013348848.1\|1720033_1721746_-	AMP-binding protein	A0A2H4PQU7	Staphylococcus_phage	4.5e-51	31.0
WP_013348849.1\|1721983_1723690_-	AMP-binding protein	NA	NA	NA	NA
WP_013348850.1\|1723892_1724960_-	thermonuclease family protein	V5UN65	Mycobacterium_phage	3.2e-10	35.5
WP_013348851.1\|1725215_1726274_-	thermonuclease family protein	NA	NA	NA	NA
WP_013348852.1\|1726481_1727351_+	VOC family protein	NA	NA	NA	NA
WP_013348853.1\|1727458_1728232_-	CatB-related O-acetyltransferase	NA	NA	NA	NA
WP_013348854.1\|1728311_1730120_-	glycosyltransferase	NA	NA	NA	NA
WP_157867124.1\|1730256_1730370_-	hypothetical protein	NA	NA	NA	NA
WP_157867125.1\|1730400_1730586_-	hypothetical protein	NA	NA	NA	NA
WP_157867126.1\|1730601_1730742_-	DUF3237 family protein	NA	NA	NA	NA
WP_013348856.1\|1731223_1732234_-	iron-siderophore ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_013348857.1\|1732445_1733435_+	iron ABC transporter permease	NA	NA	NA	NA
WP_049862724.1\|1733446_1734487_+	iron ABC transporter permease	NA	NA	NA	NA
WP_013348859.1\|1734551_1736279_+	HNH endonuclease	NA	NA	NA	NA
WP_013348860.1\|1736324_1736954_-	LysE family translocator	NA	NA	NA	NA
WP_013348861.1\|1737204_1737615_+	30S ribosomal protein S16	NA	NA	NA	NA
WP_013348862.1\|1737617_1737860_+	RNA-binding protein	NA	NA	NA	NA
WP_013348863.1\|1738014_1738557_+	ribosome maturation factor RimM	NA	NA	NA	NA
WP_013348864.1\|1738560_1739385_+\|tRNA	tRNA (guanosine(37)-N1)-methyltransferase TrmD	NA	NA	NA	NA
WP_013348865.1\|1739635_1739995_+	50S ribosomal protein L19	NA	NA	NA	NA
WP_013348866.1\|1740008_1740656_+	signal peptidase I	NA	NA	NA	NA
WP_013348867.1\|1741079_1743521_+\|protease	trypsin-like serine protease	NA	NA	NA	NA

DBSCAN-SWA_7

2071074 : 2112667

Tupanvirus(20.0%)

transposase,protease,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013349172.1\|2071074_2074335_-\|tRNA	isoleucine--tRNA ligase	A0A2K9L9X8	Tupanvirus	2.0e-156	33.6
WP_013349173.1\|2074784_2075339_+	DUF421 domain-containing protein	NA	NA	NA	NA
WP_013349174.1\|2075389_2076637_+	sensor histidine kinase	NA	NA	NA	NA
WP_013349175.1\|2076633_2077251_+	response regulator transcription factor	NA	NA	NA	NA
WP_013349176.1\|2077363_2079466_+	MMPL family transporter	NA	NA	NA	NA
WP_041648808.1\|2079458_2079902_+	DUF2871 domain-containing protein	NA	NA	NA	NA
WP_013349178.1\|2080079_2081318_+	DNA polymerase III subunit epsilon	A0A0A7RWA3	Clostridium_phage	7.4e-11	30.8
WP_013349179.1\|2081406_2082861_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_013349180.1\|2082878_2083658_-	uroporphyrinogen-III C-methyltransferase	NA	NA	NA	NA
WP_013349181.1\|2083650_2084508_-	ABC transporter permease	NA	NA	NA	NA
WP_013349182.1\|2084479_2085223_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.9e-26	35.1
WP_013349183.1\|2085222_2086320_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_013349184.1\|2086306_2087602_-	sulfate adenylyltransferase	A0A1V0SGC3	Hokovirus	9.1e-28	27.4
WP_013349185.1\|2087603_2088527_-	sulfate adenylyltransferase subunit 2	NA	NA	NA	NA
WP_013349186.1\|2088538_2089261_-	phosphoadenylyl-sulfate reductase	NA	NA	NA	NA
WP_013349187.1\|2089257_2090958_-	nitrite/sulfite reductase	NA	NA	NA	NA
WP_013349188.1\|2091025_2091766_-	CbiX family protein	NA	NA	NA	NA
WP_013349189.1\|2091796_2092561_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_013349190.1\|2092765_2095384_+\|tRNA	valine--tRNA ligase	A0A2K9KZB8	Tupanvirus	2.1e-164	38.4
WP_013349191.1\|2095445_2095634_-	hypothetical protein	NA	NA	NA	NA
WP_102598379.1\|2095703_2096693_-	hypothetical protein	NA	NA	NA	NA
WP_013349193.1\|2096901_2097972_-\|transposase	IS1595-like element ISAar1 family transposase	NA	NA	NA	NA
WP_013347368.1\|2098400_2099708_-\|transposase	ISL3-like element ISAar19 family transposase	A0A2H4PDF8	Mycobacterium_phage	2.1e-149	60.1
WP_013349194.1\|2100250_2100859_-	DsbA family protein	NA	NA	NA	NA
WP_013349195.1\|2100904_2102197_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	1.3e-130	56.3
WP_013349196.1\|2102364_2103024_-\|protease	ATP-dependent Clp protease proteolytic subunit	A0A223W000	Agrobacterium_phage	1.4e-37	43.3
WP_013349197.1\|2103071_2103692_-\|protease	ATP-dependent Clp protease proteolytic subunit	A0A223W000	Agrobacterium_phage	1.8e-45	50.8
WP_013349198.1\|2103915_2105247_-	trigger factor	NA	NA	NA	NA
WP_013349199.1\|2106879_2107848_-	DNA glycosylase	NA	NA	NA	NA
WP_013349200.1\|2107850_2108324_-	ribose-5-phosphate isomerase	NA	NA	NA	NA
WP_013349201.1\|2108613_2111154_+	aminopeptidase N	A0A0P0IY26	Acinetobacter_phage	4.8e-49	30.7
WP_013349202.1\|2111311_2112667_-\|transposase	IS481-like element ISAar28 family transposase	NA	NA	NA	NA

DBSCAN-SWA_8

2521908 : 2580162

Mycobacterium_phage(37.5%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013349578.1\|2521908_2522988_-\|transposase	IS110-like element ISAar18 family transposase	NA	NA	NA	NA
WP_013349579.1\|2523434_2524631_+\|transposase	IS110-like element ISAar17 family transposase	NA	NA	NA	NA
WP_013349581.1\|2524891_2525995_-	redox-regulated ATPase YchF	NA	NA	NA	NA
WP_013349582.1\|2526073_2527159_-	4-hydroxy-3-methylbut-2-enyl diphosphate reductase	NA	NA	NA	NA
WP_013349583.1\|2527364_2528627_+	exodeoxyribonuclease VII large subunit	A0A142K922	Gordonia_phage	3.9e-68	41.6
WP_013349584.1\|2528655_2528886_+	exodeoxyribonuclease VII small subunit	NA	NA	NA	NA
WP_013349585.1\|2528906_2529770_-	polyphosphate--nucleotide phosphotransferase	NA	NA	NA	NA
WP_013349587.1\|2530051_2531272_-	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
WP_146040892.1\|2531364_2532264_-	hypothetical protein	NA	NA	NA	NA
WP_013349590.1\|2532894_2533401_+	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_013349591.1\|2533473_2534307_-	hypothetical protein	NA	NA	NA	NA
WP_013349592.1\|2534487_2535108_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_013349593.1\|2535193_2535808_+	5-formyltetrahydrofolate cyclo-ligase	NA	NA	NA	NA
WP_013349594.1\|2535869_2536580_+	hypothetical protein	NA	NA	NA	NA
WP_013349595.1\|2536582_2536900_-	hypothetical protein	NA	NA	NA	NA
WP_157867141.1\|2536899_2541129_-	DNA helicase	NA	NA	NA	NA
WP_157867142.1\|2541382_2541934_-	hypothetical protein	NA	NA	NA	NA
WP_013349598.1\|2542090_2543677_-	glutamine-hydrolyzing GMP synthase	NA	NA	NA	NA
WP_013349599.1\|2543824_2544289_-	DUF3817 domain-containing protein	NA	NA	NA	NA
WP_013349600.1\|2544339_2545149_-	hypothetical protein	NA	NA	NA	NA
WP_013349601.1\|2545324_2546476_-	GuaB3 family IMP dehydrogenase-related protein	NA	NA	NA	NA
WP_013349602.1\|2546650_2547967_-	BtrH N-terminal domain-containing protein	NA	NA	NA	NA
WP_013349603.1\|2548216_2548771_+	hypothetical protein	NA	NA	NA	NA
WP_013349604.1\|2548967_2550473_-	IMP dehydrogenase	A0A1V0SHK8	Klosneuvirus	2.0e-90	40.2
WP_013349605.1\|2550593_2552690_-	acyltransferase	A0A166XZF2	Gordonia_phage	1.0e-52	28.5
WP_013349607.1\|2553120_2554722_-	chaperonin GroEL	A0A219YK78	uncultured_virus	2.0e-146	52.3
WP_013349608.1\|2554755_2555052_-	co-chaperone GroES	A0A221S4M3	uncultured_virus	1.3e-17	47.4
WP_157867143.1\|2555243_2556821_-	amino acid permease	NA	NA	NA	NA
WP_013349610.1\|2557269_2558511_+	methyltransferase	NA	NA	NA	NA
WP_013349611.1\|2558668_2559811_+	glutamate--cysteine ligase	NA	NA	NA	NA
WP_013349612.1\|2560243_2560972_+	hypothetical protein	NA	NA	NA	NA
WP_013349613.1\|2561202_2562015_-	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_013349614.1\|2562052_2564092_-	hypothetical protein	NA	NA	NA	NA
WP_013349615.1\|2564460_2565135_-	FadR family transcriptional regulator	NA	NA	NA	NA
WP_157867240.1\|2565131_2566400_-	MFS transporter	NA	NA	NA	NA
WP_013347368.1\|2567036_2568344_+\|transposase	ISL3-like element ISAar19 family transposase	A0A2H4PDF8	Mycobacterium_phage	2.1e-149	60.1
WP_013347368.1\|2570491_2571799_+\|transposase	ISL3-like element ISAar19 family transposase	A0A2H4PDF8	Mycobacterium_phage	2.1e-149	60.1
WP_041648901.1\|2573548_2574253_+	hypothetical protein	NA	NA	NA	NA
WP_041648904.1\|2574504_2575548_+	RNA-directed DNA polymerase	NA	NA	NA	NA
WP_013347368.1\|2575667_2576975_+\|transposase	ISL3-like element ISAar19 family transposase	A0A2H4PDF8	Mycobacterium_phage	2.1e-149	60.1
WP_157867144.1\|2577435_2577996_+	hypothetical protein	NA	NA	NA	NA
WP_157867145.1\|2578685_2580162_+\|transposase	IS3-like element ISAar44 family transposase	NA	NA	NA	NA

DBSCAN-SWA_9

3250901 : 3354467

Mycobacterium_phage(33.33%)

transposase,integrase

attL 3333348:3333407|attR 3347436:3347504

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013348203.1\|3250901_3252098_+\|transposase	IS110-like element ISAar2 family transposase	NA	NA	NA	NA
WP_013350216.1\|3252491_3253040_+	alternate-type signal peptide domain-containing protein	NA	NA	NA	NA
WP_157867169.1\|3253078_3253612_+	signal peptidase I	NA	NA	NA	NA
WP_157867170.1\|3253629_3254241_+	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_081461177.1\|3254233_3254821_+	hypothetical protein	NA	NA	NA	NA
WP_157867171.1\|3254946_3255381_+	signal peptidase I	NA	NA	NA	NA
WP_013350221.1\|3255703_3256216_+	hypothetical protein	NA	NA	NA	NA
WP_013350222.1\|3256634_3257942_+\|transposase	ISL3 family transposase	A0A2H4PDF8	Mycobacterium_phage	1.1e-150	61.7
WP_102599017.1\|3258007_3259162_-	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_102599151.1\|3259623_3261336_+	metallophosphoesterase	NA	NA	NA	NA
WP_013350225.1\|3261378_3262503_-	hypothetical protein	NA	NA	NA	NA
WP_041649066.1\|3262769_3263027_+	hypothetical protein	NA	NA	NA	NA
WP_157867172.1\|3263185_3263329_+	hypothetical protein	NA	NA	NA	NA
WP_157867173.1\|3263398_3263704_+	hypothetical protein	NA	NA	NA	NA
WP_049862667.1\|3263782_3264052_+	hypothetical protein	NA	NA	NA	NA
WP_081461178.1\|3264109_3264526_-	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_013348684.1\|3264843_3266289_+\|transposase	IS481-like element ISAar22 family transposase	NA	NA	NA	NA
WP_049862669.1\|3266449_3267112_+	HAD family hydrolase	NA	NA	NA	NA
WP_013350227.1\|3267201_3267789_+	HAD-IA family hydrolase	NA	NA	NA	NA
WP_157867174.1\|3267892_3268060_-	hypothetical protein	NA	NA	NA	NA
WP_013350228.1\|3268149_3268818_-	hypothetical protein	NA	NA	NA	NA
WP_013350229.1\|3269004_3269751_-	SUMF1/EgtB/PvdO family nonheme iron enzyme	A0A075BUR2	Microcystis_phage	3.3e-22	33.5
WP_013350230.1\|3269933_3270329_+	hypothetical protein	NA	NA	NA	NA
WP_013350231.1\|3270376_3270919_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_096257316.1\|3271154_3272304_+\|transposase	IS3-like element ISAar43 family transposase	S5WIU1	Leptospira_phage	2.3e-38	37.6
WP_041649068.1\|3272640_3273003_-	hypothetical protein	NA	NA	NA	NA
WP_013350236.1\|3273604_3274549_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_102599150.1\|3275148_3276105_-	restriction endonuclease subunit S	NA	NA	NA	NA
WP_013350238.1\|3276152_3278018_-	N-6 DNA methylase	P95687	Staphylococcus_phage	5.8e-60	31.2
WP_013350240.1\|3278451_3279060_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_013350241.1\|3279694_3279997_-	hypothetical protein	NA	NA	NA	NA
WP_013348761.1\|3280297_3281575_-\|transposase	ISL3-like element ISAar13 family transposase	A0A0A8WEF4	Clostridium_phage	1.4e-17	24.3
WP_013350242.1\|3281806_3283747_-	cadmium-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	9.2e-93	37.1
WP_013350243.1\|3283743_3284112_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_013350244.1\|3284271_3285519_-\|transposase	ISL3-like element ISAar30 family transposase	A0A2H4PDF8	Mycobacterium_phage	2.7e-178	71.6
WP_013350245.1\|3285684_3286314_-	hypothetical protein	NA	NA	NA	NA
WP_013350246.1\|3286310_3286649_-	PadR family transcriptional regulator	NA	NA	NA	NA
WP_041649078.1\|3286901_3287126_+\|transposase	transposase	A0A2H4PDF8	Mycobacterium_phage	2.0e-12	65.5
WP_013350247.1\|3287692_3289156_+\|transposase	IS21-like element ISAar7 family transposase	NA	NA	NA	NA
WP_013348174.1\|3289152_3289884_+	ATP-binding protein	A0A059NT77	Lactococcus_phage	4.5e-32	38.8
WP_013348173.1\|3289880_3290213_+	hypothetical protein	A0A220NQR3	Corynebacterium_phage	8.3e-10	54.7
WP_013350248.1\|3290346_3291735_+\|transposase	IS256-like element ISAar6 family transposase	A0A218MNI5	uncultured_virus	8.2e-35	37.0
WP_013350249.1\|3291769_3292840_-\|transposase	IS1595-like element ISAar1 family transposase	NA	NA	NA	NA
WP_013350250.1\|3293276_3293519_+	hypothetical protein	NA	NA	NA	NA
WP_013350251.1\|3293945_3294248_+	hypothetical protein	NA	NA	NA	NA
WP_013348199.1\|3294338_3295538_-\|transposase	IS256-like element ISAar5 family transposase	NA	NA	NA	NA
WP_096257432.1\|3295657_3296305_-	hypothetical protein	NA	NA	NA	NA
WP_013350252.1\|3296468_3297776_-\|transposase	ISL3-like element ISAar23 family transposase	A0A2H4PDF8	Mycobacterium_phage	7.2e-150	61.2
WP_157867175.1\|3298716_3299433_+	hypothetical protein	NA	NA	NA	NA
WP_013350253.1\|3299407_3301168_+	type IV secretory system conjugative DNA transfer family protein	NA	NA	NA	NA
WP_013350254.1\|3301164_3301782_+	hypothetical protein	NA	NA	NA	NA
WP_102599148.1\|3301993_3302281_-	hypothetical protein	NA	NA	NA	NA
WP_049862673.1\|3302559_3303156_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_013350257.1\|3304201_3304990_+	hypothetical protein	A0A2I7SCF1	Paenibacillus_phage	3.0e-10	30.6
WP_013350258.1\|3305008_3305251_+	hypothetical protein	NA	NA	NA	NA
WP_013347623.1\|3305455_3306763_+\|transposase	ISL3-like element ISAar23 family transposase	A0A2H4PDF8	Mycobacterium_phage	8.5e-151	61.5
WP_102598997.1\|3307318_3309037_-	hypothetical protein	NA	NA	NA	NA
WP_013350259.1\|3309072_3310641_+	recombinase family protein	NA	NA	NA	NA
WP_140393397.1\|3311856_3312111_-	hypothetical protein	NA	NA	NA	NA
WP_041649090.1\|3312439_3313129_+	hypothetical protein	NA	NA	NA	NA
WP_076611950.1\|3313845_3315056_-\|transposase	IS3-like element ISAar25 family transposase	A0A0P0I4A4	Acinetobacter_phage	6.1e-34	33.0
WP_041650241.1\|3318674_3319190_-	ClbS/DfsB family four-helix bundle protein	NA	NA	NA	NA
WP_157867176.1\|3319382_3322031_-	relaxase domain-containing protein	NA	NA	NA	NA
WP_013350266.1\|3322631_3323066_+	hypothetical protein	NA	NA	NA	NA
WP_013350267.1\|3323346_3323769_-	hypothetical protein	NA	NA	NA	NA
WP_013350268.1\|3325417_3326329_+	DUF1792 domain-containing protein	NA	NA	NA	NA
WP_157867177.1\|3326737_3326908_-	hypothetical protein	NA	NA	NA	NA
WP_013350270.1\|3327322_3328447_+	amidase domain-containing protein	NA	NA	NA	NA
WP_013350271.1\|3328480_3328900_+	hypothetical protein	NA	NA	NA	NA
WP_013350273.1\|3331941_3332673_+	ATP-binding protein	A0A059NT77	Lactococcus_phage	5.8e-32	38.3
WP_013350274.1\|3332669_3333002_+	hypothetical protein	A0A220NQR3	Corynebacterium_phage	3.1e-09	54.0
3333348:3333407	attL	NA	NA	NA	NA
WP_096256523.1\|3333890_3334307_+	hypothetical protein	NA	NA	NA	NA
WP_041649099.1\|3334593_3334845_+	hypothetical protein	NA	NA	NA	NA
WP_013350276.1\|3335116_3336238_+	hypothetical protein	NA	NA	NA	NA
WP_141392956.1\|3336289_3336601_+	hypothetical protein	NA	NA	NA	NA
WP_013350278.1\|3336841_3337189_+	hypothetical protein	NA	NA	NA	NA
WP_041649103.1\|3337541_3338141_+	recombinase family protein	I1ZBD6	Salisaeta_icosahedral_phage	9.7e-25	39.8
WP_013350280.1\|3338405_3338693_+	hypothetical protein	NA	NA	NA	NA
WP_013350281.1\|3339035_3339536_-	DUF805 domain-containing protein	NA	NA	NA	NA
WP_013350282.1\|3339815_3340859_-	DUF1016 family protein	Q9JMP5	Wolbachia_phage	7.5e-73	42.6
WP_013350283.1\|3341267_3341765_+	hypothetical protein	NA	NA	NA	NA
WP_013350285.1\|3342786_3343149_-	hypothetical protein	NA	NA	NA	NA
WP_162094127.1\|3343443_3343842_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_041650260.1\|3344203_3344515_-\|transposase	transposase	NA	NA	NA	NA
WP_041649106.1\|3345173_3345743_-	hypothetical protein	NA	NA	NA	NA
WP_041649107.1\|3346047_3347280_-	DUF2029 domain-containing protein	NA	NA	NA	NA
WP_157867089.1\|3347455_3348603_-\|transposase	IS3-like element ISAar3 family transposase	NA	NA	NA	NA
3347436:3347504	attR	NA	NA	NA	NA
WP_162094128.1\|3349065_3349557_+	hypothetical protein	NA	NA	NA	NA
WP_041648188.1\|3351700_3352141_-	hypothetical protein	NA	NA	NA	NA
WP_013347371.1\|3352382_3352976_-	recombinase family protein	G8I4U3	Mycobacterium_phage	4.0e-23	36.4
WP_013347368.1\|3353159_3354467_-\|transposase	ISL3-like element ISAar19 family transposase	A0A2H4PDF8	Mycobacterium_phage	2.1e-149	60.1

DBSCAN-SWA_10

3390282 : 3431331

Mycobacterium_phage(44.44%)

transposase,integrase

attL 3411257:3411272|attR 3436380:3436395

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013350322.1\|3390282_3391593_+\|transposase	ISL3-like element ISAar39 family transposase	A0A2H4PDF8	Mycobacterium_phage	7.2e-166	64.8
WP_013350323.1\|3391616_3392393_-	ABC transporter ATP-binding protein	W5SAS9	Pithovirus	4.8e-16	33.0
WP_013350324.1\|3392389_3393454_-	iron ABC transporter permease	NA	NA	NA	NA
WP_013350325.1\|3393443_3394475_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_013350326.1\|3394489_3395332_-	DJ-1/PfpI family protein	NA	NA	NA	NA
WP_096253939.1\|3395520_3396685_+\|transposase	IS3-like element ISAar24 family transposase	U5P429	Shigella_phage	5.5e-40	37.2
WP_013350329.1\|3397190_3398492_+\|transposase	ISL3-like element ISAar42 family transposase	A0A2H4PDF8	Mycobacterium_phage	3.2e-182	71.5
WP_013350331.1\|3400226_3400661_+	hypothetical protein	NA	NA	NA	NA
WP_049862679.1\|3400753_3400954_+	hypothetical protein	NA	NA	NA	NA
WP_013350333.1\|3401105_3402533_+	hypothetical protein	NA	NA	NA	NA
WP_013350334.1\|3402706_3402994_+	hypothetical protein	NA	NA	NA	NA
WP_013350335.1\|3403211_3403595_+	hypothetical protein	NA	NA	NA	NA
WP_013350336.1\|3403642_3403933_-	hypothetical protein	NA	NA	NA	NA
WP_013350337.1\|3404153_3404747_+	ParA family protein	A0A222ZPB1	Mycobacterium_phage	2.3e-26	39.3
WP_013350338.1\|3404743_3404980_+	toxin-antitoxin system HicB family antitoxin	NA	NA	NA	NA
WP_013350339.1\|3405440_3405827_+	hypothetical protein	NA	NA	NA	NA
WP_013350340.1\|3405880_3406048_+	hypothetical protein	NA	NA	NA	NA
WP_013350341.1\|3406064_3406289_+	glutaredoxin-like protein NrdH	V5UN81	Mycobacterium_phage	4.5e-20	62.5
WP_013350342.1\|3406644_3407646_+	DUF4192 family protein	NA	NA	NA	NA
WP_013350344.1\|3408150_3408384_+	hypothetical protein	NA	NA	NA	NA
WP_013350345.1\|3408585_3408912_+	hypothetical protein	NA	NA	NA	NA
WP_157867256.1\|3409071_3412344_-	N-6 DNA methylase	NA	NA	NA	NA
3411257:3411272	attL	NA	NA	NA	NA
WP_013350347.1\|3412563_3412890_+	hypothetical protein	NA	NA	NA	NA
WP_013350348.1\|3412974_3414378_-	PepSY domain-containing protein	NA	NA	NA	NA
WP_041649118.1\|3414460_3415663_-	Dyp-type peroxidase	NA	NA	NA	NA
WP_013350350.1\|3415662_3416235_-	copper chaperone PCu(A)C	NA	NA	NA	NA
WP_157867180.1\|3416641_3417067_-	hypothetical protein	NA	NA	NA	NA
WP_013350294.1\|3418019_3418961_+	metal ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_013350352.1\|3418960_3419692_+	metal ABC transporter ATP-binding protein	NA	NA	NA	NA
WP_013350353.1\|3419694_3420582_+	metal ABC transporter permease	NA	NA	NA	NA
WP_081461225.1\|3420652_3421117_-	metal-dependent transcriptional regulator	NA	NA	NA	NA
WP_041649120.1\|3421645_3422305_+	hypothetical protein	NA	NA	NA	NA
WP_013350355.1\|3422292_3422754_+	hypothetical protein	NA	NA	NA	NA
WP_041649121.1\|3423053_3423647_+	recombinase family protein	A0A219Y9V9	Aeromonas_phage	2.3e-34	47.0
WP_041649122.1\|3423773_3425162_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	H7BVK1	unidentified_phage	2.7e-14	26.1
WP_013350357.1\|3425161_3425974_+	AAA family ATPase	NA	NA	NA	NA
WP_157867047.1\|3426309_3427495_+\|transposase	IS3-like element ISAar4 family transposase	U5P429	Shigella_phage	1.4e-43	36.5
WP_013350358.1\|3427592_3428645_+	nucleotide-binding protein	NA	NA	NA	NA
WP_013350359.1\|3428770_3429103_-	hypothetical protein	NA	NA	NA	NA
WP_013350360.1\|3429417_3430212_+	restriction endonuclease	NA	NA	NA	NA
WP_013350361.1\|3430284_3431331_-\|transposase	IS110-like element ISAar41 family transposase	NA	NA	NA	NA
3436380:3436395	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_014550

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection