CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
NC_004567	Lactobacillus plantarum WCFS1, complete genome	1 crisprs	csa3,DinG,cas3,DEDDh	6
NC_006375	Lactobacillus plantarum WCFS1, complete genome	0 crisprs	NA	0
NC_006377	Lactobacillus plantarum WCFS1, complete genome	0 crisprs	csa3	0
NC_006376	Lactobacillus plantarum WCFS1, complete genome	0 crisprs	NA	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_004567_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_004567_1

2763066-2763151

Orphan

Consensus_repeat	Method
TAAGAAACTTAAAGTGTCTTATT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_004567_1

>merge|NC_004567|1|2763066-2763151|CRISPRCasFinder
TAAGAAACTTAAAGTGTCTTATTCGCATAACTGGTATAATACGCTATATAAAGAAAAAGTCAATAAGAAACTTAAAGTATCTTATT

>NC_004567|1|1|2763066-2763151|CRISPRCasFinder
TAAGAAACTTAAAGTGTCTTATT	CGCATAACTGGTATAATACGCTATATAAAGAAAAAGTCAA
TAAGAAACTTAAAGTATCTTATT

Protein	Signature genes	Signature genes Name	Protein_function
NC_004567.2\|WP_011102040.1\|2757837_2758404_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NC_004567.2\|WP_022638457.1\|2770522_2770978_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|100047
NC_004567.2\|WP_011102041.1\|2761572_2763051_-\|DHA2-family-efflux-MFS-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|129794
NC_004567.2\|WP_003642340.1\|2755884_2756169_+\|DUF1905-domain-containing-protein	unknown	unknown	gnl\|CDD\|378097
NC_004567.2\|WP_003643398.1\|2763168_2763768_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NC_004567.2\|WP_003643401.1\|2768079_2768592_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|274100
NC_004567.2\|WP_044432936.1\|2763888_2764770_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|238558
NC_004567.2\|WP_003642342.1\|2756950_2757679_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|226674
NC_004567.2\|WP_011102044.1\|2768572_2769466_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187572
NC_004567.2\|WP_003642346.1\|2760502_2761456_-\|aldo/keto-reductase	unknown	unknown	gnl\|CDD\|381318
NC_004567.2\|WP_003643400.1\|2765845_2766844_+\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376439
NC_004567.2\|WP_003642350.1\|2765054_2765849_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224045
NC_004567.2\|WP_003642338.1\|2751333_2752746_+\|NAD-dependent-succinate-semialdehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|143418
NC_004567.2\|WP_003642355.1\|2769759_2770506_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|226674
NC_004567.2\|WP_003642345.1\|2759716_2760283_-\|DUF1211-domain-containing-protein	unknown	unknown	gnl\|CDD\|226078
NC_004567.2\|WP_003642344.1\|2758530_2759568_+\|aldehyde-reductase	unknown	unknown	gnl\|CDD\|187538
NC_004567.2\|WP_011102039.1\|2756452_2756818_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224647
NC_004567.2\|WP_011102043.1\|2766840_2767836_+\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376439
NC_004567.2\|WP_011102046.1\|2771287_2772124_+\|SDR-family-NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|212492
NC_004567.2\|WP_011102038.1\|2753016_2755599_-\|SH3-domain-containing-protein	unknown	unknown	gnl\|CDD\|119382

Protein	Function_ID	Function_description	E-value
NC_004567.2\|WP_011102040.1\|2757837_2758404_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	7.31502e-05
NC_004567.2\|WP_022638457.1\|2770522_2770978_-\|hypothetical-protein	gnl\|CDD\|100047	cd03357, LbH_MAT_GAT, Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates. MAT acetylates maltose and glucose exclusively at the C6 position of the nonreducing end glucosyl moiety. GAT specifically acetylates galactopyranosides. Furthermore, MAT shows higher affinity toward artificial substrates containing an alkyl or hydrophobic chain as well as a glucosyl unit. Active MAT and GAT are homotrimers, with each subunit consisting of an N-terminal alpha-helical region and a C-terminal left-handed parallel alpha-helix (LbH) subdomain with 6 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X).	4.35635e-53
NC_004567.2\|WP_011102041.1\|2761572_2763051_-\|DHA2-family-efflux-MFS-transporter-permease-subunit	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	6.30388e-72
NC_004567.2\|WP_003642340.1\|2755884_2756169_+\|DUF1905-domain-containing-protein	gnl\|CDD\|378097	pfam08922, DUF1905, Domain of unknown function (DUF1905). This domain is found in a set of hypothetical bacterial proteins.	1.07383e-22
NC_004567.2\|WP_003643398.1\|2763168_2763768_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	4.95133e-09
NC_004567.2\|WP_003643401.1\|2768079_2768592_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|274100	TIGR02366, conserved_hypothetical_protein, probable dihydroxyacetone kinase regulator. The seed alignment for this family was built from a set of closely related uncharacterized proteins associated with operons for the type of bacterial dihydroxyacetone kinase that transfers PEP-derived phosphate from a phosphoprotein, as in phosphotransferase system transport, rather than from ATP. Members have a TetR transcriptional regulator domain (pfam00440) at the N-terminus and sequence homology throughout.	3.33884e-08
NC_004567.2\|WP_044432936.1\|2763888_2764770_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|238558	cd01138, FeuA, Periplasmic binding protein FeuA. These proteins have predicted to function as initial receptors in ABC transport of metal ions in some eubacterial species. They belong to the TroA superfamily of periplasmic metal binding proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind their ligands in the cleft between these domains.	2.72098e-56
NC_004567.2\|WP_003642342.1\|2756950_2757679_+\|SDR-family-oxidoreductase	gnl\|CDD\|226674	COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only].	1.6523e-89
NC_004567.2\|WP_011102044.1\|2768572_2769466_-\|SDR-family-oxidoreductase	gnl\|CDD\|187572	cd05262, SDR_a7, atypical (a) SDRs, subgroup 7. This subgroup contains atypical SDRs of unknown function. Members of this subgroup have a glycine-rich NAD(P)-binding motif consensus that matches the extended SDRs, TGXXGXXG, but lacks the characteristic active site residues of the SDRs. This subgroup has basic residues (HXXXR) in place of the active site motif YXXXK, these may have a catalytic role. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	7.15129e-131
NC_004567.2\|WP_003642346.1\|2760502_2761456_-\|aldo/keto-reductase	gnl\|CDD\|381318	cd19092, AKR_BsYcsN_EcYdhF-like, Bacillus subtilis YcsN, Escherichia coli YdhF and similar proteins. Bacillus subtilis YcsN and Escherichia coli YdhF are prototypes of this family. They are uncharacterized aldo/keto reductase family oxidoreductases.	5.65843e-131
NC_004567.2\|WP_003643400.1\|2765845_2766844_+\|iron-ABC-transporter-permease	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	2.31826e-81
NC_004567.2\|WP_003642350.1\|2765054_2765849_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224045	COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism].	5.60764e-114
NC_004567.2\|WP_003642338.1\|2751333_2752746_+\|NAD-dependent-succinate-semialdehyde-dehydrogenase	gnl\|CDD\|143418	cd07100, ALDH_SSADH1_GabD1, Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 1-like. Succinate-semialdehyde dehydrogenase 1 (SSADH1, GabD1, EC=1.2.1.16) catalyzes the NADP(+)-dependent oxidation of succinate semialdehyde (SSA) to succinate. SSADH activity in Mycobacterium tuberculosis (Mtb) is encoded by both gabD1 (Rv0234c) and gabD2 (Rv1731). The Mtb GabD1 SSADH1 reportedly is an enzyme of the gamma-aminobutyrate shunt, which forms a functional link between two TCA half-cycles by converting alpha-ketoglutarate to succinate.	0
NC_004567.2\|WP_003642355.1\|2769759_2770506_-\|SDR-family-oxidoreductase	gnl\|CDD\|226674	COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only].	2.40011e-91
NC_004567.2\|WP_003642345.1\|2759716_2760283_-\|DUF1211-domain-containing-protein	gnl\|CDD\|226078	COG3548, COG3548, Predicted integral membrane protein [Function unknown].	5.75015e-29
NC_004567.2\|WP_003642344.1\|2758530_2759568_+\|aldehyde-reductase	gnl\|CDD\|187538	cd05227, AR_SDR_e, aldehyde reductase, extended (e) SDRs. This subgroup contains aldehyde reductase of the extended SDR-type and related proteins. Aldehyde reductase I (aka carbonyl reductase) is an NADP-binding SDR; it has an NADP-binding motif consensus that is slightly different from the canonical SDR form and lacks the Asn of the extended SDR active site tetrad. Aldehyde reductase I catalyzes the NADP-dependent reduction of ethyl 4-chloro-3-oxobutanoate to ethyl (R)-4-chloro-3-hydroxybutanoate. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	7.62333e-95
NC_004567.2\|WP_011102039.1\|2756452_2756818_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|224647	COG1733, COG1733, Predicted transcriptional regulators [Transcription].	1.16334e-31
NC_004567.2\|WP_011102043.1\|2766840_2767836_+\|iron-ABC-transporter-permease	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	2.80019e-78
NC_004567.2\|WP_011102046.1\|2771287_2772124_+\|SDR-family-NAD(P)-dependent-oxidoreductase	gnl\|CDD\|212492	cd05327, retinol-DH_like_SDR_c_like, retinol dehydrogenase (retinol-DH), Light dependent Protochlorophyllide (Pchlide) OxidoReductase (LPOR) and related proteins, classical (c) SDRs. Classical SDR subgroup containing retinol-DHs, LPORs, and related proteins. Retinol is processed by a medium chain alcohol dehydrogenase followed by retinol-DHs. Pchlide reductases act in chlorophyll biosynthesis. There are distinct enzymes that catalyze Pchlide reduction in light or dark conditions. Light-dependent reduction is via an NADP-dependent SDR, LPOR. Proteins in this subfamily share the glycine-rich NAD-binding motif of the classical SDRs, have a partial match to the canonical active site tetrad, but lack the typical active site Ser. This subgroup includes the human proteins: retinol dehydrogenase -12, -13 ,and -14, dehydrogenase/reductase SDR family member (DHRS)-12 , -13 and -X (a DHRS on chromosome X), and WWOX (WW domain-containing oxidoreductase), as well as a Neurospora crassa SDR encoded by the blue light inducible bli-4 gene. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	1.88105e-54
NC_004567.2\|WP_011102038.1\|2753016_2755599_-\|SH3-domain-containing-protein	gnl\|CDD\|119382	cd06522, GH25_AtlA-like, AtlA is an autolysin found in Gram-positive lactic acid bacteria that degrades bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family includes the AtlA and Aml autolysins from Streptococcus mutans which have a C-terminal glycosyl hydrolase family 25 (GH25) catalytic domain as well as six tandem N-terminal repeats of the GBS (group B Streptococcus) Bsp-like peptidoglycan-binding domain. Other members of this family have one or more C-terminal peptidoglycan-binding domain(s) (SH3 or LysM) in addition to the GH25 domain.	1.71807e-70

>NC_004567.2|WP_011102041.1|2761572_2763051_-|DHA2-family-efflux-MFS-transporter-permease-subunit
MQAKAKISKATMTIAWVVVFGAMAPLLDSTMINIAINNLVTSFHSSVTTVQWAVTGYLLATGVAVPFSSWLLNRFDGKAVFVAGEILFGLGSIFAAVAPNIQLLIIARLVQGFAGGLIMPLLTTLLVQTAGAAVMGQMMATVGLPMILGPLIGPVIGGIIIKFASWHWIFWINVPVVLISIALILWKMPNYPAQNRTAKMDFIGILLLIVSSSAIIYSLVNAAHTDRFNNATSIEMLILGAIALISYVVWAAWQKERAVVPLHLFKFASFDGAGLGLFIAGTVLNGAMLLLPLYFQNVRGMSVINAALALLPQGAGMLVSRTLTGRLTDQIGAKYVVLGSVVITFVGTLPFYWFGQQTSYWILALILFVRGIGAGGILMPLMADAYTGMQPGQVPAATIGTRIIQNIGSAFGSALITAIVTAYSTHQVNVFERHLKAETYHVDAAHLQVFTTSHLQAIRLAAFQQGFLVIAIAAIVIILPTLLLTNKLKAAK
>NC_004567.2|WP_003642346.1|2760502_2761456_-|aldo/keto-reductase
MKTIQIGASQLKASAVALGIMRMVRLDTDAAANVLETVHDRGVNFIDSADIYGNGDSERIFGQALKQSSLKREDFFIQSKGGIVLDPEKSSGELVFGQRYDFSKQHLIATVDKILQRMQLDYLDSFLLHRPDPLMDPAEVAAAFDELQATGKVRHFGVSNFNPMQVEMLQAAVSQKLMINQLQFGVMHTGPIQFGLHTNMQDTASLNHDGEIIEYSRLHHMTIQAWSPYQYGMFAGTFIDNPKFPELNAKLQELADQYHVTKNAIATAWILRHPANMQVILGSMNPQHLDESIAGTDVTLTRQEWYDVYFAAGNDLP
>NC_004567.2|WP_003642345.1|2759716_2760283_-|DUF1211-domain-containing-protein
MNKARLEAFTDAIIAIVLTLLVLDLPRPQTPSVRALFAEWQSIYVYIITFTLLISIWLNHHDLFVQVKKIDRVVFWANSFWLLCQSFIPFMASWITKFPHSKWPAVFYILTGFVWMLAYQLLVAAVRRLNPHIHRMSSPALSVVFGGFLVVLTVALINPDVGLFLIPVHAFASVILATKRKWHLRKYF
>NC_004567.2|WP_003642344.1|2758530_2759568_+|aldehyde-reductase
MQKQLVVVTGGSGFIAIHIIRQLLQQGYAVRTTVRSLAKAPVIKEMLTNGGITDLSALEIVVADLAHDEHWSEAMAGATYAIDVASPTPKLNFKNKAEMIRPAVDGVRRVLTASRDAGVKRVVLTSAYGAIFAGHKNRTTPYTEADWSDLNWKAIHPYQESKTRAELAAWDFINHEGRGLELTTVNPVAVMGPVLSAKYSHSNIQIQQFLEGQVKAVPNVDSGYVDVRDVASLHLLAMTAPQANGERFLATTGETLSMLDVANVLRQAFPAFASQLPTKTIPNAAVKLAAKARPELRMVASLVGTYAETSNHKAQTLLDWHPRPAAESIIATAQSMIDLGIVTKP
>NC_004567.2|WP_011102040.1|2757837_2758404_-|TetR/AcrR-family-transcriptional-regulator
MAATNHAQAIKKDSQTYLTTALLQLLRTHDLDTITVTQVVKRAGVSRMAFYRNFTTLEDLLTAYFAPAIAARFQDVLQHVPANRKLLAMGQFFSDFAPTLRLAEQRGFENIIQQLFNANMTNYYQATMTNGMLTAVQLKYWTRFMSAGVYAIWREWLLGGQLESLTTIHEILATLQTATMQALTQAQK
>NC_004567.2|WP_003642342.1|2756950_2757679_+|SDR-family-oxidoreductase
MKPLVVITGASSGFGAEIAKLFAADNYPLLLLGRRQAKLAALSANFENAMIDTVDVTNYHQFETAVRKAEAKYGKTDLLVNNAGLMLLGNVQNQDPQEWQTMLNTNVMGVLNGTQIVLNDMRDREHGTILNMSSLAGKKTFVNHAAYVASKFGVHGLSETLREENAPKNVRVMLVAPGAAETELLTHVTSKSALSDYEAWKASMGGLTLDPKHVAATVKFMYDMPQNVNIREVDIAATAQDA
>NC_004567.2|WP_011102039.1|2756452_2756818_-|helix-turn-helix-transcriptional-regulator
MLKERVTAQPRYRNEFDATMQLIRGKWKIMILFELAEVKVSRFADLQHHIQAVSHKTLASQLKELEQDELIERHDFKTAQPHVEYRLTAKGQSLIPILDAICTWGDQHVDPALIERSLCDE
>NC_004567.2|WP_003642340.1|2755884_2756169_+|DUF1905-domain-containing-protein
MKTYQFDAPIQAATIGKGGAYVACPFDIRDLFGKGRVKVHATFDEVPYNGSIVNMGVKNLDGSICYILGIRKDIRAKLHKSIGDVVAVTVTAID
>NC_004567.2|WP_011102038.1|2753016_2755599_-|SH3-domain-containing-protein
MNFKSQNPIDASQSERFKLYKSGKLWLVAGLTFFSFLGGSVLNDTNVHADATNATTTSSSAASTASSASVATSSAASDETTKATSVSSSAATQVTSAATTKTTSQAATASSSAATSQSTSTASSSTSQATKTASSAATSTSATATSQATSVASSTATTTQVSHTASSTAASAASSTATVKAVKAASSTVSSAATTATKATAKVAAVAYTAATTSSTDVWTIGDTTRPRVDVVDVASYQSTMTQSDFNKLKAAGVKTVIVKSTEGTDYTNPAALNQAKMANKAGLNVDFYHYATFSTADAAKSEATNMAGFLVKNNVSTKVLLFADMEDSSSYSVNATANLNAFWSTLDSFGYKNHGVYTSNSYLYRDAVVKTVGQSRVWRAQYPYTPSANNLWNTNDGAWQFSDTALLPSGSDYTGYIDVSIDYNGLTEDSAGTNTFVTTTSSNDTTTSEVTTDTSATTNTSTSSTTKKASGWYTFTKNTAIKSAASDSAKTVGTYSKGNRVYYNAEITTNGETWLRYLSYSGSEHFVKIAAAKTTTTKPAASTSKTVTKNETGTYKFTKTTAIKGSVSDSAKTLGTYYKGDTVYYNAKVTKNGETWLRYLSYSGAQHYVKISGAATSTTTTKPATSSSKTVTKAETGTYKFTGTTAIKGSVNDSAKTLGTYYKGDTVYYNAKVTKNGQTWLRYLSYSGAQHYVKISGAATTTTTSSKSTATASAKTVAQSGTYKFAKTTAIKSSASDAASTVGTYYKGNTVNYNAKVTTNGQTWLRYTSYSGAQHYVKVSGGAATTTSSSASKTTAAAGTYTFKTTTNIRTAASLNASVVGQYSAGESVYYIGTVSADGYQWLKYLSNSGAYHYVAKIG
>NC_004567.2|WP_003642338.1|2751333_2752746_+|NAD-dependent-succinate-semialdehyde-dehydrogenase
MAYQTINPYTNEVVKTYDNATTDQIEQALTTGDALYHQWRHEPVSSRAASLHKIAALLREHKDELAKIATIDMGKLLSESQGEVELCAMIADYYADHGAELLAPTPISTQATGDAEIEKQATGVLMLVEPWNFPYYQIMRVFAPNYMVGNPMILKHASNTPGSAAAFAKIVEEAGAPAGSLTNLFLNYDQVSDIIADPRIQGVALTGSKRGGQAVAKAAGANLKKSSMELGGSDAFVVLADADIDEAVNLAWRVRLYNAGQVCTSSKRFIVAADVYDDFLAKLKERFAKLVPGDPMDPQTTLAPMNSKRAKEKLQDQVDRAIAGGATVAYGNEPIDLPGQFFQPTILTDIDQDNPLFYEEMFGPVAQVFKVDSEQAAIDLANNSELGLGGIVFAGTAAHGKAVAQQIETGMVFVNTFLSSLPELPFGGVKGSGYGRELSSLGLMAFVNEKLVVTAQKPDYDNGAGGLVVL
>NC_004567.2|WP_003643398.1|2763168_2763768_+|TetR/AcrR-family-transcriptional-regulator
MTKTRRRGAELENAIYQAARDILNQDGLEQLTFANVAEQAGTSKPVIYRRWRSPLELAIAAIQDQIITENHGQLDEVSLTGQTLSEDLFQVLKRFTVSINTFNQALVITWFHHLDQQANPEVKDLLNAVKKIDAHAIERVCQRAQQRGELRTGTLSCDLQLMPFDWLRYRAFANEPITDATLHLLVDDLLVPAYQHALG
>NC_004567.2|WP_044432936.1|2763888_2764770_-|ABC-transporter-substrate-binding-protein
MGSLLLGACGAKQPTSTTVTRTDYLKHKVKVPKHPKRIVASYLEDDLVALGIKPVVQWSVKNGSGTQAYLKEQLKGVPLIDYSLPYEAVTKAKPDLILIGTSSAVANGKYAQYNKIAPTYVVKNGTTVTWRQTFLDVAKVVNRQAKAKKVLAKYDKQVQTTRQALKKSGQHKVAVLWVTNNTAYMVNDNSASGALLYQDLQLGEPSLVKQVSKSATADWSAVSLEKLAKLDADDIFLVNSQKSASLFKDPLWKNIKAVKNNHLYQYGDSSSWQYSGPIAYSQMIDMVKTDLLK
>NC_004567.2|WP_003642350.1|2765054_2765849_+|ABC-transporter-ATP-binding-protein
MNTIEAQNISIGYGDKVIVDQLSITIPHGQITTLIGPNGSGKSTLIRAIAHLLPPTTGVILLDHQNIQQIKSKTFAKKIAVLPQTNQTANDLTVEELVSFGRLPYRRPLSGLTTTDHQKIEWALTQASLQDLRQRPLSTLSGGQRQRAWIAMAVAQDTDTIILDEPTTYLDLTHQLEVMQLVKKLNEQAHRTIIMALHDLNHAARISDQLIALKDGHVLAHGPVSTVMTAANLKTIFNIDATLVDYHGTPLILTYNGCQEVAPA
>NC_004567.2|WP_003643400.1|2765845_2766844_+|iron-ABC-transporter-permease
MKSTSRYWGWLALSTGVLILVMGLSLRFGADQMRTATVWHALTTTHTGNLDQQIIRHIRVPRVLGAALIGAALAGSGALMQAVTRNPLADSGLLGINAGAGLMLTLCLAFFPKLSTLQTTGWAIIGAAASAGLIFSISTARHVQLDPTILVLAGIAISSLLTALSEGLALVLQLKQDLAFWYFGGLGAVSWTQLKFLGPGLVLGLLLTLLLAPQLNLAYLTDDNAQSLGKSLPLLRGLALICAVILSGISVALVGTITFVGLMIPHMARWLVGANYRNSMPLTLILGATLTVGADLIARLVNPPHETPFGIIISLIGVPCFIYLARKEPMKA
>NC_004567.2|WP_011102043.1|2766840_2767836_+|iron-ABC-transporter-permease
MSPNRRLIIWSLLLTASMLGLAILNLSTGTMTISWPALLGILTSRGNATDMLVLVNFRLPRIVLAIMVGWALALSGNVLQTVTNNPMADPSLLGINNGAGLAVMLLIIGAGTNASLTLSLPIVALAGAWLSTALIFLLANQRQRGISSKRLLLVGVALSGCFSALMVLMTLKLSPDNYQFVMNWLAGSLWGTDWSYIGWALPWLAVGSGILFIQLPVLDAFTLGTTTAQTLGINLKRQQLGLISVAAMLAGVSVAISGGISFIGLITPNLARRIVGSRQRYQLPLAGLLGSTLLLAADTLGKLITTTTELPAGVLVALIGAPYFIYLLVRG
>NC_004567.2|WP_003643401.1|2768079_2768592_+|TetR/AcrR-family-transcriptional-regulator
MANQRNQRMQATILLAYENLLSDKPFRKITVQDISDAALVHRSTFYKHFQDQYDLLEALFEQKRQQSKLTIDQIFTHPFETLNSFGNARFQETLRHQFNDDAFRDAFLNYLIHLCKDTVDDDQRLVRFLAVGRIKGLTLWITVGNAPYNIFTDTATLDNIFSNPLNTVNY
>NC_004567.2|WP_011102044.1|2768572_2769466_-|SDR-family-oxidoreductase
MKVFITGGTGFVGSAVVQELVANGFEVVGLARSETSAQKLISWGAQPVRGSLTSLSTLATAAAQADAIIHLGFNNDFRHFFQAGAMDRRAIETMGRAISGTNKPLVVTYGTTGIRKHVETEHEVADTGLLKWLTPRKSEIVARQLMAQNINAFVVRLSPAVHGAGDMGFTRTVIERAKKSHRAEYFGLGTHAWSAVHRLDAAHLFYLVTMYGLEHPTTNERVFNAVAEESITIAAIARTISRKLNVPLKAKYNPLSFGDTAMLYLINCPTSSQLTRQILGWVPVQPDLLTDISSSRY
>NC_004567.2|WP_003642355.1|2769759_2770506_-|SDR-family-oxidoreductase
MSIKGKVVVITGASSGIGAATAKLLAAKGAKVVLGARREERLQALSQAIGDNAVYQVTDVTDRQQVRALIDLAVSKFGRVDVLYNNAGTMPQGNLSDREYDKWQMMLNVNIMGVLNGIGEVLPIMQKQHDGLIIATDSVAGHVVYPASAVYNGTKYAVRAIMEGLRQEEKEHGIRSTIVSPGAVRTELVNTIGNTQIQAGISELMNADDRQGLALNPEDIANAVLFAIDQPKHVAISEVLVRPAQQEV
>NC_004567.2|WP_022638457.1|2770522_2770978_-|hypothetical-protein
MNVTREPSEIRERLAEITGQTIDISVEIRVPLWTDYGRNLKIGKRVFINDNVQITDLGGIKLADDVLIGPGAMLLSVNHPLDPAKRHAVEVQPIHIERNAWIGAGAKVLAGVTVGENAVVGAGAVVTKSVPANTVVAGVPAKVIKTIEQVD
>NC_004567.2|WP_011102046.1|2771287_2772124_+|SDR-family-NAD(P)-dependent-oxidoreductase
MQSKLAVIIGGTSGVGKHTAIDLANQNYHVIIVGSRADKGRQAQADISQATGNQAVQLALADLSTKTGVQQFAHQLAAMTDHIDILLNSIGVILPERHLSADGYDLNLVLNYLTHFWTIQALLPLLKHSDQARILLVGALPFVINHAKVSLPDFDAPATSKYNAMTVTAQATAARVLLTLALSERLTATNVTINIFHPGYVPDSNFGAGGSWVSRLAGRILGESFSRKNSPIGAWLATAPELTHTSGHFYDDRLRQVRLSKQYTRSKANDLWRLSSQY

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

321921 : 408741

Bacillus_virus(16.67%)

protease,bacteriocin,tRNA

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003643762.1\|321921_322485_-\|protease	matrixin family metalloprotease	NA	NA	NA	NA
WP_011100974.1\|322678_323347_+	ribose 5-phosphate isomerase A	NA	NA	NA	NA
WP_003641930.1\|323496_325002_+	multicopper oxidase domain-containing protein	NA	NA	NA	NA
WP_003643763.1\|325266_325635_+	DUF1304 domain-containing protein	NA	NA	NA	NA
WP_003641932.1\|325747_326257_-	YbhB/YbcL family Raf kinase inhibitor-like protein	NA	NA	NA	NA
WP_011100975.1\|326287_327484_-	DUF2075 domain-containing protein	NA	NA	NA	NA
WP_003646440.1\|327593_328064_+	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_011100976.1\|328082_328538_+	hypothetical protein	NA	NA	NA	NA
WP_003641936.1\|328641_329214_+	acetyl-CoA carboxylase biotin carboxyl carrier protein subunit	NA	NA	NA	NA
WP_011100977.1\|329379_330300_-	ribonucleoside hydrolase RihC	NA	NA	NA	NA
WP_011100978.1\|330436_331336_+	oxidoreductase	NA	NA	NA	NA
WP_011100979.1\|331775_333656_+	hypothetical protein	NA	NA	NA	NA
WP_011100980.1\|333827_334274_-	ribonuclease H	NA	NA	NA	NA
WP_003643770.1\|334511_336038_+	ABC transporter permease/substrate-binding protein	NA	NA	NA	NA
WP_003641941.1\|336038_337010_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.7e-23	31.7
WP_003646444.1\|337087_338419_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_003643773.1\|338884_340402_+	glycerol kinase GlpK	NA	NA	NA	NA
WP_003643774.1\|340416_342246_+	type 1 glycerol-3-phosphate oxidase	NA	NA	NA	NA
WP_003641945.1\|342260_342983_+	aquaporin family protein	M1HWZ0	Paramecium_bursaria_Chlorella_virus	3.2e-30	31.9
WP_011100981.1\|343569_347265_+	MucBP domain-containing protein	NA	NA	NA	NA
WP_162045223.1\|348859_349054_+	hypothetical protein	NA	NA	NA	NA
WP_011100983.1\|349068_349488_+	hypothetical protein	NA	NA	NA	NA
WP_011100984.1\|349536_349800_+	hypothetical protein	NA	NA	NA	NA
WP_011100985.1\|349901_350180_+	hypothetical protein	NA	NA	NA	NA
WP_074161480.1\|350243_350360_+	hypothetical protein	NA	NA	NA	NA
WP_011100986.1\|350483_351401_+	hypothetical protein	NA	NA	NA	NA
WP_016526893.1\|351407_351581_+	hypothetical protein	NA	NA	NA	NA
WP_011100987.1\|352125_352668_+	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_011100988.1\|352682_352946_+	hypothetical protein	NA	NA	NA	NA
WP_003643788.1\|353062_353266_+	hypothetical protein	NA	NA	NA	NA
WP_161503992.1\|353390_353630_+	hypothetical protein	NA	NA	NA	NA
WP_003646453.1\|353647_354034_+	hypothetical protein	NA	NA	NA	NA
WP_003641954.1\|354483_354675_+	hypothetical protein	NA	NA	NA	NA
WP_157951538.1\|354877_355024_+	glycohydrolase toxin TNT-related protein	NA	NA	NA	NA
WP_011100990.1\|355100_355508_+	immunity 63 family protein	NA	NA	NA	NA
WP_011100991.1\|356778_357057_+	hypothetical protein	NA	NA	NA	NA
WP_003641962.1\|357383_358001_-	sugar O-acetyltransferase	NA	NA	NA	NA
WP_011100992.1\|358004_359159_-	MFS transporter	NA	NA	NA	NA
WP_011100993.1\|359162_359954_-	HAD family hydrolase	NA	NA	NA	NA
WP_003641965.1\|360024_360897_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_003641966.1\|361056_361872_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_011100994.1\|362397_363774_+	branched-chain amino acid transport system II carrier protein	NA	NA	NA	NA
WP_011100995.1\|363818_365003_+	cation:proton antiporter	NA	NA	NA	NA
WP_003641969.1\|365387_365591_+	hypothetical protein	NA	NA	NA	NA
WP_003641971.1\|366002_366671_-\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_011100996.1\|366667_366841_-\|bacteriocin	two-peptide bacteriocin plantaricin JK subunit PlnK	NA	NA	NA	NA
WP_003641973.1\|366871_367039_-\|bacteriocin	two-peptide bacteriocin plantaricin JK subunit PlnJ	NA	NA	NA	NA
WP_003641974.1\|367900_368101_+\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_003641975.1\|368228_368396_+\|bacteriocin	bacteriocin	NA	NA	NA	NA
WP_003641976.1\|368513_369713_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_003641977.1\|369743_370490_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003641979.1\|371367_371514_+\|bacteriocin	bacteriocin	NA	NA	NA	NA
WP_011100998.1\|371704_373033_+	GHKL domain-containing protein	NA	NA	NA	NA
WP_011100999.1\|373033_373777_+	LytTR family transcriptional regulator DNA-binding domain-containing protein	NA	NA	NA	NA
WP_003641982.1\|373895_374639_+	response regulator transcription factor	NA	NA	NA	NA
WP_003646470.1\|374943_375717_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003643811.1\|375815_375974_-\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnF	NA	NA	NA	NA
WP_003641985.1\|375998_376169_-\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnE	NA	NA	NA	NA
WP_003641986.1\|376435_378586_+	peptide cleavage/export ABC transporter	W8CYL7	Bacillus_phage	6.1e-45	27.9
WP_003641987.1\|378601_379978_+	HlyD family secretion protein	NA	NA	NA	NA
WP_003641990.1\|380824_381493_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003641991.1\|381579_382260_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_011101000.1\|382353_383040_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_063722041.1\|383155_383443_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_003646479.1\|383454_383748_+	HigA family addiction module antidote protein	M9MUN2	Rhodococcus_phage	9.9e-07	48.3
WP_011101002.1\|384037_386347_-	ATP-binding domain-containing protein	NA	NA	NA	NA
WP_011101003.1\|386605_387382_+	carbon-nitrogen family hydrolase	NA	NA	NA	NA
WP_011101004.1\|387821_388838_+\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_011101005.1\|389245_389956_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_003641998.1\|390028_391390_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_003641999.1\|391396_391585_+	hypothetical protein	NA	NA	NA	NA
WP_003642000.1\|391574_391997_+	DUF3284 domain-containing protein	NA	NA	NA	NA
WP_003643816.1\|392219_393575_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_003642002.1\|393592_395029_+	6-phospho-beta-glucosidase	A0A0B5JD41	Pandoravirus	9.7e-31	25.5
WP_011101006.1\|395149_396046_+	ROK family protein	NA	NA	NA	NA
WP_003642004.1\|396195_396942_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_011101007.1\|397054_398068_+\|tRNA	tRNA-dihydrouridine synthase family protein	NA	NA	NA	NA
WP_047672680.1\|398522_399656_+	hypothetical protein	NA	NA	NA	NA
WP_011101009.1\|399660_400455_+	hypothetical protein	NA	NA	NA	NA
WP_011101010.1\|400624_401542_+	Ppx/GppA family phosphatase	NA	NA	NA	NA
WP_011101011.1\|401587_402862_+	hydroxymethylglutaryl-CoA reductase, degradative	NA	NA	NA	NA
WP_003642010.1\|402854_403814_+	hypothetical protein	NA	NA	NA	NA
WP_003646490.1\|403835_404540_+	NAD-dependent protein deacylase	NA	NA	NA	NA
WP_003642012.1\|404539_405382_+	DUF72 domain-containing protein	NA	NA	NA	NA
WP_011101012.1\|405978_406368_+	NUDIX domain-containing protein	NA	NA	NA	NA
WP_003643823.1\|406689_408741_+\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	2.7e-90	35.8

DBSCAN-SWA_2

571807 : 664810

109

Lactobacillus_phage(34.04%)

tRNA,terminase,capsid,tail,plate,protease,portal,integrase,head

attL 570101:570116|attR 604538:604553

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
570101:570116	attL	NA	NA	NA	NA
WP_011101071.1\|571807_572500_+\|protease	matrixin family metalloprotease	NA	NA	NA	NA
WP_011101072.1\|572689_574021_-	C1 family peptidase	R4TV59	Phaeocystis_globosa_virus	4.1e-68	33.3
WP_003640926.1\|574096_574780_-	ribose-5-phosphate isomerase RpiA	NA	NA	NA	NA
WP_003640927.1\|574788_575085_-	N-acetyltransferase	NA	NA	NA	NA
WP_011101073.1\|575223_575760_+	dUTP diphosphatase	J9PV85	Bacillus_phage	1.1e-35	46.4
WP_003643928.1\|576648_578028_+	DNA repair protein RadA	NA	NA	NA	NA
WP_003640931.1\|578043_579219_+	PIN/TRAM domain-containing protein	NA	NA	NA	NA
WP_003640932.1\|579544_581035_+\|tRNA	glutamate--tRNA ligase	NA	NA	NA	NA
WP_011101074.1\|581312_582725_+\|tRNA	cysteine--tRNA ligase	M1PG92	Moumouvirus	2.3e-45	30.0
WP_003640934.1\|582726_583137_+	Mini-ribonuclease 3	NA	NA	NA	NA
WP_003640935.1\|583108_583894_+	23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB	NA	NA	NA	NA
WP_003640936.1\|583895_584441_+	NYN domain-containing protein	NA	NA	NA	NA
WP_003640938.1\|584947_585550_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_003637768.1\|585611_585761_+	50S ribosomal protein L33	NA	NA	NA	NA
WP_003640939.1\|585772_585958_+	preprotein translocase subunit SecE	NA	NA	NA	NA
WP_003643932.1\|586062_586611_+	transcription termination/antitermination protein NusG	NA	NA	NA	NA
WP_003640942.1\|587628_588054_+	50S ribosomal protein L11	NA	NA	NA	NA
WP_003640943.1\|588154_588844_+	50S ribosomal protein L1	NA	NA	NA	NA
WP_003643933.1\|589042_589546_+	50S ribosomal protein L10	NA	NA	NA	NA
WP_003637775.1\|589607_589976_+	50S ribosomal protein L7/L12	NA	NA	NA	NA
WP_011101076.1\|590127_591330_-\|integrase	tyrosine-type recombinase/integrase	A0A126GGK4	Streptococcus_phage	6.9e-38	29.8
WP_011101077.1\|591509_592673_-	DNA/RNA non-specific endonuclease	NA	NA	NA	NA
WP_011101078.1\|593162_593339_-	hypothetical protein	A0A2P0ZL93	Lactobacillus_phage	1.2e-07	53.4
WP_011101079.1\|593480_594527_-	Ltp family lipoprotein	V9QJ01	Oenococcus_phage	9.3e-23	44.4
WP_011101080.1\|594556_594925_-	membrane protein	NA	NA	NA	NA
WP_011101081.1\|594997_595414_-	ImmA/IrrE family metallo-endopeptidase	A0A0M4RD70	Bacillus_phage	4.5e-05	29.6
WP_011101082.1\|595425_595788_-	helix-turn-helix domain-containing protein	A0A0U4KKM4	Exiguobacterium_phage	2.6e-09	32.0
WP_011101083.1\|595960_596191_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_011101084.1\|596263_596578_-	hypothetical protein	NA	NA	NA	NA
WP_011101085.1\|596615_596852_-	helix-turn-helix transcriptional regulator	A0A0K2CNE2	Brevibacillus_phage	8.5e-09	30.7
WP_011101086.1\|596998_597199_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_011101087.1\|597357_597540_+	hypothetical protein	NA	NA	NA	NA
WP_011101088.1\|597600_598155_+	hypothetical protein	O03909	Lactobacillus_phage	3.6e-98	100.0
WP_011101089.1\|598160_598445_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_063733331.1\|598765_599203_+	hypothetical protein	NA	NA	NA	NA
WP_011101092.1\|599199_600087_+	recombinase RecT	E9LUM3	Lactobacillus_phage	2.5e-61	47.0
WP_061876303.1\|600118_600871_+	PD-(D/E)XK nuclease-like domain-containing protein	A0A0P0IZH9	Lactobacillus_phage	6.3e-74	52.6
WP_011101094.1\|600952_601885_+	DUF4373 domain-containing protein	A0A0P0HRQ2	Lactobacillus_phage	1.1e-56	44.3
WP_011101095.1\|601881_602169_+	hypothetical protein	NA	NA	NA	NA
WP_011101096.1\|602165_602696_+	hypothetical protein	NA	NA	NA	NA
WP_011101097.1\|602692_603226_+	hypothetical protein	O03915	Lactobacillus_phage	4.9e-36	51.7
WP_165442608.1\|603221_603638_+	RusA family crossover junction endodeoxyribonuclease	A8YQM5	Lactobacillus_phage	1.5e-21	42.2
WP_011101099.1\|603634_603865_+	hypothetical protein	O03916	Lactobacillus_phage	1.2e-23	63.2
WP_011101101.1\|603995_604367_+	hypothetical protein	A0A291I9N7	Lactobacillus_phage	7.8e-41	67.0
WP_011101103.1\|604487_604670_+	hypothetical protein	NA	NA	NA	NA
604538:604553	attR	NA	NA	NA	NA
WP_011101104.1\|604662_605010_+	hypothetical protein	O03921	Lactobacillus_phage	1.9e-57	93.9
WP_161792467.1\|605009_605447_+	DUF1642 domain-containing protein	Q5ULV5	Lactobacillus_virus	1.9e-14	45.2
WP_011101106.1\|605443_605611_+	hypothetical protein	E9LUP4	Lactobacillus_phage	2.3e-13	87.0
WP_011101107.1\|605738_606200_+	transcriptional regulator	D6PSV8	Lactobacillus_phage	2.4e-39	56.3
WP_011101108.1\|606571_607354_+	hypothetical protein	NA	NA	NA	NA
WP_165442606.1\|607574_607724_+	hypothetical protein	NA	NA	NA	NA
WP_011101110.1\|607763_608360_+\|terminase	terminase small subunit	O03926	Lactobacillus_phage	5.8e-14	33.3
WP_011101111.1\|608343_609630_+\|terminase	PBSX family phage terminase large subunit	A0A2H4IYR5	uncultured_Caudovirales_phage	3.3e-115	50.4
WP_162786275.1\|609682_611278_+\|portal	phage portal protein	D2IZM0	Enterococcus_phage	1.0e-65	34.2
WP_011101113.1\|611277_612222_+\|capsid	minor capsid protein	NA	NA	NA	NA
WP_011101114.1\|612329_612977_+	DUF4355 domain-containing protein	NA	NA	NA	NA
WP_011101115.1\|612990_614061_+\|capsid	phage capsid protein	A0A0S0N2Q7	Pseudomonas_phage	2.0e-33	30.6
WP_011101116.1\|614075_614441_+\|head,tail	phage head-tail connector protein	H9A0V3	Staphylococcus_phage	3.0e-05	38.2
WP_011101117.1\|614445_614769_+	hypothetical protein	NA	NA	NA	NA
WP_011101118.1\|614758_615313_+\|tail	tail protein	NA	NA	NA	NA
WP_011101119.1\|615313_615700_+	hypothetical protein	NA	NA	NA	NA
WP_011101120.1\|615711_616299_+\|tail	tail protein	NA	NA	NA	NA
WP_011101121.1\|616316_616829_+	hypothetical protein	NA	NA	NA	NA
WP_011101122.1\|616897_617134_+	hypothetical protein	NA	NA	NA	NA
WP_011101123.1\|617133_621138_+	tape measure protein	E9LUR1	Lactobacillus_phage	5.2e-82	44.3
WP_011101124.1\|621131_621869_+	hypothetical protein	A0A1S5SA63	Streptococcus_phage	4.1e-41	36.6
WP_011101125.1\|621868_623743_+\|tail	phage tail protein	A0A1X9IGI5	Lactococcus_phage	7.9e-49	33.2
WP_011101126.1\|623747_624740_+	SGNH/GDSL hydrolase family protein	A0A1J0MFI8	Staphylococcus_phage	4.1e-36	41.0
WP_011101127.1\|624754_625369_+\|plate	phage baseplate upper protein	A0A1J0MFQ3	Staphylococcus_phage	7.3e-44	47.8
WP_011101128.1\|625374_626115_+	hypothetical protein	NA	NA	NA	NA
WP_011101129.1\|626115_626436_+	DUF2977 domain-containing protein	NA	NA	NA	NA
WP_011101130.1\|626435_626612_+	XkdX family protein	NA	NA	NA	NA
WP_164920196.1\|626637_627738_+	LysM peptidoglycan-binding domain-containing protein	O03950	Lactobacillus_phage	1.4e-45	60.4
WP_011101132.1\|627738_628035_+	hypothetical protein	A0A1I9KK55	Lactobacillus_phage	4.4e-39	76.5
WP_011101134.1\|629227_629434_-	hypothetical protein	NA	NA	NA	NA
WP_080315010.1\|629599_629701_+	hypothetical protein	C1KFN7	Lactobacillus_virus	9.1e-05	66.7
WP_011101135.1\|629828_630098_+	hypothetical protein	NA	NA	NA	NA
WP_163621584.1\|630160_631351_+	hypothetical protein	NA	NA	NA	NA
WP_011101137.1\|632145_633123_-	DNA/RNA non-specific endonuclease	NA	NA	NA	NA
WP_003640947.1\|633135_633804_-	cell surface protein	NA	NA	NA	NA
WP_011101138.1\|634107_636711_+	bifunctional lysylphosphatidylglycerol flippase/synthetase MprF	NA	NA	NA	NA
WP_003643936.1\|636885_637461_-	TIGR00730 family Rossman fold protein	A0A1G5S9X4	Enterococcus_phage	4.9e-26	41.7
WP_003640950.1\|637542_638553_-	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A096XT60	Enterococcus_phage	3.1e-108	60.5
WP_003643938.1\|638580_640746_-	class 1b ribonucleoside-diphosphate reductase subunit alpha	A8E2R1	Enterococcus_phage	5.7e-269	63.5
WP_003640952.1\|640884_641115_-	redoxin NrdH	X2KRY7	Enterococcus_phage	2.8e-09	40.0
WP_003640953.1\|641337_641946_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_003640954.1\|641948_642455_+	nucleoside deaminase	NA	NA	NA	NA
WP_011101139.1\|642981_644679_+	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	3.9e-55	37.0
WP_003640956.1\|644700_645009_+	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_003637790.1\|645024_645624_+	recombination protein RecR	NA	NA	NA	NA
WP_003640957.1\|645638_645890_+	YaaL family protein	NA	NA	NA	NA
WP_011101140.1\|646287_646953_+	dTMP kinase	M1PSC7	Streptococcus_phage	1.4e-53	52.7
WP_003640965.1\|646949_647279_+	cyclic-di-AMP receptor	NA	NA	NA	NA
WP_003640966.1\|647295_648315_+	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	2.1e-32	33.5
WP_003640967.1\|648339_648687_+	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	2.4e-12	33.3
WP_003643942.1\|648785_649682_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	9.9e-82	55.7
WP_003640969.1\|649685_650471_+	acyl-ACP thioesterase	NA	NA	NA	NA
WP_003643943.1\|650609_651605_+	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	5.9e-51	38.2
WP_003640973.1\|653682_654537_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_003640974.1\|654533_655337_-	phosphonate ABC transporter, permease protein PhnE	NA	NA	NA	NA
WP_003640975.1\|655326_656097_-	phosphonate ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	4.9e-13	31.8
WP_003643945.1\|656134_657187_-	PhnD/SsuA/transferrin family substrate-binding protein	NA	NA	NA	NA
WP_003640977.1\|657466_658192_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA
WP_011101142.1\|658175_658754_+	ribosomal protein S18-alanine N-acetyltransferase	NA	NA	NA	NA
WP_003640979.1\|658746_659202_+	ribosomal protein S18-alanine N-acetyltransferase	NA	NA	NA	NA
WP_011101143.1\|659206_660253_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	1.0e-61	41.4
WP_003643947.1\|661172_663155_-	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L0W2	Tupanvirus	2.0e-50	28.7
WP_003640983.1\|663323_664001_+	redox-sensing transcriptional repressor Rex	NA	NA	NA	NA
WP_011101144.1\|664165_664810_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA

DBSCAN-SWA_3

1083488 : 1090553

Escherichia_phage(50.0%)

integrase

attL 1083083:1083096|attR 1097474:1097487

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1083083:1083096	attL	NA	NA	NA	NA
WP_011101289.1\|1083488_1084352_+	glucose-1-phosphate thymidylyltransferase RfbA	K7QKA7	Escherichia_phage	1.5e-98	62.4
WP_011101290.1\|1084374_1085664_+	glycosyl hydrolase	A0A2K9VCN9	Lactobacillus_phage	1.5e-27	24.4
WP_003644155.1\|1085723_1086305_+	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	4.3e-38	45.1
WP_003643249.1\|1086314_1087343_+	dTDP-glucose 4,6-dehydratase	A0A1D7XFE8	Escherichia_phage	4.9e-69	42.1
WP_011101291.1\|1087412_1088255_+	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	4.2e-34	37.2
WP_011101297.1\|1089965_1090553_-\|integrase	tyrosine-type recombinase/integrase	D2XR58	Bacillus_phage	2.1e-32	41.9
1097474:1097487	attR	NA	NA	NA	NA

DBSCAN-SWA_4

1300477 : 1310325

Lactobacillus_phage(87.5%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011101397.1\|1300477_1301716_+	hypothetical protein	A0A2P0ZL72	Lactobacillus_phage	4.2e-216	97.2
WP_011101398.1\|1301806_1302778_-	peptidase S41	A0A2P0ZL68	Lactobacillus_phage	2.0e-181	98.8
WP_003643099.1\|1302963_1303911_-	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	2.7e-178	100.0
WP_003643097.1\|1304254_1304869_+	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	6.3e-112	100.0
WP_011101399.1\|1304871_1307310_+	flavocytochrome c	A0A2P0ZL82	Lactobacillus_phage	0.0e+00	99.6
WP_011101400.1\|1307397_1307958_+	hypothetical protein	A0A2P0ZL75	Lactobacillus_phage	3.8e-100	99.5
WP_011101401.1\|1308028_1308469_-	nucleoside 2-deoxyribosyltransferase	A0A2P0ZL88	Lactobacillus_phage	3.0e-76	98.6
WP_080499794.1\|1308565_1308703_+	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_003645220.1\|1309329_1310325_+	glycosyltransferase family 2 protein	S5FKN0	Shigella_phage	3.1e-52	38.8

DBSCAN-SWA_5

2163937 : 2218340

Lactobacillus_phage(52.94%)

capsid,tail,terminase,portal,holin,integrase,head

attL 2204682:2204703|attR 2218518:2218539

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011101731.1\|2163937_2164315_-\|holin	holin	A0A2K9VCG4	Lactobacillus_phage	2.3e-16	67.5
WP_011101732.1\|2164301_2164598_-	hypothetical protein	A0A2K9VCD4	Lactobacillus_phage	2.1e-36	71.4
WP_164920204.1\|2164598_2165711_-	LysM peptidoglycan-binding domain-containing protein	O03950	Lactobacillus_phage	1.1e-34	35.6
WP_011101735.1\|2165895_2166135_-	hypothetical protein	A0A0A1ENR9	Lactobacillus_phage	3.8e-17	71.2
WP_011101736.1\|2166131_2167274_-	collagen-like protein	A0A2P0ZLF6	Lactobacillus_phage	1.7e-57	84.2
WP_011101737.1\|2167328_2169524_-	SGNH/GDSL hydrolase family protein	NA	NA	NA	NA
WP_011101738.1\|2169513_2169771_-	hypothetical protein	NA	NA	NA	NA
WP_164920180.1\|2169767_2170946_-\|tail	phage tail protein	Q9T1A5	Listeria_phage	8.3e-20	24.1
WP_011101740.1\|2170945_2171842_-\|tail	phage tail family protein	A8ATA8	Listeria_phage	7.7e-18	28.2
WP_011101741.1\|2171851_2175925_-	tape measure protein	E9LUR1	Lactobacillus_phage	3.1e-82	47.7
WP_076657353.1\|2175924_2176161_-	hypothetical protein	NA	NA	NA	NA
WP_011101743.1\|2176253_2176742_-	hypothetical protein	NA	NA	NA	NA
WP_011101744.1\|2176775_2177342_-\|tail	tail protein	NA	NA	NA	NA
WP_011101745.1\|2177353_2177740_-	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_011101746.1\|2177741_2178296_-\|tail	tail protein	NA	NA	NA	NA
WP_011101747.1\|2178285_2178609_-	hypothetical protein	NA	NA	NA	NA
WP_011101748.1\|2178613_2178979_-\|head,tail	phage head-tail connector protein	A0A1W6JNH7	Staphylococcus_phage	5.2e-05	38.5
WP_011101749.1\|2178993_2180052_-\|capsid	phage capsid protein	A0A0S0N2Q7	Pseudomonas_phage	1.8e-34	31.4
WP_011101750.1\|2180068_2180716_-	DUF4355 domain-containing protein	NA	NA	NA	NA
WP_011101751.1\|2180822_2181767_-\|capsid	minor capsid protein	NA	NA	NA	NA
WP_011101752.1\|2181769_2183422_-\|portal	phage portal protein	D2IZF6	Enterococcus_phage	6.3e-66	32.2
WP_011101755.1\|2184915_2185425_-\|terminase	terminase small subunit	O03926	Lactobacillus_phage	1.0e-46	63.2
WP_011101756.1\|2185622_2185886_-	hypothetical protein	A0A1S5SBT9	Streptococcus_phage	1.3e-21	57.5
WP_011101758.1\|2187248_2187710_-	transcriptional regulator	D6PSV8	Lactobacillus_phage	1.2e-38	56.3
WP_011101759.1\|2187788_2187989_-	hypothetical protein	NA	NA	NA	NA
WP_164920182.1\|2188019_2188313_-	hypothetical protein	NA	NA	NA	NA
WP_011101762.1\|2188528_2188840_-	hypothetical protein	A0A2K9VC43	Lactobacillus_phage	1.3e-17	43.1
WP_164920206.1\|2188912_2189320_-	hypothetical protein	Q5ULS7	Lactobacillus_virus	2.5e-24	46.8
WP_011101764.1\|2189537_2189705_-	hypothetical protein	A0A2P0ZLB5	Lactobacillus_phage	5.6e-15	89.8
WP_011101765.1\|2189697_2190078_-	endodeoxyribonuclease	NA	NA	NA	NA
WP_011101766.1\|2190074_2190593_-	hypothetical protein	O03915	Lactobacillus_phage	6.8e-35	51.3
WP_011101096.1\|2190589_2191120_-	hypothetical protein	NA	NA	NA	NA
WP_011101767.1\|2191116_2191404_-	hypothetical protein	NA	NA	NA	NA
WP_164920183.1\|2191400_2192309_-	DnaD domain protein	NA	NA	NA	NA
WP_011101769.1\|2192475_2193141_-	DUF669 domain-containing protein	O03912	Lactobacillus_phage	9.6e-66	60.4
WP_011101770.1\|2193143_2193806_-	AAA family ATPase	O03911	Lactobacillus_phage	2.9e-107	85.5
WP_011101771.1\|2193812_2194322_-	hypothetical protein	NA	NA	NA	NA
WP_023376660.1\|2194764_2194941_+	YegP family protein	NA	NA	NA	NA
WP_011101774.1\|2195189_2195702_-	transcriptional regulator	D6PST4	Lactobacillus_phage	4.0e-27	42.9
WP_011101775.1\|2195769_2196075_-	DUF771 domain-containing protein	NA	NA	NA	NA
WP_011101776.1\|2196116_2196257_-	hypothetical protein	NA	NA	NA	NA
WP_164920184.1\|2196253_2196475_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_011101778.1\|2196609_2196972_+	helix-turn-helix domain-containing protein	A0A2R2ZGJ3	Clostridioides_phage	1.7e-08	48.4
WP_011101779.1\|2196983_2197397_+	ImmA/IrrE family metallo-endopeptidase	A0A0M4RD70	Bacillus_phage	1.5e-05	31.3
WP_011101780.1\|2197423_2197759_+	hypothetical protein	A0A1B0Y4P2	Lactobacillus_phage	6.4e-26	53.0
WP_011101781.1\|2197884_2198946_+	type I restriction enzyme HsdR N-terminal domain-containing protein	A0A1S5SAB0	Streptococcus_phage	9.2e-87	45.4
WP_011101782.1\|2199109_2199286_+	hypothetical protein	A0A2P0ZL93	Lactobacillus_phage	1.0e-06	51.7
WP_011101783.1\|2199893_2201642_+	AAA family ATPase	NA	NA	NA	NA
WP_011101784.1\|2201695_2202610_+	DNA adenine methylase	NA	NA	NA	NA
WP_011101785.1\|2202696_2203818_+\|integrase	site-specific integrase	D6PSS4	Lactobacillus_phage	1.7e-46	32.7
WP_003642774.1\|2204168_2204375_-	hypothetical protein	NA	NA	NA	NA
2204682:2204703	attL	NA	NA	NA	NA
WP_011101786.1\|2204794_2205100_-	hypothetical protein	NA	NA	NA	NA
WP_164920185.1\|2205182_2205554_-	hypothetical protein	NA	NA	NA	NA
WP_011101788.1\|2205704_2205974_-\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
WP_011101790.1\|2207592_2208693_-\|portal	phage portal protein	A0A2H4J9Q5	uncultured_Caudovirales_phage	1.8e-48	34.3
WP_076657360.1\|2208693_2208894_-	hypothetical protein	NA	NA	NA	NA
WP_011101791.1\|2208847_2210551_-\|terminase	terminase large subunit	A0A2H4JBN3	uncultured_Caudovirales_phage	5.4e-121	40.3
WP_011101792.1\|2210547_2211021_-\|terminase	phage terminase small subunit P27 family	NA	NA	NA	NA
WP_011101793.1\|2211803_2212193_-	HNH endonuclease	A0A1J0MFT4	Staphylococcus_phage	5.1e-19	44.3
WP_011101794.1\|2212185_2212524_-\|head	phage head closure protein	A0A2P0ZLF0	Lactobacillus_phage	3.0e-07	35.6
WP_011101795.1\|2212510_2212702_-	hypothetical protein	NA	NA	NA	NA
WP_011101796.1\|2212723_2213197_-	hypothetical protein	NA	NA	NA	NA
WP_011101797.1\|2213342_2214737_-	virulence protein	Q4ZD27	Staphylococcus_phage	2.3e-69	35.8
WP_011101798.1\|2214736_2215537_-	bifunctional DNA primase/polymerase	NA	NA	NA	NA
WP_011101799.1\|2215533_2215788_-	hypothetical protein	NA	NA	NA	NA
WP_033613426.1\|2216227_2216431_-	hypothetical protein	NA	NA	NA	NA
WP_011101802.1\|2216563_2217130_+	helix-turn-helix domain-containing protein	A0A139ZPI6	Marinitoga_camini_virus	1.9e-06	47.5
WP_011101803.1\|2217182_2218340_+\|integrase	site-specific integrase	Q938N9	Temperate_phage	3.0e-54	34.5
2218518:2218539	attR	NA	NA	NA	NA

DBSCAN-SWA_6

2421448 : 2429959

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011101893.1\|2421448_2422027_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	2.1e-21	33.9
WP_011101894.1\|2422019_2423045_-	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	3.2e-60	41.0
WP_003642591.1\|2423041_2424496_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	2.5e-50	34.0
WP_003645864.1\|2424480_2426700_-	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	4.5e-144	39.3
WP_011101895.1\|2426692_2427373_-	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_003642588.1\|2427372_2427627_-	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_003642587.1\|2427628_2428360_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	M4SM18	Cyanophage	1.6e-37	37.3
WP_011101896.1\|2428362_2429493_-	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_003645861.1\|2429476_2429959_-	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	2.3e-16	41.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage