CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
NC_007336	Cupriavidus pinatubonensis JMP134 megaplasmid, complete sequence	0 crisprs	PD-DExK	44
NC_007348	Cupriavidus pinatubonensis JMP134 chromosome 2, complete sequence	0 crisprs	DEDDh,csa3,DinG	0
NC_007337	Cupriavidus pinatubonensis JMP134 plasmid 1, complete sequence	0 crisprs	NA	0
NC_007347	Cupriavidus pinatubonensis JMP134 chromosome 1, complete sequence	1 crisprs	cas3,csa3,DEDDh,DinG,WYL	2

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 9489

Acinetobacter_phage(50.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011295671.1\|313_1129_-	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_011295672.1\|1133_2687_-	AMP-binding protein	A0A2H4PQM9	Staphylococcus_phage	1.7e-28	25.8
WP_011295673.1\|2679_3252_-	(2Fe-2S)-binding protein	A0A0P0IVM8	Acinetobacter_phage	1.1e-14	41.3
WP_011295674.1\|3248_4064_-	carbon monoxide dehydrogenase	NA	NA	NA	NA
WP_011295675.1\|4060_7099_-	molybdopterin-dependent oxidoreductase	A0A0P0I429	Acinetobacter_phage	2.5e-36	25.1
WP_011295676.1\|7374_8283_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_011295677.1\|8481_9489_+	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	5.8e-14	25.6

DBSCAN-SWA_2

15044 : 26528

Oenococcus_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011295682.1\|15044_16193_-	mandelate racemase/muconate lactonizing enzyme family protein	Q6A202	Oenococcus_phage	5.4e-32	29.1
WP_011295683.1\|16189_17203_-	hydroxyacid dehydrogenase	M1HKI4	Acanthocystis_turfacea_Chlorella_virus	1.9e-17	28.2
WP_011295684.1\|17199_18276_-	tartrate dehydrogenase	NA	NA	NA	NA
WP_011295685.1\|18297_19182_-	NAD(P)-dependent oxidoreductase	A0A077SLF7	Escherichia_phage	1.8e-19	31.7
WP_011295686.1\|19211_20672_-	NAD-dependent succinate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_166487214.1\|20709_21639_-	D-glycerate dehydrogenase	M1I4S0	Paramecium_bursaria_Chlorella_virus	1.6e-13	22.5
WP_086004475.1\|21945_22725_+	FadR family transcriptional regulator	NA	NA	NA	NA
WP_166487186.1\|23143_23377_+	hypothetical protein	NA	NA	NA	NA
WP_011295690.1\|23834_26528_+	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	7.9e-159	34.6

DBSCAN-SWA_3

33817 : 36646

Cronobacter_phage(100.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011295699.1\|33817_36646_+\|protease	ATP-dependent Clp protease ATP-binding subunit	K4FB40	Cronobacter_phage	1.4e-121	39.3

DBSCAN-SWA_4

52030 : 120467

Staphylococcus_phage(15.38%)

integrase,transposase

attL 54504:54519|attR 128001:128016

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011295719.1\|52030_53476_+\|transposase	IS1182 family transposase	NA	NA	NA	NA
WP_086004473.1\|53873_55008_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.7e-12	27.0
54504:54519	attL	NA	NA	NA	NA
WP_011295722.1\|55027_56707_-	AMP-binding protein	A0A2H4PQM9	Staphylococcus_phage	1.4e-28	28.6
WP_041680704.1\|56935_57664_+	nitroreductase	M1I6Q5	Acanthocystis_turfacea_Chlorella_virus	6.2e-26	32.5
WP_011295724.1\|57707_59078_+	MFS transporter	NA	NA	NA	NA
WP_011295725.1\|59097_59856_+	SDR family NAD(P)-dependent oxidoreductase	F2NZ40	Diadromus_pulchellus_ascovirus	7.5e-06	32.2
WP_011295726.1\|59863_61066_+	acetyl-CoA C-acyltransferase	NA	NA	NA	NA
WP_011295727.1\|61123_61810_-	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_011295728.1\|62190_62841_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_011295729.1\|63165_64884_+	tannase/feruloyl esterase family alpha/beta hydrolase	NA	NA	NA	NA
WP_166487188.1\|65280_66057_-	FCD domain-containing protein	NA	NA	NA	NA
WP_011295731.1\|66016_66778_+	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_011295732.1\|66806_67781_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_011295733.1\|67797_68958_+	CoA transferase	NA	NA	NA	NA
WP_011295734.1\|69588_70605_-	NAD(P)-dependent alcohol dehydrogenase	NA	NA	NA	NA
WP_011295735.1\|70658_71690_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_011295736.1\|71701_72589_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_041680705.1\|72592_73300_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.4e-11	28.1
WP_011295738.1\|73332_74103_-	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	6.8e-15	25.8
WP_011295739.1\|74325_75555_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_011295740.1\|75588_76470_-	3-hydroxyisobutyrate dehydrogenase	A0A077SLF7	Escherichia_phage	3.1e-27	29.8
WP_011295741.1\|76508_77492_-	zinc-binding dehydrogenase	NA	NA	NA	NA
WP_011295742.1\|77559_79065_-	CoA-acylating methylmalonate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_011295743.1\|79219_80143_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_166487183.1\|81239_81635_-	hypothetical protein	NA	NA	NA	NA
WP_049796578.1\|81730_82384_+	amidohydrolase family protein	NA	NA	NA	NA
WP_011295745.1\|82544_83171_-\|integrase	tyrosine-type recombinase/integrase	E2ELN7	Clostridium_phage	5.4e-10	29.3
WP_011295746.1\|83641_84007_-	hypothetical protein	NA	NA	NA	NA
WP_041680706.1\|84818_86189_-	MHS family MFS transporter	Q6JIH2	Burkholderia_virus	3.5e-46	33.8
WP_049796579.1\|86423_86897_+	hypothetical protein	NA	NA	NA	NA
WP_166487184.1\|87299_87701_-	hypothetical protein	NA	NA	NA	NA
WP_011295750.1\|89499_90828_-	TolC family outer membrane protein	NA	NA	NA	NA
WP_011295751.1\|90943_96595_-	type I secretion C-terminal target domain-containing protein	NA	NA	NA	NA
WP_041680708.1\|96679_98068_-	HlyD family type I secretion periplasmic adaptor subunit	NA	NA	NA	NA
WP_011295753.1\|98051_100247_-	type I secretion system permease/ATPase	W8CYL7	Bacillus_phage	1.6e-32	27.6
WP_166487189.1\|101007_101283_+	hypothetical protein	NA	NA	NA	NA
WP_011295754.1\|101334_102129_+	DUF1016 family protein	Q9JMP5	Wolbachia_phage	4.6e-75	54.4
WP_011295755.1\|102480_103581_+\|transposase	IS5-like element ISRme16 family transposase	NA	NA	NA	NA
WP_011295756.1\|103727_104705_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_011295757.1\|104794_105481_+	DJ-1/PfpI family protein	NA	NA	NA	NA
WP_011295758.1\|105529_106513_+	hypothetical protein	NA	NA	NA	NA
WP_011295759.1\|106980_108024_-	glutathione S-transferase	NA	NA	NA	NA
WP_011295760.1\|108078_108969_-	tryptophan 2,3-dioxygenase	NA	NA	NA	NA
WP_166487190.1\|109108_110401_-	amidase	NA	NA	NA	NA
WP_011295762.1\|110508_111627_-	iron-containing alcohol dehydrogenase	NA	NA	NA	NA
WP_011295763.1\|111745_112657_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_011295764.1\|112841_113528_+	nitroreductase	M1I6Q5	Acanthocystis_turfacea_Chlorella_virus	2.7e-23	34.2
WP_011295765.1\|113640_114591_+	ring-cleaving dioxygenase	NA	NA	NA	NA
WP_011295766.1\|114612_115239_+	NAD(P)H:quinone oxidoreductase	NA	NA	NA	NA
WP_041680710.1\|115374_115617_-	hypothetical protein	NA	NA	NA	NA
WP_140952663.1\|116613_116904_-	hypothetical protein	NA	NA	NA	NA
WP_011295769.1\|117740_118946_+\|transposase	ISL3 family transposase	A4PE56	Ralstonia_virus	1.0e-121	57.6
WP_041680712.1\|118983_119418_-	DNA-binding protein	NA	NA	NA	NA
WP_041680713.1\|119555_120467_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
128001:128016	attR	NA	NA	NA	NA

DBSCAN-SWA_5

140246 : 148977

Vibrio_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011295787.1\|140246_142121_+	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	3.1e-37	36.0
WP_011295788.1\|142227_142431_-	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	7.0e-20	70.1
WP_041680721.1\|142771_143143_-	hypothetical protein	NA	NA	NA	NA
WP_011295789.1\|143638_144346_+	hypothetical protein	NA	NA	NA	NA
WP_011295790.1\|145346_147362_+	diguanylate cyclase	A0A127AWB9	Bacillus_phage	1.8e-14	32.1
WP_041680723.1\|147439_147646_+	hypothetical protein	NA	NA	NA	NA
WP_011295791.1\|148233_148977_-	acetoacetyl-CoA reductase	A0A0K0KVL6	Prochlorococcus_phage	6.0e-08	27.2

DBSCAN-SWA_6

155889 : 165413

Bacillus_virus(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011295798.1\|155889_159219_+	EAL domain-containing protein	G3MA91	Bacillus_virus	8.6e-22	34.6
WP_011295799.1\|159265_159904_+	hypothetical protein	NA	NA	NA	NA
WP_084792064.1\|160441_160711_+	DUF2188 domain-containing protein	NA	NA	NA	NA
WP_011295800.1\|161089_161293_-	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	1.8e-20	71.6
WP_166487192.1\|161882_162047_+\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_166487193.1\|162155_162689_-	hypothetical protein	NA	NA	NA	NA
WP_011295801.1\|163274_165413_+	glycosyltransferase	M1HZF6	Acanthocystis_turfacea_Chlorella_virus	1.8e-36	32.8

DBSCAN-SWA_7

174944 : 180421

Trichoplusia_ni_ascovirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011295807.1\|174944_175709_-	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	3.8e-18	33.2
WP_011295808.1\|175874_176663_-	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_011295809.1\|176691_177588_-	alpha/beta hydrolase	A2RQC8	Archaeal_BJ1_virus	1.6e-15	29.2
WP_011295810.1\|177745_178366_-	flavin reductase family protein	NA	NA	NA	NA
WP_011295811.1\|178593_179007_-	tautomerase family protein	NA	NA	NA	NA
WP_011295812.1\|179070_179481_-	hypothetical protein	NA	NA	NA	NA
WP_011295813.1\|179527_180421_-	alpha/beta hydrolase	M1PGN2	Moumouvirus	8.8e-14	26.8

DBSCAN-SWA_8

202987 : 204667

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011295833.1\|202987_204667_+	AMP-binding protein	A0A2H4PQM9	Staphylococcus_phage	7.1e-33	26.1

DBSCAN-SWA_9

220291 : 223680

Paramecium_bursaria_Chlorella_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011295848.1\|220291_221563_+	DUF1254 domain-containing protein	M1IA53	Paramecium_bursaria_Chlorella_virus	1.2e-29	27.2
WP_011295849.1\|221608_222589_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_011295850.1\|222648_223680_+	NAD(P)-dependent alcohol dehydrogenase	A0A2K9L339	Tupanvirus	1.6e-14	25.5

DBSCAN-SWA_10

233333 : 234116

Trichoplusia_ni_ascovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011295859.1\|233333_234116_-	(S)-sulfopropanediol 2-dehydrogenase HpsO	Q06VL0	Trichoplusia_ni_ascovirus	1.8e-15	28.7

DBSCAN-SWA_11

240369 : 241614

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011295865.1\|240369_241614_+	class I SAM-dependent methyltransferase	A0A2K9L4K8	Tupanvirus	4.9e-31	30.6

DBSCAN-SWA_12

250431 : 252880

Hirudovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011295875.1\|250431_251199_-	glucose 1-dehydrogenase	V5L4T3	Hirudovirus	1.2e-08	33.6
WP_011295876.1\|251203_252880_-	AMP-binding protein	A0A2H4PQM9	Staphylococcus_phage	2.4e-33	26.3

DBSCAN-SWA_13

269968 : 270877

Lactobacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011295889.1\|269968_270877_+	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	1.5e-08	23.4

DBSCAN-SWA_14

277137 : 281793

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011295897.1\|277137_278547_-	PLP-dependent aminotransferase family protein	A0A1X9I5H2	Streptococcus_phage	9.0e-13	25.6
WP_011295898.1\|278728_279388_+	HD domain-containing protein	NA	NA	NA	NA
WP_011295899.1\|279440_280163_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_011295900.1\|280644_281793_-	CapA family protein	S4VS02	Pandoravirus	8.4e-110	55.6

DBSCAN-SWA_15

301991 : 302249

Acidovorax_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_049796588.1\|301991_302249_+	recombination-associated protein RdgC	A0A218M310	Acidovorax_phage	3.6e-05	43.9

DBSCAN-SWA_16

307023 : 309203

Ochrobactrum_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011295919.1\|307023_308235_+	AAA family ATPase	A0A240F4U1	Ochrobactrum_phage	8.5e-28	28.2
WP_011295920.1\|308231_309203_+	ParB/RepB/Spo0J family partition protein	S5VSZ7	Leptospira_phage	1.2e-13	34.2

DBSCAN-SWA_17

328516 : 330064

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_041680757.1\|328516_330064_+	AMP-binding protein	A0A1V0SBX8	Catovirus	1.5e-16	25.6

DBSCAN-SWA_18

335886 : 340596

Leptospira_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011295940.1\|335886_337485_+\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	4.3e-80	36.8
WP_011295941.1\|338871_340596_-	AMP-binding protein	A0A2H4PQM9	Staphylococcus_phage	1.1e-25	27.9

DBSCAN-SWA_19

349431 : 357432

Bathycoccus_sp._RCC1105_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011295949.1\|349431_351372_-	ATP-dependent metallopeptidase FtsH/Yme1/Tma family protein	E5ESM9	Bathycoccus_sp._RCC1105_virus	3.2e-109	46.7
WP_084792046.1\|352270_352579_-	YHS domain-containing protein	NA	NA	NA	NA
WP_041680765.1\|352594_352816_-	hypothetical protein	NA	NA	NA	NA
WP_049796613.1\|352812_355197_-	cadmium-translocating P-type ATPase	A0A218MNH6	uncultured_virus	3.4e-97	38.3
WP_011295951.1\|355408_356593_-	methionine adenosyltransferase	NA	NA	NA	NA
WP_041680766.1\|356811_357432_+	LemA family protein	A0A1X9IGG1	Lactococcus_phage	3.6e-06	35.0

DBSCAN-SWA_20

374134 : 375632

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_041680846.1\|374134_374890_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	6.3e-13	28.3
WP_011295966.1\|374879_375632_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.1e-13	25.5

DBSCAN-SWA_21

389763 : 390657

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011295977.1\|389763_390657_+	3-keto-5-aminohexanoate cleavage protein	A0A1V0SL81	Klosneuvirus	8.5e-25	27.9

DBSCAN-SWA_22

397513 : 406231

Pandoravirus(25.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011295983.1\|397513_398503_+	alpha/beta hydrolase	S4W4Z4	Pandoravirus	3.0e-15	30.9
WP_011295984.1\|398542_399388_+	fumarylacetoacetate hydrolase family protein	NA	NA	NA	NA
WP_011295985.1\|399449_400406_+	metapyrocatechase 2	NA	NA	NA	NA
WP_011295986.1\|401188_402115_-	fasciclin domain-containing protein	A0A2I2L5V0	Orpheovirus	2.7e-05	32.4
WP_011295987.1\|402365_402968_-	lipocalin	A0A1W6JNX6	Morganella_phage	9.4e-36	44.4
WP_011295988.1\|402986_403961_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_049796591.1\|404074_404545_+\|transposase	transposase	NA	NA	NA	NA
WP_166487204.1\|404575_406231_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.7e-10	46.5

DBSCAN-SWA_23

414911 : 415859

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011295996.1\|414911_415859_+	hydroxymethylglutaryl-CoA lyase	A0A1V0SKU2	Klosneuvirus	3.1e-17	27.2

DBSCAN-SWA_24

436458 : 437968

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011296013.1\|436458_437235_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	6.2e-16	25.3
WP_011296014.1\|437248_437968_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	7.3e-11	26.9

DBSCAN-SWA_25

444322 : 447948

Mycobacterium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011296021.1\|444322_445666_+	aspartate aminotransferase family protein	A0A1C9EHH3	Mycobacterium_phage	1.3e-08	24.4
WP_011296022.1\|447198_447948_+	3-oxoacyl-ACP reductase FabG	A0A0N9R355	Chrysochromulina_ericina_virus	2.9e-10	26.2

DBSCAN-SWA_26

452394 : 453123

Trichoplusia_ni_ascovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011296027.1\|452394_453123_+	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	9.0e-09	28.5

DBSCAN-SWA_27

468653 : 469571

Trichoplusia_ni_ascovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011296041.1\|468653_469571_+	SDR family NAD(P)-dependent oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	6.5e-12	25.7

DBSCAN-SWA_28

473945 : 474665

Acanthocystis_turfacea_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_049796615.1\|473945_474665_+	nitroreductase	M1I6Q5	Acanthocystis_turfacea_Chlorella_virus	1.2e-18	29.6

DBSCAN-SWA_29

496589 : 502892

Tupanvirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011296066.1\|496589_497693_-	alcohol dehydrogenase catalytic domain-containing protein	A0A2K9L339	Tupanvirus	1.5e-10	28.4
WP_011296067.1\|497738_498950_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_011296068.1\|498960_499266_-	non-heme iron oxygenase ferredoxin subunit	NA	NA	NA	NA
WP_011296069.1\|499302_500616_-	Rieske 2Fe-2S domain-containing protein	NA	NA	NA	NA
WP_041680880.1\|500644_501409_-	SDR family oxidoreductase	F2NZ40	Diadromus_pulchellus_ascovirus	2.5e-09	30.0
WP_011296071.1\|501451_502147_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	8.1e-15	30.8
WP_011296072.1\|502133_502892_-	ABC transporter ATP-binding protein	W5SAS9	Pithovirus	1.6e-11	26.0

DBSCAN-SWA_30

506149 : 507367

unidentified_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011296076.1\|506149_507367_+	IscS subfamily cysteine desulfurase	H7BUW1	unidentified_phage	8.0e-34	39.0

DBSCAN-SWA_31

512464 : 514069

Leptospira_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_041680776.1\|512464_514069_-\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	7.2e-67	34.8

DBSCAN-SWA_32

523906 : 524953

Wolbachia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011296094.1\|523906_524953_+	DUF1016 domain-containing protein	Q9JMP5	Wolbachia_phage	8.8e-98	50.9

DBSCAN-SWA_33

528309 : 529638

Burkholderia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011296099.1\|528309_529638_-	MFS transporter	Q6JIH2	Burkholderia_virus	7.5e-62	35.7

DBSCAN-SWA_34

541788 : 542580

Trichoplusia_ni_ascovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011296110.1\|541788_542580_+	glucose 1-dehydrogenase	Q06VL0	Trichoplusia_ni_ascovirus	4.4e-17	29.8

DBSCAN-SWA_35

551783 : 553400

Catovirus(100.0%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_049796617.1\|551783_553400_-\|holin	glucose-methanol-choline oxidoreductase	A0A1V0S9M4	Catovirus	9.8e-56	30.0

DBSCAN-SWA_36

559903 : 561499

Leptospira_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011296123.1\|559903_561499_+\|transposase	IS66 family transposase	S5VLC8	Leptospira_phage	1.7e-39	32.6

DBSCAN-SWA_37

570300 : 570714

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011296130.1\|570300_570714_+	RidA family protein	S4VVW6	Pandoravirus	3.5e-10	38.3

DBSCAN-SWA_38

579285 : 580839

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011296137.1\|579285_580839_+	AMP-binding protein	A0A2H4PQM9	Staphylococcus_phage	7.0e-35	25.2

DBSCAN-SWA_39

591292 : 594749

Trichoplusia_ni_ascovirus(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011296146.1\|591292_592069_+	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	1.8e-15	32.0
WP_011296147.1\|592136_592877_+	3-oxoacyl-ACP reductase FabG	W8CYX9	Bacillus_phage	1.1e-09	41.8
WP_011296148.1\|592876_593908_+	phosphotransferase	NA	NA	NA	NA
WP_011296149.1\|593984_594749_+	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	1.9e-17	30.0

DBSCAN-SWA_40

598388 : 599654

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_166487224.1\|598388_599654_+	peptidoglycan DD-metalloendopeptidase family protein	G9BW84	Planktothrix_phage	9.8e-19	41.8

DBSCAN-SWA_41

605248 : 610343

Ralstonia_virus(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011295769.1\|605248_606454_-\|transposase	ISL3 family transposase	A4PE56	Ralstonia_virus	1.0e-121	57.6
WP_166487213.1\|606545_607598_-	hypothetical protein	NA	NA	NA	NA
WP_011296159.1\|609125_610343_+	AAA family ATPase	A0A125SJ49	Acidianus_tailed_spindle_virus	5.9e-13	32.0

DBSCAN-SWA_42

615971 : 617627

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011296165.1\|615971_617627_-	acyl-CoA synthetase	A0A2H4PQM9	Staphylococcus_phage	1.1e-30	29.2

DBSCAN-SWA_43

623324 : 624203

Lactobacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_041680795.1\|623324_624203_+	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	7.8e-07	27.9

DBSCAN-SWA_44

629078 : 630565

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011296176.1\|629078_629783_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.2e-10	26.9
WP_041680897.1\|629785_630565_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	3.9e-10	23.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NC_007347

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_007347_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_007347_1

1669729-1669824

Orphan

Consensus_repeat	Method
CGCCGGCTACGCCGGCGAAACAGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_007347_1

>merge|NC_007347|1|1669729-1669824|CRISPRCasFinder
CGCCGGCTACGCCGGCGAAACAGCGGCGCTCTCGCCAAGCACCACAAACCAGCCCCCGCTTAGAAAAGCTCCCGCCGGCTACGCCGGCGAAACAGC

>NC_007347|1|1|1669729-1669824|CRISPRCasFinder
CGCCGGCTACGCCGGCGAAACAGC	GGCGCTCTCGCCAAGCACCACAAACCAGCCCCCGCTTAGAAAAGCTCC
CGCCGGCTACGCCGGCGAAACAGC

Protein	Signature genes	Signature genes Name	Protein_function
NC_007347.1\|WP_011297709.1\|1664406_1664931_+\|flavin-reductase	unknown	unknown	gnl\|CDD\|214900
NC_007347.1\|WP_011297710.1\|1665030_1665795_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187600
NC_007347.1\|WP_011297706.1\|1660093_1661242_+\|LLM-class-flavin-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|225052
NC_007347.1\|WP_041679584.1\|1659523_1659880_-\|glyoxalase/bleomycin-resistance/dioxygenase-family-protein	unknown	unknown	gnl\|CDD\|319925
NC_007347.1\|WP_011297721.1\|1677215_1677932_+\|EthD-domain-containing-protein	unknown	unknown	gnl\|CDD\|369213
NC_007347.1\|WP_011297704.1\|1658342_1659527_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197715
NC_007347.1\|WP_011297714.1\|1669875_1670742_-\|SDR-family-NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|187664
NC_007347.1\|WP_041679919.1\|1674025_1674859_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|235546
NC_007347.1\|WP_011297720.1\|1675101_1676289_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197715
NC_007347.1\|WP_011297716.1\|1671369_1672218_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|235546
NC_007347.1\|WP_011297718.1\|1673059_1673962_-\|NAD-dependent-epimerase/dehydratase-family-protein	unknown	unknown	gnl\|CDD\|187539
NC_007347.1\|WP_041679918.1\|1668526_1668973_+\|SnoaL-like-domain-containing-protein	unknown	unknown	gnl\|CDD\|379275
NC_007347.1\|WP_041679586.1\|1666872_1668504_+\|fatty-acid--CoA-ligase-family-protein	unknown	unknown	gnl\|CDD\|236072
NC_007347.1\|WP_011297723.1\|1678948_1679839_+\|CoA-transferase-subunit-A	unknown	unknown	gnl\|CDD\|224702
NC_007347.1\|WP_011297708.1\|1662655_1664410_+\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|236111
NC_007347.1\|WP_011297717.1\|1672249_1673017_+\|glucose-1-dehydrogenase	unknown	unknown	gnl\|CDD\|187600
NC_007347.1\|WP_011297722.1\|1678038_1678935_+\|biphenyl-2,3-dioxygenase	unknown	unknown	gnl\|CDD\|132257
NC_007347.1\|WP_011297715.1\|1670941_1671361_+\|nuclear-transport-factor-2-family-protein	unknown	unknown	gnl\|CDD\|379275
NC_007347.1\|WP_041679585.1\|1661434_1662628_+\|flavin-dependent-monooxygenase	unknown	unknown	gnl\|CDD\|173848
NC_007347.1\|WP_011297711.1\|1665806_1666871_+\|ferredoxin--NADP-reductase	unknown	unknown	gnl\|CDD\|99810

Protein	Function_ID	Function_description	E-value
NC_007347.1\|WP_011297709.1\|1664406_1664931_+\|flavin-reductase	gnl\|CDD\|214900	smart00903, Flavin_Reduct, Flavin reductase like domain. This entry represents the FMN-binding domain found in NAD(P)H-flavin oxidoreductases (flavin reductases), a class of enzymes capable of producing reduced flavin for bacterial bioluminescence and other biological processes. This domain is also found in various other oxidoreductase and monooxygenase enzymes... This domain consists of a beta-barrel with Greek key topology, and is related to the ferredoxin reductase-like FAD-binding domain. The flavin reductases have a different dimerisation mode than that found in the PNP oxidase-like family, which also carries an FMN-binding domain with a similar topology.	6.07053e-40
NC_007347.1\|WP_011297710.1\|1665030_1665795_+\|SDR-family-oxidoreductase	gnl\|CDD\|187600	cd05341, 3beta-17beta-HSD_like_SDR_c, 3beta17beta hydroxysteroid dehydrogenase-like, classical (c) SDRs. This subgroup includes members identified as 3beta17beta hydroxysteroid dehydrogenase, 20beta hydroxysteroid dehydrogenase, and R-alcohol dehydrogenase. These proteins exhibit the canonical active site tetrad and glycine rich NAD(P)-binding motif of the classical SDRs. 17beta-dehydrogenases are a group of isozymes that catalyze activation and inactivation of estrogen and androgens, and include members of the SDR family. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRS are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes have a 3-glycine N-terminal NAD(P)(H)-binding pattern (typically, TGxxxGxG in classical SDRs and TGxxGxxG in extended SDRs), while substrate binding is in the C-terminal region. A critical catalytic Tyr residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering), is often found in a conserved YXXXK pattern. In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) or additional Ser, contributing to the active site. Substrates for these enzymes include sugars, steroids, alcohols, and aromatic compounds. The standard reaction mechanism is a proton relay involving the conserved Tyr and Lys, as well as Asn (or Ser). Some SDR family members, including 17 beta-hydroxysteroid dehydrogenase contain an additional helix-turn-helix motif that is not generally found among SDRs.	8.97804e-100
NC_007347.1\|WP_011297706.1\|1660093_1661242_+\|LLM-class-flavin-dependent-oxidoreductase	gnl\|CDD\|225052	COG2141, COG2141, Coenzyme F420-dependent N5,N10-methylene tetrahydromethanopterin reductase and related flavin-dependent oxidoreductases [Energy production and conversion].	1.61728e-42
NC_007347.1\|WP_041679584.1\|1659523_1659880_-\|glyoxalase/bleomycin-resistance/dioxygenase-family-protein	gnl\|CDD\|319925	cd07264, VOC_like, uncharacterized subfamily of vicinal oxygen chelate (VOC) family. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	2.91296e-08
NC_007347.1\|WP_011297721.1\|1677215_1677932_+\|EthD-domain-containing-protein	gnl\|CDD\|369213	pfam07110, EthD, EthD domain. This family consists of several bacterial sequences which are related to the EthD protein of Rhodococcus ruber. In Rhodococcus ruber, EthD is thought to be involved in the degradation of ethyl tert-butyl ether (ETBE). EthD synthesis is induced by ETBE but it's exact function is unknown, it is however thought to be essential to the ETBE degradation system.	0.000671551
NC_007347.1\|WP_011297704.1\|1658342_1659527_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|197715	smart00421, HTH_LUXR, helix_turn_helix, Lux Regulon. lux regulon (activates the bioluminescence operon.	6.9564e-11
NC_007347.1\|WP_011297714.1\|1669875_1670742_-\|SDR-family-NAD(P)-dependent-oxidoreductase	gnl\|CDD\|187664	cd09763, DHRS1-like_SDR_c, human dehydrogenase/reductase (SDR family) member 1 (DHRS1) -like, classical (c) SDRs. This subgroup includes human DHRS1 and related proteins. These are members of the classical SDR family, with a canonical Gly-rich NAD-binding motif and the typical YXXXK active site motif. However, the rest of the catalytic tetrad is not strongly conserved. DHRS1 mRNA has been detected in many tissues, liver, heart, skeletal muscle, kidney and pancreas; a longer transcript is predominantly expressed in the liver , a shorter one in the heart. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRS are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes have a 3-glycine N-terminal NAD(P)(H)-binding pattern (typically, TGxxxGxG in classical SDRs and TGxxGxxG in extended SDRs), while substrate binding is in the C-terminal region. A critical catalytic Tyr residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering), is often found in a conserved YXXXK pattern. In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) or additional Ser, contributing to the active site. Substrates for these enzymes include sugars, steroids, alcohols, and aromatic compounds. The standard reaction mechanism is a proton relay involving the conserved Tyr and Lys, as well as Asn (or Ser). Some SDR family members, including 17 beta-hydroxysteroid dehydrogenase contain an additional helix-turn-helix motif that is not generally found among SDRs.	5.89339e-89
NC_007347.1\|WP_041679919.1\|1674025_1674859_-\|SDR-family-oxidoreductase	gnl\|CDD\|235546	PRK05653, fabG, 3-oxoacyl-ACP reductase FabG.	5.51248e-73
NC_007347.1\|WP_011297720.1\|1675101_1676289_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|197715	smart00421, HTH_LUXR, helix_turn_helix, Lux Regulon. lux regulon (activates the bioluminescence operon.	6.36512e-09
NC_007347.1\|WP_011297716.1\|1671369_1672218_+\|SDR-family-oxidoreductase	gnl\|CDD\|235546	PRK05653, fabG, 3-oxoacyl-ACP reductase FabG.	2.09317e-60
NC_007347.1\|WP_011297718.1\|1673059_1673962_-\|NAD-dependent-epimerase/dehydratase-family-protein	gnl\|CDD\|187539	cd05228, AR_FR_like_1_SDR_e, uncharacterized subgroup of aldehyde reductase and flavonoid reductase related proteins, extended (e) SDRs. This subgroup contains proteins of unknown function related to aldehyde reductase and flavonoid reductase of the extended SDR-type. Aldehyde reductase I (aka carbonyl reductase) is an NADP-binding SDR; it has an NADP-binding motif consensus that is slightly different from the canonical SDR form and lacks the Asn of the extended SDR active site tetrad. Aldehyde reductase I catalyzes the NADP-dependent reduction of ethyl 4-chloro-3-oxobutanoate to ethyl (R)-4-chloro-3-hydroxybutanoate. The related flavonoid reductases act in the NADP-dependent reduction of flavonoids, ketone-containing plant secondary metabolites. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	3.23583e-18
NC_007347.1\|WP_041679918.1\|1668526_1668973_+\|SnoaL-like-domain-containing-protein	gnl\|CDD\|379275	pfam13577, SnoaL_4, SnoaL-like domain. This family contains a large number of proteins that share the SnoaL fold.	2.03981e-22
NC_007347.1\|WP_041679586.1\|1666872_1668504_+\|fatty-acid--CoA-ligase-family-protein	gnl\|CDD\|236072	PRK07656, PRK07656, long-chain-fatty-acid--CoA ligase; Validated.	0
NC_007347.1\|WP_011297723.1\|1678948_1679839_+\|CoA-transferase-subunit-A	gnl\|CDD\|224702	COG1788, AtoD, Acyl CoA:acetate/3-ketoacid CoA transferase, alpha subunit [Lipid metabolism].	1.00644e-49
NC_007347.1\|WP_011297708.1\|1662655_1664410_+\|FAD-dependent-oxidoreductase	gnl\|CDD\|236111	PRK07843, PRK07843, 3-oxosteroid 1-dehydrogenase.	0
NC_007347.1\|WP_011297717.1\|1672249_1673017_+\|glucose-1-dehydrogenase	gnl\|CDD\|187600	cd05341, 3beta-17beta-HSD_like_SDR_c, 3beta17beta hydroxysteroid dehydrogenase-like, classical (c) SDRs. This subgroup includes members identified as 3beta17beta hydroxysteroid dehydrogenase, 20beta hydroxysteroid dehydrogenase, and R-alcohol dehydrogenase. These proteins exhibit the canonical active site tetrad and glycine rich NAD(P)-binding motif of the classical SDRs. 17beta-dehydrogenases are a group of isozymes that catalyze activation and inactivation of estrogen and androgens, and include members of the SDR family. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRS are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes have a 3-glycine N-terminal NAD(P)(H)-binding pattern (typically, TGxxxGxG in classical SDRs and TGxxGxxG in extended SDRs), while substrate binding is in the C-terminal region. A critical catalytic Tyr residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering), is often found in a conserved YXXXK pattern. In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) or additional Ser, contributing to the active site. Substrates for these enzymes include sugars, steroids, alcohols, and aromatic compounds. The standard reaction mechanism is a proton relay involving the conserved Tyr and Lys, as well as Asn (or Ser). Some SDR family members, including 17 beta-hydroxysteroid dehydrogenase contain an additional helix-turn-helix motif that is not generally found among SDRs.	4.348e-106
NC_007347.1\|WP_011297722.1\|1678038_1678935_+\|biphenyl-2,3-dioxygenase	gnl\|CDD\|132257	TIGR03213, Biphenyl-23-diol_12-dioxygenase_1, 2,3-dihydroxybiphenyl 1,2-dioxygenase. Members of this protein family all have activity as 2,3-dihydroxybiphenyl 1,2-dioxygenase, the third enzyme of a pathway for biphenyl degradation. Many of the extradiol ring-cleaving dioxygenases, to which these proteins belong, act on a range of related substrates. Note that some members of this family may be found operons for toluene or naphthalene degradation, where other activities of the same enzyme may be more significant; the trusted cutoff for this model is set relatively high to exclude most such instances. [Energy metabolism, Other].	6.07757e-85
NC_007347.1\|WP_011297715.1\|1670941_1671361_+\|nuclear-transport-factor-2-family-protein	gnl\|CDD\|379275	pfam13577, SnoaL_4, SnoaL-like domain. This family contains a large number of proteins that share the SnoaL fold.	3.47342e-29
NC_007347.1\|WP_041679585.1\|1661434_1662628_+\|flavin-dependent-monooxygenase	gnl\|CDD\|173848	cd01159, NcnH, Naphthocyclinone hydroxylase. Naphthocyclinone is an aromatic polyketide and an antibiotic, which is active against Gram-positive bacteria. Polyketides are secondary metabolites, which have important biological functions such as antitumor, immunosupressive or antibiotic activities. NcnH is a hydroxylase involved in the biosynthesis of naphthocyclinone and possibly other polyketides.	1.42294e-130
NC_007347.1\|WP_011297711.1\|1665806_1666871_+\|ferredoxin--NADP-reductase	gnl\|CDD\|99810	cd06214, PA_degradation_oxidoreductase_like, NAD(P) binding domain of ferredoxin reductase like phenylacetic acid (PA) degradation oxidoreductase. PA oxidoreductases of E. coli hydroxylate PA-CoA in the second step of PA degradation. Members of this group typically fuse a ferredoxin reductase-like domain with an iron-sulfur binding cluster domain. Ferredoxins catalyze electron transfer between an NAD(P)-binding domain of the alpha/beta class and a discrete (usually N-terminal) domain which vary in orientation with respect to the NAD(P) binding domain. The N-terminal portion may contain a flavin prosthetic group, as in flavoenzymes, or use flavin as a substrate. Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin. Isoforms of these flavoproteins (i.e. having a non-covalently bound FAD as a prosthetic group) are present in chloroplasts, mitochondria, and bacteria and participate in a wide variety of redox metabolic pathways. The C-terminal domain contains most of the NADP(H) binding residues and the N-terminal domain interacts non-covalently with the isoalloxazine rings of the flavin molecule which lies largely in a large gap betweed the two domains. Ferredoxin-NADP+ reductase first accepts one electron from reduced ferredoxin to form a flavin semiquinone intermediate. The enzyme then accepts a second electron to form FADH2 which then transfers two electrons and a proton to NADP+ to form NADPH.	1.05225e-119

>NC_007347.1|WP_041679918.1|1668526_1668973_+|SnoaL-like-domain-containing-protein
MTDMKSLAQRLDRLEAADAIRALKLRYLRACDDKNPEDMRACFVADGAHIHYDRIGSFAGRDALVQCFTELACRPTLGEMHFAGQGDVQVLDDGTARGSWDLAYLAIDDANGARTFLSGRYADEYVCVDGVWLIRSTVFTTGLLSQGA
>NC_007347.1|WP_041679586.1|1666872_1668504_+|fatty-acid--CoA-ligase-family-protein
MTTSDTIDAIAASAGTGMAARDDIPATIPELVRRAAQRYGDRIAIQEDGLRLSYAALDASRIQAARALMALGVQPGDRVAMWAPNFSEWIIAALATHSVGAALVPLNTRMKGVEAGAVLADSGARLLFCVDDFLGESYPQMLAPHRPATLERLVILRPGHGRAAADGELPWEAFLALAQQVDMAAFAEREATVRGDMPMDIMFTSGTTGRPKGVVTAHVQNLRAVDGWAAITGVQAGDRYLIVNPFFHTFGYKAGWLAALSRGATVLPHLVFDAEAVMTRVENERITVLPGPPTLYQTLLNAPRLREFDLSSLCIAVTGASAIAPALIQRMRSELGFDTIITGYGLTESCGFATLTRAGDDADTVAATSGRAMPGIEIRCVDAQGRPVATGEPGEVLVRGYNVMQGYFSLPEATAEAIDADGWLHTGDVGTLDTRGYLRITDRIKDMFIVGGFNCYPAEVEKLLVAHPAVAQVAVVGMPHDRLGEVGRAYVVLRHGARVDADTLIGWARRQMANYKVPREIVFVPTLPVSAAGKVLKYQLRES
>NC_007347.1|WP_011297711.1|1665806_1666871_+|ferredoxin--NADP-reductase
MVQAQFHRLQIAEVVAETDQAHSLVFALPESLRDTFAYRPGQFLTLRVPVDGVPQQRCYSLSSAPDVDSALRVTIKRVQGGRVSNWVCDHLGAGDTVEVMPPAGVFTPPTLHGDFLLLAGGSGITPVLSIAKAALRHGRGTVTLVYANRDEQSVIFREALGELARRHPGRLRVIHWLDSVQGPPSQRQVEELVRPWSLAECFICGPGPFMDSAQAALQELGVPRGKLHVERFVSLPDRTSAPVQAVMPAASTVVTPVPVATMHGAALTVQLDGETHQVSVAPDETVLDAMQRAGVAAPNSCRAGLCGACMCQVTQGDVTLGENHVLDQADLESGWTLACQARPASGDIHLKFPD
>NC_007347.1|WP_011297710.1|1665030_1665795_+|SDR-family-oxidoreductase
MSRRTEGKIAIVTGAASGVGREDALLLAREGARVVLTDLNEEAGHALAREIGETALFVQHDIASEAGWQQVMARTEQRFGAPNVLVNNAAILLLGNVEDTSLEQWQRVQRINADGYFLGCKYGVAAMKADGGSIVNMSSVAALGGMGAFCAYSASKGAVAALTRSVAAHCKQSGYKVRCNSIHPDGILTPMTAAFLPGGATALPEEVGGVDPMQRMCHPRDVANLVLFLASDESRFINGAELRIDNAQSIMGVA
>NC_007347.1|WP_011297709.1|1664406_1664931_+|flavin-reductase
MSANPIPGATLRDDMLMAMRRMARSVAVISCRDGERRYSMSVTAVDSLSADPPSLLICINRNSSIYPPLDAGADFCINLLAADHRDIAVDCSGRLKGEERFTSGQWDDDMLGVPCLRDAQANLICTQDGRFDYGTHAVFIGRLREVRLAGEVSPLVYVDGAYTTSAPLASLCPA
>NC_007347.1|WP_011297708.1|1662655_1664410_+|FAD-dependent-oxidoreductase
MSQSTARKQPAEFDVVVVGSGAGGMLTACRAADRGLSVVVLEKSSQYGGTSAVSGGGIWIPLNHHIAAAGAKDDYATALEYILACTGEHGDPQRLRAYLDHAPRMLQYLEKQAGVHYYTLPRYADYFQKQPGAMPGYRSLDPMPFDGARLREEFDRLRPPSPGTLVAGRVAVTSGEAHKLVCKSPGWLWLAVRQFARYWLDLGWRRKTRRDRRLTLGNSLAGGLRRAMMDRAIPLWLDTALQDLIIEDGVVRGVRALQDGRVVEIRALRGVVLAAGGFERNQTMREQYLPQPTQAAWSATPPNNTGDAIRAGQAAGAGVALMSHMWGAPTVRVQGEEKQRALFIERAMPGCMVVNGQGRRFVNEAAPYSEFVPAMYRDHEQTGCSVPAWMVFDATFRHKYPCGPILPGSVMPDHSIPASLSGILVKADTLDALAGQTGIDAAGLADSVARMNRYAASGVDEEFGKGDNLFDTYYSDPTVRPNPCLAPIGKAPFYAVRLDAGDIGTKGGLVTDASARVLREDGSVIPGLFAIGNTSAAVMGTSYPGAGSTLGPAMTFGFIAADVLAQQARQTAAAPHTQSVQEAL
>NC_007347.1|WP_041679585.1|1661434_1662628_+|flavin-dependent-monooxygenase
MHHDNNPKELAARLIARAEQMIPVLAQRAAQAEAEGRIPEETVADMQAAGFFKVLQPRRYGGYELDPQTFFRVQMALAKGCMSTAWVYGVVGVHNWQLALFDERAQQEVWGNNASTLIASTYMPVGKVTPVEGGFRFSGHWKFSSGSELCEWIFLGGLVPPSEPGGAYDYRTFLLPRSDYKIVRNWDVLGLRATGSHDIVVDDVFVPEYRTHRAVDGAMGTSPGLAQNNVPLYRLPFAQIFVRAVCTACIGALEGTLDDFVAYADGRVSSNGGSKTAEDGGAQLACANAAIAIDEMRTILERNFDELLALAREGGQMPTPRRLHFRYQSSQVAERCAQLANSLLRYAGGNGIYRSNPMVRRFMDLHAARAHYANNLDRFGQNLGGVMMGRANTDFFI
>NC_007347.1|WP_011297706.1|1660093_1661242_+|LLM-class-flavin-dependent-oxidoreductase
MRFSLIYEAQTVDASRAGDHKVFDEIMEQVVLAEDMGFDVVWAVEHTALTNYAHMSAPETFLAFVAGRTQRIGIGHGVVCLPPAMNHPVKVAERIATLDILSGGRVHFGVGKGGTQQEAGTFGYDLNTLHPMIDESMYLIPKILTQDEIEHDGEFIKIPRRPIHPKPRQDPHPLMYLACTNADTLQRAGARGMGALVLGFGGPEDVAKKNDIYRTAWERRKPEDQVGFRPHQHLAALCPTIVLEDGLAARKIGIKGQRYFMESLSYWYAGGERPDPSKWDDEHVTATDAQGKDVINTSFASEKVSVDFSDPAMMMLNPNHAYGTVEDCIGYVQRLIDAGADEILFICQMGTVPQWAQLETIRNIGEHVIPHFRKQGHKLRVA
>NC_007347.1|WP_041679584.1|1659523_1659880_-|glyoxalase/bleomycin-resistance/dioxygenase-family-protein
MQSKLLLYPVGNLDTALPFFTEALGLPVKFRDGDRYCALDAGALTLALVAGEERLVEQPALAFKVDEGEDIATAVARLVKAGAAVTQPPAQGPHEARAVLHTPEGFALVLSAKLAPAS
>NC_007347.1|WP_011297704.1|1658342_1659527_+|helix-turn-helix-transcriptional-regulator
MLMEASQNPAIAHLFTQATVSLSDFSALLGNIYQGPMEQVPWGKALEQIRRQLDANYVTLILRSPATDRPGLMVNASEHGQTLPGEVSYNSYYYSLDPFIGLPSDRVVTIDEHLGHGVWCMSELYQQFLKDIGIRYILGADLRTDDGVECRFRVCRNHDGPDFSTSDKALCTALLPHLKRAVDLHSRIDVVESERTVYASAIDRMLVGMVILDESGTIIKTNAAADEILAAKDGIRIAKGGLDVEYGQENRKFQRVLRQAMMGHVGTAPPVMEAMSITRPSGSAKLGVLVRTIPLSEWSEDNRKRPACVVFIRDPERRSQASHDVVRQLFDLTPAETQLALQLANGLTLDEAADELGISKNTARAHLRAIFSKTGVTRQATLVRMLLSSVISLG
>NC_007347.1|WP_011297714.1|1669875_1670742_-|SDR-family-NAD(P)-dependent-oxidoreductase
MSDSKQACVAVVTGASRGAGRGIALALGAAGATVYVTGRTEQEGSAPLPGTIHATARDIDALGGRGIAVACDHSDDAQVAALFQRVREEAGRLDILVNNATFLHDELIMPGPFWQKPLEMTGILDVGLRSGYVASWHAAPMMVAQGSGLIVFTSSFGANCYMHGPAYGAQKAGIDKFAHDMAVDLRPYGVAAVSLWMGPLRTARTMQVWEKHPDKYASFAPVAETPEFTGRIVDALYRDPALMDKSGKVLICAEAALEYGIVDDEGVQPPSYRQVLGGPPGVHPAIVE
>NC_007347.1|WP_011297715.1|1670941_1671361_+|nuclear-transport-factor-2-family-protein
MPDPESIEAIRSLAWRYAQAVDRREFARLTALFTPDAQLSGPGFHLDGAQAIAEGMSALGNYSATQHHVHHQLVDVDGDTASGETYCIANHLYQDEGGVPRKLDWGIRYQDRYVRRQGEWRIAARTLLVDWTQDLPQKG
>NC_007347.1|WP_011297716.1|1671369_1672218_+|SDR-family-oxidoreductase
MTKALEGKAALVTGGAGGIGAASALALARDGAAVALMGRRREALEVARDALREKVPGASIEICVGDACRADDVQAALQRAWDLRGRLDILVPTVGGGGFKPMLMHDAASFMAEIEFNIASAFLAVRHAAPLMAPHGGSIVCISSGAARMNCRWLSAYCAAKAGLEAFVRGAAEELAEAGIRVNAVRPGLTRSGATGPMFDNEAVLGQFVAQMPLGRAGEPEDIANAVRYLAGPESGWVTGQSFGVDGGNELRGNPMLDDAIAAMYGRAALDDVLAGRIPAAA
>NC_007347.1|WP_011297717.1|1672249_1673017_+|glucose-1-dehydrogenase
MKQEGRVKGKVALVTGAASGVGRADALLLAAEGARVVLSDVNEEAGQALAREIGDAALFVRHDIASEEDWRSVMAAALDRFGRLDVLVNNAAICPLGSIEETSLECWRQVMRVNADGYFLGCRFGVAAMKGNEAGGSIVMMSSVAALGGLPMMCAYTGSKGAVTALTRSVAAHCKQQGYRIRCNSIHPDGIWTPMTQALVPDLDPVALGIGTDPMARMCNPEDVANLVLFLASDASRFINGAELRIDNAQLISSL
>NC_007347.1|WP_011297718.1|1673059_1673962_-|NAD-dependent-epimerase/dehydratase-family-protein
MKILIVGGTGMIGGHAALALRDKGHEVTIAGRNCPAAGTPLGELDYLRCDYIANDLPAAQLGAFDALVFAAGNDVRHLPPDGNEAAHWERANVQGVPSFFRAARDAGIRVAVHVGSFYPQAMPALAEQNAYIRSRKLADEGVRALAGPAFRVVSVNAPFVVGTVPGLLVPMFKAYTDYAKGGFAPMPDFAPPGGVNFISAASLSEAIEGALLRGENGKAYLVGDENLTFQDYFGAFFREAGRPVPPAIDQEHPLMPDAAICFGRGNTLYYEPDAAETALLGYRRQDIARTVREIVAQYSA
>NC_007347.1|WP_041679919.1|1674025_1674859_-|SDR-family-oxidoreductase
MMDFQGKTVLITGGGAGIGLAAAQAFQEQGARVAVIEIDPSRADAAVSLLGGDGNDALVVHGDVTCAATVASLAAQIGERFGALDVLVNNVGDFLRIAKPFELYDDAEIDSLYAVNLRHVFSVTRAMLPLLRRSAAASIVSVSSIEGFRGIPNCSVYGAFKAALTGFTQSLALELAPSGIRVNLIAPETTETPQVPVSLVVAEEHRHHMPNWIPLGRFGTPRDIAEGIVFLAGPRASWITGTALHVNGGALAASGWYRDPKGNWTNMPVMVGNGMNL
>NC_007347.1|WP_011297720.1|1675101_1676289_+|helix-turn-helix-transcriptional-regulator
MLMATEPAPDASSPLFTHSRLGLAQFSALLAAIYEGPMESVPWGRALEMLRKQLDATYVSFILRSPASDRSGLAVHASEQGTSLEAEASYNSYYYAIDPFINLPTDRAVTVDEATGSGNWCHSEIYRQFLQPLDIRYLLGADIRTDDGVECRLRICRPHASRDFDEKDKAACGVILPHLKRAVRLHSRLDVVESERSLYAGAIDRMLVGMLILDESGAILKKNFEADEILAENDGIRLNGGNFEIAYAQESRKFQFLLRRARMGHHGGAPAIAEAMSITRPSGRGKLGVLIRTIPLSEWSEDNRHRPACAVFIRDPERKSRASHEVVRKLFDLTPAETALALVLADGLTLDEAAVELGISKNTARAHLRAIFSKTGVTRQATLVRTLLSSVVALG
>NC_007347.1|WP_011297721.1|1677215_1677932_+|EthD-domain-containing-protein
MEKVIYIVWRDPSTKPETFAHDLRTKLAQQLLQLGARGVQINVQDEDVAPAAALRQVNTLPQMDGLVSVWVDSAITSLRRPFDDAVLAATGRMAGYLVTESQPIRNTRHPARAGERTPGFSQLAFLKRPPRLTHEAWLDTWHNRHTQVAIDTQDTFLYVQNVVVRALTYGAPPLDAVVEEGFPEAAMTDPQAFFDAPGDEAKYQRNLAAMMESCQRFIDFDKIDVVASSQYIVRPPAA
>NC_007347.1|WP_011297722.1|1678038_1678935_+|biphenyl-2,3-dioxygenase
MLDIRALGYIVVESTDLGQWRHYAEQVLGMACSGAPGGALYVKMDERDYRYLIVPGTRDRYLASGWELADEPAYRHALATLREANVEVVHASAADLAQRRVQALAWFVDPSGNRHEISWGMRSDFLRFVSPIGVPRFITDPMGAGHTVLPAPAFDETYAFLRDVMGFGLSDIFRVRFTNDPAEPEKRIHFLHCGNGRHHSLAIFEMPSEAGCIHVMAEVPEMAEVGRALDRVQQHGVKMSATLGQHCNDRMTSFYMKTPGGFDLEYGHGGLVVDWSHHAAYEATRVSLWGHDFSIGYR
>NC_007347.1|WP_011297723.1|1678948_1679839_+|CoA-transferase-subunit-A
MIKTIDKTMSAADVVGQLADGMTIGIGGWGPRRKPMALVREILRSPLKDLTVVAYGGPEVGMLCAAGKVRKLVFGFVSLDVIPLEPYFRQARERGQLAVTELDEGMLQLGLRAAAARLPFLPTRASLGTDVLDRTPELKTVRSPYADGEVLVAMPAIELDVALLHVNESDVLGNTRIDGPDPFFDEWFARAARRCYVSCETLRPSIEDEDLSRARGNAFERSLVTGVVHAPGGAHPTSCAPAYGWDLPALKAYCASAEVENGFAAYRNEVVGTSEAAYLERIGGLGHVHDLPLPVL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

2609136 : 2650612

Burkholderia_phage(41.03%)

integrase,capsid,terminase

attL 2599574:2599593|attR 2615721:2615740

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2599574:2599593	attL	NA	NA	NA	NA
WP_011298516.1\|2609136_2610351_+\|integrase	tyrosine-type recombinase/integrase	A0A1B0VMI6	Pseudomonas_phage	2.4e-86	44.5
WP_049796423.1\|2610347_2610899_+	hypothetical protein	NA	NA	NA	NA
WP_011298518.1\|2610914_2611481_-	DUF1643 domain-containing protein	A0A142KC71	Gordonia_phage	1.1e-22	47.6
WP_011298519.1\|2611477_2612146_-	hypothetical protein	H2BDG4	Pseudomonas_virus	1.5e-42	48.1
WP_041679666.1\|2612144_2612618_+	hypothetical protein	NA	NA	NA	NA
WP_011298520.1\|2612650_2614441_-	DNA cytosine methyltransferase	L7TH64	Pseudomonas_virus	7.8e-187	63.0
WP_011298521.1\|2614437_2614932_-	hypothetical protein	A9YX19	Burkholderia_phage	2.1e-54	68.6
WP_011298522.1\|2614928_2615189_-	hypothetical protein	NA	NA	NA	NA
WP_011298523.1\|2615188_2615392_-	AlpA family transcriptional regulator	NA	NA	NA	NA
WP_011298524.1\|2615388_2615571_-	hypothetical protein	NA	NA	NA	NA
WP_011298525.1\|2615570_2617310_-	AAA family ATPase	H2BD46	Pseudomonas_phage	6.0e-83	38.0
2615721:2615740	attR	NA	NA	NA	NA
WP_011298526.1\|2617316_2618195_-	cell division protein FtsK	J7I0T4	Pseudomonas_phage	6.6e-30	35.5
WP_011298527.1\|2618310_2619465_-	hypothetical protein	J7HXB6	Pseudomonas_phage	1.4e-64	50.2
WP_041679667.1\|2619506_2620301_-	nuclease	J7HXJ4	Pseudomonas_phage	6.1e-59	47.8
WP_011298529.1\|2620577_2620877_-	hypothetical protein	NA	NA	NA	NA
WP_011298530.1\|2620887_2621172_-	hypothetical protein	NA	NA	NA	NA
WP_011298531.1\|2621369_2622635_-	helix-turn-helix transcriptional regulator	B6SCU0	Bacteriophage	3.5e-32	49.3
WP_011298532.1\|2622747_2622990_+	transcriptional regulator	NA	NA	NA	NA
WP_011298533.1\|2623256_2623523_+	hypothetical protein	NA	NA	NA	NA
WP_086004446.1\|2623582_2624719_+	DUF1376 domain-containing protein	H2BD69	Pseudomonas_phage	1.3e-25	43.3
WP_011298535.1\|2624715_2625189_+	RusA family crossover junction endodeoxyribonuclease	A9YWY9	Burkholderia_phage	1.1e-44	59.4
WP_011298536.1\|2625214_2625823_+	hypothetical protein	Q3HR05	Burkholderia_phage	1.8e-47	53.4
WP_166487050.1\|2626150_2627506_+	chromosome partitioning protein ParB	R4THK0	Halovirus	2.2e-80	41.4
WP_011298538.1\|2627511_2627922_+	hypothetical protein	NA	NA	NA	NA
WP_011298539.1\|2627872_2629423_+\|terminase	phage terminase large subunit	W8VT11	Pseudomonas_phage	4.9e-113	46.1
WP_011298540.1\|2629419_2630991_+	DUF1073 domain-containing protein	A0A0P0I486	Acinetobacter_phage	3.9e-158	62.7
WP_166487013.1\|2630941_2631574_+\|capsid	minor capsid protein	A9YWZ8	Burkholderia_phage	2.0e-76	69.3
WP_011298542.1\|2631575_2631938_+	hypothetical protein	G8GWD9	Rhodobacter_phage	7.6e-17	43.5
WP_011298543.1\|2631939_2633271_+	DUF2213 domain-containing protein	A0A0P0IRE1	Acinetobacter_phage	1.9e-65	46.7
WP_011298544.1\|2633283_2633778_+	hypothetical protein	A0A0P0I8F3	Acinetobacter_phage	2.0e-36	54.9
WP_011298545.1\|2633791_2634829_+	DUF2184 domain-containing protein	A0A0N7IRF2	Acinetobacter_phage	1.6e-123	66.5
WP_011298546.1\|2634841_2635246_+	hypothetical protein	NA	NA	NA	NA
WP_011298547.1\|2635285_2635669_+	DUF4054 domain-containing protein	A9YX25	Burkholderia_phage	2.5e-42	65.9
WP_011298548.1\|2635694_2636174_+	hypothetical protein	A9YX26	Burkholderia_phage	2.2e-51	68.6
WP_011298549.1\|2636177_2636549_+	hypothetical protein	A9YX28	Burkholderia_phage	1.2e-60	91.1
WP_011298550.1\|2636552_2637143_+	hypothetical protein	A9YX29	Burkholderia_phage	6.3e-77	75.1
WP_011298551.1\|2637213_2638689_+	DUF3383 domain-containing protein	A0A0P0I492	Acinetobacter_phage	4.0e-104	44.5
WP_011298552.1\|2638700_2639144_+	DUF3277 family protein	A0A0M5M1K6	Salmonella_phage	2.1e-37	51.0
WP_011298553.1\|2639146_2639593_+	hypothetical protein	A0A0N7IRF3	Acinetobacter_phage	1.4e-20	40.5
WP_084791935.1\|2639589_2639778_+	hypothetical protein	NA	NA	NA	NA
WP_166487051.1\|2640859_2641465_+	hypothetical protein	Q4L1H3	Burkholderia_phage	2.4e-15	34.3
WP_011298555.1\|2641461_2642040_+	hypothetical protein	A0A0M3ULD5	Salmonella_phage	4.3e-22	39.3
WP_011298556.1\|2642039_2642357_+	hypothetical protein	A0A0M4R5B7	Salmonella_phage	1.8e-14	40.4
WP_011298557.1\|2642353_2643322_+	hypothetical protein	A9YX04	Burkholderia_phage	7.8e-141	84.5
WP_049796471.1\|2643318_2643690_-	hypothetical protein	A9YX05	Burkholderia_phage	2.3e-40	66.4
WP_011298559.1\|2643694_2644450_+	hypothetical protein	A9YX06	Burkholderia_phage	1.5e-102	76.5
WP_011298560.1\|2644458_2644809_+	hypothetical protein	A9YX11	Burkholderia_phage	7.3e-41	76.7
WP_011298561.1\|2644808_2645990_+	hypothetical protein	A9YX12	Burkholderia_phage	3.1e-168	78.4
WP_011298562.1\|2645991_2646654_+	DUF2612 domain-containing protein	A9YX13	Burkholderia_phage	2.8e-97	75.0
WP_011298563.1\|2646663_2647710_+	hypothetical protein	A9YX14	Burkholderia_phage	1.2e-22	51.0
WP_011298564.1\|2647709_2647946_+	hypothetical protein	NA	NA	NA	NA
WP_041679668.1\|2648004_2649639_-	hypothetical protein	NA	NA	NA	NA
WP_011298567.1\|2650090_2650612_+	glycoside hydrolase family 104 protein	S4TUB1	Salmonella_phage	3.1e-51	62.8

DBSCAN-SWA_2

3574909 : 3580917

uncultured_Caudovirales_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011299392.1\|3574909_3575497_-	phosphoheptose isomerase	A0A067XQR2	Caulobacter_phage	6.8e-15	32.7
WP_011299393.1\|3575580_3575964_-	YraN family protein	NA	NA	NA	NA
WP_011299394.1\|3575975_3576875_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	1.0e-33	41.7
WP_041680082.1\|3576947_3577613_-	septal ring lytic transglycosylase RlpA family protein	H2BCY4	Synechococcus_phage	1.5e-18	53.2
WP_011299396.1\|3577951_3578602_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_011299397.1\|3578627_3579275_+	hypothetical protein	A0A2L0UZL4	Agrobacterium_phage	2.7e-33	39.5
WP_041679736.1\|3579459_3579690_+	hypothetical protein	NA	NA	NA	NA
WP_011299399.1\|3579831_3580191_-	arsenate reductase (glutaredoxin)	A0A2H4J8T1	uncultured_Caudovirales_phage	1.8e-18	43.6
WP_041679737.1\|3580332_3580917_+	N-acetyltransferase	A0A2H4J136	uncultured_Caudovirales_phage	1.8e-23	42.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_007336

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NC_007347

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection