CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NC_017196	Bacillus subtilis subsp. natto BEST195, complete genome	2 crisprs	csa3,cas3,DEDDh,WYL,DinG	0	1	11	0
NC_017194	Bacillus subtilis subsp. natto BEST195 plasmid pBEST195S, complete sequence	0 crisprs	NA	0	0	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_017196_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_017196_1

918048-918153

Orphan

Consensus_repeat	Method
AGAAAACAAAACCAACAATCAGCTG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_017196_1

>merge|NC_017196|1|918048-918153|CRISPRCasFinder
AGAAAACAAAACCAACAATCAGCTGCTGGTCAAGGTCAATTTGGCACTGAATTTGCTAGCGAAACAAACGCTCAGCAAGTCAGAAAACAAAACCAGCAATCAGCTG

>NC_017196|1|1|918048-918153|CRISPRCasFinder
AGAAAACAAAACCAACAATCAGCTG	CTGGTCAAGGTCAATTTGGCACTGAATTTGCTAGCGAAACAAACGCTCAGCAAGTC
AGAAAACAAAACCAGCAATCAGCTG

Protein	Signature genes	Signature genes Name	Protein_function
NC_017196.2\|WP_014479227.1\|933473_934250_-\|sporulation-control-protein-Spo0M	unknown	unknown	gnl\|CDD\|226776
NC_017196.2\|WP_003243727.1\|925622_926507_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379641
NC_017196.2\|WP_014479220.1\|909828_910689_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223669
NC_017196.2\|WP_003223262.1\|917181_917934_+\|enoyl-[acyl-carrier-protein]-reductase-FabL	unknown	unknown	gnl\|CDD\|236145
NC_017196.2\|WP_014479221.1\|911980_914566_+\|YfhO-family-protein	unknown	unknown	gnl\|CDD\|226888
NC_017196.2\|WP_003223285.1\|924589_925027_+\|peroxide-responsive-transcriptional-repressor-PerR	unknown	unknown	gnl\|CDD\|223806
NC_017196.2\|WP_014479224.1\|921270_922332_-\|aromatic-acid-exporter-family-protein	unknown	unknown	gnl\|CDD\|226614
NC_017196.2\|WP_014479222.1\|915757_916867_+\|A/G-specific-adenine-glycosylase	unknown	unknown	gnl\|CDD\|130156
NC_017196.2\|WP_014479226.1\|925061_925415_-\|YgzB-family-protein	unknown	unknown	gnl\|CDD\|371346
NC_017196.2\|WP_003243789.1\|908492_908762_+\|YfhJ-family-protein	unknown	unknown	gnl\|CDD\|379438
NC_017196.2\|WP_014479218.1\|908906_909425_+\|SH3-domain-containing-protein	unknown	unknown	gnl\|CDD\|214600
NC_017196.2\|WP_003244113.1\|910919_911909_+\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|133030
NC_017196.2\|WP_014476212.1\|914558_915542_-\|metal-dependent-hydrolase	unknown	unknown	gnl\|CDD\|224899
NC_017196.2\|WP_003242708.1\|918429_918690_+\|ygaB-like-family-protein	unknown	unknown	gnl\|CDD\|372951
NC_017196.2\|WP_003233532.1\|923993_924467_+\|thioredoxin-dependent-thiol-peroxidase	unknown	unknown	gnl\|CDD\|224146
NC_017196.2\|WP_009966836.1\|919451_921194_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224055
NC_017196.2\|WP_014479225.1\|922552_923842_-\|glutamate-1-semialdehyde-2,1-aminomutase	unknown	unknown	gnl\|CDD\|183493
NC_017196.2\|WP_003233542.1\|916874_917099_-\|hypothetical-protein	unknown	unknown	unknown
NC_017196.2\|WP_014479219.1\|909509_909842_+\|SdpC-immunity-protein-SpdL	unknown	unknown	gnl\|CDD\|227945
NC_017196.2\|WP_003223272.1\|918833_919364_+\|DUF402-domain-containing-protein	unknown	unknown	gnl\|CDD\|184219

Protein	Function_ID	Function_description	E-value
NC_017196.2\|WP_003243727.1\|925622_926507_+\|hypothetical-protein	gnl\|CDD\|379641	pfam14540, NTF-like, Nucleotidyltransferase-like. Structural comparisons with Structure 1kny indicate that this N-terminal domain resembles a nucleotidyltransferase fold.	1.16999e-58
NC_017196.2\|WP_014479220.1\|909828_910689_+\|alpha/beta-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	2.76887e-38
NC_017196.2\|WP_003223262.1\|917181_917934_+\|enoyl-[acyl-carrier-protein]-reductase-FabL	gnl\|CDD\|236145	PRK08063, PRK08063, enoyl-[acyl-carrier-protein] reductase FabL.	2.59874e-172
NC_017196.2\|WP_014479221.1\|911980_914566_+\|YfhO-family-protein	gnl\|CDD\|226888	COG4485, COG4485, Predicted membrane protein [Function unknown].	0
NC_017196.2\|WP_003223285.1\|924589_925027_+\|peroxide-responsive-transcriptional-repressor-PerR	gnl\|CDD\|223806	COG0735, Fur, Fe2+/Zn2+ uptake regulation proteins [Inorganic ion transport and metabolism].	2.19115e-56
NC_017196.2\|WP_014479224.1\|921270_922332_-\|aromatic-acid-exporter-family-protein	gnl\|CDD\|226614	COG4129, COG4129, Predicted membrane protein [Function unknown].	2.78773e-90
NC_017196.2\|WP_014479222.1\|915757_916867_+\|A/G-specific-adenine-glycosylase	gnl\|CDD\|130156	TIGR01084, A/G-specific_adenine_glycosylase, A/G-specific adenine glycosylase. This equivalog model identifies mutY members of the pfam00730 superfamily (HhH-GPD: Helix-hairpin-helix and Gly/Pro rich loop followed by a conserved aspartate). The major members of the superfamily are nth and mutY. [DNA metabolism, DNA replication, recombination, and repair].	5.39938e-157
NC_017196.2\|WP_014479226.1\|925061_925415_-\|YgzB-family-protein	gnl\|CDD\|371346	pfam11023, DUF2614, Zinc-ribbon containing domain. This is a family of proteins conserved in the Bacillaceae family. Some members are annotated as being protein YgzB. The function is not known.	7.28983e-70
NC_017196.2\|WP_003243789.1\|908492_908762_+\|YfhJ-family-protein	gnl\|CDD\|379438	pfam14043, WVELL, WVELL protein. This family includes the B. subtilis YfjH protein, which is functionally uncharacterized. This is not a homolog of E. coli YfjH, a synonym for IscX, which belongs to pfam04384. This family of proteins is found in bacteria. Proteins in this family are approximately 90 amino acids in length and contain a highly conserved WVELL motif.	4.98563e-41
NC_017196.2\|WP_014479218.1\|908906_909425_+\|SH3-domain-containing-protein	gnl\|CDD\|214600	smart00287, SH3b, Bacterial SH3 domain homologues.	1.93802e-13
NC_017196.2\|WP_003244113.1\|910919_911909_+\|glycosyltransferase-family-2-protein	gnl\|CDD\|133030	cd04187, DPM1_like_bac, Bacterial DPM1_like enzymes are related to eukaryotic DPM1. A family of bacterial enzymes related to eukaryotic DPM1; Although the mechanism of eukaryotic enzyme is well studied, the mechanism of the bacterial enzymes is not well understood. The eukaryotic DPM1 is the catalytic subunit of eukaryotic Dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. The enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. This protein family belongs to Glycosyltransferase 2 superfamily.	2.54502e-85
NC_017196.2\|WP_014476212.1\|914558_915542_-\|metal-dependent-hydrolase	gnl\|CDD\|224899	COG1988, COG1988, Predicted membrane-bound metal-dependent hydrolases [General function prediction only].	3.46531e-44
NC_017196.2\|WP_003242708.1\|918429_918690_+\|ygaB-like-family-protein	gnl\|CDD\|372951	pfam14182, YgaB, YgaB-like protein. The YgaB-like protein family includes the B. subtilis YgaB protein, which is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 90 amino acids in length.	1.32408e-26
NC_017196.2\|WP_003233532.1\|923993_924467_+\|thioredoxin-dependent-thiol-peroxidase	gnl\|CDD\|224146	COG1225, Bcp, Peroxiredoxin [Posttranslational modification, protein turnover, chaperones].	6.45936e-86
NC_017196.2\|WP_009966836.1\|919451_921194_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	0
NC_017196.2\|WP_014479227.1\|933473_934250_-\|sporulation-control-protein-Spo0M	gnl\|CDD\|226776	COG4326, Spo0M, Sporulation control protein [General function prediction only].	4.07628e-154
NC_017196.2\|WP_014479225.1\|922552_923842_-\|glutamate-1-semialdehyde-2,1-aminomutase	gnl\|CDD\|183493	PRK12389, PRK12389, glutamate-1-semialdehyde aminotransferase; Provisional.	0
NC_017196.2\|WP_014479219.1\|909509_909842_+\|SdpC-immunity-protein-SpdL	gnl\|CDD\|227945	COG5658, COG5658, Predicted integral membrane protein [Function unknown].	7.58487e-27
NC_017196.2\|WP_003223272.1\|918833_919364_+\|DUF402-domain-containing-protein	gnl\|CDD\|184219	PRK13662, PRK13662, hypothetical protein; Provisional.	7.36814e-127

>NC_017196.2|WP_003223262.1|917181_917934_+|enoyl-[acyl-carrier-protein]-reductase-FabL
MEQNKCALVTGSSRGVGKAAAIRLAENGYNIVINYARSKKAALETAEEIEKLGVKVLVVKANVGQPAKIKEMFQQIDETFGRLDVFVNNAASGVLRPVMELEETHWDWTMNINAKALLFCAQEAAKLMEKNGGGHIVSISSLGSIRYLENYTTVGVSKAALEALTRYLAVELSPKQIIVNAVSGGAIDTDALKHFPNREDLLEDARQNTPAGRMVEIKDMVDTVEFLVSSKADMIRGQTIIVDGGRSLLV
>NC_017196.2|WP_003233542.1|916874_917099_-|hypothetical-protein
MYVGRDMSELNMVSKKDWKNSELAYFHHAFQQIMPYLNEEGQSKYRELTQEIEARGGMKRNEADYSHGTRVSYD
>NC_017196.2|WP_014479222.1|915757_916867_+|A/G-specific-adenine-glycosylase
MNVLEDKLKQKDIQQFRDDLISWFEREQRVLPWREDQDPYKVWVSEVMLQQTRVETVIPYFLRFVEQFPTVEALADADEEKVLKAWEGLGYYSRVRNLQSAVKEVKQEYGGIVPPDEKDFGGLKGVGPYTKGAVLSIAYNKPIPAVDGNVMRVMSRILSIWDDIAKPKTRTIFEDAIRAFISKEKPSEFNQGLMELGALICTPKSPSCLLCPVQQHCSAFEEGTERELPVKSKKKKPGIKTMAAIVLTDEDGQVYIHKRPSKGLLANLWEFPNLETQKGIKTEREQLIAFLENEYGIQADISDLQGVVEHVFTHLVWNISVFFGKVKQVSDTSKLKKVTKEELEQFAFPVSHQKIWKMAVEAAAISAAP
>NC_017196.2|WP_014476212.1|914558_915542_-|metal-dependent-hydrolase
MDTGTHVVMGIALGGIATLDPVVGSDPAMAHAVMIATLAGSQAPDIDTVLKLKNNAVYIRNHRGFTHSIPAVLFWSVIIPAILYLFYPQADFLHLWLWTLLAVVLHVFVDIFNAYGTQAIRPFSKKWVALGLINTFDPFIFISHLAAIAIWYAGGSPGITFLSLYIILAGYYLVRLIMQLRIKRKLHEMIHDEIESIIISPTMKFRQWRIAVTTAHAFYVGRSMEGHVVILDTFNRVPVPETDVMHAAKQDDNIAAFLSFSPVYRWEVDTFKDHYEVRFIDLRYRSKGHYPFVAIVHIGHDLTIRSSYTGWIFSEEKLQKKLKLGSI
>NC_017196.2|WP_014479221.1|911980_914566_+|YfhO-family-protein
MKRKHIMIYAASLLVSVLAHAFFVKEWAEGRYMTGPGDGLAQMIVFKKLLFDQYTHGNFFYNYSFGLGGGTFSQLGYYFSASFLFLAVSAAVWMLQAVQLIGEADTLFWAESAVFISIFKLSLIIFTSASVFHYLIKHRAASFTGAVLYGVSIIYFRHEAYWEFFTDTMVWLPLLVLGAEKIIRERRPAWFIVACSLTLINNFYFAYINLIFIGIYVLFRWLISLEPHEEKRWIQIRLFLVSGFISFGISAAAFVPVVYGFLNNLRPPYSQKIEWLNFDDNILFSSRIIIVPAAFLLFLFMISFYKNRVFRLFAGLSLLFILFHFSPYAASVFNGFSAPQNRFEYILAFTIAGAAAAGLSQLSELKRKELLPAAAVVLLLYLYHIQRYKLDIWKPANESILLLLLMTIAALFAAAFAKKRAKMAVYGIIILSSLFVANSYQKYALSEGGDLDSVTKEYLTSEEYRGRESSELIRRLQKEDDDPLMRIDWMNGVRNNTPIIYGFNGFSAYSSILNKDLLAFYWNDLSIDMGRESVSRYASLGDRANLYSLLYGKYYMTEKTNEASVPYGFKKHLETEHYAVYENQYMLPFVKTADAIYSESELDRLPALAKEQAMLKGIILKDPSGKTEQTPKQSNLITKSDITAKQAQYQNGLLTVTGENGGELIITPKQPSSAPGDYYVSFYLKSKAKDRGFALKVNDYVTTRKSNKSIYKTGVNNITVRVPKSGHISINLPKGTYELRNIALYEENYQTLKNAVMQNKTEKADKLNWNKNRLTFAYHLSKDQYIMLPIPYEKGWELKINGKTQKIEKADYAFIGFKAQKGDNHIELTYYPPYFKISAIISLVSLLLAVFYIRRKKPGSI
>NC_017196.2|WP_003244113.1|910919_911909_+|glycosyltransferase-family-2-protein
MKQGLISIIIPSYNEGYNVKLIHESLKKEFKNIHYDYEIFFINDGSVDDTLQQIKDLAATCSRVKYISFSRNFGKEAAILAGFEHVQGEAVIVMDADLQHPTYLLKEFIKGYEEGYDQVIAQRNRKGDSFVRSLLSSMYYKFINKAVEVDLRDGVGDFRLLSRQAVNALLKLSEGNRFSKGLFCWIGFDQKIVFYENVERKNGTSKWSFSSLFNYGMDGVVSFNHKPLRLCFYTGIFILLLSIIYIIATFVKILTNGISVPGYFTIISAVLFLGGVQLLSLGIIGEYIGRIYYETKKRPHYLIKEANIPNKDLPETNELKSMRRLTKMH
>NC_017196.2|WP_014479220.1|909828_910689_+|alpha/beta-hydrolase
MDGVKCQFVNTNGITLHVAAAGPEDGPLIVLLHGFPEFWYGWKNQIKPLVDAGYRVIAPDQRGYNLSDKPEGIDSYRIDTLRDDIIGLITQFTDEKAIVIGHDWGGAVAWHLASTRPEYLEKLIAINIPHPHVMKTVTPLYPPQWLKSSYIAYFQLPDIPEASLRENDYETLDKAIGLSDRPALFTSEDVSRYKEAWKQPGALTAMLNWYRALRKGSLAEKPSYETVPYRMIWGMEDRFLSRKLAKETERHCPNGHLIFVDEASHWINHEKPAIVNQLILEYLKNQ
>NC_017196.2|WP_014479219.1|909509_909842_+|SdpC-immunity-protein-SpdL
MTDLVGGGLMIIAGILIKLFPPKSINSVYGYRTRRSMSDQRLWNEANRYSASLMILSGLVIAGMGLLLGSNLFILQLILLIAACVITFMLTEKRLKIMTHSQGGDRSGRS
>NC_017196.2|WP_014479218.1|908906_909425_+|SH3-domain-containing-protein
MKKKQVMLALTAAAGLGLTALHSAPAAKAAPLHDISVSMPSSDTYIIKAGKLNVRTEPNHEGDILGTVSSEQKVKVDRFVNADWAQIHFKGKKAYISTHFLMKTASQAKTTKQTAFYAPTPENGKAKQLSSGTEVTILGWGFSENGGFDFTWAFVDYGGVKGYIHTKDLQMR
>NC_017196.2|WP_003243789.1|908492_908762_+|YfhJ-family-protein
MNMYIEKLTNLLLEKNEMISYIQAKTWVELLWSDFEATYAKAGHAYQGEKMTEKIVTQWIENYGGQLHLFQSSRNDVNDYLNQSRGLLH
>NC_017196.2|WP_003242708.1|918429_918690_+|ygaB-like-family-protein
MTEFEKLVSEQMKTMDKLLDLQSELDRCKQIEAELRHLERDARLRGIQAEIAVKRKHLADIQDMFQKQTEQVIRSYRSSEKPSSFV
>NC_017196.2|WP_003223272.1|918833_919364_+|DUF402-domain-containing-protein
MGYPKEGETIQIHSYKHNGLIHRIWNETTILKSTEMCVIGANDRTMVTESDGRTWITREPAICYFHARQWFNVIGMLREDGVHYYCNISSPFAYDGEAIKYIDYDLDVKVFPDMTYNILDEDEYDDHRKAMNYPKEIDSILRDYLNTLLHWIHQRQGPFAPEFVDMWYERYLRYTK
>NC_017196.2|WP_009966836.1|919451_921194_+|ABC-transporter-ATP-binding-protein
MGVMKRYMQFVKPYKKQIFVTVLIGIVKFSIPLALPLLLKYVVDDIIQGGGTASDKTTSLFTIMAIMFALFLILRPPVEYYRQYFAQWTASKVLYDIRAKLFDHIQKLSLRFYANTRTGEVISRVINDVEQTKDFVITGLMNIWLDMLTILIVISIMLTLDVKLTLISIVLFPLYGISVKYFYGRLRKLTRERSQALAQVQGHLHERIQGMPVIRSFAIEDHEQAQFNEKNGHFLDKAIRHTNWNAKTFAVVNTITDLAPLIVIACAGYFVINGPLTVGTMVAFVGYIDRMYNPVRRLINSSTTLTQSIASMDRVFEFIDEPYELTDKPNAIKADQIRGGVEFQNVSFQYEKDKENILHDVSLKVNRGETVALVGMSGGGKSTLVSLIPRFYDVTSGRLLIDGTDIRDYEARSLRNQVGMVLQDTFLFSETIRENIAIGKPDATLEEIIEAAKAANAHEFIMSFPEGYETRVGERGVKLSGGQKQRISIARVFLKNPPLLILDEATSALDLESEHYIQEAMDKLAKDRTTFVVAHRLSTITHADKIVVMENGTIIEIGTHDELMDYESQYKHLFTIQNLN
>NC_017196.2|WP_014479224.1|921270_922332_-|aromatic-acid-exporter-family-protein
MKLGARIFKTGIAITLALYLASWIGLPAPIFAGIAAIFAIQPSIYRSFLIIIDQVQANIIGAVIATVFGLIFGPSPIMIGLTAVIVITIMLKLKIEHTISIALVTVIAILESAGDDFLMFALIRTSTVILGVLSSFIVNLVFLPPKYETKLIHNTVENTEEIMKWIRLSMRQSTEHSILKEDIEKLKEKMIKLDQTYLLYKEERSYFKKTTYVKSRKLVLFRQAIITANRALDTLKKLHRLENEIYHMPEEFQETLTEELDYLLYWHERILMRFVGKIKPHDDAVEEGIQYKQLLTKSFLKNQQNTDEELIDYNMLNIMASAVEYREQLEHLETLITSFQTYHPKDCEIETEE
>NC_017196.2|WP_014479225.1|922552_923842_-|glutamate-1-semialdehyde-2,1-aminomutase
MHTKSIELHNEALQHIVGGVNSPSRSYKAVGGGSPVAMEKASGAYFWDVDGNKYIDYLAAYGPIITGHAHPHITEAIKKAAENGVLYGTPTKHEVTFAKMLKEAIPAMDKVRFVNSGTEAVMTTIRVARAYTGRTKIIKFAGCYHGHSDLVLVAAGSGPSTLGTPDSAGVPKSIANEVITVPFNDINSYKAALDKWGSEIAAVLVEPIVGNFGIVEPKEGFLEKVNELTHNAGALVIYDEVITAFRFMYGGAQDLLQVKPDLTALGKIIGGGLPIGAYGGKQEIMEQVAPLGPAYQAGTMAGNPASILSGIACLEVLKEKGVYEKLDHLGAMLEEGILKHAETHGITITVNRLKGALTVYFSDEKVENYEQAERSDGETFATFFKLMLERGINLAPSKYEAWFITTAHTEQDIKDTLAAVEDAFKHLKN
>NC_017196.2|WP_003233532.1|923993_924467_+|thioredoxin-dependent-thiol-peroxidase
MTIEIGQKAPDLELKGDHGETVKLSDYKGKYIVLYFYPKDMTPGCTTEACDFRDSHESFAELDAVIIGVSPDSQEKHGKFKEKHNLPFLLLVDDEHKLAEAFDVWKLKKNFGKEYMGIERSTFLIDKEGRLIKEWRKVKVKDHVAEALQTLKDMSEK
>NC_017196.2|WP_003223285.1|924589_925027_+|peroxide-responsive-transcriptional-repressor-PerR
MAAHELKEALETLKETGVRITPQRHAILEYLVNSMAHPTADDIYKALEGKFPNMSVATVYNNLRVFRESGLVKELTYGDASSRFDFVTSDHYHAICENCGKIVDFHYPGLDEVEQLAAHVTGFKVSHHRLEIYGVCQECSKKENH
>NC_017196.2|WP_014479226.1|925061_925415_-|YgzB-family-protein
MAKYSSKINKIRTFALSLVFVGFIIMYIGIFFKESVLLSSLFMILGLLSIGLSTVVYFWIGMLSTKAVRVICPGCDKETKVLGRVDMCMHCREPLTLDKGLEGKEFDESYNKKKMSK
>NC_017196.2|WP_003243727.1|925622_926507_+|hypothetical-protein
MENLLRPIYQERASHPNTLAVIMIERRNKTSSLTDNFDAALLVIVKDADEPVFIKHYEFDHQTASLHVVTDSQIQEWILLGTNRRIIDWIVNGRVLFDRNEYVVELIDRLNTFPFAERKLKIGLEYGKLIRRYVEGKAFFEANQFLDAYNAVVHALHHLARIEVIDRGFHPETTVWSQVRQMEPQVYKLYSELIESHESLEKRLELLFLANDFLIHSKAEIGSAHLFEVMKEKDIWQFGELLQHHDLKHFTQDLGVMLDYLTEKGLINVCQIETKGQAVYHRGYSFKKGVDSDS
>NC_017196.2|WP_014479227.1|933473_934250_-|sporulation-control-protein-Spo0M
MSFFKKLAASAGIGAAKVDTILEKDAYFPGEEVQGTVHVKGGKIAQDIRYIDLQLSTRYVIVKDDEEHRKYATIHSFRVTGSFTIQPGEEHQFPFTFTLPLDTPMTVGKVEVTVVTDLDIQGGIDKSDHDRIFVEAHPWIENVLEAIENLGFRLNEADCEQAPYFRRRLPFVQEFEFVPTSGYYRQMLDELELIFLLDEDGLEIIFEVDRRARGLRGWLEEMYNDGEQLVRVRFSQSELEDAEELEEVLEEILDQYAE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_017196_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_017196_2

2933921-2934028

Orphan

Consensus_repeat	Method
TGATGGGAATCGAACCCACGACAT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_017196_2

>merge|NC_017196|2|2933921-2934028|CRISPRCasFinder
TGATGGGAATCGAACCCACGACATCAGCTTGGAAGGCTGAGGTTTTACCACTAAACTACACCCGCAATTTTTATTTGGGGCGATTGATGGGAATCGAACCCACGAATG

>NC_017196|2|2|2933921-2934028|CRISPRCasFinder
TGATGGGAATCGAACCCACGACAT	CAGCTTGGAAGGCTGAGGTTTTACCACTAAACTACACCCGCAATTTTTATTTGGGGCGAT
TGATGGGAATCGAACCCACGAATG

Protein	Signature genes	Signature genes Name	Protein_function
NC_017196.2\|WP_014480648.1\|2921354_2922410_-\|spore-coat-protein-CotS	unknown	unknown	gnl\|CDD\|131952
NC_017196.2\|WP_014480651.1\|2924900_2925368_+\|TspO/MBR-family-protein	unknown	unknown	gnl\|CDD\|226007
NC_017196.2\|WP_003243556.1\|2949173_2949719_+\|biofilm-surface-layer-protein-BslA	unknown	unknown	gnl\|CDD\|379999
NC_017196.2\|WP_014480660.1\|2946763_2948236_-\|betaine-aldehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|143437
NC_017196.2\|WP_014480649.1\|2922424_2923558_-\|spore-coat-protein-CotSA	unknown	unknown	gnl\|CDD\|340831
NC_017196.2\|WP_033881498.1\|2944378_2944867_+\|DinB-family-protein	unknown	unknown	gnl\|CDD\|378981
NC_017196.2\|WP_014480652.1\|2925398_2927795_-\|glycogen/starch/alpha-glucan-phosphorylase	unknown	unknown	gnl\|CDD\|273967
NC_017196.2\|WP_014480653.1\|2927781_2929236_-\|glycogen-synthase-GlgA	unknown	unknown	gnl\|CDD\|234809
NC_017196.2\|WP_003243227.1\|2945538_2946747_-\|choline-dehydrogenase	unknown	unknown	gnl\|CDD\|341481
NC_017196.2\|WP_014480654.1\|2931426_2933310_-\|1,4-alpha-glucan-branching-enzyme	unknown	unknown	gnl\|CDD\|273667
NC_017196.2\|WP_014480661.1\|2948434_2948977_+\|transcriptional-regulator-GbsR	unknown	unknown	gnl\|CDD\|224427
NC_017196.2\|WP_014480647.1\|2920924_2921353_-\|hypothetical-protein	unknown	unknown	unknown
NC_017196.2\|WP_004398841.1\|2929232_2930264_-\|glucose-1-phosphate-adenylyltransferase-subunit-GlgD	unknown	unknown	gnl\|CDD\|273966
NC_017196.2\|WP_072592554.1\|2923747_2924821_+\|spore-coat-kinase-CotI	unknown	unknown	gnl\|CDD\|131952
NC_017196.2\|WP_014480655.1\|2941597_2942119_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|224168
NC_017196.2\|WP_014480656.1\|2942136_2943666_-\|flotillin-lipid-rafts-scaffold-protein-FloT	unknown	unknown	gnl\|CDD\|225177
NC_017196.2\|WP_014480659.1\|2944872_2945451_-\|MOSC-domain-containing-protein	unknown	unknown	gnl\|CDD\|377051
NC_017196.2\|WP_032727091.1\|2943686_2944211_-\|NfeD-family-protein	unknown	unknown	gnl\|CDD\|376684
NC_017196.2\|WP_003229018.1\|2930287_2931430_-\|glucose-1-phosphate-adenylyltransferase	unknown	unknown	gnl\|CDD\|179997
NC_017196.2\|WP_003228966.1\|2940977_2941556_+\|energy-coupled-thiamine-transporter-ThiT	unknown	unknown	gnl\|CDD\|226377

Protein	Function_ID	Function_description	E-value
NC_017196.2\|WP_014480648.1\|2921354_2922410_-\|spore-coat-protein-CotS	gnl\|CDD\|131952	TIGR02906, Spore_coat_protein_S, spore coat protein, CotS family. Members of this family include the spore coat proteins CotS and YtaA from Bacillus subtilis and, from other endospore-forming bacteria, homologs that are more closely related to these two than to the spore coat proteins YutH and YsxE. The CotS family is more broadly distributed than YutH or YsxE, but still is not universal among spore-formers. [Cellular processes, Sporulation and germination].	6.9211e-130
NC_017196.2\|WP_014480651.1\|2924900_2925368_+\|TspO/MBR-family-protein	gnl\|CDD\|226007	COG3476, COG3476, Tryptophan-rich sensory protein (mitochondrial benzodiazepine receptor homolog) [Signal transduction mechanisms].	2.06085e-39
NC_017196.2\|WP_003243556.1\|2949173_2949719_+\|biofilm-surface-layer-protein-BslA	gnl\|CDD\|379999	pfam17735, BslA, Biofilm surface layer A. This family includes members such as BslA (previously called YuaB). Secreted BslA from Bacillus subtillis has been shown to form surface layers around the biofilm self-assembling at interfaces of B. subtilis biofilms, forming an elastic film. structural analysis revealed that BslA consists of an Ig-type fold with the addition of an unusual, extremely hydrophobic cap region. The hydrophobic cap exhibits physiochemical properties similar to the hydrophobic surface found in fungal hydrophobins; thus, BslA is defined as member of a class of bacterially produced hydrophobins.	5.35887e-46
NC_017196.2\|WP_014480660.1\|2946763_2948236_-\|betaine-aldehyde-dehydrogenase	gnl\|CDD\|143437	cd07119, ALDH_BADH-GbsA, Bacillus subtilis NAD+-dependent betaine aldehyde dehydrogenase-like. Included in this CD is the NAD+-dependent, betaine aldehyde dehydrogenase (BADH, GbsA, EC=1.2.1.8) of Bacillus subtilis involved in the synthesis of the osmoprotectant glycine betaine from choline or glycine betaine aldehyde.	0
NC_017196.2\|WP_014480649.1\|2922424_2923558_-\|spore-coat-protein-CotSA	gnl\|CDD\|340831	cd03801, GT4_PimA-like, phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.	2.38164e-74
NC_017196.2\|WP_033881498.1\|2944378_2944867_+\|DinB-family-protein	gnl\|CDD\|378981	pfam12867, DinB_2, DinB superfamily. The DinB family are an uncharacterized family of potential enzymes. The structure of these proteins is composed of a four helix bundle.	2.35984e-17
NC_017196.2\|WP_014480652.1\|2925398_2927795_-\|glycogen/starch/alpha-glucan-phosphorylase	gnl\|CDD\|273967	TIGR02093, Glycogen_phosphorylase, glycogen/starch/alpha-glucan phosphorylases. This family consists of phosphorylases. Members use phosphate to break alpha 1,4 linkages between pairs of glucose residues at the end of long glucose polymers, releasing alpha-D-glucose 1-phosphate. The nomenclature convention is to preface the name according to the natural substrate, as in glycogen phosphorylase, starch phosphorylase, maltodextrin phosphorylase, etc. Name differences among these substrates reflect differences in patterns of branching with alpha 1,6 linkages. Members include allosterically regulated and unregulated forms. A related family, TIGR02094, contains examples known to act well on particularly small alpha 1,4 glucans, as may be found after import from exogenous sources. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0
NC_017196.2\|WP_014480653.1\|2927781_2929236_-\|glycogen-synthase-GlgA	gnl\|CDD\|234809	PRK00654, glgA, glycogen synthase GlgA.	0
NC_017196.2\|WP_014480661.1\|2948434_2948977_+\|transcriptional-regulator-GbsR	gnl\|CDD\|224427	COG1510, COG1510, Predicted transcriptional regulators [Transcription].	1.21185e-72
NC_017196.2\|WP_014480654.1\|2931426_2933310_-\|1,4-alpha-glucan-branching-enzyme	gnl\|CDD\|273667	TIGR01515, branching_enzym, alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase. This model describes the glycogen branching enzymes which are responsible for the transfer of chains of approx. 7 alpha(1--4)-linked glucosyl residues to other similar chains (in new alpha(1--6) linkages) in the biosynthesis of glycogen. This enzyme is a member of the broader amylase family of starch hydrolases which fold as (beta/alpha)8 barrels, the so-called TIM-barrel structure. All of the sequences comprising the seed of this model have been experimentally characterized. This model encompasses both bacterial and eukaryotic species. No archaea have this enzyme, although Aquifex aolicus does. Two species, Bacillus thuringiensis and Clostridium perfringens have two sequences each which are annotated as amylases. These annotations are aparrently in error. GP\|18143720 from C. perfringens, for instance, contains the note "674 aa, similar to gp:A14658_1 amylase (1,4-alpha-glucan branching enzyme (EC 2.4.1.18) ) from Bacillus thuringiensis (648 aa); 51.1% identity in 632 aa overlap." A branching enzyme from Porphyromonas gingivales, OMNI\|PG1793, appears to be more closely related to the eukaryotic species (across a deep phylogenetic split) and may represent an instance of lateral transfer from this species' host. A sequence from Arabidopsis thaliana, GP\|9294564, scores just above trusted, but appears either to contain corrupt sequence or, more likely, to be a pseudogene as some of the conserved catalytic residues common to the alpha amylase family are not conserved here. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0
NC_017196.2\|WP_003243227.1\|2945538_2946747_-\|choline-dehydrogenase	gnl\|CDD\|341481	cd08551, Fe-ADH, iron-containing alcohol dehydrogenases (Fe-ADH)-like. This family contains large metal-containing alcohol dehydrogenases (ADH), known as iron-containing alcohol dehydrogenases. They contain a dehydroquinate synthase-like protein structural fold and mostly contain iron. They are distinct from other alcohol dehydrogenases which contains different protein domains. There are several distinct families of alcohol dehydrogenases: Zinc-containing long-chain alcohol dehydrogenases, insect-type, or short-chain alcohol dehydrogenases, iron-containing alcohol dehydrogenases, among others. The iron-containing family has a Rossmann fold-like topology that resembles the fold of the zinc-dependent alcohol dehydrogenases, but lacks sequence homology, and differs in strand arrangement. ADH catalyzes the reversible oxidation of alcohol to acetaldehyde with the simultaneous reduction of NAD(P)+ to NAD(P)H.	1.69004e-175
NC_017196.2\|WP_004398841.1\|2929232_2930264_-\|glucose-1-phosphate-adenylyltransferase-subunit-GlgD	gnl\|CDD\|273966	TIGR02092, Glycogen_biosynthesis_protein_GlgD, glucose-1-phosphate adenylyltransferase, GlgD subunit. This family is GlgD, an apparent regulatory protein that appears in an alpha2/beta2 heterotetramer with GlgC (glucose-1-phosphate adenylyltransferase, TIGR02091) in a subset of bacteria that use GlgC for glycogen biosynthesis. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0
NC_017196.2\|WP_072592554.1\|2923747_2924821_+\|spore-coat-kinase-CotI	gnl\|CDD\|131952	TIGR02906, Spore_coat_protein_S, spore coat protein, CotS family. Members of this family include the spore coat proteins CotS and YtaA from Bacillus subtilis and, from other endospore-forming bacteria, homologs that are more closely related to these two than to the spore coat proteins YutH and YsxE. The CotS family is more broadly distributed than YutH or YsxE, but still is not universal among spore-formers. [Cellular processes, Sporulation and germination].	4.64632e-132
NC_017196.2\|WP_014480655.1\|2941597_2942119_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|224168	COG1247, COG1247, Sortase and related acyltransferases [Cell envelope biogenesis, outer membrane].	3.65478e-10
NC_017196.2\|WP_014480656.1\|2942136_2943666_-\|flotillin-lipid-rafts-scaffold-protein-FloT	gnl\|CDD\|225177	COG2268, COG2268, Uncharacterized protein conserved in bacteria [Function unknown].	1.34239e-122
NC_017196.2\|WP_014480659.1\|2944872_2945451_-\|MOSC-domain-containing-protein	gnl\|CDD\|377051	pfam03473, MOSC, MOSC domain. The MOSC (MOCO sulfurase C-terminal) domain is a superfamily of beta-strand-rich domains identified in the molybdenum cofactor sulfurase and several other proteins from both prokaryotes and eukaryotes. These MOSC domains contain an absolutely conserved cysteine and occur either as stand-alone forms or fused to other domains such as NifS-like catalytic domain in Molybdenum cofactor sulfurase. The MOSC domain is predicted to be a sulfur-carrier domain that receives sulfur abstracted by the pyridoxal phosphate-dependent NifS-like enzymes, on its conserved cysteine, and delivers it for the formation of diverse sulfur-metal clusters.	4.89511e-05
NC_017196.2\|WP_032727091.1\|2943686_2944211_-\|NfeD-family-protein	gnl\|CDD\|376684	pfam01957, NfeD, NfeD-like C-terminal, partner-binding. NfeD-like proteins are widely distributed throughout prokaryotes and are frequently associated with genes encoding stomatin-like proteins (slipins). There appear to be three major groups: an ancestral group with only an N-terminal serine protease domain and this C-terminal beta sheet-rich domain which is structurally very similar to the OB-fold domain, associated with its neighboring slipin cluster; a second major group with an additional middle, membrane-spanning domain, associated in some species with eoslipin and in others with yqfA; a final 'artificial' group which unites truncated forms lacking the protease region and associated with their ancestral gene partner, either yqfA or eoslipin. This NefD, C-terminal, domain appears to be the major one for relating to the associated protein. NfeD homologs are clearly reliant on their conserved gene neighbor which is assumed to be necessary for function, either through direct physical interaction or by functioning in the same pathway, possibly involve with lipid-rafts.	0.000254791
NC_017196.2\|WP_003229018.1\|2930287_2931430_-\|glucose-1-phosphate-adenylyltransferase	gnl\|CDD\|179997	PRK05293, glgC, glucose-1-phosphate adenylyltransferase; Provisional.	0
NC_017196.2\|WP_003228966.1\|2940977_2941556_+\|energy-coupled-thiamine-transporter-ThiT	gnl\|CDD\|226377	COG3859, COG3859, Predicted membrane protein [Function unknown].	1.328e-72

>NC_017196.2|WP_014480654.1|2931426_2933310_-|1,4-alpha-glucan-branching-enzyme
MAAASPTAHDVYLFHEGSLFKSYQLFGSHYRELNGKSGYEFCVWAPHASEVRVAGDFNSWSGEEHVMHRVNDNGIWTLFIPGIGEKERYKYEIVTNNGEIRLKADPYAIYSEVRPNTASLTYDLEGYSWQDQKWQKKQKAKTLYEKPVFIYELHLGSWKKHSDGRHYSYIELSQTLIPYIKEHGFTHIELLPVYEHPYDRSWGYQGTGYYSPTSRFGTPHDLMKFVDECHQQNIGVILDWVPGHFCKDAHGLYMFDGEPLYEYKEERDRENWLWGTANFDLGKPEVHSFLISNALYWAEFYHIDGFRVDAVANILYWPNQDERHTNPYAVEFLKKLNQTMREAYPYVMMIAEDSTEWPQVTGAVEEGGLGFHYKWNMGWMNDVLKYMETPPEERRHCHQLISFSLLYAFSEHFVLPFSHDEVVYGKKSLLNKMPGDYWQKFAQYRLLLGYMTVHPGKKLIFMGSEFAQFDEWKDTEQLDWFLDSFPMHQKASVFTQDLLRFYQKSKILYEHDHRAQSFEWIDVHNDEQSIFSFIRYGKKHGEALVIICNFTPVVYHQYDVGVPFFTQYIEVLNSDSETYGGSGQINKKPLSAKKGALHHKPCYITMTIPPYGISILRAVKKRGEIKR
>NC_017196.2|WP_003229018.1|2930287_2931430_-|glucose-1-phosphate-adenylyltransferase
MKKQCVAMLLAGGKGSRLSGLTKNMAKPAVSFGGKYRIIDFTLSNCSNSGIDTVGILTQYQPLELNSYIGIGSAWDLDRYNGGVTVLPPYAESSEVKWYKGTASAIYENLNYLNQYDPEYVLILSGDHIYKMDYGKMLDYHIEKKADVTISVIEVGWEEASRFGIMKANPDGTITHFDEKPKFPKSNLASMGIYIFNWPLLKQYLEMDDQNPYSSHDFGKDIIPLLLEEKKKLSAYPFKGYWKDVGTVQSLWEANMDLLKEDSELKLFERKWKIYSVNPNQPPQFISSDAQVQDSLVNEGCVVYGNVSHSVLFQGVTVGKHTTVTSSVIMPDVTIGEHVVIENAIVPNGMVLPDGAVIRSEKDIEEVLLVSEEFVEKELI
>NC_017196.2|WP_004398841.1|2929232_2930264_-|glucose-1-phosphate-adenylyltransferase-subunit-GlgD
MFNNQMLGVIDETTYKHSLQDLTAQRSLGAIPFAGRYRLIDFMLSNMVNADIRSVAIFPKYRYRSLMDHLGAGKEWDLHRKKDGLFFFPSPHLHHEYDEFGSFRQFSDHLDYFHRSTQQYAVISNSHTVCNIQFQYVLKRHQEVGCDVTEVFQDGQSLQIYIMSTTLLKDLIYGHSEKGYKTIQEAVEKESSALTICPYEYSGYAAVIDSVEKYYTHSMELIQPRFWQQVFLPQQPIYTKVKDEPPTKYGKHSTVKNSLVANGCVLEGEVENCILFRAVHVGKGTKLKNCIIMQKTQIGEDCLLEQVISDKDVKIGKATEAAGTAEQPLVLRKGLVQGELMNS
>NC_017196.2|WP_014480653.1|2927781_2929236_-|glycogen-synthase-GlgA
MKILLAVSECTPFVKSGGLADVAGALPKALARLGNAVAVMLPKYSQIPEPWKKRMKKKAECTVAVGWRQQYCGIEHMAEDDVNYYFIDNEYYFNRDSLYGHYDDGERFAYFSRAVLEAAKVVNVPADIVHTHDWHTAMVNYLLKEEYRKHPFYERMKSVLTIHNLQFQGIFPPDVTHDLLGLEMDHFHYERLECNSFVNFMKAGIIAADHVTTVSPTYRNEILTPYYGEQLEQVLQYREDDVTGILNGIDDTFYQPKSDPYIEAQYDSGDLACKLENKTKLQRRMGLPEKNDIPLISMVTRLTKQKGLDLVRRIMHELLEEQDIQLVVLGTGEREFEDYFRYAEFAFHEKCRAYIGFDEPLAHQIYAGSDMFLMPSKFEPCGLGQLIALQYGAIPIVRETGGLYDTVRAYQEEEGTGNGFTFSAFNAHDLKFTIERALAFYRQQDVWKSIVKTAMNADYSWGKSAKEYQRIFEQVTRSGRDVLE
>NC_017196.2|WP_014480652.1|2925398_2927795_-|glycogen/starch/alpha-glucan-phosphorylase
MFSSKERFADLFLKRLEMTCGKSFKDSVKLDQYKTLGNMVREYISANWIETNEKSRSNSGKQTYYLSIEFLLGQLLEQNLMNLGVRDVVEAGLKEIGINLEEILQIENDAGLGNGGLGRLAACFLDSLASLNLPGHGMGIRYKHGLFEQKIVDGHQVELPEQWLKNGNVWEVRNADQAVDVPFWGEVHMTEKSGRLHFRHEQATIVTAVPYDIPIIGYETGTVNTLRLWNAEPYAHYHGGNILSYKRETEAVSEFLYPDDTHDEGKILRLKQQYFLVCASLKSIVNNYRKTHKSLSGLHKEVSIHINDTHPALAVPELMRILLDEENMSWEEAWHITVHTISYTNHTTLSEALEKWPIHLFKPLLPRMYMIIEEINERFCRAVWEKYPGDWKRIEDMAITAHGVVKMAHLAIVGSYSVNGVAKIHSDILKEREMRDFHLLFPNRFNNKTNGIAHRRWLLKANPGLSAIITEAIGDEWVKQPESLIRLEPYATDPAFIEQFQNNKSKKKQELADLIFCTAGVVVNPDSIFDVQVKRLHAYKRQLLNVLHIMYLYNRLKEDAGFSIYPQTFIFGAKASPSYYYAKKIIKLIHSVAEKVNYDPAVKQLIKVVFLENYRVSMAERIFTASDVSEQISTASKEASGTGNMKFMMNGALTIGTHDGANIEILERVGPDCIYTFGLKADEVLSYQENGGYRSREYYQHDRRIRQVADQLINGFFEGEADEFESIFDSLLPHNDEYFVLKDFSSYADAQERIQADYRERRKWSERSIVNIAHSGYFSSDRTIREYAKDIWGIKPMM
>NC_017196.2|WP_014480651.1|2924900_2925368_+|TspO/MBR-family-protein
MKKIVGALAVFVITYALFSAAGYLFPVDQEWYNSLKKPDWTPSVTAIGIIWATLFALISLSAAIVYAAFSFKGAKSFRFTLLINYVLNQAFSYFQFTQKNLLAASLDCLLVAITAIVLLIIAKKYNRAASYLLLPYYLWSAFATFLSFTINSMNL
>NC_017196.2|WP_072592554.1|2923747_2924821_+|spore-coat-kinase-CotI
MCPLMAENHEVIEEGNSSELPLSAEDAKKLTELAENVLQGWDVQAEKIDVIQGNQMALVWKVHTDSGALCLKRIHRPEKKALFSIFAQDYLAKKGMNVPGILPNKKGSLYSKHGSFLFVVYDWIEGRPFELTVKQDLEFIMKGLADFHTASVGYQPPNGVPVFTKLGRWPNHYTKRCKQMETWKLMAEAEKEDPFSQFYLQEIDGFIEDGLRIKDRLLQSTYVPWTEQLKKSPNLCHQDYGTGNTLLGENEQIWVIDLDTVSFDLPIRDLRKMIIPLLDTTGVWDEETFHVMLNAYESRAPLTEEQKQVMFIDMLFPYELYDVIREKYVRKSALPKEELESAFEYERIKANALRQLI
>NC_017196.2|WP_014480649.1|2922424_2923558_-|spore-coat-protein-CotSA
MKIALIATEKLPVPSVRGGAIQIYLEAVAPLIAKKHEVTVFSIKDPNLADREKVDGVHYVHLDEDRYEEAVGEELKKSRFDLVHVCNRPSWVPKLKKKAPDAVFILSVHNEMFAYDKISQAEGEICIDSVAQIVTVSDYIGQTITSRFPSARSKTKTVYSGVDLKAYHPRWTNEGQRAREEMRSELGLHGKKIVLFVGRLSKVKGPHILLQALPDIIEEHPDVMMVFIGSKWFGDNELNNYVKHLHTLGAMQKDHVTFIQFVKPKDIPRLYTMSDVFVCSSQWQEPLARVHYEAMAAGLPIITSNRGGNPEVIEEGKNGYIIHDFENPKQYAERINDLLSSSEKRERLGKYSRREAENKFGWQRVAENLLSVYEKNR
>NC_017196.2|WP_014480648.1|2921354_2922410_-|spore-coat-protein-CotS
MYQKEHEEQIVSEILSYYPFHIDHVALKSNKSGRKIWEVETDHGPKLLKEAQMKPERMLFITQAHAHLQEQGLPIAPIHQTKNGGSCLGTDQVSYSLYDKVTGKEMIYYDAEQMKKVMSFAGHFHHASKGYVCTDESKKRSRLGKWHKLYRWKLQELEGNMQIAASYPDDVFSQTFLKHADKMLARGKEALQALDDSEYETWTKETLEHGGFCFQDFTLARLTEIEGEPFLKELHSITYDLPSRDLRILLNKVMVKLSVWDTDFMVALLAAYDAVYPLTEKQYEVLWIDLAFPHLFCAIGHKYYLKQKKTWSDEKYNWALQNMISVEGSKDSFLDNLPELYKKIKAYREAN
>NC_017196.2|WP_014480647.1|2920924_2921353_-|hypothetical-protein
MRSSRQKASISKLDLDQFVFTPPGPMGWQAHDSIPAEKGEEEKHLDMGSIRELPHINASKEYQEETKEKETDHKIVDDEEETKFETTPEPEEERDSKRSAPPYEEEDEEEPDVAEEARVEIIILPSESKPAPWFSQTVKRKA
>NC_017196.2|WP_003228966.1|2940977_2941556_+|energy-coupled-thiamine-transporter-ThiT
MNQSKQLVRLIEIAIMTAAAVILDIVSGMFLSMPQGGSVSIMMIPIFLISFRWGVKAGLTTGLLTGLVQIAIGNLFAQHPVQLLLDYIVAFAAIGISGCFASSVRKAAVSKTKGKLIVSVVSAVFIGSLLRYAAHVISGAVFFGSFAPKGTPVWIYSLTYNATYMVPSFIICAIVLCLLFMTAPRLLKSDKA
>NC_017196.2|WP_014480655.1|2941597_2942119_-|GNAT-family-N-acetyltransferase
MVTVREAKLEDIKDIAKVHVDSWRTTYHEIIPIDYLNSLNYKEFEDKWKSRSLKGVFVAQDEMDSVFGFASFGPIRSEQEGYDGELYAIYLLEERQRQGAGRALLAKGAEYLLQHGFSSMFVWVIEQNPSIIFYQAYSPERVAEDNFEIAGVRLKEVGLGWPDLSALKTLLNR
>NC_017196.2|WP_014480656.1|2942136_2943666_-|flotillin-lipid-rafts-scaffold-protein-FloT
MTMPIIMIIGVVFFLLIALIAVFITKYRTAGPDEALIVTGSYLGNKNVHVDEGGNRIKIVRGGGTFVLPVFQQAEPLSLLSSKLDVSTPEVYTEQGVPVMADGTAIIKIGGSIGEIATAAEQFLGKSKDDREQEAREVLEGHLRSILGSMTVEEIYKNREKFSQEVQRVASQDLAKMGLVIVSFTIKDVRDKNGYLESLGKPRIAQVKRDADIATAEADKETRIKRAEADKDAKKSELERATEIAEAEKLNQLKMAEFRREQDTAKANADQAYDLETARARQQVTEQEMQVKIIERQKQIELEEKEILRRERQYDSEVKKKADADRYSVEQSAAAEKAKQLAEADAKKYSIEAMAKAEAEKVRIDGLAKAEAEKAKGETEAEVIRLKGLAEAEAKEKIAAAFEQYGQAAIFDMIVKMLPEYAKQAAAPLSNIDKITVVDTGGSGESSGANKVTSYATNLMSSLQESLKASSGIDVKEMLENFSGKGNVKQSINELTNEIKEAKTVQKSE
>NC_017196.2|WP_032727091.1|2943686_2944211_-|NfeD-family-protein
MELFGVPIQTIYLYTLIIAGSLTLLFLFFGDVFAGLSEGIPFLNPTLVLSFFTCFSAGGYIGELVLPLSSLLIALLSCILSIMLVVLLHIFVLVPLSSAEESLAYREDDLRGRLGKVITAVPVDGFGEVVIEGIGGTISKSAVSFDNQQISYGTTVLVVDINNGVLSVTPHEPI
>NC_017196.2|WP_033881498.1|2944378_2944867_+|DinB-family-protein
MSIFNEARLETWNELKGLSDEKLNQKPSAEEWSIREVLDHLKKIDMTAQKMLKERVKDAPIKEIEEKSLEVAQDRNNKRKAPSHLEPAHDFISGSQMKRELDVVREQLTAAIASLKEEDFERVLPHPVFQELTVRQWIDFIGHHEKRHLSQMKEIKEKIERA
>NC_017196.2|WP_014480659.1|2944872_2945451_-|MOSC-domain-containing-protein
MWKRMTAKAEGLYIAETESFVTKQMDKLDFDYGGIPGDLHFGLTKKAGAREPMFSRGTEIFNRRQISIVSIEECNEIALKMGVPRILPEWLGANVAVSGMPDLTSLKEGSRIIFPSGAALLCEGENDPCIQPGEVIQSYYPDKPKLTPAFVRHALGIRGIVCIVERPGAVYTGDEIEVHSYQRKVKRKAERV
>NC_017196.2|WP_003243227.1|2945538_2946747_-|choline-dehydrogenase
MTLNMKVESMQKFHTFEIPTVIKHGIGAIKHTGEEVAALGVSKALLVTDPGIYKAGVADPVIESLKEAGIEVVLFNKVEPNPPVRLVNEGSELYKKENCNGLVAVGGGSSMDTAKAIGVEATHEGSVLDYEAADGKKPLENRIPPLTTIPTTAGTGSEVTQWAVITDEEREFKFNTGGPLIAAHLTIIDPELHVSMPPHVTAMTGIDALAHAIECYTMKFAQPITDAVALMAIEYAAHYIKRAFADGEDLEARYGMAQAAMLAGLSYGSESAGAAHAMSQTLGGIIPVAHGQCVAAMMGPVMEYNWKGYPEKFARIAKAFGIDTSKMTTEEAAKASVNWMYDLVEDLEVPTLEEQGVSPDMIERLSKEAMKDPQTFGNPRDLNEKAYNWIYKRCFNLTPKTV
>NC_017196.2|WP_014480660.1|2946763_2948236_-|betaine-aldehyde-dehydrogenase
MSQTLFIDGEWISAEKEQIRSIINPFNQEEIATVSEGGREDAIKAIAAARRAFDKGEWSSLSGLERGKIVLKIAELIRRDLEELAELESLDTGKTLEESKADMDDIANVFQYYAGLADKDGGEIVSSPIPDSESKIIREPIGVCGQITPWNYPLLQASWKIAPALAAGNTIVMKPSEITPLTTIKVFKLMEEAGVPKGVANLVLGPGATVGDELAVNKDVDLISFTGGIETGKKIMRAASGNVKKIALELGGKNPNIVFKDADLEVAVDQALNAVFFHAGQVCSAGSRLLVEDAIHDQFLAELVKRAKRIKLGNGFHAETESGPLISAEHRAKVEKYVEIGIEEGAKLETGGKRPEDPALQNGFFYEPTIFSNCNSDMRIVQEEVFGPVLTVETFSSEEEVIELANDTIYGLAGAVWSKDIEKCERVAARLRMGTVWINDFHPYFAQAPWGGYKQSGFGRELGKIGLEEYTEVKHVYRNTKPAAVNWFNS
>NC_017196.2|WP_014480661.1|2948434_2948977_+|transcriptional-regulator-GbsR
MDENPEFAAIEQARDLVIDSIAETMDLYGITRSVGILYGTMYMRDEMTLDEMREELQMSKPSMSTGVKKLQDLNVVKKTFHRGIRKHTFVAEKDFFKFFTNFFPPKWEREVQVNVAAIEEAQADLQKVLCKEDLDEDIKNEALQLYDQLESSKAYYDWLKRLAESVQTGEIFKFIPIETK
>NC_017196.2|WP_003243556.1|2949173_2949719_+|biofilm-surface-layer-protein-BslA
MKRKLLSSLAISALSLGLLVSAPTASFAAESTSTKAHTESTMRTQSTASLFATITGASKTEWSFSDIELTYRPNTLLSLGVMEFTLPSGFTANTKDTLNGNALRTTQILNNGKTVRVPLALDLLGAGEFKLKLNNKTLPAAGTYTFRAENKSLSIGNKFYAEASIDVAKRSTPPTQPCGCN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_017196_2	2.1\|2933945\|60\|NC_017196\|CRISPRCasFinder	2933945-2934004	60	NZ_CP024037	Bacillus aryabhattai strain K13 plasmid unnamed2	10417-10476	7	0.883
NC_017196_2	2.1\|2933945\|60\|NC_017196\|CRISPRCasFinder	2933945-2934004	60	NZ_CP026740	Bacillus megaterium strain YC4-R4 plasmid unnamed4	70764-70823	7	0.883
NC_017196_2	2.1\|2933945\|60\|NC_017196\|CRISPRCasFinder	2933945-2934004	60	NC_017139	Bacillus megaterium WSH-002 plasmid WSH-002_p1, complete sequence	1318-1377	7	0.883
NC_017196_2	2.1\|2933945\|60\|NC_017196\|CRISPRCasFinder	2933945-2934004	60	NZ_CP010587	Bacillus megaterium Q3 plasmid p1, complete sequence	838-897	7	0.883
NC_017196_2	2.1\|2933945\|60\|NC_017196\|CRISPRCasFinder	2933945-2934004	60	NZ_CP023319	Bacillus megaterium strain A plasmid p2, complete sequence	75825-75884	7	0.883
NC_017196_2	2.1\|2933945\|60\|NC_017196\|CRISPRCasFinder	2933945-2934004	60	NC_020451	Vibrio coralliilyticus strain ATCC BAA-450 plasmid, complete sequence	1960-2019	9	0.85
NC_017196_2	2.1\|2933945\|60\|NC_017196\|CRISPRCasFinder	2933945-2934004	60	NZ_CP015440	Anoxybacillus amylolyticus strain DSM 15939 plasmid pDSM15939_2, complete sequence	64773-64832	12	0.8
NC_017196_2	2.1\|2933945\|60\|NC_017196\|CRISPRCasFinder	2933945-2934004	60	NZ_CP033045	Bacillus foraminis strain Bac44 plasmid unnamed, complete sequence	483791-483850	13	0.783
NC_017196_2	2.1\|2933945\|60\|NC_017196\|CRISPRCasFinder	2933945-2934004	60	NZ_LR134399	Listeria monocytogenes strain NCTC7974 plasmid 2, complete sequence	57361-57420	14	0.767

1. spacer 2.1|2933945|60|NC_017196|CRISPRCasFinder matches to NZ_CP024037 (Bacillus aryabhattai strain K13 plasmid unnamed2) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

2. spacer 2.1|2933945|60|NC_017196|CRISPRCasFinder matches to NZ_CP026740 (Bacillus megaterium strain YC4-R4 plasmid unnamed4) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

3. spacer 2.1|2933945|60|NC_017196|CRISPRCasFinder matches to NC_017139 (Bacillus megaterium WSH-002 plasmid WSH-002_p1, complete sequence) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

4. spacer 2.1|2933945|60|NC_017196|CRISPRCasFinder matches to NZ_CP010587 (Bacillus megaterium Q3 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

5. spacer 2.1|2933945|60|NC_017196|CRISPRCasFinder matches to NZ_CP023319 (Bacillus megaterium strain A plasmid p2, complete sequence) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

6. spacer 2.1|2933945|60|NC_017196|CRISPRCasFinder matches to NC_020451 (Vibrio coralliilyticus strain ATCC BAA-450 plasmid, complete sequence) position: , mismatch: 9, identity: 0.85

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcattttagttatggcccggg	Protospacer
****************************************** ***   * ***  **.

7. spacer 2.1|2933945|60|NC_017196|CRISPRCasFinder matches to NZ_CP015440 (Anoxybacillus amylolyticus strain DSM 15939 plasmid pDSM15939_2, complete sequence) position: , mismatch: 12, identity: 0.8

cagcttggaaggctgaggttttaccactaaactacacccgca-------atttttatttg	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcataataatatataccattg	Protospacer
******************************************       ** * .  ***

8. spacer 2.1|2933945|60|NC_017196|CRISPRCasFinder matches to NZ_CP033045 (Bacillus foraminis strain Bac44 plasmid unnamed, complete sequence) position: , mismatch: 13, identity: 0.783

cagcttggaaggctgaggttttaccactaaactacacccgc--------aatttttattt	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatggttaaaagttttgcca	Protospacer
*****************************************        ** ****...

9. spacer 2.1|2933945|60|NC_017196|CRISPRCasFinder matches to NZ_LR134399 (Listeria monocytogenes strain NCTC7974 plasmid 2, complete sequence) position: , mismatch: 14, identity: 0.767

cagcttggaaggctgaggttttaccactaaactacacccgc---------aatttttatt	CRISPR spacer
cagcttggaaggctgtagttttaccactaaactacacccgcatagtaagtagttcttagt	Protospacer
*************** .************************         *.**.*** *

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

672183 : 744680

Synechococcus_phage(15.79%)

coat,transposase,tRNA

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014479048.1\|672183_673725_-\|coat	outer spore coat copper-dependent laccase CotA	NA	NA	NA	NA
WP_014479049.1\|673873_675283_-	GABA permease	NA	NA	NA	NA
WP_009966725.1\|675320_675608_-	hypothetical protein	NA	NA	NA	NA
WP_014479050.1\|675680_676553_+	manganese transporter MneS	NA	NA	NA	NA
WP_014479051.1\|676703_677666_+	MoxR family ATPase	NA	NA	NA	NA
WP_014479052.1\|677665_678862_+	DUF58 domain-containing protein	NA	NA	NA	NA
WP_014479053.1\|678883_681097_+	DUF4129 domain-containing protein	NA	NA	NA	NA
WP_003244399.1\|681259_682801_+	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	5.7e-21	30.5
WP_014479055.1\|683032_683812_+	hypothetical protein	NA	NA	NA	NA
WP_014479056.1\|684439_685762_+	hypoxanthine/guanine permease PbuG	A0A0R6PHV4	Moraxella_phage	5.2e-39	31.2
WP_014479057.1\|685972_686776_+	hypothetical protein	NA	NA	NA	NA
WP_014479058.1\|686934_687102_+	Fur-regulated basic protein FbpA	NA	NA	NA	NA
WP_009966729.1\|687315_687870_+	DUF2179 domain-containing protein	NA	NA	NA	NA
WP_003219403.1\|687869_688067_+	NETI motif-containing protein	NA	NA	NA	NA
WP_003244134.1\|688389_688878_+	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	8.7e-24	44.9
WP_014479059.1\|688870_690013_+	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_003233955.1\|690009_691305_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	5.9e-19	25.7
WP_014479060.1\|691378_692104_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0E3G7P8	Synechococcus_phage	1.2e-45	44.1
WP_003219409.1\|692096_692351_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_003243954.1\|692347_693031_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_003233949.1\|693014_695243_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	3.8e-159	40.1
WP_003233947.1\|695218_696649_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.2e-52	32.5
WP_014479061.1\|696750_697791_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	1.7e-64	42.0
WP_014479062.1\|697787_698375_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	2.4e-28	41.0
WP_014479063.1\|698371_699910_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	3.0e-78	52.6
WP_014479064.1\|699925_701194_+	phosphoribosylamine--glycine ligase	NA	NA	NA	NA
WP_014479065.1\|701231_701654_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_014479066.1\|701797_703072_+	amino acid permease	NA	NA	NA	NA
WP_014479068.1\|703442_705185_+	adenine deaminase	NA	NA	NA	NA
WP_014479069.1\|705211_706207_+	DUF3048 domain-containing protein	NA	NA	NA	NA
WP_014479070.1\|706209_706524_+	hypothetical protein	NA	NA	NA	NA
WP_031600238.1\|706558_708136_-	FMN-binding glutamate synthase family protein	NA	NA	NA	NA
WP_014479073.1\|708400_709087_+	heptaprenylglyceryl phosphate synthase	NA	NA	NA	NA
WP_014479074.1\|709148_711368_+	DNA helicase PcrA	A7KV33	Bacillus_phage	3.2e-134	41.9
WP_014479075.1\|711391_713398_+	NAD-dependent DNA ligase LigA	A0A0K2QQN8	Ralstonia_phage	3.1e-128	40.3
WP_014479076.1\|713413_714604_+	CamS family sex pheromone protein	NA	NA	NA	NA
WP_087614160.1\|714720_715870_+\|transposase	IS3 family transposase	A0A0N9SIX5	Staphylococcus_phage	1.7e-38	61.2
WP_072592588.1\|716056_717067_+	phosphotransferase enzyme family protein	NA	NA	NA	NA
WP_010886431.1\|717104_717803_-	MgtC/SapB family protein	G3MA03	Bacillus_virus	2.7e-18	37.9
WP_003242814.1\|717908_719387_-	proline transporter OpuE	NA	NA	NA	NA
WP_003219442.1\|719800_720091_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC	NA	NA	NA	NA
WP_014479078.1\|720106_721564_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA	NA	NA	NA	NA
WP_003219444.1\|721577_723008_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB	NA	NA	NA	NA
WP_014479079.1\|723044_723893_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_014479080.1\|724024_727183_+	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	5.0e-64	23.5
WP_003233894.1\|727333_728245_+	diacylglycerol kinase	A0A1V0SBJ0	Catovirus	1.2e-21	29.7
WP_031600241.1\|728554_729931_+	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	3.6e-115	46.6
WP_014479083.1\|731252_731462_-	hypothetical protein	NA	NA	NA	NA
WP_029317421.1\|731695_734713_+	SIR2 family protein	NA	NA	NA	NA
WP_014479085.1\|735141_735339_-	hypothetical protein	NA	NA	NA	NA
WP_014479086.1\|735937_736411_-	TIGR01741 family protein	NA	NA	NA	NA
WP_031600245.1\|736415_738425_-	ribonuclease YeeF family protein	A0A1P8CWI7	Bacillus_phage	3.7e-145	57.4
WP_014479091.1\|739801_740932_+	response regulator aspartate phosphatase RapH	A0A1P8CWN8	Bacillus_phage	9.8e-87	45.9
WP_003242557.1\|740921_741095_+	phosphatase RapH inhibitor PhrH	NA	NA	NA	NA
WP_003233863.1\|741254_741974_+	YebC/PmpR family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_049832634.1\|742107_742725_+\|coat	spore coat protein	NA	NA	NA	NA
WP_014479093.1\|742839_743424_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_014479094.1\|743600_743849_+\|coat	spore coat associated protein CotJA	NA	NA	NA	NA
WP_014479095.1\|743832_744096_+\|coat	spore coat protein CotJB	NA	NA	NA	NA
WP_014479096.1\|744110_744680_+\|coat	spore coat protein CotJC	NA	NA	NA	NA

DBSCAN-SWA_2

1195096 : 1243882

Planktothrix_phage(22.22%)

transposase,coat,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_087614160.1\|1195096_1196247_-\|transposase	IS3 family transposase	A0A0N9SIX5	Staphylococcus_phage	1.7e-38	61.2
WP_003245356.1\|1196424_1196604_+	YjzC family protein	NA	NA	NA	NA
WP_003245236.1\|1196649_1196835_-	DUF2929 domain-containing protein	NA	NA	NA	NA
WP_014479433.1\|1197083_1197818_+	hypothetical protein	NA	NA	NA	NA
WP_014479435.1\|1197899_1198457_+	hypothetical protein	NA	NA	NA	NA
WP_014479436.1\|1198547_1199501_+	transcriptional regulator Med	NA	NA	NA	NA
WP_003224559.1\|1199515_1199707_+	ComG operon repressor	NA	NA	NA	NA
WP_031600361.1\|1199736_1199964_-	hypothetical protein	NA	NA	NA	NA
WP_003232971.1\|1200128_1201067_+	beta-ketoacyl-ACP synthase III	NA	NA	NA	NA
WP_014479438.1\|1201089_1202331_+	beta-ketoacyl-ACP synthase II	NA	NA	NA	NA
WP_014479439.1\|1202406_1203192_+	DUF2268 domain-containing protein	NA	NA	NA	NA
WP_003232965.1\|1203383_1204370_+	oligopeptide ABC transporter ATP-binding protein AppD	G9BWD6	Planktothrix_phage	5.7e-22	32.9
WP_003232964.1\|1204366_1205356_+	oligopeptide ABC transporter ATP-binding protein AppF	F2Y302	Organic_Lake_phycodnavirus	6.7e-07	26.1
WP_014479440.1\|1205443_1207075_+	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003245828.1\|1207150_1208101_+	oligopeptide ABC transporter permease AppB	NA	NA	NA	NA
WP_014479441.1\|1208117_1209029_+	oligopeptide ABC transporter permease AppC	NA	NA	NA	NA
WP_003239298.1\|1209234_1209987_+	YjbA family protein	A0A0A0RP53	Bacillus_phage	5.4e-49	43.9
WP_003245134.1\|1210021_1211014_-\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_014479443.1\|1211757_1213395_+	oligopeptide ABC transporter substrate-binding protein OppA	NA	NA	NA	NA
WP_014479444.1\|1213502_1214438_+	oligopeptide ABC transporter permease OppB	NA	NA	NA	NA
WP_003232954.1\|1214441_1215359_+	oligopeptide ABC transporter permease OppC	NA	NA	NA	NA
WP_072173823.1\|1215363_1216440_+	oligopeptide ABC transporter ATP-binding protein OppD	G9BWD6	Planktothrix_phage	2.1e-17	30.8
WP_003245567.1\|1216441_1217359_+	oligopeptide ABC transporter ATP-binding protein OppF	M1HP82	Acanthocystis_turfacea_Chlorella_virus	1.2e-05	24.6
WP_072592593.1\|1217466_1218684_+	MFS transporter	NA	NA	NA	NA
WP_003224597.1\|1218847_1219426_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_014476435.1\|1219606_1220002_+	transcriptional regulator Spx	NA	NA	NA	NA
WP_014479447.1\|1220044_1220701_-	TerC family protein	A0A2R2YAT9	Pseudomonas_phage	1.1e-29	38.0
WP_119122854.1\|1220870_1221011_+	hypothetical protein	NA	NA	NA	NA
WP_014479448.1\|1220977_1221634_+	adaptor protein MecA	NA	NA	NA	NA
WP_003245684.1\|1221628_1221751_-	hypothetical protein	NA	NA	NA	NA
WP_014479449.1\|1221794_1222946_+	competence protein CoiA	NA	NA	NA	NA
WP_173401378.1\|1223175_1225005_+	oligoendopeptidase F	NA	NA	NA	NA
WP_003244944.1\|1225042_1225210_-	hypothetical protein	NA	NA	NA	NA
WP_003245184.1\|1225524_1226424_-	adaptor protein SpxH	NA	NA	NA	NA
WP_003232928.1\|1226420_1226819_-	group 2 truncated hemoglobin YjbI	NA	NA	NA	NA
WP_072592594.1\|1227073_1227619_-	bifunctional muramidase/murein lytic transglycosylase	A0A1P8CWQ1	Bacillus_phage	5.1e-41	73.7
WP_014479452.1\|1227822_1228395_-	CYTH domain-containing protein	NA	NA	NA	NA
WP_014479453.1\|1228519_1228888_+	hypothetical protein	NA	NA	NA	NA
WP_003245294.1\|1228916_1229552_+	GTP diphosphokinase	NA	NA	NA	NA
WP_003232918.1\|1229570_1230371_+	NAD kinase	NA	NA	NA	NA
WP_014479454.1\|1230385_1231285_+	RluA family pseudouridine synthase	NA	NA	NA	NA
WP_003232912.1\|1231297_1232032_-	bis(5'-nucleosyl)-tetraphosphatase PrpE	A8E2N0	Enterococcus_phage	7.2e-06	24.8
WP_014479455.1\|1232266_1234111_+	monovalent cation:proton antiporter family protein	NA	NA	NA	NA
WP_014479456.1\|1234359_1235070_+	thiaminase II	NA	NA	NA	NA
WP_014479457.1\|1235044_1235662_+	thiazole tautomerase TenI	NA	NA	NA	NA
WP_014479458.1\|1235645_1236755_+	glycine oxidase ThiO	NA	NA	NA	NA
WP_072592596.1\|1236754_1236955_+	sulfur carrier protein ThiS	NA	NA	NA	NA
WP_072592522.1\|1236951_1237722_+	thiazole synthase	NA	NA	NA	NA
WP_014479461.1\|1237718_1238729_+	thiazole biosynthesis adenylyltransferase ThiF	NA	NA	NA	NA
WP_014479462.1\|1238747_1239563_+	bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase	NA	NA	NA	NA
WP_003232896.1\|1239698_1240475_+	enoyl-ACP reductase FabI	NA	NA	NA	NA
WP_031600370.1\|1240575_1241259_+\|coat	spore coat protein CotO	NA	NA	NA	NA
WP_014479464.1\|1241351_1241801_-\|coat	spore coat protein CotZ	NA	NA	NA	NA
WP_014479465.1\|1241928_1242417_-\|coat	spore coat protein CotY	NA	NA	NA	NA
WP_014479466.1\|1242568_1243051_-\|coat	spore coat protein	NA	NA	NA	NA
WP_014479467.1\|1243135_1243456_-	hypothetical protein	NA	NA	NA	NA
WP_014479468.1\|1243495_1243882_-\|coat	spore coat protein	NA	NA	NA	NA

DBSCAN-SWA_3

1326821 : 1361701

uncultured_Caudovirales_phage(32.35%)

transposase,plate,tail,holin,terminase,portal

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_087614160.1\|1326821_1327972_-\|transposase	IS3 family transposase	A0A0N9SIX5	Staphylococcus_phage	1.7e-38	61.2
WP_015252291.1\|1328384_1329521_+	response regulator aspartate phosphatase RapA	A0A1P8CWN8	Bacillus_phage	4.9e-94	47.4
WP_003245487.1\|1329510_1329645_+	phosphatase RapA inhibitor PhrA	NA	NA	NA	NA
WP_014479545.1\|1330042_1330996_+	N-acetylmuramoyl-L-alanine amidase	A0A218KC88	Bacillus_phage	1.6e-66	73.8
WP_014479546.1\|1331035_1331413_-	PH domain-containing protein	A5GYQ0	Lactococcus_phage	7.9e-17	42.3
WP_014479547.1\|1331517_1332120_+	poly-gamma-glutamate hydrolase family protein	F8WQ53	Bacillus_phage	1.4e-44	48.7
WP_003245071.1\|1332196_1333033_+	manganese catalase family protein	NA	NA	NA	NA
WP_003232721.1\|1333076_1333673_-	ImmA/IrrE family metallo-endopeptidase	A0A2H4JA43	uncultured_Caudovirales_phage	8.1e-40	51.7
WP_003232719.1\|1333835_1334177_-	helix-turn-helix transcriptional regulator	A0A2H4J6F9	uncultured_Caudovirales_phage	1.3e-18	45.8
WP_003232712.1\|1334355_1334535_+	hypothetical protein	NA	NA	NA	NA
WP_003232710.1\|1334521_1335358_+	hypothetical protein	S6BFM4	Thermus_phage	6.7e-24	27.8
WP_072592528.1\|1335257_1336058_+	ATP-binding protein	A6XMI1	Bacillus_virus	1.1e-60	51.7
WP_003245588.1\|1336057_1336225_+	hypothetical protein	NA	NA	NA	NA
WP_014479549.1\|1336309_1336660_+	phage-like element PBSX protein XkdD	NA	NA	NA	NA
WP_014476537.1\|1336656_1336863_+	phage-like element PBSX protein XtrA	A0A2H4J4M6	uncultured_Caudovirales_phage	2.1e-11	50.0
WP_014479550.1\|1336978_1337488_+	sigma-70 family RNA polymerase sigma factor	A0A1L2JY33	Aeribacillus_phage	6.5e-22	39.2
WP_003244697.1\|1337603_1338401_+\|terminase	terminase small subunit	A0A0S2MVB6	Bacillus_phage	8.0e-59	50.2
WP_003232697.1\|1338397_1339699_+\|terminase	PBSX family phage terminase large subunit	A0A2P1JTW5	Anoxybacillus_phage	9.1e-153	60.0
WP_003232695.1\|1339702_1341190_+\|portal	phage portal protein	A0A1B1P7C8	Bacillus_phage	1.7e-139	55.7
WP_014479551.1\|1341209_1342037_+	hypothetical protein	A0A1B1P7E4	Bacillus_phage	1.6e-54	59.2
WP_003232690.1\|1342062_1342998_+	phage-like element PBSX protein XkdG	A0A1B1P7E3	Bacillus_phage	1.1e-104	63.8
WP_014479552.1\|1343019_1343403_+	DUF3199 family protein	A0A1B1P7D6	Bacillus_phage	1.4e-13	40.5
WP_009967053.1\|1343399_1343756_+	YqbH/XkdH family protein	NA	NA	NA	NA
WP_003245226.1\|1343752_1344238_+	HK97 gp10 family phage protein	A0A249XXA4	Clostridium_phage	2.1e-38	47.0
WP_014479553.1\|1344250_1344691_+	hypothetical protein	NA	NA	NA	NA
WP_003232679.1\|1344694_1344913_+	hypothetical protein	NA	NA	NA	NA
WP_014479554.1\|1344909_1346310_+\|tail	phage tail sheath subtilisin-like domain-containing protein	A0A0A7S087	Clostridium_phage	3.0e-77	39.3
WP_014479555.1\|1346311_1346755_+\|tail	phage tail tube protein	A0A0K2CNG3	Brevibacillus_phage	1.9e-25	44.5
WP_014479556.1\|1346846_1347293_+	hypothetical protein	A0A0A7RTY8	Clostridium_phage	1.0e-10	36.8
WP_014479557.1\|1347334_1347475_+	hypothetical protein	NA	NA	NA	NA
WP_031600410.1\|1347475_1352479_+	transglycosylase SLT domain-containing protein	A0A2H4JA91	uncultured_Caudovirales_phage	6.4e-37	44.8
WP_014479559.1\|1352471_1353131_+	LysM peptidoglycan-binding domain-containing protein	A0A0A8WJR4	Clostridium_phage	1.1e-24	33.2
WP_003245730.1\|1353146_1354124_+	phage-like element PBSX protein XkdQ	H7BV96	unidentified_phage	1.0e-39	32.6
WP_003244812.1\|1354123_1354390_+	DUF2577 family protein	S6C459	Thermus_phage	1.7e-05	36.4
WP_014479560.1\|1354447_1354873_+	DUF2634 domain-containing protein	A0A2H4J6K5	uncultured_Caudovirales_phage	3.0e-12	38.0
WP_003232669.1\|1354865_1355912_+\|plate	baseplate J/gp47 family protein	S6AVU3	Thermus_phage	1.3e-72	44.3
WP_014476551.1\|1355895_1356474_+	YmfQ family protein	A0A2H4J717	uncultured_Caudovirales_phage	3.9e-15	34.2
WP_003232665.1\|1356470_1356743_+	hypothetical protein	NA	NA	NA	NA
WP_014479561.1\|1356745_1358809_+	hypothetical protein	A0A2H4J4R1	uncultured_Caudovirales_phage	2.6e-29	34.5
WP_014479562.1\|1358820_1359150_+	hypothetical protein	A0A2H4JCI0	uncultured_Caudovirales_phage	1.3e-15	40.7
WP_014479563.1\|1359146_1359311_+	XkdX family protein	A0A2H4JAA1	uncultured_Caudovirales_phage	1.9e-15	67.9
WP_014479564.1\|1359357_1360197_+	phage-like element PBSX protein XepA	NA	NA	NA	NA
WP_014479565.1\|1360249_1360519_+	hemolysin XhlA family protein	A0A2H4JD40	uncultured_Caudovirales_phage	1.4e-23	64.8
WP_014479566.1\|1360531_1360795_+\|holin	phage holin	A0A2H4J6M0	uncultured_Caudovirales_phage	6.1e-24	64.4
WP_014479567.1\|1360807_1361701_+	N-acetylmuramoyl-L-alanine amidase	Q9ZXD7	Bacillus_phage	5.2e-83	69.2

DBSCAN-SWA_4

1798086 : 1897721

111

Bacillus_phage(56.36%)

transposase,head,plate,protease,capsid,tail,holin,coat,terminase,portal,tRNA,integrase

attL 1800050:1800109|attR 1864828:1864993

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017697674.1\|1798086_1798620_+\|terminase	phage terminase small subunit P27 family	Q9ZXG2	Bacillus_phage	1.0e-70	82.5
WP_031600532.1\|1798619_1798787_+	hypothetical protein	D6R3Y4	Bacillus_phage	4.4e-12	87.5
WP_031600391.1\|1798907_1800119_-\|transposase	IS256 family transposase	A0A220NQR7	Corynebacterium_phage	2.2e-23	26.8
1800050:1800109	attL	NA	NA	NA	NA
WP_072592534.1\|1801165_1801621_-	hypothetical protein	NA	NA	NA	NA
WP_014479830.1\|1801775_1802333_-	hypothetical protein	NA	NA	NA	NA
WP_014479831.1\|1802453_1803068_+	TetR family transcriptional regulator	NA	NA	NA	NA
WP_003231786.1\|1803206_1803563_-	hypothetical protein	NA	NA	NA	NA
WP_072592535.1\|1803641_1804466_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_033881122.1\|1804576_1805905_-\|protease	serine protease AprX	A0A1B0T6A2	Bacillus_phage	1.2e-27	33.6
WP_014476869.1\|1806129_1806363_+	hypothetical protein	NA	NA	NA	NA
WP_014479835.1\|1806642_1807350_+	poly-gamma-glutamate hydrolase family protein	F8WQ53	Bacillus_phage	3.2e-51	56.9
WP_014479836.1\|1807419_1807872_+	OsmC family protein	NA	NA	NA	NA
WP_014479837.1\|1807885_1808239_-	multidrug efflux SMR transporter subunit EbrB	NA	NA	NA	NA
WP_009967307.1\|1808252_1808570_-	multidrug efflux SMR transporter subunit EbrA	NA	NA	NA	NA
WP_014479838.1\|1808704_1808983_-	hypothetical protein	NA	NA	NA	NA
WP_072592536.1\|1809071_1809485_+	hypothetical protein	NA	NA	NA	NA
WP_014479840.1\|1809584_1810529_+\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
WP_003221097.1\|1810568_1810790_+	RNA chaperone Hfq	NA	NA	NA	NA
WP_014479841.1\|1810984_1811257_+	hypothetical protein	NA	NA	NA	NA
WP_003245262.1\|1811338_1811569_+	hypothetical protein	NA	NA	NA	NA
WP_003231758.1\|1811811_1812204_+	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	G3MBF1	Bacillus_virus	2.5e-29	58.3
WP_014479842.1\|1812163_1814266_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	U5PY35	Bacillus_phage	0.0e+00	86.8
WP_003231754.1\|1814283_1815273_+	class 1b ribonucleoside-diphosphate reductase subunit beta	F8WQ21	Bacillus_phage	1.9e-155	83.5
WP_003245105.1\|1815322_1815943_+	hypothetical protein	A0A127AYS1	Bacillus_phage	1.6e-46	48.4
WP_014479843.1\|1816006_1816774_-	sporulation-specific N-acetylmuramoyl-L-alanine amidase	E5DV68	Deep-sea_thermophilic_phage	1.2e-51	49.5
WP_003231746.1\|1817414_1818383_+	stage V sporulation protein K	G3MAX6	Bacillus_virus	5.2e-52	40.5
WP_015483254.1\|1818515_1819778_+	GTPase HflX	NA	NA	NA	NA
WP_014479845.1\|1819795_1821061_+	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_003238341.1\|1821170_1821578_+	transcriptional repressor GlnR	NA	NA	NA	NA
WP_031600540.1\|1821636_1822971_+	type I glutamate--ammonia ligase	NA	NA	NA	NA
WP_033881119.1\|1823083_1824238_-\|integrase	site-specific integrase	A0A0M5M609	Bacillus_phage	8.3e-65	38.9
WP_105778744.1\|1824256_1825312_-	ImmA/IrrE family metallo-endopeptidase	A0A0F6N3H6	Staphylococcus_phage	1.7e-08	24.2
WP_014479849.1\|1825295_1825682_-	helix-turn-helix transcriptional regulator	R9W020	Paenibacillus_phage	9.0e-08	31.4
WP_033881118.1\|1825806_1826025_+	helix-turn-helix transcriptional regulator	A0A0K2CZL1	Paenibacillus_phage	2.1e-17	63.2
WP_014479850.1\|1826139_1826904_+	phage antirepressor KilAC domain-containing protein	A8ATN0	Listeria_phage	1.0e-47	49.1
WP_014479851.1\|1826919_1827231_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_105778750.1\|1827291_1827483_+	hypothetical protein	Q9ZXD0	Bacillus_phage	7.1e-06	53.1
WP_014479853.1\|1827479_1827755_+	hypothetical protein	Q9ZXC9	Bacillus_phage	1.2e-19	47.1
WP_014479855.1\|1827950_1828505_+	host-nuclease inhibitor Gam family protein	Q9ZXC8	Bacillus_phage	3.1e-94	96.2
WP_014479856.1\|1828508_1829444_+	AAA family ATPase	Q9ZXC7	Bacillus_phage	2.0e-170	96.5
WP_014479857.1\|1829433_1829748_+	hypothetical protein	Q9ZXC6	Bacillus_phage	1.5e-53	99.0
WP_014479858.1\|1829768_1830206_+	DUF669 domain-containing protein	Q9ZXC5	Bacillus_phage	1.3e-79	97.2
WP_014479859.1\|1830266_1832684_+	hypothetical protein	D6R422	Bacillus_phage	0.0e+00	88.7
WP_014479860.1\|1832883_1833321_+	hypothetical protein	Q9ZXC3	Bacillus_phage	4.8e-74	91.7
WP_014479861.1\|1833317_1833857_+	ERCC4 domain-containing protein	Q9ZXC2	Bacillus_phage	1.8e-94	96.1
WP_014479862.1\|1833891_1834407_+	hypothetical protein	D6R425	Bacillus_phage	8.7e-91	93.0
WP_046159992.1\|1834660_1835074_+	ArpU family transcriptional regulator	D6R428	Bacillus_phage	2.1e-63	97.0
WP_033881110.1\|1835445_1835829_+	hypothetical protein	A0A075M5R4	Enterococcus_phage	1.2e-17	43.3
WP_033881107.1\|1835831_1836038_+	hypothetical protein	NA	NA	NA	NA
WP_014479865.1\|1836276_1836762_+\|terminase	phage terminase small subunit P27 family	A0A1Q1PVW3	Staphylococcus_phage	4.2e-18	36.0
WP_014479866.1\|1836751_1838485_+\|terminase	terminase large subunit	A0A2H4JCI4	uncultured_Caudovirales_phage	2.1e-144	48.9
WP_014479867.1\|1838501_1838708_+	hypothetical protein	NA	NA	NA	NA
WP_014479868.1\|1838712_1839939_+\|portal	phage portal protein	A0A1J0MFU3	Staphylococcus_phage	2.4e-70	39.4
WP_014479869.1\|1839931_1840528_+\|head,protease	HK97 family phage prohead protease	A0A1J0MFL1	Staphylococcus_phage	3.3e-49	53.8
WP_014479870.1\|1840575_1841784_+\|capsid	phage major capsid protein	A0A2H4J824	uncultured_Caudovirales_phage	4.9e-76	49.8
WP_014479871.1\|1841811_1842195_+	collagen-like protein	D6R3Z0	Bacillus_phage	1.4e-05	56.8
WP_014479872.1\|1842249_1842543_+\|head,tail	phage gp6-like head-tail connector protein	A0A2H4JB77	uncultured_Caudovirales_phage	2.6e-07	33.0
WP_014479873.1\|1842532_1842859_+\|head	phage head closure protein	NA	NA	NA	NA
WP_031600548.1\|1842858_1843251_+	HK97 gp10 family phage protein	A0A0M5M1E5	Enterococcus_phage	3.0e-11	37.9
WP_014479875.1\|1843247_1843655_+	hypothetical protein	NA	NA	NA	NA
WP_014479876.1\|1843660_1844245_+	hypothetical protein	U5U3Z7	Lactobacillus_phage	9.1e-28	36.5
WP_014479877.1\|1844304_1844667_+	hypothetical protein	NA	NA	NA	NA
WP_014479878.1\|1844678_1844861_+	hypothetical protein	NA	NA	NA	NA
WP_014479879.1\|1844923_1848664_+\|tail	phage tail tape measure protein	A0A0S2SXL7	Bacillus_phage	9.1e-105	60.4
WP_014479880.1\|1848676_1849510_+\|tail	phage tail family protein	M4ZS20	Bacillus_phage	3.5e-33	34.1
WP_033881098.1\|1849523_1851398_+\|tail	phage tail protein	D6R400	Bacillus_phage	5.5e-50	27.8
WP_031600552.1\|1853022_1854144_+\|plate	BppU family phage baseplate upper protein	M4ZRP1	Bacillus_phage	9.8e-196	92.5
WP_031600553.1\|1854159_1854459_+	hypothetical protein	M4ZR44	Bacillus_phage	2.0e-39	79.2
WP_031600554.1\|1854455_1854626_+	XkdX family protein	NA	NA	NA	NA
WP_031600555.1\|1854677_1854890_+	hypothetical protein	A0A290GDY2	Caldibacillus_phage	1.9e-15	59.4
WP_031600556.1\|1854904_1855168_+\|holin	phage holin	A0A2H4J6M0	uncultured_Caudovirales_phage	2.7e-24	66.7
WP_031600557.1\|1855223_1856201_+	N-acetylmuramoyl-L-alanine amidase	A0A218KC88	Bacillus_phage	2.0e-64	71.4
WP_031600558.1\|1856246_1856711_-	SMI1/KNR4 family protein	NA	NA	NA	NA
WP_033881288.1\|1856729_1858493_-	ribonuclease YeeF family protein	A0A1P8CWI7	Bacillus_phage	3.3e-121	52.3
WP_080283100.1\|1858662_1858734_+	hypothetical protein	NA	NA	NA	NA
WP_014479884.1\|1858749_1859835_-	DUF4917 family protein	NA	NA	NA	NA
WP_033881290.1\|1860668_1860959_+	hypothetical protein	NA	NA	NA	NA
WP_014479885.1\|1861197_1861689_+	hypothetical protein	NA	NA	NA	NA
WP_014479887.1\|1863019_1863271_+	hypothetical protein	NA	NA	NA	NA
WP_072592598.1\|1863454_1863889_+	SMI1/KNR4 family protein	NA	NA	NA	NA
WP_014479891.1\|1864931_1865690_-	ATP-binding protein	U5N3V8	Enterobacteria_phage	5.8e-43	38.6
1864828:1864993	attR	NA	NA	NA	NA
WP_014480339.1\|1865686_1867234_-\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_014479132.1\|1867396_1868551_+\|transposase	IS256 family transposase	A0A220NQR7	Corynebacterium_phage	2.4e-24	22.6
WP_033881852.1\|1868547_1869447_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_029726895.1\|1869524_1869905_+	UPF0715 family protein	NA	NA	NA	NA
WP_014479898.1\|1870446_1870677_+	helix-turn-helix transcriptional regulator	A0A1P8CWU2	Bacillus_phage	2.1e-20	75.0
WP_014479901.1\|1872188_1872353_+	hypothetical protein	NA	NA	NA	NA
WP_014479902.1\|1872492_1872963_+	hypothetical protein	NA	NA	NA	NA
WP_014479903.1\|1873759_1875151_+	MFS transporter	NA	NA	NA	NA
WP_014479904.1\|1875223_1875541_+\|transposase	transposase	NA	NA	NA	NA
WP_033880480.1\|1875537_1876452_+\|transposase	IS3 family transposase	A0A1B3AZE5	Gordonia_phage	9.0e-06	22.9
WP_014479906.1\|1876590_1878192_+	glycoside hydrolase family 43 protein	NA	NA	NA	NA
WP_014479907.1\|1878329_1879484_-	ROK family protein	NA	NA	NA	NA
WP_014479908.1\|1879721_1881059_+	xylose isomerase	NA	NA	NA	NA
WP_014479909.1\|1881209_1882709_+	xylulokinase	NA	NA	NA	NA
WP_031600262.1\|1883193_1884441_+\|transposase	IS256-like element ISBsu2 family transposase	A0A220NQR7	Corynebacterium_phage	2.6e-24	22.6
WP_014479910.1\|1884570_1885206_-	endonuclease YncB	A0A1P8CWK6	Bacillus_phage	7.7e-73	68.5
WP_033881939.1\|1885618_1887034_+	sugar porter family MFS transporter	NA	NA	NA	NA
WP_031600564.1\|1887135_1888320_-	alanine racemase	NA	NA	NA	NA
WP_014479913.1\|1888730_1889156_-	hypothetical protein	NA	NA	NA	NA
WP_014479915.1\|1890074_1890509_+	dUTP diphosphatase	A0A1P8CX51	Bacillus_phage	5.8e-72	92.3
WP_033881937.1\|1891109_1891373_-\|coat	spore coat protein CotU	NA	NA	NA	NA
WP_003231643.1\|1891779_1891944_+	hypothetical protein	NA	NA	NA	NA
WP_014479918.1\|1892218_1893058_+	thymidylate synthase	A0A1P8CX42	Bacillus_phage	5.6e-164	98.2
WP_121509411.1\|1893180_1893468_-	hypothetical protein	NA	NA	NA	NA
WP_014479919.1\|1893510_1894230_-	hypothetical protein	NA	NA	NA	NA
WP_014479920.1\|1894389_1894746_-	hypothetical protein	NA	NA	NA	NA
WP_014479921.1\|1894991_1895192_-\|coat	spore coat protein CotC	NA	NA	NA	NA
WP_003231634.1\|1895366_1895555_-	twin-arginine translocase TatAC	NA	NA	NA	NA
WP_009967329.1\|1895808_1896207_+	hypothetical protein	NA	NA	NA	NA
WP_014478984.1\|1896368_1897721_+\|transposase	IS1182 family transposase	A0A1X9I5T2	Streptococcus_phage	1.4e-87	41.8

DBSCAN-SWA_5

1990777 : 2001467

Bacillus_phage(75.0%)

transposase,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_031600262.1\|1990777_1992025_+\|transposase	IS256-like element ISBsu2 family transposase	A0A220NQR7	Corynebacterium_phage	2.6e-24	22.6
WP_033881859.1\|1994231_1994591_-	hypothetical protein	A0A1P8CWJ9	Bacillus_phage	2.2e-61	98.3
WP_072592542.1\|1994850_1994934_+\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_014479996.1\|1995222_1995756_-	GNAT family N-acetyltransferase	O64026	Bacillus_phage	2.9e-97	97.2
WP_014479997.1\|1995815_1996370_-	SMI1/KNR4 family protein	O64025	Bacillus_phage	4.3e-96	91.3
WP_014479998.1\|1996425_1996884_-	SMI1/KNR4 family protein	A0A1P8CWJ1	Bacillus_phage	2.8e-72	85.5
WP_003231326.1\|1996976_1997435_-	type II toxin-antitoxin system antitoxin YobK	NA	NA	NA	NA
WP_014479999.1\|1997444_1999247_-	type II toxin-antitoxin system toxin ribonuclease YobL	A0A1P8CWI7	Bacillus_phage	1.3e-218	87.0
WP_029318053.1\|1999345_1999903_-	SMI1/KNR4 family protein	O64022	Bacillus_phage	7.0e-102	95.7
WP_121509415.1\|2000030_2001467_+	flavin monoamine oxidase family protein	A0A2K9L022	Tupanvirus	2.6e-07	30.6

DBSCAN-SWA_6

2213908 : 2220003

Staphylococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014480158.1\|2213908_2214502_-	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	2.6e-14	35.4
WP_014477220.1\|2214491_2215247_-	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	5.5e-09	29.2
WP_014480159.1\|2215526_2216051_+	DUF309 domain-containing protein	NA	NA	NA	NA
WP_003223910.1\|2216064_2216439_-	GNAT family N-acetyltransferase RibT	NA	NA	NA	NA
WP_003223915.1\|2216551_2217016_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	5.5e-44	60.0
WP_014480160.1\|2217048_2218245_-	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	4.1e-115	54.9
WP_014480161.1\|2218259_2218907_-	riboflavin synthase subunit alpha	A0A2H4PQS5	Staphylococcus_phage	8.5e-43	45.9
WP_014480162.1\|2218917_2220003_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	6.6e-56	36.1

DBSCAN-SWA_7

2591430 : 2644899

uncultured_Mediterranean_phage(12.5%)

coat,protease,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003229725.1\|2591430_2592576_-\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	3.4e-87	44.0
WP_003229723.1\|2592602_2593631_-\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
WP_003222669.1\|2593660_2593861_-	DUF2905 domain-containing protein	NA	NA	NA	NA
WP_003229718.1\|2593853_2594858_-	Holliday junction branch migration DNA helicase RuvB	B3GAM6	uncultured_virus	1.1e-07	30.8
WP_003229717.1\|2594868_2595474_-	Holliday junction branch migration protein RuvA	NA	NA	NA	NA
WP_014480438.1\|2595612_2596125_-	sporulation cell-cell signaling protein BofC	NA	NA	NA	NA
WP_014480439.1\|2596172_2597480_-	MFS transporter	NA	NA	NA	NA
WP_014480440.1\|2597550_2598576_-	inositol 2-dehydrogenase	NA	NA	NA	NA
WP_014480441.1\|2598813_2599461_+	hypothetical protein	A0A2R3ZQF2	Marseillevirus	9.2e-05	26.3
WP_003229707.1\|2599506_2599629_-	hypothetical protein	NA	NA	NA	NA
WP_031600754.1\|2599734_2600160_+	hypothetical protein	NA	NA	NA	NA
WP_004398683.1\|2600166_2600307_+	hypothetical protein	NA	NA	NA	NA
WP_014480443.1\|2600470_2601925_+	alanine:cation symporter family protein	NA	NA	NA	NA
WP_033881612.1\|2601965_2602688_-	YebC/PmpR family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_014480445.1\|2602790_2603387_-	spore germination protein SgpA	NA	NA	NA	NA
WP_014480446.1\|2603534_2604698_-\|coat	spore coat assembly protein SafA	NA	NA	NA	NA
WP_014480447.1\|2604814_2605921_-	quinolinate synthase NadA	NA	NA	NA	NA
WP_014480448.1\|2605907_2606777_-	carboxylating nicotinate-nucleotide diphosphorylase	NA	NA	NA	NA
WP_014480449.1\|2606730_2608326_-	L-aspartate oxidase	NA	NA	NA	NA
WP_033881608.1\|2608428_2609616_+	cysteine desulfurase NifS	A0A141ZJV0	Faustovirus	1.7e-33	27.4
WP_004398582.1\|2609575_2610118_+	transcription repressor NadR	NA	NA	NA	NA
WP_004398512.1\|2610142_2611000_-	prephenate dehydratase	NA	NA	NA	NA
WP_003222630.1\|2611016_2611460_-	transcriptional regulator ThrR	NA	NA	NA	NA
WP_003246161.1\|2611520_2612807_-	GTPase ObgE	NA	NA	NA	NA
WP_014480451.1\|2612840_2613419_-	sporulation initiation phosphotransferase Sop0B	NA	NA	NA	NA
WP_003229671.1\|2613496_2613619_+	hypothetical protein	NA	NA	NA	NA
WP_003222623.1\|2613739_2614024_-	50S ribosomal protein L27	NA	NA	NA	NA
WP_003229669.1\|2614036_2614375_-\|protease	ribosomal-processing cysteine protease Prp	NA	NA	NA	NA
WP_003229668.1\|2614377_2614686_-	50S ribosomal protein L21	NA	NA	NA	NA
WP_014480452.1\|2614832_2615699_-	stage IV sporulation protein SpoIVFB	NA	NA	NA	NA
WP_014480453.1\|2615691_2616486_-	stage IV sporulation protein SpoIVFA	NA	NA	NA	NA
WP_014480454.1\|2616635_2617442_-	septum site-determining protein MinD	NA	NA	NA	NA
WP_004398901.1\|2617443_2618124_-	septum site-determining protein MinC	NA	NA	NA	NA
WP_004398811.1\|2618176_2618695_-	rod shape-determining protein MreD	NA	NA	NA	NA
WP_003222609.1\|2618691_2619564_-	rod shape-determining protein MreC	NA	NA	NA	NA
WP_003229650.1\|2619594_2620608_-	rod shape-determining protein MreB	NA	NA	NA	NA
WP_014480455.1\|2620699_2621395_-	DNA repair protein RadC	NA	NA	NA	NA
WP_014480456.1\|2621431_2622001_-	septum formation protein Maf	NA	NA	NA	NA
WP_014480457.1\|2622153_2623152_-	stage II sporulation protein SpoIIB	NA	NA	NA	NA
WP_072592551.1\|2623285_2624032_-	prepilin peptidase	NA	NA	NA	NA
WP_014480460.1\|2624171_2625464_-	bifunctional folylpolyglutamate synthase/dihydrofolate synthase	NA	NA	NA	NA
WP_014480461.1\|2625523_2628166_-\|tRNA	valine--tRNA ligase	A0A1V0S951	Catovirus	3.7e-161	42.6
WP_003222590.1\|2628613_2628805_+	hypothetical protein	NA	NA	NA	NA
WP_014480462.1\|2628823_2629849_-\|coat	spore coat protein CotN	NA	NA	NA	NA
WP_014480463.1\|2629881_2631603_-\|coat	spore coat morphogenetic protein SpoVID	NA	NA	NA	NA
WP_014480464.1\|2631733_2633026_-	glutamate-1-semialdehyde 2,1-aminomutase	NA	NA	NA	NA
WP_014480465.1\|2633055_2634030_-	porphobilinogen synthase	NA	NA	NA	NA
WP_014480466.1\|2634026_2634815_-	uroporphyrinogen-III synthase	NA	NA	NA	NA
WP_014480467.1\|2634804_2635749_-	hydroxymethylbilane synthase	NA	NA	NA	NA
WP_003222575.1\|2635781_2636612_-	cytochrome c biogenesis protein CcsA	NA	NA	NA	NA
WP_004399038.1\|2636619_2637987_-\|tRNA	glutamyl-tRNA reductase	NA	NA	NA	NA
WP_014477563.1\|2638216_2638714_+	hypothetical protein	NA	NA	NA	NA
WP_003229621.1\|2638735_2639323_-	YihA family ribosome biogenesis GTP-binding protein	NA	NA	NA	NA
WP_014480468.1\|2639319_2641644_-	endopeptidase La	A0A0R6PGP8	Moraxella_phage	2.6e-182	43.7
WP_004398923.1\|2641824_2643483_-\|protease	ATP-dependent protease LonB	A0A1V0SHJ7	Hokovirus	8.1e-05	33.7
WP_003229613.1\|2643636_2644899_-\|protease	ATP-dependent protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	1.3e-148	64.9

DBSCAN-SWA_8

3242897 : 3298719

Bacillus_phage(67.44%)

head,plate,protease,capsid,tail,portal,terminase,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014480874.1\|3242897_3244481_+	hypothetical protein	A0A1P8CWI7	Bacillus_phage	4.2e-75	59.7
WP_014480875.1\|3244495_3244885_+	hypothetical protein	NA	NA	NA	NA
WP_105778748.1\|3245227_3245830_+	hypothetical protein	NA	NA	NA	NA
WP_014480877.1\|3245869_3246811_-	N-acetylmuramoyl-L-alanine amidase	Q9ZXD7	Bacillus_phage	3.0e-97	77.1
WP_014480878.1\|3246852_3247275_-\|holin	holin family protein	D6R405	Bacillus_phage	3.0e-57	85.7
WP_014480879.1\|3247328_3247499_-	XkdX family protein	NA	NA	NA	NA
WP_031600923.1\|3247495_3247795_-	hypothetical protein	M4ZR44	Bacillus_phage	1.5e-39	79.2
WP_031600924.1\|3247810_3249034_-\|plate	BppU family phage baseplate upper protein	M4ZRP1	Bacillus_phage	6.5e-177	79.9
WP_072592555.1\|3249070_3250645_-	hypothetical protein	M4ZSB3	Bacillus_phage	1.1e-264	88.7
WP_031600926.1\|3250681_3252388_-\|tail	phage tail protein	D6R400	Bacillus_phage	9.4e-267	81.8
WP_031600927.1\|3252399_3253239_-\|tail	phage tail family protein	D6R3Z9	Bacillus_phage	8.5e-136	83.2
WP_033882059.1\|3253238_3257117_-\|tail	phage tail tape measure protein	D6R3Z8	Bacillus_phage	0.0e+00	81.0
WP_017696308.1\|3257129_3257309_-	hypothetical protein	D6R3Z7	Bacillus_phage	1.6e-12	68.5
WP_003220222.1\|3257311_3257650_-	hypothetical protein	Q9ZXE8	Bacillus_phage	3.0e-39	70.5
WP_017696306.1\|3257704_3258316_-\|tail	major tail protein	Q9ZXE9	Bacillus_phage	7.9e-99	89.7
WP_031600930.1\|3258316_3258697_-	DUF3168 domain-containing protein	Q9ZXF0	Bacillus_phage	2.6e-39	66.1
WP_033882058.1\|3258693_3259077_-	HK97 gp10 family phage protein	Q9ZXF1	Bacillus_phage	2.9e-59	86.6
WP_033882056.1\|3259069_3259441_-\|head	phage head closure protein	Q9ZXF2	Bacillus_phage	3.5e-41	68.3
WP_031600933.1\|3259373_3259721_-\|head,tail	phage gp6-like head-tail connector protein	Q9ZXF3	Bacillus_phage	2.0e-51	87.0
WP_031600934.1\|3259736_3260228_-	collagen-like protein	D6R3Z0	Bacillus_phage	1.3e-27	69.1
WP_031600935.1\|3260256_3260571_-	hypothetical protein	Q9ZXF5	Bacillus_phage	6.8e-30	68.8
WP_033882054.1\|3260586_3261789_-\|capsid	phage major capsid protein	Q9ZXF6	Bacillus_phage	3.3e-157	71.5
WP_003220242.1\|3261825_3262452_-\|head,protease	HK97 family phage prohead protease	Q9ZXF7	Bacillus_phage	1.8e-106	92.8
WP_033882052.1\|3262441_3263689_-\|portal	phage portal protein	D6R3Y6	Bacillus_phage	1.3e-217	86.5
WP_033882051.1\|3263694_3263910_-	hypothetical protein	Q9ZXF9	Bacillus_phage	1.3e-24	80.6
WP_031600939.1\|3263922_3265632_-\|terminase	terminase large subunit	D6R3Y4	Bacillus_phage	0.0e+00	92.3
WP_017697674.1\|3265631_3266165_-\|terminase	phage terminase small subunit P27 family	Q9ZXG2	Bacillus_phage	1.0e-70	82.5
WP_046160532.1\|3266544_3266919_-	HNH endonuclease	Q38456	Bacillus_phage	7.5e-60	82.3
WP_033881251.1\|3266968_3267715_-	hypothetical protein	NA	NA	NA	NA
WP_031600943.1\|3268105_3268879_-	hypothetical protein	NA	NA	NA	NA
WP_123772464.1\|3269029_3269395_-	hypothetical protein	NA	NA	NA	NA
WP_031600945.1\|3270603_3271056_-	hypothetical protein	S6AVV9	Thermus_phage	3.4e-38	56.6
WP_014480881.1\|3271309_3271510_-	hypothetical protein	NA	NA	NA	NA
WP_014480882.1\|3271506_3271926_-	hypothetical protein	A0A2I6UHP7	Bacillus_phage	1.6e-42	61.2
WP_014480883.1\|3271922_3272255_-	hypothetical protein	F8WQ59	Bacillus_phage	8.3e-18	53.3
WP_014480884.1\|3272254_3272911_-	dUTP diphosphatase	R9TQ23	Paenibacillus_phage	9.9e-39	46.0
WP_014480885.1\|3273028_3273286_-	hypothetical protein	A0A2H4JA61	uncultured_Caudovirales_phage	6.6e-07	41.7
WP_014480886.1\|3273282_3273690_-	hypothetical protein	W8CYU3	Bacillus_phage	1.3e-25	45.8
WP_014480887.1\|3273686_3274004_-	hypothetical protein	NA	NA	NA	NA
WP_014480888.1\|3274000_3274363_-	hypothetical protein	NA	NA	NA	NA
WP_003220282.1\|3274405_3274603_-	hypothetical protein	NA	NA	NA	NA
WP_014480890.1\|3274681_3274837_-	hypothetical protein	NA	NA	NA	NA
WP_003237439.1\|3274849_3274990_-	BH0509 family protein	NA	NA	NA	NA
WP_014480892.1\|3275097_3275646_-	hypothetical protein	NA	NA	NA	NA
WP_003220291.1\|3275642_3275801_-	hypothetical protein	A8ATM6	Listeria_phage	2.2e-05	57.8
WP_014480893.1\|3275797_3275947_-	hypothetical protein	NA	NA	NA	NA
WP_014480894.1\|3275960_3276788_-	ATP-binding protein	A0A0U3U1U1	Bacillus_phage	3.7e-35	35.9
WP_014480895.1\|3276771_3277653_-	phage replisome organizer N-terminal domain-containing protein	V9QKF6	Oenococcus_phage	6.8e-27	33.1
WP_033881245.1\|3277645_3277864_-	hypothetical protein	NA	NA	NA	NA
WP_033881244.1\|3277888_3278080_-	helix-turn-helix domain-containing protein	A0A1B2APY7	Phage_Wrath	1.0e-12	59.0
WP_014480896.1\|3278131_3278335_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_014480897.1\|3278569_3278968_+	helix-turn-helix transcriptional regulator	S5M5X8	Brevibacillus_phage	4.3e-05	33.7
WP_014480900.1\|3279400_3280501_-	hypothetical protein	NA	NA	NA	NA
WP_003220025.1\|3282425_3282896_-	SsrA-binding protein	W5RAM5	Staphylococcus_phage	3.2e-47	63.4
WP_003228386.1\|3283040_3285380_-	ribonuclease R	Q0GXV6	Lactococcus_phage	2.4e-87	42.9
WP_003242610.1\|3285398_3286139_-	carboxylesterase	NA	NA	NA	NA
WP_003220028.1\|3286270_3286501_-	preprotein translocase subunit SecG	NA	NA	NA	NA
WP_014480904.1\|3286649_3287423_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_003220031.1\|3287456_3287690_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_003220034.1\|3287841_3288249_+	transcriptional repressor RghR	S6C481	Thermus_phage	1.9e-16	64.8
WP_014480905.1\|3288278_3288698_+	helix-turn-helix domain-containing protein	S6C481	Thermus_phage	5.4e-14	62.7
WP_003242888.1\|3288789_3289116_+	catDE operon transcriptional regulator CatR	NA	NA	NA	NA
WP_014480906.1\|3289243_3290944_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	8.0e-24	29.8
WP_014480907.1\|3290984_3291665_-\|holin	choline ABC transporter permease OpuBD	NA	NA	NA	NA
WP_014480908.1\|3291681_3292602_-	osmoprotectant ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003228370.1\|3292613_3293267_-\|holin	choline ABC transporter permease OpuBB	NA	NA	NA	NA
WP_014480909.1\|3293283_3294429_-\|holin	betaine/proline/choline family ABC transporter ATP-binding protein	F2Y2R6	Organic_Lake_phycodnavirus	6.0e-15	32.7
WP_014480910.1\|3294712_3295246_+	GbsR/MarR family transcriptional regulator	NA	NA	NA	NA
WP_014478003.1\|3295277_3295952_-\|holin	glycine betaine/carnitine/choline/choline sulfate ABC transporter permease OpuCD	NA	NA	NA	NA
WP_031600963.1\|3295969_3296881_-	osmoprotectant ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003228349.1\|3296900_3297554_-\|holin	glycine betaine/carnitine/choline/choline sulfate ABC transporter permease OpuCB	NA	NA	NA	NA
WP_014480912.1\|3297576_3298719_-\|holin	betaine/proline/choline family ABC transporter ATP-binding protein	F2Y1V5	Organic_Lake_phycodnavirus	2.8e-12	29.6

DBSCAN-SWA_9

3373051 : 3396723

Bacillus_phage(30.43%)

plate,tail,terminase,portal,integrase

attL 3380140:3380155|attR 3398482:3398497

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_033881229.1\|3373051_3373285_-	helix-turn-helix domain-containing protein	B3RH35	Bacillus_virus	4.3e-21	62.0
WP_014480971.1\|3373563_3373842_+	hypothetical protein	NA	NA	NA	NA
WP_014480972.1\|3373854_3375039_+	DNA translocase FtsK	Q0H250	Geobacillus_phage	1.3e-108	53.4
WP_014480973.1\|3375025_3375658_+	replication-relaxation family protein	Q0H249	Geobacillus_phage	7.2e-63	57.1
WP_014480974.1\|3375699_3376002_-	hypothetical protein	NA	NA	NA	NA
WP_014480975.1\|3376123_3376381_-	hypothetical protein	A0A0U4JE55	Bacillus_phage	5.6e-22	57.6
WP_033881228.1\|3376400_3377348_-	N-acetylmuramoyl-L-alanine amidase	Q9ZXD7	Bacillus_phage	2.5e-91	62.7
WP_033881227.1\|3377420_3377624_-	hypothetical protein	A0A290GDY2	Caldibacillus_phage	1.9e-09	46.5
WP_014480977.1\|3377648_3377819_-	XkdX family protein	M4ZS22	Bacillus_phage	1.1e-10	68.1
WP_014480978.1\|3377819_3378113_-	hypothetical protein	M4ZR44	Bacillus_phage	1.6e-41	80.2
WP_031600995.1\|3378128_3379352_-\|plate	BppU family phage baseplate upper protein	M4ZRP1	Bacillus_phage	4.1e-163	74.9
WP_031600996.1\|3379388_3380966_-	hypothetical protein	M4ZSB3	Bacillus_phage	3.3e-258	86.8
3380140:3380155	attL	NA	NA	NA	NA
WP_031600997.1\|3380978_3382373_-\|tail	phage tail protein	A6M966	Geobacillus_virus	3.0e-37	30.3
WP_033880944.1\|3382387_3383806_-\|tail	phage tail family protein	A0A2H4JBY6	uncultured_Caudovirales_phage	1.3e-56	42.4
WP_080283095.1\|3383809_3386632_-\|tail	phage tail tape measure protein	A0A0N9SJR9	Paenibacillus_phage	6.7e-68	36.4
WP_033880947.1\|3386636_3386858_-	hypothetical protein	NA	NA	NA	NA
WP_033880428.1\|3386953_3387310_-	hypothetical protein	NA	NA	NA	NA
WP_033880949.1\|3387396_3387966_-	hypothetical protein	A0A0N9SHI3	Paenibacillus_phage	1.0e-52	63.0
WP_033880952.1\|3388006_3388381_-	hypothetical protein	NA	NA	NA	NA
WP_033880954.1\|3388385_3388793_-	hypothetical protein	A0A0N9SJT1	Paenibacillus_phage	2.1e-31	55.5
WP_033880956.1\|3388789_3389128_-	hypothetical protein	A0A0N9RTI3	Paenibacillus_phage	8.1e-21	47.3
WP_031601003.1\|3389128_3389521_-	hypothetical protein	A0A0N9SGG4	Paenibacillus_phage	7.5e-18	39.5
WP_033880957.1\|3389538_3389730_-	hypothetical protein	NA	NA	NA	NA
WP_031601004.1\|3389786_3390695_-	hypothetical protein	A0A0N9S7T7	Paenibacillus_phage	1.4e-80	52.5
WP_031601005.1\|3390726_3391287_-	hypothetical protein	NA	NA	NA	NA
WP_017695234.1\|3391392_3392205_-	type IV secretion protein Rhs	A0A0N9SJR1	Paenibacillus_phage	8.1e-75	52.7
WP_031601006.1\|3392204_3393875_-\|portal	phage portal protein	A0A2H4J180	uncultured_Caudovirales_phage	1.5e-155	55.3
WP_031601007.1\|3393879_3394314_-	hypothetical protein	A0A2H4J6Z8	uncultured_Caudovirales_phage	1.5e-27	49.3
WP_033880959.1\|3394330_3396091_-\|terminase	phage terminase large subunit	A0A142F1L6	Bacillus_phage	8.3e-133	44.8
WP_033880961.1\|3396174_3396723_+\|integrase	site-specific integrase	A0A2H4J6I5	uncultured_Caudovirales_phage	7.0e-38	51.6
3398482:3398497	attR	NA	NA	NA	NA

DBSCAN-SWA_10

3705349 : 3780688

Bacillus_phage(26.67%)

bacteriocin,protease,coat,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003227570.1\|3705349_3707020_-\|tRNA	arginine--tRNA ligase	NA	NA	NA	NA
WP_014481216.1\|3707016_3707445_-	DUF1934 domain-containing protein	NA	NA	NA	NA
WP_003222002.1\|3707757_3707889_+\|bacteriocin	subtilosin A family bacteriocin	NA	NA	NA	NA
WP_010886632.1\|3707845_3707998_+\|bacteriocin	bacteriocin-like protein SboX	NA	NA	NA	NA
WP_014481217.1\|3708022_3709369_+	subtilosin maturase AlbA	NA	NA	NA	NA
WP_003222006.1\|3709381_3709543_+\|bacteriocin	antilisterial bacteriocin subtilosin biosynthesis protein AlbB	NA	NA	NA	NA
WP_014481218.1\|3709539_3710259_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.6e-18	27.2
WP_033881822.1\|3710251_3711562_+\|bacteriocin	antilisterial bacteriocin subtilosin biosynthesis protein AlbD	NA	NA	NA	NA
WP_072592616.1\|3711551_3712712_+	insulinase family protein	NA	NA	NA	NA
WP_014481221.1\|3712716_3713997_+	insulinase family protein	NA	NA	NA	NA
WP_014481222.1\|3713993_3714695_+\|bacteriocin	antilisterial bacteriocin subtilosin biosynthesis protein AlbG	NA	NA	NA	NA
WP_014481223.1\|3714700_3716077_-	YncE family protein	NA	NA	NA	NA
WP_014481224.1\|3716115_3717471_-	YncE family protein	NA	NA	NA	NA
WP_014481226.1\|3717700_3718846_+	response regulator aspartate phosphatase RapF	A0A1P8CWN8	Bacillus_phage	1.7e-78	43.5
WP_009968329.1\|3718829_3718949_+	phosphatase RapF inhibitor PhrF	NA	NA	NA	NA
WP_105778741.1\|3719046_3719604_+	YbaK/EbsC family protein	NA	NA	NA	NA
WP_003227545.1\|3719538_3720411_-	agmatinase	NA	NA	NA	NA
WP_003227543.1\|3720471_3721302_-	spermidine synthase	NA	NA	NA	NA
WP_014481227.1\|3721503_3723579_+	penicillin-binding protein	NA	NA	NA	NA
WP_014478299.1\|3723606_3724041_-	hypothetical protein	NA	NA	NA	NA
WP_003244446.1\|3724179_3724698_-	YwhD family protein	NA	NA	NA	NA
WP_003243167.1\|3724711_3725371_-\|protease	site-2 protease family protein	NA	NA	NA	NA
WP_003222038.1\|3725479_3725668_+	4-oxalocrotonate tautomerase	NA	NA	NA	NA
WP_003227535.1\|3725710_3726130_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_014481228.1\|3726249_3728166_-\|tRNA	threonine--tRNA ligase	A0A2K9L6B6	Tupanvirus	1.9e-143	43.4
WP_003243441.1\|3729010_3730411_-	MFS transporter	NA	NA	NA	NA
WP_003243988.1\|3730410_3730881_-	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_003227524.1\|3730992_3731493_-	YwgA family protein	NA	NA	NA	NA
WP_003243873.1\|3731528_3732830_-	HD domain-containing protein	E3T4P8	Cafeteria_roenbergensis_virus	4.2e-25	28.9
WP_003222050.1\|3732991_3733216_-	DUF1450 domain-containing protein	NA	NA	NA	NA
WP_003227516.1\|3733430_3734207_+	prespore-specific transcription regulator RsfA	A0A1D6X8E5	Bacillus_phage	7.6e-06	50.0
WP_033881831.1\|3734350_3735241_-	DMT family transporter	NA	NA	NA	NA
WP_014481232.1\|3735409_3736255_-	octanoyl-[GcvH]:protein N-octanoyltransferase	NA	NA	NA	NA
WP_014481233.1\|3736303_3737203_-	cysJI operon transcriptional regulator CysL	A0A2H4J8I9	uncultured_Caudovirales_phage	3.6e-07	42.5
WP_003235941.1\|3737348_3738320_-	phosphate acetyltransferase	NA	NA	NA	NA
WP_003227507.1\|3738589_3739354_+	heme-dependent peroxidase	NA	NA	NA	NA
WP_014481234.1\|3739486_3740266_+	NADPH-dependent reductase BacG	NA	NA	NA	NA
WP_031601099.1\|3740281_3741496_-	transaminase BacF	NA	NA	NA	NA
WP_014481236.1\|3741496_3742681_-	bacilysin exporter BacE	NA	NA	NA	NA
WP_003242921.1\|3742677_3744096_-	alanine--anticapsin ligase	NA	NA	NA	NA
WP_003243359.1\|3744114_3744876_-	dihydroanticapsin 7-dehydrogenase	Q06VL0	Trichoplusia_ni_ascovirus	2.8e-21	30.9
WP_003244300.1\|3744878_3745586_-	3-((4R)-4-hydroxycyclohexa-1, 5-dien-1-yl)-2-oxopropanoate isomerase	NA	NA	NA	NA
WP_009968341.1\|3745575_3746190_-	prephenate decarboxylase	NA	NA	NA	NA
WP_014481237.1\|3746341_3747580_-	MFS transporter	NA	NA	NA	NA
WP_015250969.1\|3747789_3749202_-	amino acid permease	NA	NA	NA	NA
WP_014481239.1\|3749201_3750902_-	M20/M25/M40 family metallo-hydrolase	NA	NA	NA	NA
WP_014478322.1\|3750975_3752523_-	L-glutamate gamma-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_003227482.1\|3752749_3754024_-	glutamate dehydrogenase	NA	NA	NA	NA
WP_014481241.1\|3754201_3754666_-	biofilm-surface layer protein BslB	NA	NA	NA	NA
WP_014481242.1\|3754989_3755445_-	dTDP-4-dehydrorhamnose 3,5-epimerase family protein	NA	NA	NA	NA
WP_014481243.1\|3755437_3756289_-	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	1.3e-38	38.9
WP_003244201.1\|3756302_3757250_-	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	4.4e-72	43.8
WP_014478328.1\|3757249_3757990_-	NTP transferase domain-containing protein	I7I009	Enterobacteria_phage	4.5e-48	41.9
WP_014481244.1\|3758014_3759034_-\|coat	spore coat polysaccharide biosynthesis protein SpsG	NA	NA	NA	NA
WP_014481245.1\|3759036_3759759_-\|coat	spore coat polysaccharide biosynthesis protein SpsF	NA	NA	NA	NA
WP_031601100.1\|3759751_3760873_-\|coat	spore coat biosynthesis protein SpsE	NA	NA	NA	NA
WP_014481248.1\|3760872_3761742_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_014481249.1\|3761742_3762912_-	DegT/DnrJ/EryC1/StrS aminotransferase family protein	A0A1D8KU11	Synechococcus_phage	1.2e-15	28.1
WP_014481250.1\|3762932_3764357_-	CDP-glycerol glycerophosphotransferase family protein	NA	NA	NA	NA
WP_014481251.1\|3764361_3765132_-\|coat	spore coat dTDP-glycosyltransferase SpsA	A0A0F7L2F7	uncultured_marine_virus	4.4e-06	28.6
WP_014481253.1\|3765451_3765997_+\|coat	spore coat protein GerQ	NA	NA	NA	NA
WP_003227446.1\|3766040_3766412_-	DUF423 domain-containing protein	NA	NA	NA	NA
WP_014481254.1\|3766473_3767796_-	purine/pyrimidine permease	NA	NA	NA	NA
WP_014481255.1\|3767815_3768133_-	YwdI family protein	NA	NA	NA	NA
WP_014481256.1\|3768300_3769671_+	aldehyde dehydrogenase	NA	NA	NA	NA
WP_003242965.1\|3769695_3770373_-	uracil-DNA glycosylase	A0A172DS90	Canid_alphaherpesvirus	8.3e-49	46.1
WP_014481257.1\|3770386_3771193_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_014481258.1\|3771384_3772200_+	bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase	NA	NA	NA	NA
WP_003243437.1\|3772290_3772539_-	hypothetical protein	NA	NA	NA	NA
WP_014481259.1\|3772632_3774072_-	sucrose-6-phosphate hydrolase	F8WPR5	Bacillus_phage	3.7e-22	26.8
WP_014481260.1\|3774068_3775454_-	PTS system sucrose transporter subunit IIBC	NA	NA	NA	NA
WP_014481261.1\|3775755_3776526_+	formate/nitrite transporter family protein	NA	NA	NA	NA
WP_015250947.1\|3777435_3777738_-	hypothetical protein	NA	NA	NA	NA
WP_014481265.1\|3778267_3780688_+\|protease	serine protease Vpr	A0A217EQY2	Bacillus_phage	5.3e-21	38.2

DBSCAN-SWA_11

3947632 : 4045375

Bacillus_phage(23.81%)

coat,protease,holin,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003227093.1\|3947632_3947998_+\|coat	inner spore coat protein CotNE	NA	NA	NA	NA
WP_003242469.1\|3948245_3948599_+	hypothetical protein	NA	NA	NA	NA
WP_014481403.1\|3948642_3949041_-	hypothetical protein	NA	NA	NA	NA
WP_014481404.1\|3949218_3950184_+	iron-hydroxamate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003227084.1\|3950224_3950572_-	YxeA family protein	NA	NA	NA	NA
WP_014481410.1\|3953321_3954299_-	two-component system sensor histidine kinase YxdJ	NA	NA	NA	NA
WP_003243527.1\|3954295_3954985_-	two-component system response regulator YxdJ	NA	NA	NA	NA
WP_014481411.1\|3955092_3955965_-	6-phospho-5-dehydro-2-deoxy-D-gluconate aldolase	NA	NA	NA	NA
WP_014481412.1\|3955985_3956822_-	2-keto-myo-inositol isomerase	NA	NA	NA	NA
WP_014481413.1\|3956907_3957777_-	sugar phosphate isomerase/epimerase	NA	NA	NA	NA
WP_014481414.1\|3957796_3958831_-	bifunctional inositol 2-dehydrogenase/D-chiro-inositol 1-dehydrogenase	NA	NA	NA	NA
WP_014481415.1\|3958853_3960170_-	myo-inositol transporter IolF	NA	NA	NA	NA
WP_014481416.1\|3960184_3961078_-	myo-inosose-2 dehydratase	NA	NA	NA	NA
WP_014481417.1\|3961094_3963008_-	3D-(3,5/4)-trihydroxycyclohexane-1,2-dione acylhydrolase (decyclizing)	NA	NA	NA	NA
WP_014478485.1\|3963040_3964018_-	5-dehydro-2-deoxygluconokinase	NA	NA	NA	NA
WP_014481418.1\|3964041_3964857_-	5-deoxy-glucuronate isomerase	NA	NA	NA	NA
WP_014481419.1\|3964931_3966395_-	CoA-acylating methylmalonate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_031601042.1\|3966808_3967933_-\|transposase	IS4-like element IS4Bsu1 family transposase	NA	NA	NA	NA
WP_003227050.1\|3968226_3968982_+	myo-inositol utilization transcriptional regulator IolR	NA	NA	NA	NA
WP_014481420.1\|3969035_3969968_+	aldo/keto reductase	NA	NA	NA	NA
WP_014481421.1\|3970197_3970512_+	hypothetical protein	L7TIP7	Escherichia_phage	1.6e-10	47.0
WP_014481422.1\|3970615_3971086_-	hypothetical protein	NA	NA	NA	NA
WP_014481425.1\|3971842_3972355_+	HPP family protein	NA	NA	NA	NA
WP_014481428.1\|3973900_3975781_-	molecular chaperone HtpG	A0A1V0SAD6	Catovirus	1.1e-93	33.4
WP_014481429.1\|3975948_3976200_-	hypothetical protein	NA	NA	NA	NA
WP_033881094.1\|3977391_3977592_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_014481433.1\|3978214_3978433_-	hypothetical protein	NA	NA	NA	NA
WP_014481434.1\|3978477_3978699_-	hypothetical protein	NA	NA	NA	NA
WP_014478926.1\|3979020_3980145_+\|transposase	IS4-like element IS4Bsu1 family transposase	NA	NA	NA	NA
WP_014481435.1\|3980422_3980677_+	hypothetical protein	NA	NA	NA	NA
WP_014481436.1\|3980840_3983024_+	peptide cleavage/export ABC transporter	W8CYL7	Bacillus_phage	1.7e-50	30.8
WP_014481437.1\|3983024_3984494_+	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_014481439.1\|3984902_3985937_-	quercetin 2,3-dioxygenase	NA	NA	NA	NA
WP_014481440.1\|3986030_3986606_-	transcriptional regulator YxaF	NA	NA	NA	NA
WP_014481441.1\|3986736_3987807_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_003243994.1\|3987865_3988297_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_009968420.1\|3988523_3988928_+\|holin	CidA/LrgA family holin-like protein	NA	NA	NA	NA
WP_003227015.1\|3988897_3989590_+	LrgB family protein	NA	NA	NA	NA
WP_014481442.1\|3989629_3990661_-	polysaccharide pyruvyl transferase family protein	NA	NA	NA	NA
WP_014481443.1\|3990753_3991902_-	glycerate kinase	W6LM47	Streptococcus_phage	1.4e-48	42.3
WP_003243132.1\|3992097_3992829_+	gluconate operon transcriptional repressor GntR	NA	NA	NA	NA
WP_014481444.1\|3992821_3994363_+	gluconokinase	NA	NA	NA	NA
WP_003243139.1\|3994391_3995738_+	gluconate permease GntP	NA	NA	NA	NA
WP_014478511.1\|3995760_3997167_+	decarboxylating NADP(+)-dependent phosphogluconate dehydrogenase	E3SJC4	Synechococcus_phage	1.7e-32	30.6
WP_003243686.1\|3997632_3998196_+	peroxiredoxin	NA	NA	NA	NA
WP_003243077.1\|3998209_3999739_+	alkyl hydroperoxide reductase subunit F	A0A1V0SIN1	Klosneuvirus	1.0e-33	29.3
WP_014481445.1\|3999849_4001289_-	6-phospho-beta-glucosidase	NA	NA	NA	NA
WP_014481447.1\|4001855_4002566_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_014478516.1\|4002656_4003379_-	peptide ABC transporter permease	NA	NA	NA	NA
WP_014481448.1\|4003399_4004029_-	ATP-binding cassette domain-containing protein	NA	NA	NA	NA
WP_014481449.1\|4004509_4006435_+	fructose-bisphosphatase class III	NA	NA	NA	NA
WP_080283096.1\|4006885_4007236_-	hypothetical protein	NA	NA	NA	NA
WP_014481451.1\|4007716_4008157_+	Hsp20/alpha crystallin family protein	A0A1B2LRT2	Wolbachia_phage	3.4e-11	34.4
WP_014479891.1\|4008576_4009335_-	ATP-binding protein	U5N3V8	Enterobacteria_phage	5.8e-43	38.6
WP_014480339.1\|4009331_4010879_-\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_033881507.1\|4011008_4011395_-	hypothetical protein	NA	NA	NA	NA
WP_031601173.1\|4011806_4013270_+	Abi family protein	A0A0S2MYH0	Enterococcus_phage	1.0e-11	36.0
WP_121591334.1\|4013504_4015391_-	ATP-dependent helicase	S5MMD7	Bacillus_phage	6.6e-19	21.8
WP_031601176.1\|4015368_4017402_-	AAA family ATPase	NA	NA	NA	NA
WP_014479904.1\|4018459_4018777_+\|transposase	transposase	NA	NA	NA	NA
WP_033881055.1\|4018773_4019688_+\|transposase	IS3 family transposase	A0A1B3AZE5	Gordonia_phage	4.0e-06	22.9
WP_080283097.1\|4019768_4020215_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	3.2e-57	97.5
WP_017696296.1\|4020199_4020478_-\|transposase	transposase	A0A1P8CWP5	Bacillus_phage	7.3e-44	100.0
WP_033881129.1\|4021176_4021440_-	hypothetical protein	NA	NA	NA	NA
WP_033881055.1\|4021823_4022738_-\|transposase	IS3 family transposase	A0A1B3AZE5	Gordonia_phage	4.0e-06	22.9
WP_014479904.1\|4022734_4023052_-\|transposase	transposase	NA	NA	NA	NA
WP_014481454.1\|4023316_4026430_-	DEAD/DEAH box helicase	A7WKM3	Acidianus_filamentous_virus	6.6e-08	26.4
WP_014481455.1\|4026395_4027304_-	hypothetical protein	NA	NA	NA	NA
WP_003226975.1\|4027591_4028071_-	23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH	NA	NA	NA	NA
WP_014481456.1\|4028151_4028322_-	CxxH/CxxC protein	NA	NA	NA	NA
WP_014481457.1\|4028506_4028920_+	hypothetical protein	NA	NA	NA	NA
WP_014481458.1\|4028953_4030180_-	formaldehyde dehydrogenase, glutathione-independent	A0A2K9L7I1	Tupanvirus	1.1e-11	29.3
WP_014481459.1\|4030242_4030413_-	hypothetical protein	NA	NA	NA	NA
WP_014481460.1\|4030517_4030766_-	DUF2651 family protein	NA	NA	NA	NA
WP_014481461.1\|4030781_4031939_-	hypothetical protein	NA	NA	NA	NA
WP_014481462.1\|4031949_4032687_-	hypothetical protein	NA	NA	NA	NA
WP_014481463.1\|4032828_4033299_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_014481464.1\|4033409_4034507_+	response regulator aspartate phosphatase RapG	D6R410	Bacillus_phage	6.0e-73	39.3
WP_003226961.1\|4034507_4034624_+	Phr family secreted Rap phosphatase inhibitor	NA	NA	NA	NA
WP_003226959.1\|4034860_4035751_-	arginase	A0A1V0SJM8	Klosneuvirus	2.0e-26	29.1
WP_014481465.1\|4035823_4037227_-	amino acid permease	NA	NA	NA	NA
WP_033882007.1\|4037449_4038655_-	ornithine aminotransferase	A0A1V0SKB7	Klosneuvirus	2.0e-29	28.5
WP_015715048.1\|4038986_4039589_-	sporulation delaying protein family toxin	NA	NA	NA	NA
WP_014481469.1\|4039650_4040604_-	hypothetical protein	NA	NA	NA	NA
WP_015715050.1\|4040588_4041143_-	SdpA family antimicrobial peptide system protein	NA	NA	NA	NA
WP_014481470.1\|4041326_4041962_-	SdpI family protein	NA	NA	NA	NA
WP_015715052.1\|4041961_4042246_-	winged helix-turn-helix transcriptional regulator	A0A218MNF3	uncultured_virus	2.8e-06	41.3
WP_003244510.1\|4042472_4043858_+	arginine utilization regulatory protein RocR	NA	NA	NA	NA
WP_014481472.1\|4044172_4045375_-\|protease	serine protease HtrC	W5SAB9	Pithovirus	5.9e-13	40.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_017196

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection