CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NC_015554	Alteromonas naphthalenivorans, complete sequence	4 crisprs	csa3,DinG,WYL,RT,DEDDh,cas3,PrimPol,cas14j	0	1	8	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_015554_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_015554_1

478911-479026

Orphan

Consensus_repeat	Method
TTTTCTTATTCATTAATTCGTGATTGAAATTGTGGGTGTCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_015554_1

>merge|NC_015554|1|478911-479026|CRISPRCasFinder
TTTTCTTATTCATTAATTCGTGATTGAAATTGTGGGTGTCCGAGAGGTAATGATTTTAGCATTACGGGTTTCTGATTTTCTTATTCATTAATTCGTGATTGAAACTGTGGGTGTCC

>NC_015554|1|1|478911-479026|CRISPRCasFinder
TTTTCTTATTCATTAATTCGTGATTGAAATTGTGGGTGTCC	GAGAGGTAATGATTTTAGCATTACGGGTTTCTGA
TTTTCTTATTCATTAATTCGTGATTGAAACTGTGGGTGTCC

Protein	Signature genes	Signature genes Name	Protein_function
NC_015554.1\|WP_013782901.1\|474258_474798_-\|YggT-family-protein	unknown	unknown	gnl\|CDD\|376765
NC_015554.1\|WP_013782913.1\|483941_484736_-\|M48-family-metallopeptidase	unknown	unknown	gnl\|CDD\|320690
NC_015554.1\|WP_013782915.1\|487223_488348_+\|beta-ketoacyl-ACP-synthase-III	unknown	unknown	gnl\|CDD\|236037
NC_015554.1\|WP_013782903.1\|475697_476384_-\|YggS-family-pyridoxal-phosphate-dependent-enzyme	unknown	unknown	gnl\|CDD\|143497
NC_015554.1\|WP_013782902.1\|474819_475641_-\|pyrroline-5-carboxylate-reductase	unknown	unknown	gnl\|CDD\|237008
NC_015554.1\|WP_013782916.1\|488474_490502_+\|PEP-CTERM-system-histidine-kinase-PrsK	unknown	unknown	gnl\|CDD\|274349
NC_015554.1\|WP_013782900.1\|473795_474236_-\|DUF4426-domain-containing-protein	unknown	unknown	gnl\|CDD\|379616
NC_015554.1\|WP_013782911.1\|482349_482514_-\|hypothetical-protein	unknown	unknown	unknown
NC_015554.1\|WP_013782909.1\|480308_481262_-\|glutathione-synthase	unknown	unknown	gnl\|CDD\|235371
NC_015554.1\|WP_013782910.1\|481474_482203_-\|16S-rRNA-(uracil(1498)-N(3))-methyltransferase	unknown	unknown	gnl\|CDD\|236959
NC_015554.1\|WP_041452469.1\|472666_473605_-\|hypothetical-protein	unknown	unknown	unknown
NC_015554.1\|WP_013782914.1\|485059_486871_+\|choice-of-anchor-I-family-protein	unknown	unknown	gnl\|CDD\|189968
NC_015554.1\|WP_013782897.1\|469869_470205_+\|glyoxalase/bleomycin-resistance/dioxygenase-family-protein	unknown	unknown	gnl\|CDD\|319909
NC_015554.1\|WP_013782906.1\|478579_478894_+\|DUF2007-domain-containing-protein	unknown	unknown	gnl\|CDD\|378182
NC_015554.1\|WP_013782904.1\|476408_477452_+\|type-IV-pilus-twitching-motility-protein-PilT	unknown	unknown	gnl\|CDD\|225364
NC_015554.1\|WP_013782898.1\|470299_472321_-\|NADPH-dependent-2,4-dienoyl-CoA-reductase	unknown	unknown	gnl\|CDD\|239240
NC_015554.1\|WP_013782905.1\|477461_478574_+\|PilT/PilU-family-type-4a-pilus-ATPase	unknown	unknown	gnl\|CDD\|227341
NC_015554.1\|WP_013782912.1\|483019_483862_+\|mechanosensitive-ion-channel	unknown	unknown	gnl\|CDD\|182386
NC_015554.1\|WP_013782907.1\|479272_479707_-\|Holliday-junction-resolvase-RuvX	unknown	unknown	gnl\|CDD\|234639
NC_015554.1\|WP_013782908.1\|479699_480266_-\|YqgE/AlgH-family-protein	unknown	unknown	gnl\|CDD\|234694

Protein	Function_ID	Function_description	E-value
NC_015554.1\|WP_013782901.1\|474258_474798_-\|YggT-family-protein	gnl\|CDD\|376765	pfam02325, YGGT, YGGT family. This family consists of a repeat found in conserved hypothetical integral membrane proteins. The function of this region and the proteins which possess it is unknown.	4.31244e-13
NC_015554.1\|WP_013782913.1\|483941_484736_-\|M48-family-metallopeptidase	gnl\|CDD\|320690	cd07331, M48C_Oma1_like, Peptidase M48C, integral membrane endopeptidase. This subfamily contains peptidase M48C Oma1 (also called mitochondrial metalloendopeptidase OMA1) protease homologs that are mostly uncharacterized. Oma1 is part of the quality control system in the inner membrane of mitochondria, with its catalytic site facing the matrix space. It cleaves and thereby promotes the turnover of mistranslated or misfolded membrane proteins. Oma1 can cleave the misfolded multi-pass membrane protein Oxa1, thus exerting a function similar to the ATP-dependent m-AAA protease for quality control of inner membrane proteins; it cleaves a misfolded polytopic membrane protein at multiple sites. It has been proposed that in the absence of m-AAA protease, proteolysis of Oxa1 is mediated by Oma1 in an ATP-independent manner. Oma1 is part of highly conserved mitochondrial metallopeptidases, with homologs present in higher eukaryotes, eubacteria and archaebacteria, all containing the zinc binding motif (HEXXH). It forms a high molecular mass complex in the inner membrane, possibly a homo-hexamer.	2.57802e-86
NC_015554.1\|WP_013782915.1\|487223_488348_+\|beta-ketoacyl-ACP-synthase-III	gnl\|CDD\|236037	PRK07515, PRK07515, 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed.	0
NC_015554.1\|WP_013782903.1\|475697_476384_-\|YggS-family-pyridoxal-phosphate-dependent-enzyme	gnl\|CDD\|143497	cd06824, PLPDE_III_Yggs_like, Pyridoxal 5-phosphate (PLP)-binding TIM barrel domain of Type III PLP-Dependent Enzymes, Yggs-like proteins. This subfamily contains mainly uncharacterized proteobacterial proteins with similarity to the hypothetical Escherichia coli protein YggS, a homolog of yeast YBL036c, which is homologous to a Pseudomonas aeruginosa gene that is co-transcribed with a known proline biosynthetic gene. Like yeast YBL036c, Yggs is a single domain monomeric protein with a typical TIM-barrel fold. Its structure, which shows a covalently-bound PLP cofactor, is similar to the N-terminal domain of the fold type III PLP-dependent enzymes, bacterial alanine racemase and eukaryotic ornithine decarboxylase, which are two-domain dimeric proteins. YggS has not been characterized extensively and its biological function is still unkonwn.	6.4347e-136
NC_015554.1\|WP_013782902.1\|474819_475641_-\|pyrroline-5-carboxylate-reductase	gnl\|CDD\|237008	PRK11880, PRK11880, pyrroline-5-carboxylate reductase; Reviewed.	3.12875e-116
NC_015554.1\|WP_013782916.1\|488474_490502_+\|PEP-CTERM-system-histidine-kinase-PrsK	gnl\|CDD\|274349	TIGR02916, sensor_histidine_kinase, putative PEP-CTERM system histidine kinase. Members of this protein family have a novel N-terminal domain, a single predicted membrane-spanning helix, and a predicted cystosolic histidine kinase domain. We designate this protein PrsK, and its companion DNA-binding response regulator protein (TIGR02915) PrsR. These predicted signal-transducing proteins appear to enable enhancer-dependent transcriptional activation. The prsK gene is often associated with exopolysaccharide biosynthesis genes. [Protein fate, Protein and peptide secretion and trafficking, Signal transduction, Two-component systems].	1.264e-174
NC_015554.1\|WP_013782900.1\|473795_474236_-\|DUF4426-domain-containing-protein	gnl\|CDD\|379616	pfam14467, DUF4426, Domain of unknown function (DUF4426). Members of this entry are found mostly in g-proteobacteria, especially in Vibrio. Strangely enough, there seems to be one eukaryotic homolog in Nematostella vectensis (NEMVEDRAFT_v1g226006), where the PA0388-like domain is fused with a domain homogous to the Methionine biosynthesis protein MetW (see below). In several Pseudomonas species, but also in Vibrio vulnificus and Azotobacter vinelandii PA0388 homologs are genomic neighbors of Nucleoside 5-triphosphatase RdgB (dHAPTP, dITP, XTP-specific) (EC 3.6.1.15) and Methionine biosynthesis protein MetW. On the other hand, in most Vibrio species it appears as a part of a conserved operon involved in possible response to stress.	4.87997e-56
NC_015554.1\|WP_013782909.1\|480308_481262_-\|glutathione-synthase	gnl\|CDD\|235371	PRK05246, PRK05246, glutathione synthetase; Provisional.	0
NC_015554.1\|WP_013782910.1\|481474_482203_-\|16S-rRNA-(uracil(1498)-N(3))-methyltransferase	gnl\|CDD\|236959	PRK11713, PRK11713, 16S ribosomal RNA methyltransferase RsmE; Provisional.	9.08867e-90
NC_015554.1\|WP_013782914.1\|485059_486871_+\|choice-of-anchor-I-family-protein	gnl\|CDD\|189968	pfam01391, Collagen, Collagen triple helix repeat (20 copies). Members of this family belong to the collagen superfamily. Collagens are generally extracellular structural proteins involved in formation of connective tissue structure. The alignment contains 20 copies of the G-X-Y repeat that forms a triple helix. The first position of the repeat is glycine, the second and third positions can be any residue but are frequently proline and hydroxy-proline. Collagens are post translationally modified by proline hydroxylase to form the hydroxy-proline residues. Defective hydroxylation is the cause of scurvy. Some members of the collagen superfamily are not involved in connective tissue structure but share the same triple helical structure. The family includes bacterial collagen-like triple-helix repeat proteins.	3.62835e-06
NC_015554.1\|WP_013782897.1\|469869_470205_+\|glyoxalase/bleomycin-resistance/dioxygenase-family-protein	gnl\|CDD\|319909	cd07245, VOC_like, uncharacterized subfamily of vicinal oxygen chelate (VOC) family. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	5.41538e-11
NC_015554.1\|WP_013782906.1\|478579_478894_+\|DUF2007-domain-containing-protein	gnl\|CDD\|378182	pfam09413, DUF2007, Putative prokaryotic signal transducing protein. This is a family of putative prokaryotic signal transducing proteins of Pii-type.	8.56627e-11
NC_015554.1\|WP_013782904.1\|476408_477452_+\|type-IV-pilus-twitching-motility-protein-PilT	gnl\|CDD\|225364	COG2805, PilT, Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion].	0
NC_015554.1\|WP_013782898.1\|470299_472321_-\|NADPH-dependent-2,4-dienoyl-CoA-reductase	gnl\|CDD\|239240	cd02930, DCR_FMN, 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain. DCR in E. coli is an iron-sulfur flavoenzyme which contains FMN, FAD, and a 4Fe-4S cluster. It is also a monomer, unlike that of its eukaryotic counterparts which form homotetramers and lack the flavin and iron-sulfur cofactors. Metabolism of unsaturated fatty acids requires auxiliary enzymes in addition to those used in b-oxidation. After a given number of cycles through the b-oxidation pathway, those unsaturated fatty acyl-CoAs with double bonds at even-numbered carbon positions contain 2-trans, 4-cis double bonds that can not be modified by enoyl-CoA hydratase. DCR utilizes NADPH to remove the C4-C5 double bond. DCR can catalyze the reduction of both natural fatty acids with cis double bonds, as well as substrates containing trans double bonds. The reaction is initiated by hybrid transfer from NADPH to FAD, which in turn transfers electrons, one at a time, to FMN via the 4Fe-4S cluster. The fully reduced FMN provides a hydrid ion to the C5 atom of substrate, and Tyr and His are proposed to form a catalytic dyad that protonates the C4 atom of the substrate and completes the reaction.	0
NC_015554.1\|WP_013782905.1\|477461_478574_+\|PilT/PilU-family-type-4a-pilus-ATPase	gnl\|CDD\|227341	COG5008, PilU, Tfp pilus assembly protein, ATPase PilU [Cell motility and secretion / Intracellular trafficking and secretion].	0
NC_015554.1\|WP_013782912.1\|483019_483862_+\|mechanosensitive-ion-channel	gnl\|CDD\|182386	PRK10334, PRK10334, small-conductance mechanosensitive channel MscS.	1.94711e-80
NC_015554.1\|WP_013782907.1\|479272_479707_-\|Holliday-junction-resolvase-RuvX	gnl\|CDD\|234639	PRK00109, PRK00109, Holliday junction resolvase RuvX.	2.43946e-71
NC_015554.1\|WP_013782908.1\|479699_480266_-\|YqgE/AlgH-family-protein	gnl\|CDD\|234694	PRK00228, PRK00228, YqgE/AlgH family protein.	4.34298e-90

>NC_015554.1|WP_013782906.1|478579_478894_+|DUF2007-domain-containing-protein
MIKLFTSSDPFLLQSVKSELDALSIPYLVKNEFAGGAMGELPWQESQPELWLIDESWSTRANKVVNSLMDSHEPAEKFPWVCGHCNEPNGEAFDTCWKCGESRP
>NC_015554.1|WP_013782905.1|477461_478574_+|PilT/PilU-family-type-4a-pilus-ATPase
MLDSFLEKMVEKSASDLFVTAGFPVSAKVHGKLTPISENSFNDEDALALVHEAMNEKQKEAFHTTKECNFAIVREGLGRFRCSAFWQRDQAGMVVRRIVTEIPKVDDLGLPSVLKDIIMSKRGLVLFVGGTGTGKSTSLAALIGHRNSNSYGHILTIEDPIEFVHEHKSCVITQREVGIDTHSFDDALKSSLRQAPDVILIGEIRSMETMEYAMSFADTGHLCVATLHANNANQAIERIMHLAPKDQHDKLRFDLSQNIKAIVAQQLLPTKDGEGRVAAIEILLNSPLVSDLIQRNEIGSLKEAMKKGKELGMQSFDMALYDLYREGSIDLDQALHHADSPNDLRLMIKLDSNDGSSLGTLSNVSIDMDD
>NC_015554.1|WP_013782904.1|476408_477452_+|type-IV-pilus-twitching-motility-protein-PilT
MDITELLAFSAKNKASDLHLSAGLPPLIRVDGEMRKLNVPALDHKQVHALIYEIMNDMQRKEYEENLETDFSFEISGLSRFRVNAFVQNRGAAAVLRTIPNTVLTLDDLGAPEIFKEIINQPTGIVLVTGATGSGKSTTLAAMVDHINSHKREHILTIEDPIEFVHENKLSLVNQREVHRDTHSFSNALRSALREDPDVILVGELRDLETIRLAISAAETGHLVFGTLHTNSAPKTIDRIIDVFPAEEKAMVRSMLSESLRAVISQTLLKKVGGGRIAAHEIMVGIPAIRNLIREDKVPQMYSVIQTGQATGMQTMDQCLQRLLALGAISKEDAAAKSKDKQSMSNF
>NC_015554.1|WP_013782903.1|475697_476384_-|YggS-family-pyridoxal-phosphate-dependent-enzyme
MQTIAERLNSARQDVSLATANANRPPNSVKLLAVSKTKPVSDIMAAYEEGQRTFGENYIQEGVDKIQQLSALSDIEWHMIGPIQSNKTKIVAENFDWVQSVDREKIARRLNDQRPAEMAPLNVCIQVNIDDEASKSGVKPEDVDELVRFITKQDKLCLRGLMAIPKANPDSHEQAQSLSALKELFDRYHTNLTNFDTLSVGMSSDMQSAIAHGSTMVRIGTAIFGARN
>NC_015554.1|WP_013782902.1|474819_475641_-|pyrroline-5-carboxylate-reductase
MQQKKLAFIGAGNMSRSIISGLIQSGYDKTRILASNPSTPKLDKLKEEFGIQITQSNDEACQFADAIVLAVKPQMMGDMCADLKQNNDLTGKLFLSIAAGLPVSRLQEMLGGEYPVVRIMPNTPSLLGKGMSGMYADNTVSEDDRTYVDDVMNSVGETVWVEEEDGINGVIAAAGSSPAYFFLFLQAMQEEAINMGFDKAQSRLMVQQAMLGAAEMVCHNPDLELSELRAQVTSKGGTTAAAVNTLIDQGLSDIVSKAMRAAVARAEEMAKQL
>NC_015554.1|WP_013782901.1|474258_474798_-|YggT-family-protein
MNATVFLVDTLFGLYLMVVILRLWLQLVRADFYNPMSQFIVKATHPIVGPLRRIIPSIGRFDTATFVLALVVAALKIITLSLMVGGSLNPVGIVIVALIEVVKETLSIMFWVLILRAILSWVSQGQTPIDYLLYQLTEPFLAPIRKVIPPLGGLDLSVLIAIIGLQFLQLLLQDTFRFF
>NC_015554.1|WP_013782900.1|473795_474236_-|DUF4426-domain-containing-protein
MKKISTLLFGLLGSLLLITSSAAYAEQKQQLGEWDVHYMVVSTPFLTPEVAASYGIVRSKFNALVNISVLDAVTGTAQRVSVSGTAKNLIGTTKTLTFKKVEEGDAIYYLAVLPFRDRENYRFSIDVQRGNTMQTLNFKQEMFVDG
>NC_015554.1|WP_041452469.1|472666_473605_-|hypothetical-protein
MPSPRKSLICLQNTPYYHCVSRCVRRAFLCGDDHYTGKSYEHRRQWVEDRLIALTNVFSIDVCAYAVMSNHTHLVLHVDRNEALSWTTEEVLRRWHSLHKGTVLTQQYMQPTQRASLTEAQITTIISTANVYRQRLYDISWFMRLLNEFIAREANKEDECTGRFWEGRFKSQALLDEAALAACMAYVDLNPLRAGISKAPEKSEFTSIKHRIEAAQFGLQPAFLKPLVGSSSHGLKGLPFNLADYLTLVDETARQISAGKSGYVLHNVSPILQRTGLSQTNWNSMVVGIEAIFSNSIGLSIAQRKLALSKTG
>NC_015554.1|WP_013782898.1|470299_472321_-|NADPH-dependent-2,4-dienoyl-CoA-reductase
MTNAYPHLLEPLDLGFTTLKNRTLMGSMHLGLEEEKGGFDKLAAFYAERAKGGVALIVTGGISPNISGWVAPFAGRMTAKRHAKKHRVITEAVHAEGGKICMQILHSGRYGYHPLAVSASPVKSPITPFKPRALSSKAVTSTIKDYVSCAALAKEAGYDGVEVMGSEGYLINQFLVKRTNHRDDEWGGCLENRVKIAVDIVKGIREKVGTDFIIIYRLSMLDLVEGGAKWDEVVYLAKAIEKAGATLINTGIGWHEARVPTISTSVPRAAFTWITQRMKKEVSLPLVTTNRINTPEVAEGVLADGHADMVSMARPFLADSQFVAKAMRNESQLINTCIACNQACLDHAFEQKRASCLVNPQACYETELTFTPVTHSKRIAVVGAGPAGLAFAMYAADRGHQVILFDKASELGGQFNYAKQVPGKEEFYETIRYFSNQLERTGVTVTLNTDVTCEFLTESGFDEVVLASGINPRSLTIEGADHSKVMSYIDVLRDHKAVGQKVAIIGAGGIGFDVAEYLVEDKDLSLNTDKWLSHWGIDKNYTNEGALTEKSYTPSSREVFLLQRKTSKVGKGLGKTTGWIHRQSLKLHNVQMVNGVSYEKVDDEGLHVLINDKPKCLAVDNVIVCAGQEPFKPLQAPLEAAGVSVHIIGGADVAAELDAKRAIRQGAELAAKI
>NC_015554.1|WP_013782897.1|469869_470205_+|glyoxalase/bleomycin-resistance/dioxygenase-family-protein
MQPGLFSLSLAVSDIAISKAFYETLGFEAMPSCGSVEEKWVIMKSGQTMIGLFEGMFEGNILTFNPTDVRELEQRLKDKGIEIDVPVKGDEGPGHCVVKDPDGNTIMFDQF
>NC_015554.1|WP_013782907.1|479272_479707_-|Holliday-junction-resolvase-RuvX
MPDIGSRTVLAFDFGTKSIGVAVGQEITGTASPLAALKARDGIPDWNVIEKLYEEWQPQLVVVGLPLNMDGTEQEVTQRAKKFANRLHGRFKVAVDLCDERLTTTDAKSMLFELGGYKKLTKEKIDSVSACVIFTSWVENQYGD
>NC_015554.1|WP_013782908.1|479699_480266_-|YqgE/AlgH-family-protein
MTELKSLQNHFLVAMPSLDDPYFSRSLTYICEHNKDGAMGLVINQPSTMNLKELLEQTDKDLTVAEDKAEQIILAGGPVSQERGFVLHSSQSGWDSSLALSPDVMITTSKDILSAIGTNTGPDSSIIALGYAGWTAGQLEQEMQDNSWLTIEADDDILFNTPIHKKWQAAVNKLGVDVWQLAPGAGHA
>NC_015554.1|WP_013782909.1|480308_481262_-|glutathione-synthase
MHYTLGVIMDPIAVIKPHKDTSLAMMLEAQRRGATVLYFELKDIFINNGKPMGLARTITVRDQATDFYTLGEEHTVSLGDIDVLLMRKDPPFDSEFLYATHILSLAQDEGALVVNNPQALRDYNEKLFTSLFPEHIPNTLVTNNQKLIRDFHAKHQDIICKPLDGMGGASIFRVKPDGNNLGVIIETLTNLGKRYMMVQEYLPQIKDGDKRILIVDGEVIPYCLARLPTKGETRGNLAAGGTGRPQEISETDRALAEAVAPTLRENNILFVGLDVIGEKITEINITSPTCVREIEGHYNINIMASLFDAIEKRLTTK
>NC_015554.1|WP_013782910.1|481474_482203_-|16S-rRNA-(uracil(1498)-N(3))-methyltransferase
MRIPRIYYPNPIPLEEEFQLTEEAGHHIASVLRLKANHPIVLFNGDGNEYSAQIINAQRKKVFVEADACLTLSKESSLNIHLGQGVSKGDRMDTVLQKSVELGVTEITPILSERCTVKLDEARWEKKLLQWQKIIIGACEQSGRNTLPSLNPPIALNKWLSESTSSSRLVLAPGAEKPLARQPYNSQGFRLLIGPEGGLSEGEIHQANESGFTSCSLGPRILRTETAAISSISILQAQHGDF
>NC_015554.1|WP_013782911.1|482349_482514_-|hypothetical-protein
MFYFILLAIIVAALFLYSLRTDKGEHTKYARKDGQAVPPHQNETQNTTSTPSAA
>NC_015554.1|WP_013782912.1|483019_483862_+|mechanosensitive-ion-channel
MEENLSLFSSSDVERYINDYAIPWGINIAMAIVIYVIGRIVVGFILSLFRRLMAKSKYDAMLVDFLEAIISAILMLFVIVASLNQLGVDTTSLVAILGAAGLAIGLSLQDSLKNFAAGVMLLVFKPFKSGDFVEAAGTAGTINKIGIFTTTMATPDNKEIIVPNGGIYSNNITNYSAKETRRVDMVVGIGYDADLRKAKEILNEMVRADERILSEPAPTVAVSELADSSVNFVVRPWCKASDFWGVKFDFTEQVKLRFDQEGISIPFPQMDVHLHKNDSE
>NC_015554.1|WP_013782913.1|483941_484736_-|M48-family-metallopeptidase
MKLRFTASIAAVALAVTACATSPTGRNQVLLYSESQLEEMGDQAFSGMKEELKISNKAVQNSYVECVANAITAKVPNSVFDGTWEVVVFDDEQVNAFALPGGKIGVYTGLLNVAENQHQLAAVIGHEVGHVIAEHGNERMSQSTLINMGTQAAGAALAMNEVSQTAPIMAAIGLGLQVGVQLPFSRTHESEADVIGLQLMAMSGFDPRQSVNLWQNMDAASNGERPLELLSTHPAPQTRISNLQANMNAAYTDYQASAYRPNCG
>NC_015554.1|WP_013782914.1|485059_486871_+|choice-of-anchor-I-family-protein
MSAQSKFKYGVLALLISAALTGCGLDGDDGAQGETGAQGPQGEQGEAGSDGADGVDGSDASLGVSLDVVARAFLGNLTSAEIVQYHADTQTIYATNGETNAIAVIAADTVSTTAMSDPINTTNLTVSDITLPADIDGVTLGSLTSIAISGDLMAVAVPADVKTDNGYVLFYNGLDTSAPVFLDSVVVGALPDMVTFTPDGGKVLVANEGEPSDDYTIDPEGSISVINILASGEPEETASSVSFTGFNGSQDDLVAQGMMFPNPSGRTIKGVDIATTVAQDLEPEYITATNDVAYVSLQENNGLAILDLEELTVEIIGLGVKSWADLNIDIQEDGSVSFGQYDGLYGVYQPDTIANYSWKDATFIVTANEGDAREYFFDSADEATCLSEGGLEFDEDDGCLAFIDEVKVEDLTAEANSELADLQANGEADDLRVTNAMGDADGNGEYDAAYAYGSRSFTIWDQNGLAVYDSGDDFERITASVHGASFNNGDDANEGDSRSENKGPEPEALTVGVIGDRTYAFVGTERMGGIFVYDVTNPYDVQFADYIINRDLTEGLEATDVIGDLAPESLVFVSADDSASGVPLLLVGNEVSGTVTVWQITQN
>NC_015554.1|WP_013782915.1|487223_488348_+|beta-ketoacyl-ACP-synthase-III
MSQQIVVSGVGVWHPESSITNQELVDSYNAYVDSYNEAHKAEIEAQQVTAKPYSSAEFIEKASGIKSRYIYQKEGALDISRMKPKIEAREDEALSHQAEIAVEAAKLALASANKTAQDVDAVIVSCAYTQRAYPAIAIEVQEALGIEGFGFDMLVACSAATFGMHRAYEMLSAGNAKCVLVINPELVSPQINYTDRDSHFIFGDVATATVLETAETVNSEHSYDVMSTNAVTKYSNNIRSNFGYITRTEDVDPYGADKLFHQAGRKVFKEVCPMAASHIESHLDRHQLTATDVRRWWLHQANINMNTLIIKRLLGRDANADEAPIVLDEYANTASAGSVIAFGLNHEDLVAGDVGVLCSFGAGYSIGSLLLKKR
>NC_015554.1|WP_013782916.1|488474_490502_+|PEP-CTERM-system-histidine-kinase-PrsK
MISDIGYALNSLAYLLLMLLLFAVRKPGLANHLLVLATATTLFWSTSMITALFGPISLSWLLTIDALRQVAWLLFLAGCLKNNFTNLFDVLRRPTTLFILLPGCIALVLPHVLWIDASWRYLMLIILALEVLILLEVIYRQADADQWAYKPLILYLGATHLFDFVTYANATMVNQVEVNYIAARGYIYFLLIPFLVIAIRRIKHWGVDIFISRDVVLHSSLLLVAGAYLFIMAIIGYAISYVGGNWGAMVQTILVVLSLALLVTVFLSNSFRTKCKVFITKHFFANQFDYRVEWIKLTKTLSSSMDAPNTVHESALRGILEAIEYDSGKLYKRVNNDFEQLAQVNPLPDTHDDLTIIRTLTDYCTSNTWLIDVHEYQAKPFHYKGLQIDRDILKDWGYQLYLPFYKNDEIWGFAVLSAGDKERLSLNWEVRDYLNAITEQVSMFVFHHEASKLVAENAQFAAFNRMSAFVVHDLKNVMAQVDLILANAQQHKHNPEFIEDTFETLEHTKARMDKMLKQLTDKKINDDGAHTSCSLSHIINDVVANRCMGLLPAPKVHCSSEEPVLIDKEKVANVFYHLISNAQQATEDSGEIDIVLTHDIQNRVQYVMIEDTGTGMDQDFIDTRLFTPFDTTKGNAGMGIGAYDAKTYIESIGGKISVQSEPGKGSCFTLAFTLN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_015554_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_015554_2

2633756-2633864

Orphan

Consensus_repeat	Method
TTTTTTTAAAAGTGTAAGGCGAGTGCCACTGGTTCAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_015554_2

>merge|NC_015554|2|2633756-2633864|CRISPRCasFinder
TTTTTTTAAAAGTGTAAGGCGAGTGCCACTGGTTCAACAACTTCGTTGCGAGCCACAGCAGACGTCCACCACTTTTTTTAAAAGTGTCAGGCGAGTGCCACTGGTTCAA

>NC_015554|2|2|2633756-2633864|CRISPRCasFinder
TTTTTTTAAAAGTGTAAGGCGAGTGCCACTGGTTCAA	CAACTTCGTTGCGAGCCACAGCAGACGTCCACCAC
TTTTTTTAAAAGTGTCAGGCGAGTGCCACTGGTTCAA

Protein	Signature genes	Signature genes Name	Protein_function
NC_015554.1\|WP_041452953.1\|2636238_2636766_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|379112
NC_015554.1\|WP_013784796.1\|2625375_2626074_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|226647
NC_015554.1\|WP_013784798.1\|2626816_2627002_+\|hypothetical-protein	unknown	unknown	unknown
NC_015554.1\|WP_013784801.1\|2629430_2629664_-\|hypothetical-protein	unknown	unknown	unknown
NC_015554.1\|WP_041452557.1\|2627081_2628062_+\|hypothetical-protein	unknown	unknown	unknown
NC_015554.1\|WP_013784803.1\|2631954_2633364_-\|glutamate--tRNA-ligase	unknown	unknown	gnl\|CDD\|234953
NC_015554.1\|WP_013784808.1\|2640088_2640304_+\|DUF3820-family-protein	unknown	unknown	gnl\|CDD\|378970
NC_015554.1\|WP_013784813.1\|2644982_2645450_-\|low-molecular-weight-phosphotyrosine-protein-phosphatase	unknown	unknown	gnl\|CDD\|319971
NC_015554.1\|WP_013784797.1\|2626091_2626748_+\|arylesterase	unknown	unknown	gnl\|CDD\|238860
NC_015554.1\|WP_013784814.1\|2645544_2646267_+\|dipeptidase-PepE	unknown	unknown	gnl\|CDD\|179990
NC_015554.1\|WP_013784807.1\|2638111_2639914_+\|ABC-transporter-ATP-binding-protein/permease	unknown	unknown	gnl\|CDD\|227590
NC_015554.1\|WP_013784795.1\|2622837_2625360_-\|FtsX-like-permease-family-protein	unknown	unknown	gnl\|CDD\|225669
NC_015554.1\|WP_013784802.1\|2629731_2630670_-\|M14-family-metallocarboxypeptidase	unknown	unknown	gnl\|CDD\|349450
NC_015554.1\|WP_013784811.1\|2643241_2644015_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|235150
NC_015554.1\|WP_013784810.1\|2641815_2643159_-\|3-deoxy-7-phosphoheptulonate-synthase-class-II	unknown	unknown	gnl\|CDD\|366662
NC_015554.1\|WP_013784806.1\|2636842_2637811_-\|GTP-3',8-cyclase-MoaA	unknown	unknown	gnl\|CDD\|234672
NC_015554.1\|WP_013784812.1\|2644011_2644980_-\|iron-chelate-uptake-ABC-transporter-family-permease-subunit	unknown	unknown	gnl\|CDD\|235159
NC_015554.1\|WP_013784800.1\|2628128_2629067_-\|tRNA-dihydrouridine(16)-synthase-DusC	unknown	unknown	gnl\|CDD\|236713
NC_015554.1\|WP_083820154.1\|2629260_2629434_-\|DUF1289-domain-containing-protein	unknown	unknown	gnl\|CDD\|377738
NC_015554.1\|WP_013784804.1\|2634625_2636251_+\|response-regulator	unknown	unknown	gnl\|CDD\|381123

Protein	Function_ID	Function_description	E-value
NC_015554.1\|WP_041452953.1\|2636238_2636766_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|379112	pfam13302, Acetyltransf_3, Acetyltransferase (GNAT) domain. This domain catalyzes N-acetyltransferase reactions.	9.78162e-25
NC_015554.1\|WP_013784796.1\|2625375_2626074_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|226647	COG4181, COG4181, Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism].	3.61648e-109
NC_015554.1\|WP_013784811.1\|2643241_2644015_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|235150	PRK03695, PRK03695, vitamin B12-transporter ATPase; Provisional.	5.8068e-55
NC_015554.1\|WP_013784803.1\|2631954_2633364_-\|glutamate--tRNA-ligase	gnl\|CDD\|234953	PRK01406, gltX, glutamyl-tRNA synthetase; Reviewed.	0
NC_015554.1\|WP_013784808.1\|2640088_2640304_+\|DUF3820-family-protein	gnl\|CDD\|378970	pfam12843, QSregVF_b, Putative quorum-sensing-regulated virulence factor. QSregVF_b is a family of short Pseudomonas proteins that are potential virulence factors. The structure of UniProtKB:Q9HY15 a secreted protein has been solved and deposited as Structure 3npd, from pfam13652. It is predicted that these two adjacent proteins form a single transcriptional unit based on the prediction that together they interact with their adjacent protein PotD, which is the putrescine-binding periplasmic protein in the polyamine uptake system comprising PotABCD. These two adjacent proteins are predicted to be quroum-sensing-regulated virulence factors.	8.1195e-37
NC_015554.1\|WP_013784813.1\|2644982_2645450_-\|low-molecular-weight-phosphotyrosine-protein-phosphatase	gnl\|CDD\|319971	cd16343, LMWPTP, Low molecular weight protein tyrosine phosphatase. Low molecular weight protein tyrosine phosphatases (LMW-PTP) are a family of small soluble single-domain enzymes that are characterized by a highly conserved active site motif (V/I)CXGNXCRS and share no sequence similarity with other types of protein tyrosine phosphatases (PTPs). LMW-PTPs play important roles in many biological processes and are widely distributed in prokaryotes and eukaryotes.	1.71005e-75
NC_015554.1\|WP_013784797.1\|2626091_2626748_+\|arylesterase	gnl\|CDD\|238860	cd01822, Lysophospholipase_L1_like, Lysophospholipase L1-like subgroup of SGNH-hydrolases. The best characterized member in this family is TesA, an E. coli periplasmic protein with thioesterase, esterase, arylesterase, protease and lysophospholipase activity.	9.2882e-90
NC_015554.1\|WP_013784814.1\|2645544_2646267_+\|dipeptidase-PepE	gnl\|CDD\|179990	PRK05282, PRK05282, dipeptidase PepE.	2.8808e-122
NC_015554.1\|WP_013784807.1\|2638111_2639914_+\|ABC-transporter-ATP-binding-protein/permease	gnl\|CDD\|227590	COG5265, ATM1, ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones].	0
NC_015554.1\|WP_013784795.1\|2622837_2625360_-\|FtsX-like-permease-family-protein	gnl\|CDD\|225669	COG3127, COG3127, Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, permease component [Secondary metabolites biosynthesis, transport, and catabolism].	0
NC_015554.1\|WP_013784802.1\|2629731_2630670_-\|M14-family-metallocarboxypeptidase	gnl\|CDD\|349450	cd06231, M14_REP34-like, Peptidase M14-like domain similar to rapid encystment phenotype 34 (REP34). This family includes Francisella tularensis protein rapid encystment phenotype 34 (REP34) which is a zinc-containing monomeric protein demonstrating carboxypeptidase B-like activity. REP34 possesses a novel topology with its substrate binding pocket deviating from the canonical M14 peptidases with a possible catalytic role for a conserved tyrosine and distinct S1' recognition site. Thus, REP34, identified as an active carboxypeptidase and a potential key F. tularensis effector protein, may help elucidate a mechanistic understanding of F. tularensis infection of phagocytic cells. A functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs). The M14 family are zinc-binding carboxypeptidases (CPs) which hydrolyze single, C-terminal amino acids from polypeptide chains, and have a recognition site for the free C-terminal carboxyl group, which is a key determinant of specificity. Two major subfamilies of the M14 family, defined based on sequence and structural homology, are the A/B and N/E subfamilies. Enzymes belonging to the A/B subfamily are normally synthesized as inactive precursors containing preceding signal peptide, followed by an N-terminal pro-region linked to the enzyme; these proenzymes are called procarboxypeptidases. The A/B enzymes can be further divided based on their substrate specificity; Carboxypeptidase A-like (CPA-like) enzymes favor hydrophobic residues while carboxypeptidase B-like (CPB-like) enzymes only cleave the basic residues lysine or arginine. The A forms have slightly different specificities, with Carboxypeptidase A1 (CPA1) preferring aliphatic and small aromatic residues, and CPA2 preferring the bulky aromatic side chains. Enzymes belonging to the N/E subfamily enzymes are not produced as inactive precursors and instead rely on their substrate specificity and subcellular compartmentalization to prevent inappropriate cleavages. They contain an extra C-terminal transthyretin-like domain, thought to be involved in folding or formation of oligomers. MCPs can also be classified based on their involvement in specific physiological processes; the pancreatic MCPs participate only in alimentary digestion and include carboxypeptidase A and B (A/B subfamily), while others, namely regulatory MCPs or the N/E subfamily, are involved in more selective reactions, mainly in non-digestive tissues and fluids, acting on blood coagulation/fibrinolysis, inflammation and local anaphylaxis, pro-hormone and neuropeptide processing, cellular response and others. Another MCP subfamily, is that of succinylglutamate desuccinylase /aspartoacylase, which hydrolyzes N-acetyl-L-aspartate (NAA), and deficiency in which is the established cause of Canavan disease. Another subfamily (referred to as subfamily C) includes an exceptional type of activity in the MCP family, that of dipeptidyl-peptidase activity of gamma-glutamyl-(L)-meso-diaminopimelate peptidase I which is involved in bacterial cell wall metabolism.	6.29075e-57
NC_015554.1\|WP_013784810.1\|2641815_2643159_-\|3-deoxy-7-phosphoheptulonate-synthase-class-II	gnl\|CDD\|366662	pfam01474, DAHP_synth_2, Class-II DAHP synthetase family. Members of this family are aldolase enzymes that catalyze the first step of the shikimate pathway.	0
NC_015554.1\|WP_013784806.1\|2636842_2637811_-\|GTP-3',8-cyclase-MoaA	gnl\|CDD\|234672	PRK00164, moaA, GTP 3',8-cyclase MoaA.	5.09448e-163
NC_015554.1\|WP_013784812.1\|2644011_2644980_-\|iron-chelate-uptake-ABC-transporter-family-permease-subunit	gnl\|CDD\|235159	PRK03784, PRK03784, vtamin B12-transporter permease; Provisional.	1.1861e-60
NC_015554.1\|WP_013784800.1\|2628128_2629067_-\|tRNA-dihydrouridine(16)-synthase-DusC	gnl\|CDD\|236713	PRK10550, PRK10550, tRNA dihydrouridine(16) synthase DusC.	1.05407e-137
NC_015554.1\|WP_083820154.1\|2629260_2629434_-\|DUF1289-domain-containing-protein	gnl\|CDD\|377738	pfam06945, DUF1289, Protein of unknown function (DUF1289). This family consists of a number of hypothetical bacterial proteins. The aligned region spans around 56 residues and contains 4 highly conserved cysteine residues towards the N-terminus. The function of this family is unknown. Structural modelling suggests this domain may bind nucleic acids.	5.8292e-18
NC_015554.1\|WP_013784804.1\|2634625_2636251_+\|response-regulator	gnl\|CDD\|381123	cd17589, REC_TPR, phosphoacceptor receiver (REC) domain of uncharacterized tetratricopeptide repeat (TPR)-containing response regulators. Response regulators share the common phosphoacceptor REC domain and different output domains. This subfamily contains uncharacterized response regulators with TPR repeats as the effector or output domain, which might contain between 3 to 16 TPR repeats (each about 34 amino acids). TPR-containing proteins occur in all domains of life and the abundance of TPR-containing proteins in a bacterial proteome is not indicative of virulence. REC domains function as phosphorylation-mediated switches within response regulators, but some also transfer phosphoryl groups in multistep phosphorelays. Some members in this subfamily may contain inactive REC domains lacking canonical metal-binding and active site residues.	4.9292e-32

>NC_015554.1|WP_013784803.1|2631954_2633364_-|glutamate--tRNA-ligase
MSVVTRFAPSPTGYLHVGGARTALYSWLLAKNNGGEFVLRIEDTDIERSTEEAKQAILDGMQWLGLTWDTGPIYQTDRFDRYKDLIQQLLDEGKAYKCFMSAEELDAIREAQKDRGEKPRYPGTWRDRTDHPEGEPFVIRFKTPLEGTVVITDHVRGKIEINNSELDDLIIQRTDGTPTYNFCVVVDDWDMGITHVVRGEDHINNTPRQINILQALGAPVPEYAHVSMILGDDGKKLSKRHGAVSVMQYRDDGFLPQAVLNYLVRLGWSHGDQEIFTLDEMIELFSLDAIGQSASAFNTEKLIWLNQHYIKSLPASEVATHLKWHFDGLGIDLTAGPALESVIAIQADRVKTLKELAEISTYFYQDYEEFDANAAKKHLRPVARGPLERVKEKLMAIEAWEPENIQAAINATAEELEVGMGKVGMPLRVATTGSGNSPSLDVTLNLLSKEKVGERIDKALTFIANRENS
>NC_015554.1|WP_013784802.1|2629731_2630670_-|M14-family-metallocarboxypeptidase
MQNYPIGTPGKPWGEEEKEEWKQRQTIKRSYNDEVLKQLGSIPEGFELKQYGALPYDESRYPLYAIVPKDMPKNIPKDMPTNIDAAKPAVLVTGGVHGYETSGVQGALQFINTKLSDYAEDFTIIVVPCVSPWGYETINRWDQYALDPNRSFYPNSPAPESAQLMAFVESLNLPFTLHIDLHETTDTDNSEFRPALAARDATTHDNWNIPDGFYLVANTPNPQKQFQEAIIDAVKQITHIAPADESGKIIGADLLSEGVICYDKKALYLCGGMTGAAYVTTTEVYPDSANATAENCNAAQVAVITAALKYIK
>NC_015554.1|WP_013784801.1|2629430_2629664_-|hypothetical-protein
MFTFSALIYDGYKQQLVTGDYEDKAQFDAFLNTKFGVHVCMWTAKEPTQKVIDVMLQATLVAKENASNKLNLKAKYS
>NC_015554.1|WP_083820154.1|2629260_2629434_-|DUF1289-domain-containing-protein
MSITSPCIANCKLDEDEVCTGCKRTIKEITNWSNYSTQQKQNILTRLEQQKLDTHSS
>NC_015554.1|WP_013784800.1|2628128_2629067_-|tRNA-dihydrouridine(16)-synthase-DusC
MKIMLAPMEGVVDHLMRDMLTHVGGFDQCVTEFVRVVDQKLPNKTFYKLCPELHNGGKTPNGVPVRVQLLGQHPQWLAENAHTAVDLGSPGVDLNFGCPAKTVNKSKGGAVLLKETQALYDIVKAVRDAVPASQPVSAKIRLGFEDKSLAVENAIAITEAGASELVVHARTKTEGYKPPAYWDWIAKIKQNTDIPLVANGEIWNEEDGKRCQEQSACTNLMVGRGALAMPNLARCIRDGEPPMAWEDVAALLIRYSGYEIYGDKGKYYPNRIKQWCGYLKRQYPEAELLFNDIRRLSKSQEIVDVLARQASH
>NC_015554.1|WP_041452557.1|2627081_2628062_+|hypothetical-protein
MPLPRYKQVNLEVTPYYHCTSRCVRQSFLCGVDAITGKNYNHRRQWIVDRLHRLTKTFAIDLCAYAVMHNHTHVVVHIAKARAEHWSMDEVLLRWKSFYRCPSLVQRYLDEESRGSLSEVELQKVEELSEIYRHRLYSVSWFMRLLNEFIARKANKEDECTGYFWERRFKSQAILSENALAVTMAYTDLNPIRAGIAKTSEQSNFTSIQYRINALKVNKVPARLMPFNDQVPVNEISLPFKLSDYLVLVDETGRVMRPDKKGAIPQKMKPILDRLKLSNNSWITLSTKLERKFTGPIGSAERICVFASACEYGRKPNIANARRYLQ
>NC_015554.1|WP_013784798.1|2626816_2627002_+|hypothetical-protein
MDVSSSTSTPVSNVLQSPQQEPQRQVQQRASQQTEVSAPQQTQQAAPASDSRVGSRIDTYV
>NC_015554.1|WP_013784797.1|2626091_2626748_+|arylesterase
MIYRFRSAVLFTLLLLIPLSALSDQTDTIVPNNSAKLLILGDSLSAAYGLDQQEGWVSLLQKRWRDENISIDIVNAAVSGETTDGGLARLPRLIEQHTPSHILVELGGNDGLQGHSISKIRNNLSAIVSIAKSDNTTVFVQDMQIPTNYGKRYTQMFSDTFDTVSEQHEVTKIPFFLEDIALQKDLMQRDGIHPNAKAQPMIVEFMFEKLTPLIMNNQ
>NC_015554.1|WP_013784796.1|2625375_2626074_-|ABC-transporter-ATP-binding-protein
MIKTSKVTKSVNTSEGKLEILHPISFEVKSGESVAIIGASGSGKSTLLGLLAGLDEVSKGEIHLDGEPLHTMDEEARAVLRGQKVGFIFQSFMLVQSLTAIENVMLPAEIAGLDNPKQMASKILEQVGIGHRASHYPNQLSGGEQQRVAIARAFITSPKILFADEPTGNLDATNSHKVEELLFALNREKGTTLVLVTHDNELAAKCDRQLTMQAGVLTESTPVSPRQRSEAV
>NC_015554.1|WP_013784795.1|2622837_2625360_-|FtsX-like-permease-family-protein
MSMTSTLAWRLFRHEAKRGELTIILLAIVLSVGAVLSLSLFSERLQGALKERSAAFIAADAQLRSDTPINDTWLQQARDEGLNTAKQVTTRSMVFHRDEMSLVDLRAVNENYPLKGTVNITDVPFGQKEAATDLPKPGEVWLQSLLFQTLKLSLGDSIEIGDAEFTVTKVLVDIPDAGFSVFNTEPIALIRLSDLDATAITGPGSRARYVGYFEGERSAISNFYDWLSPNLQDDLHNWRTVEDDESAIGRSVASAERYFLLASLLAIVLAAVSIAVAAQRYSQRHFDPVAIMKTLGATKQVIRRIYLLQILFITGLGIIIGLIMGFIGQQVVVWLVAEQVDVALSIWHWRPVLIAVFTGATCSLLFSLYPLMQLFSIPPLRVLRRDLSTNLRSRTIQYVASGGAIFLLMWIYSQDLMISLILFGSGVVLVAGLLGATFLLIAAGRKFGSGKMGPWQLAWARIKRRSMENSVQLISFSVTTMLLLVVLVMRNDMVSQWRSQLPEGTPNYFLINITGDQKTELDTHFKSNGITIEEFYPVIRGRFVAVNDDSVNTEVSKEEDSNTEGRQGLGREANLTWSNSLQKENEITSGTWHGDNPDALDEGVFAVSVETDVGERLGIELGDMLTFNVGSEIVKTKVTSFRKVNWQTMQPNFFFVIQPEAMAAFNPTYITSFYLPEAQKSQLTTLLKPFASITMFDVDARINQLRDIVNQVSVAIEFILVLVLVAGSLVLIAQVQASMDERRQELAILRTLGAKGSLIRKSVVFEFVIIGVVAGFMAALANELSLFMLQTNVFQMTASLHLEYWVIAPIVGAIVVGALGAIGCWRLLTLNTSALLRKMV
>NC_015554.1|WP_013784804.1|2634625_2636251_+|response-regulator
MNLQLARQTRLLIAEDQALAKSHMKYALEQLGFQHIDYVDRAANALTSLRTRQYDVIVCAYDLRHEQGGYNLFEQLKTEKIIPLTTGFIFTSADTAIDVVHAIIEMQPDEFLAKPFSVNELDKRLSKVVTRKKMFHDVYRYMDEQNPEQALKELEFILVEPKNAEHFPLALKTKGDLLLLNRQFENAKLFYQSIINIQNFTWAKLGLVQCYIHLDEFDDAERDLIQLALQPESMLSAYDLLAELQIKLEAYDEALECVNVASDISPRNVMRHITAVQLARLTHDYKGQFNSAKKVVRFGKNSVHDTPEMYLSVARAGIDFAMTAETSQTNKIIKQSNEYLRQLKSAYPKVNLDHQLQVISARIHYLKDENDKAKDLLDALDIDNLEEQSVETLLDSAKAFHDLGLRGSALKLLDKATLRQKELDAPNSLLSRYINQEVEEKTAISISPKNLNDVAVVQYKRGELAKSYKTFEQAFRVMPRNPAIALNLLQASAMRRSREGKAEGNMNAVMKRCRFTLESASLSEEQSQRYETVKGLLDQVV
>NC_015554.1|WP_041452953.1|2636238_2636766_-|GNAT-family-N-acetyltransferase
MFIEDSARLSFHYITDADVEFLWELDQDEEVMRFISDGQKTSREDITNTFVPRFQAYSNPALGWGLWRVQEKESEEDIGWVLVRPFGFFTKNPEIDNIELGWRFKQASWGKGYATEAAMQVKDALYQIGIDKFCAMAKPENLNSIKVMEKIGMTFSHEIEYKDNLYQEKVVVYTT
>NC_015554.1|WP_013784806.1|2636842_2637811_-|GTP-3',8-cyclase-MoaA
MLEDSFGRQFHYLRLSVTEACNFRCQYCLPDGYQGPSSEHFLSLGEINTLLSAFSGLGTSKVRLTGGEPTLRRDFLDILSATANTPGIKRVAMTTHGGRMAEHAAAWKQAGLHQVNVSIDSLDPRQFAAITGQDKLKQVLAGLDAAVEAGLDVKVNSVLLNDFSDARLNRFLDWLKTMPVTLRFIELMETGDTTHFFKAQHQGGTPLKQTLIDAGWQPMVRRKDAGPAQEFFHPDYAGKIGLIMPYSKDFCKSCNRLRVAANGKLHLCLFSEHGIDMRHLLADQDVVGLQQFLVECLGEKHATHFLHEGNTGATKHLAMLGG
>NC_015554.1|WP_013784807.1|2638111_2639914_+|ABC-transporter-ATP-binding-protein/permease
MRKNRFPLNENEPIKWQVLKQLWPYLLEFKGRVALALLCLVAAKLASIGLPYVLKYTVDSLNGDVEALAIAVPISLIIAYGALRLTNVLLGEVRDTLFGRVTERAMRRLGLKVFNHLHNLDLGFHLNRRTGGLSRDIERGTNGVSFLMRFMVFNIVPTLLEIGLVVILLLIQFGWSFAMIIVVSVISYVMFSMKATDWRTRFVQQMNEADSTTNSRAVDSLLNFETVKYFNNERFEANRYDTDLAGWEKARRKNRLSLFALNGGQASIIALAMTAMMANAAYGVMEGEMTIGDFVLINAFTMQIFMPLNFLGFVYREIRGSLANIQNLFSLLSQKPAIEDKPNATHLSAKQASIRFSNVQFHYQQARPILKGISFEVPSGAKIAVVGESGAGKSTIMKLLFRFYDPTEGGIFINGQDIRELSQHSLRSHIGIVPQDTVLFNTSLVENIRYGNPDASDEEVTHAIKLAHLTQFVESLPDGLDTTVGERGLKLSGGEKQRVAIARALLKGAPIMIFDEATSSLDSQSEQAILGALRDAAKGHTSLVIAHRLSTIVDADTILVLSKGMIAEHGTHETLLAQQGIYNRLWATQQRDSNHEEMGQ
>NC_015554.1|WP_013784808.1|2640088_2640304_+|DUF3820-family-protein
MDPEAIKSAINQTMPFGKYAGRRLFHLPEPYLVWFNKQGFPEGKLGQQLALMYEIKLNGLESVVEPLLNDD
>NC_015554.1|WP_013784810.1|2641815_2643159_-|3-deoxy-7-phosphoheptulonate-synthase-class-II
MSNWQVDSWRQKPILQQPEYDDAAQLKQVEHTLSTYPPLVFAAEARDLRRQLGEVSLGKGFLLQGGDCAESFDEFNAPKIRDTFKVLLQMAIVLTFAGRCPVTKVARMAGQYAKPRSSNFETRDGVTLPSYRGDIINSFEFNEAARRPDPNRLIEAYHRSASTLNLLRAFSQGGLADLHEVNRWNMAFVENNPLKERYHDMAVRIQDTLSFMDVIGINSQSSPTLHETSLFTSHEALLLNYEQALTRIDTLTGKPYDCSAHMIWIGERTRQLDHAHIEFFRGIHNPIGVKVGPSMQEDELIRLIDALNPNNDPGRLTLITRMGADNLADNLPRLLRRVKAEGRHVVWSSDPMHGNTFSASSGYKTRNFDAILREIKQFFQAHSDEGTHAGGIHLEMTGQHVTECTGGAYEISDEDLAQAYKTQCDPRLNADQVLEMAFLVADHLRNA
>NC_015554.1|WP_013784811.1|2643241_2644015_-|ATP-binding-cassette-domain-containing-protein
MSPVISLRNINVNKRLTNITLDINKGDCVHILGPNGAGKSTLLSIMAGVLPAEHGEALLLKQPLPQWPLSALATFRTLLAQQSEAVFAVSVREYLSFFSSEQAFELPSLLEATLEVTGFYQTPLNRLSGGERQRVEICRALLQVWPAIKRGEALLLLDEPLQGVDIRHQYALMALFQALCNKGNTLVLSSHDISLSANYSYKMLLMKLGTSVSFGLPESVLSVKNLEHTFDCHFAVNKRDDFLDIQVCAPIVLDQMW
>NC_015554.1|WP_013784812.1|2644011_2644980_-|iron-chelate-uptake-ABC-transporter-family-permease-subunit
MHTVLKGRAATFLLCSVTFLLTVGVLATVWLTDSPTALKQHITLQLQIPLIITAILVGSVLAVSGATLQIVLRNPLADPGIIGITSGASLVAASLLLLTPLWAQPYLHYILPLGCFIGALITTFVIYRLARKLLGSAVAVILSGIAISTLSGAVIAWLYMFSDAQSLRNLTFWLMGSVYQTTWPILWLSGPLIVGSLWYQIRQSAKFNRLYAGDLAALSSGVNVQRLTERSLIATAVGVGAAVSIAGAIAFVGLLVPHILRLILGHDNRILLPASALCGASLLLVVVLMSELTRAITLPVSMITATLGGPLLIWALLKGQLR
>NC_015554.1|WP_013784813.1|2644982_2645450_-|low-molecular-weight-phosphotyrosine-protein-phosphatase
MGQNTSVLFVCLGNICRSPTAEAVFLAKAARAGLKLDVGSAGTHGYHIGKQPDKRSQAVGVERGYSFKGLKCRRVDDKDFEKYDYILAMDNSNLDNLREMSPPEHHEKIHLFLDFANSEDKEVPDPYYGGKRGFELVLDLIEEASDGLIAHIQQS
>NC_015554.1|WP_013784814.1|2645544_2646267_+|dipeptidase-PepE
MTAHVLMLSSSRQGDEAYLEHARSLILAHLGGIRDLLFIPYAAVTQSYDNYVSAVATALPECNVTGIHTFDHPVKVINNAKANNQAIVVGGGNTFHLMHTIYQQNLLEPLQHAIAEGTPYIGWSAGSNICGQSIRTTNDMPIVEPESFNALNVVPFQLNPHYSDYHPPGHNGETRDQRLAEFTVLNPTTPVVAIREGTALSLSKQQLTLVGEKGGFIFLGNEKRPIAPNENLTELLNSSL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_015554_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_015554_3

3893736-3893848

Orphan

Consensus_repeat	Method
AGCTTTTGCAGGTATTAGGTATGCCTACTGTTATGCATAGCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_015554_3

>merge|NC_015554|3|3893736-3893848|CRISPRCasFinder
AGCTTTTGCAGGTATTAGGTATGCCTACTGTTATGCATAGCCCCATCTTTTCAGATAAAAGTTTGATATACAGCTTTTGCAGGTATTAGGTATGCCTACTGTTATGCATAGCC

>NC_015554|3|3|3893736-3893848|CRISPRCasFinder
AGCTTTTGCAGGTATTAGGTATGCCTACTGTTATGCATAGCC	CCATCTTTTCAGATAAAAGTTTGATATAC
AGCTTTTGCAGGTATTAGGTATGCCTACTGTTATGCATAGCC

Protein	Signature genes	Signature genes Name	Protein_function
NC_015554.1\|WP_013785876.1\|3899491_3900934_+\|SLC5-family-protein	unknown	unknown	gnl\|CDD\|271362
NC_015554.1\|WP_148259195.1\|3887024_3888650_-\|pilus-(MSHA-type)-biogenesis-protein-MshL	unknown	unknown	gnl\|CDD\|274176
NC_015554.1\|WP_013785866.1\|3886107_3887022_-\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|132060
NC_015554.1\|WP_013785864.1\|3883100_3884837_-\|type-II/IV-secretion-system-protein	unknown	unknown	gnl\|CDD\|225363
NC_015554.1\|WP_041452602.1\|3908389_3909568_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340863
NC_015554.1\|WP_013785877.1\|3900946_3902488_+\|tryptophan-7-halogenase	unknown	unknown	gnl\|CDD\|368139
NC_015554.1\|WP_013785870.1\|3889674_3890304_-\|mannose-sensitive-agglutinin-biogenesis-protein-MshI	unknown	unknown	unknown
NC_015554.1\|WP_083820163.1\|3903016_3903268_+\|SapC-family-protein	unknown	unknown	gnl\|CDD\|377801
NC_015554.1\|WP_013785868.1\|3888699_3889041_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|339769
NC_015554.1\|WP_013785869.1\|3889033_3889678_-\|type-II-secretion-system-protein-M	unknown	unknown	gnl\|CDD\|377391
NC_015554.1\|WP_013785881.1\|3905612_3906728_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|370767
NC_015554.1\|WP_013785865.1\|3884833_3886111_-\|tetratricopeptide-repeat-protein	unknown	unknown	gnl\|CDD\|276809
NC_015554.1\|WP_013785878.1\|3902525_3903005_+\|SapC-family-protein	unknown	unknown	gnl\|CDD\|377801
NC_015554.1\|WP_013785874.1\|3893983_3894742_-\|DeoR/GlpR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|182827
NC_015554.1\|WP_013785873.1\|3892041_3893568_-\|glycerol-3-phosphate-dehydrogenase	unknown	unknown	gnl\|CDD\|237027
NC_015554.1\|WP_013785875.1\|3894899_3896384_+\|glycerol-kinase-GlpK	unknown	unknown	gnl\|CDD\|198361
NC_015554.1\|WP_013785882.1\|3906950_3908228_-\|dienelactone-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|226651
NC_015554.1\|WP_013785871.1\|3890300_3891266_-\|hypothetical-protein	unknown	unknown	unknown
NC_015554.1\|WP_126872568.1\|3891358_3891922_-\|histidine-phosphatase-family-protein	unknown	unknown	gnl\|CDD\|366010
NC_015554.1\|WP_013785880.1\|3903424_3905569_+\|alpha-galactosidase	unknown	unknown	gnl\|CDD\|225882

Protein	Function_ID	Function_description	E-value
NC_015554.1\|WP_013785876.1\|3899491_3900934_+\|SLC5-family-protein	gnl\|CDD\|271362	cd10328, SLC5sbd_YidK, uncharacterized SLC5 subfamily, Escherichia coli YidK-like; solute binding domain. Uncharacterized subfamily of the solute binding domain of the solute carrier 5 (SLC5) transporter family (also called the sodium/glucose cotransporter family or solute sodium symporter family) that co-transports Na+ with sugars, amino acids, inorganic ions or vitamins. One member of the SLC5 family, human SGLT3, has been characterized as a glucose sensor and not a transporter. This subfamily includes the uncharacterized Escherichia coli YidK protein, and belongs to the solute carrier 5 (SLC5) transporter family.	0
NC_015554.1\|WP_148259195.1\|3887024_3888650_-\|pilus-(MSHA-type)-biogenesis-protein-MshL	gnl\|CDD\|274176	TIGR02519, related_to_type_II_protein_secretion_protein, pilus (MSHA type) biogenesis protein MshL. Members of this family are predicted secretins, that is, outer membrane pore proteins associated with delivery of proteins from periplasm to the outside of the cell. Related families include GspD of type II secretion (TIGR02517), the YscC/HrcC family from type III secretion (TIGR02516), and the PilQ secretin of type IV pilus formation (TIGR02515). Members of this family are found in gene clusters associated with MSHA (mannose-sensitive hemagglutinin) and related pili, and appear to be the secretin of this pilus system. [Cell envelope, Surface structures].	9.75232e-78
NC_015554.1\|WP_013785866.1\|3886107_3887022_-\|AAA-family-ATPase	gnl\|CDD\|132060	TIGR03015, pepcterm_ATPase, putative secretion ATPase, PEP-CTERM locus subfamily. Members of this protein are marked as probable ATPases by the nucleotide binding P-loop motif GXXGXGKTT, a motif DEAQ similar to the DEAD/H box of helicases, and extensive homology to ATPases of MSHA-type pilus systems and to GspA proteins associated with type II protein secretion systems. [Protein fate, Protein and peptide secretion and trafficking].	1.42761e-63
NC_015554.1\|WP_013785864.1\|3883100_3884837_-\|type-II/IV-secretion-system-protein	gnl\|CDD\|225363	COG2804, PulE, Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion].	0
NC_015554.1\|WP_041452602.1\|3908389_3909568_-\|MFS-transporter	gnl\|CDD\|340863	cd06173, MFS_MefA_like, Macrolide efflux protein A and similar proteins of the Major Facilitator Superfamily of transporters. This family is composed of Streptococcus pyogenes macrolide efflux protein A (MefA) and similar transporters, many of which remain uncharacterized. Some members may be multidrug resistance (MDR) transporters, which are drug/H+ antiporters (DHAs) that mediate the efflux of a variety of drugs and toxic compounds, conferring resistance to these compounds. MefA confers resistance to 14-membered macrolides including erythromycin and to 15-membered macrolides. It functions as an efflux pump to regulate intracellular macrolide levels. The MefA-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	2.55381e-17
NC_015554.1\|WP_013785877.1\|3900946_3902488_+\|tryptophan-7-halogenase	gnl\|CDD\|368139	pfam04820, Trp_halogenase, Tryptophan halogenase. Tryptophan halogenase catalyzes the chlorination of tryptophan to form 7-chlorotryptophan. This is the first step in the biosynthesis of pyrrolnitrin, an antibiotic with broad-spectrum anti-fungal activity. Tryptophan halogenase is NADH-dependent.	2.68147e-116
NC_015554.1\|WP_083820163.1\|3903016_3903268_+\|SapC-family-protein	gnl\|CDD\|377801	pfam07277, SapC, SapC. This family contains a number of bacterial SapC proteins approximately 250 residues long. In Campylobacter fetus, SapC forms part of a paracrystalline surface layer (S-layer) that confers serum resistance.	1.02529e-12
NC_015554.1\|WP_013785868.1\|3888699_3889041_-\|hypothetical-protein	gnl\|CDD\|339769	pfam16537, T2SSB, Type II secretion system protein B. This is the B protein from some operons of bacterial secretion systems of type II. The exact function of the B protein is not known, though in the case of Vibrio cholerae there is a fusion protein between proteins A and B that includes an AAA domain, a PG_binding domains well as this domain at the C-terminus. Many of the other species have no A or B domain genes in this operon. The type II secretion pathway is conserved in Gram-negative bacteria that are prevalent in bacterial pathogens of plants (Pseudomonas fluorescens, Erwinia or Xanthomonas species), animals (Aeromonas hydrophila) and humans (Klebsiella oxytoca, Pseudomonas aeruginosa, Vibrio cholerae or Legionella pneumophila). Typical type II secretion systems (T2SSs) are encoded by a set of 12 to 16 gsp (general secretion pathway) genes organized into large operons including the conserved 'core' genes denoted C to O and in some bacterial species, as indicated above, extra gsp genes such as gspAB, gspN or gspS. A different nomenclature is used for Pseudomonas T2SSs, so the B gene is referred to as the P protein.	4.33717e-05
NC_015554.1\|WP_013785869.1\|3889033_3889678_-\|type-II-secretion-system-protein-M	gnl\|CDD\|377391	pfam04612, T2SSM, Type II secretion system (T2SS), protein M. This family of membrane proteins consists of Type II secretion system protein M sequences from several Gram-negative (diderm) bacteria. The precise function of these proteins is unknown, though in Vibrio cholerae, the T2SM (EpsM) protein interacts with the T2SL (EpsL) protein, and also forms homodimers.	0.0015526
NC_015554.1\|WP_013785881.1\|3905612_3906728_-\|hypothetical-protein	gnl\|CDD\|370767	pfam09976, TPR_21, Tetratricopeptide repeat-like domain. This family resembles a single unit of a TPR repeat.	3.61499e-05
NC_015554.1\|WP_013785865.1\|3884833_3886111_-\|tetratricopeptide-repeat-protein	gnl\|CDD\|276809	sd00006, TPR, Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.	3.35162e-09
NC_015554.1\|WP_013785878.1\|3902525_3903005_+\|SapC-family-protein	gnl\|CDD\|377801	pfam07277, SapC, SapC. This family contains a number of bacterial SapC proteins approximately 250 residues long. In Campylobacter fetus, SapC forms part of a paracrystalline surface layer (S-layer) that confers serum resistance.	4.42117e-31
NC_015554.1\|WP_013785874.1\|3893983_3894742_-\|DeoR/GlpR-family-transcriptional-regulator	gnl\|CDD\|182827	PRK10906, PRK10906, DeoR/GlpR family transcriptional regulator.	6.37693e-116
NC_015554.1\|WP_013785873.1\|3892041_3893568_-\|glycerol-3-phosphate-dehydrogenase	gnl\|CDD\|237027	PRK12266, glpD, glycerol-3-phosphate dehydrogenase; Reviewed.	0
NC_015554.1\|WP_013785875.1\|3894899_3896384_+\|glycerol-kinase-GlpK	gnl\|CDD\|198361	cd07786, FGGY_EcGK_like, Escherichia coli glycerol kinase-like proteins; belongs to the FGGY family of carbohydrate kinases. This subgroup is composed of mostly bacterial and archaeal glycerol kinases (GK), including the well characterized proteins from Escherichia coli (EcGK), Thermococcus kodakaraensis (TkGK), and Enterococcus casseliflavus (EnGK). GKs contain two large domains separated by a deep cleft that forms the active site. This model includes both the N-terminal domain, which adopts a ribonuclease H-like fold, and the structurally related C-terminal domain. The high affinity ATP binding site of EcGK is created only by a substrate-induced conformational change, which is initiated by protein-protein interactions through complex formation with enzyme IIAGlc (also known as IIIGlc), the glucose-specific phosphocarrier protein of the phosphotransferase system (PTS). EcGK exists in a dimer-tetramer equilibrium. IIAGlc binds to both EcGK dimer and tetramer, and inhibits the uptake and subsequent metabolism of glycerol and maltose. Another well-known allosteric regulator of EcGK is fructose 1,6-bisphosphate (FBP), which binds to the EcGK tetramer and plays an essential role in the stabilization of the inactive tetrameric form. EcGK requires Mg2+ for its enzymatic activity. Members in this subgroup belong to the FGGY family of carbohydrate kinases.	0
NC_015554.1\|WP_013785882.1\|3906950_3908228_-\|dienelactone-hydrolase-family-protein	gnl\|CDD\|226651	COG4188, COG4188, Predicted dienelactone hydrolase [General function prediction only].	3.78538e-21
NC_015554.1\|WP_126872568.1\|3891358_3891922_-\|histidine-phosphatase-family-protein	gnl\|CDD\|366010	pfam00300, His_Phos_1, Histidine phosphatase superfamily (branch 1). The histidine phosphatase superfamily is so named because catalysis centers on a conserved His residue that is transiently phosphorylated during the catalytic cycle. Other conserved residues contribute to a 'phosphate pocket' and interact with the phospho group of substrate before, during and after its transfer to the His residue. Structure and sequence analyses show that different families contribute different additional residues to the 'phosphate pocket' and, more surprisingly, differ in the position, in sequence and in three dimensions, of a catalytically essential acidic residue. The superfamily may be divided into two main branches. The larger branch 1 contains a wide variety of catalytic functions, the best known being fructose 2,6-bisphosphatase (found in a bifunctional protein with 2-phosphofructokinase) and cofactor-dependent phosphoglycerate mutase. The latter is an unusual example of a mutase activity in the superfamily: the vast majority of members appear to be phosphatases. The bacterial regulatory protein phosphatase SixA is also in branch 1 and has a minimal, and possible ancestral-like structure, lacking the large domain insertions that contribute to binding of small molecules in branch 1 members.	3.87084e-09
NC_015554.1\|WP_013785880.1\|3903424_3905569_+\|alpha-galactosidase	gnl\|CDD\|225882	COG3345, GalA, Alpha-galactosidase [Carbohydrate transport and metabolism].	2.58205e-155

>NC_015554.1|WP_013785873.1|3892041_3893568_-|glycerol-3-phosphate-dehydrogenase
MNQNTNSTQTVDVLVVGGGVNGAGVALDAAGRGLSVALCEKGDLAGATSSSSSKLIHGGLRYLEHYEFRLVKEALAEREVLLEKAPHIMWPLRFRLPHQKHLRPAWMIRIGLFMYDSLAKRNVLPRSKKMSTSPTGPLVNDITTCFEYSDGWVDDARLVVLNALAAQDKGASIYTRTECISAEKQDKLWKVTLKDALGKTFTINAKAVVNAAGPWAVSFLDRLADTKNPNAMRMVKGSHFIVPKLYDTEEAYILQNKDGRIVFVIPYEDDFSLVGTTDENYVGEPSQAAISEAETEYLIDVVNTYFKTKIDESDIVHSYSGVRPLLEEKNASAQELTRDYKVELSGTESSPILLNIFGGKITTYRKLSEHAVDKLTSLFPKAGKAWTKNVALPGGAFTNKADLIKQLQQDYPWLPESVGVRYARQYGMLCVKFLEGKADLGSMGENFGADMYQAEVDYLIDHEWAMSLEDVIWRRTKHGLRLSQSEQTNLESYITTQVSKSVDMQQSA
>NC_015554.1|WP_126872568.1|3891358_3891922_-|histidine-phosphatase-family-protein
MEEDRMKEIILIRHGKPLSAHNNKLSAGEFTNWVRQYNQSPLDSAHYPNEKREFAAHHIIASPLKRAQLSANYYMGEPAVDVIPELKEMDIPYYRLPLRLKAWHWVLLNRLMWICGKAGRFESFVEAKNRVGKAAKELEKKAEQHAQIVVFGHGMSNRYIRILLAKRGWEITEKNNGYWGVTRLIKN
>NC_015554.1|WP_013785871.1|3890300_3891266_-|hypothetical-protein
MHIGWRQYLKQKFRRVPKHHVLGVSVDAESVSFCIVKREQDSIVLVDEETVTPEKWGEKLHTWLKEKNLLGISTCVCMSHSWYNALQLDRPNVEDNEVHGALQWSVAEILGSDKAYVFDYVDLPVPLAGTNKVNVFALPRSVIADVVSHIQFADVTLKEITTAELALCELMPSMESATVLLTQEAGEEVVLNVVKDGNLYSSRRLKGFENIGSFSQEELEMGLLDNLGVQIQRSMDHFESQLRQPPIRSVLFRLDSPHSTTLKMQLSQLIPAQIDQLISPIQVSEDIDVYRLNLVSLSAAFCALVPQPIAPPTMSTTGELK
>NC_015554.1|WP_013785870.1|3889674_3890304_-|mannose-sensitive-agglutinin-biogenesis-protein-MshI
MRQRINLYWPEFKPEFRWLNVGTMLVVWLLTLLIVVLVTMRLSATVQKQSAVLNQAQERTIQLDEELAMAKSQLAERKPSQVLSEEHETLNLSVSQKTLLIEELSGQETREQAPFYQALNGFADVADGSLWLTRFVVRSERLSLYGKVNDPGALPAWLKRLGNATYFEEKEFEVIKLSRDINKDGNPNGVLSFELLSEPADEDVEVAPE
>NC_015554.1|WP_013785869.1|3889033_3889678_-|type-II-secretion-system-protein-M
MSKDSLNSKLAAMSPRELIMLFVAGLVVIVLVGFTFFIEPLWKKSQSIQRRLASEATQTSSLSQQLQIYLEALEEDPDKALISSIAELEEKDAILERRFRDELKTLVTPDEMPALVSRMFDDAQQVRLESMATIAPVNIFAGREDLSALTLYRHGLTLTFSGSYFDIRDFLQRAQKENIKLYWEAMDYQVSDYPNGKVTIEFYTVSTQRTFIRV
>NC_015554.1|WP_013785868.1|3888699_3889041_-|hypothetical-protein
MFKLILTIVLTFSSFLLFAQQDPTRPGNTKMTGIGATQQGEFSLSAIMYSAQSKHAIINNKVVREGDDIADGKVESITKNTVVILKNRYAKPVRTVLSLAPITTIKKNVSEDL
>NC_015554.1|WP_148259195.1|3887024_3888650_-|pilus-(MSHA-type)-biogenesis-protein-MshL
MAGCQSTSEPQQQLVSKVEQNLQEQIDAEKARKSSQLNTPVPIPSAVSAALAAPESVSSTNSLFGPQRFDVNAQSVPISAFFAGLVEGTPYSVAIHPQVTGSVSLQLKQVTIDEVMSLLSDLYGYDIARSGTVFKVRAAGMRTETFAVNYLYMQRNGATQTSITSGGVTQNNNQNNNNGSSSGSYSGNFSSSESYGSQNNSNTNGTTINTRTETDFWADLKVSLEAMVGKENGRAVFVTPQASLVTVRAMPDELSDIRRFLKTSEANLTKQVILEARILEVELNDGYQQGINWNEILANTGNTDFSLSTTAGTLGNDISATLGGVTSLAFLNKDFSGVLSLLSTQGNVQVLSSPRVTAINNQKAVIKVGDDEYFVTDVSSDSTVTSTTTSISPDIELTPFFSGIALDVTPQIDDKGTVLLHVHPSVIETAEQQKVVTMDDEQIVLPLAQSTIRESDTIIRAGSGEIVVIGGLMQTSQTDVVSKTPLLGDIPLFGELFKNRQVSETKKELIILLKPTVVGHDTFEQQLETSRQNMVDWLYVD
>NC_015554.1|WP_013785866.1|3886107_3887022_-|AAA-family-ATPase
MYLYHFGIRELPFTLTPHTSFFYGLPSHIEASEVLLTALKSGEGFIKVTGEVGTGKTLICRKFLNELPAHFQSAYIPNPLLSPDELRRAVASELGVDIGQTCDQQRFTQCIQERLIDINAQHRSAVLVIDEAQALPVESIEALRLMTNLETESRKLLQVVLFGQPELNQKLSMPELRQLKQRITFSYSLSHMDTDQIYHYVKHRLVVAGHTGEEVFDLACCRLMFMATKGTPRLVNVLCHKAMMLAYGEGKYNVDVSHIKLAIADTEATTLPWYASFALWPSLVAAGVVVSVTLASVLEFGGMA
>NC_015554.1|WP_013785865.1|3884833_3886111_-|tetratricopeptide-repeat-protein
MSVVNKMLKDLEAREGVEQPQARYEPPQKKSVSALTIVVFLLVIVTIALAVWVLLNPAPSVSSAVLPSESMPITDTNEVSLTEPSPAILPTSLTASAQPSTESAEKERAEKETAEKVSAEKVSAEKGSVEASLSQNDDTNTPQNLSKPMQASAQVAQDTSSEKATATEGEYLKSPSSRAASDASINPTSNPDNSPTGIFVAKTVSKSVDSLKTAESAPVPRFSKQIDNNKNAPAIDEQVRLALDNNDYNTAIRLMQQKAQSHPTDISVKKKLASLLFASGQVEQAQALLQGMLVNSPDDHSVRLMLSRLYVKQGLTTLAIENANGAVSSPRNPLSVELLSFRANLLQQHGEFDKSLNDYLVLTKRRPLEPKWWLGAAISADSLHQSALAFHAFSQVVKIDTQQTLSPNVHHYAQERMARLREVVK
>NC_015554.1|WP_013785864.1|3883100_3884837_-|type-II/IV-secretion-system-protein
MNKPRVRLGDLLVQHNLISADELMTALSEQKSTGRKLGATLISMGLVTEHQMLELLSRHLNVPLIDIDQYRVNQQAVLLLPEIQARRYRALVIDDKGDSLLVAMSDPADLTAVDHLSETLNRQIELAVVSEQQLFTAYDTFYRKTQEIASFAQELAEEYDTEDNFNIELGGAGDQDTTVARLLQSIFEDAVIAKASDIHIEPDENQLRIRQRVDGVLQETVIPEKSIAAALVLRLKLMAGLDISEKRLPQDGRTQIKVKGHKIDVRLSTMPVQGGESVVMRLLDQSAGILTLEQTGMPSAQLTRFRNLLRRPHGMILVTGPTGSGKTTTLYGALSELNTAKSKIITVEDPVEYRLPRINQVQVNPKINLTFSNVLRTTLRQDPDIIMVGEMRDQETVEIGLRGALTGHLVLSTLHTNDAISSVVRLLDMGAPGYLVASSLRGIIAQRLVRRICDNCTTSYTPTDDEKVWLNGIDENAADVAFKQGRGCQKCNQTGYRGRIGVFELLEMTENMMNYLKSSDIQGFSDAATKSTGYRSLPQSALTYAKMGVTSVEEVLKLVEMVAQDAPSSEITDDTTVQ
>NC_015554.1|WP_013785874.1|3893983_3894742_-|DeoR/GlpR-family-transcriptional-regulator
MNQTQRHEKIVSFIKQNGFMSIDDLVTRCDVTPQTIRRDLNQLAEAGIVSRYHGGAGLNRSWENTPYQERKTQNSEVKERIAEAVASMIPDGASLFINIGTTTEMIASKLLNHKNLHVVTNNIHVATILSAKEDFSVIIAAGEVRYRDGGIIGEATCDFISQFRMDYGIIGISGISADGALLDFDFREVKVSQAILEHTQHVILAADYSKFERRAMVEQGHISQVDCLVCDQTPPPAIRKIIDENNISFIKA
>NC_015554.1|WP_013785875.1|3894899_3896384_+|glycerol-kinase-GlpK
MGQYILAIDQGTTSSRSIIFAADGAIVAVAQQEFSQKYPQDGWVEHDPEEIWESVTTTMKQVFDKCSVSPEDIASIGITNQRETTLVWNKNTGKPVYPAIVWQDRRTSQQCRELDDDESLVAHITESTGLLLDPYFSATKLAWILDNVEGARAQAEAGELLFGTVDTFLIWRLTNGESHKTDATNASRTMLFDINTQCWDERLLDTFNIPKAMLPEVMDCADEFGVVSKDILGCAIPIQGVAGDQQATLVGQACFQKGMAKSTYGTGCFMILNTGDKPLQSKNRLLTTVGYRLNGKTTYALEGSIFMAGATVQWLRDGLKLIDDASETEALAQRARQDNGVFLVPAFTGLGAPYWDPDARGAILGLTRDTGISEIVAAGLQSVCYQTKDLQKAMESDGARPTTIRVDGGMSRNDWVMGFLSDILGAEVERPEITETTALGAAFLAGLQAGVFTSVDSLTECWKSDSIFTPRLSKEERDKAYDGWKNAVARIRCS
>NC_015554.1|WP_013785876.1|3899491_3900934_+|SLC5-family-protein
MSGSLIQIIVFFVITALIGLLTYIKCRGHGHSKASETKEYFLAGGGLTWIFVAGSITLTNLSTDQLVGMNGNQMALLAWWEFAAVIGLIILARIFLPVYYHYQCTTTTELLEKRYNNKHIRALIGLLFFLGSSLIFMPAVIYSGSLFMINMFNLDLPLMYVATAFAIIGALYAIFGGLRAVAVSDTYSGVLLLVMAIVVVILAMVAIDFDFSGIPTERLTLIGDADSPLPWQTLLTGMIFIQTFYWSTNQTITQRAMAAPNIKEAQKGVYAAAIIRFIIVPSIIVVPGIISFKLYGDINDAAYGTLVGDVLPDWLSGVFAAALAAAVLTTYNSNLNSATALYVCDIHEAYVNKKPEVAKLGGIVTAILTVVSLVMVPIYAQAESIINLLQQLYGLLSMPILSIFIVGLLFNNVNPYAGITAVIFGVLLYSFFSFVHAPFGLHYIHLMLVTLICCIGVALGVNKLVFRQSAQWRGRLVDAD
>NC_015554.1|WP_013785877.1|3900946_3902488_+|tryptophan-7-halogenase
MTPVNSVVIVGGGTAGWLTAGLLAATHSKQGSTGARLSVKVIESDSIHPIGVGEGTWPTMRSTLAKIGIEEAALVQQASATFKQASKFVHWHTEGQRTGYYHPFSAPQGSASVDITPYWLHNDSLNEYASDVCFQPSLCEQGLAPKLKADSKQSFSANYGYHLDAGKFINVIREHCKKVLGVEHIIDDVTDVATDDAGIKHVVTKNNDHIRGDIFVDCTGFSARLIEKALDVPMEDASSVLFSDSALVHQIAYSDEHQPIACHTLSTAQEAGWIWDIGLQNRRGTGYVYSSEFQSDDEATQTFMAYLKSINPNEELPSTFRKINYKTGYRKRFWEKNCVAIGLSSGFLEPLEASSLMLIEQSAIQLAEQLPAYTQVMPHVASRFNRALTNKWQSTIEFLKLHYVLSNRNEDFWLANRSPQSIPQRLASLLEEWQYRPILDSDFTDTDEVFSAQSYRYILYGMSHKTNLSQYVRSMSEYEGADKQLQLNKALIAQLKARLPSHRGLIDTMLNKH
>NC_015554.1|WP_013785878.1|3902525_3903005_+|SapC-family-protein
MSSYTPLDSQAHRNLRIKVDKNFGHNAEFNLVSLGFNEIASIAGCMPIVVTANDTNHSHTLAAVVGWPEFGNVYCSDTEWMGHAVPLSIQSYPFNYAVEQDKLTVLFDEDSPLVSNNSSEGASALFASDGSPSASLKQYQSMLSNLASGSQQASAFIQL
>NC_015554.1|WP_083820163.1|3903016_3903268_+|SapC-family-protein
MLSNLSITLHFENGEPRESTGLMTINEDKLAQLNADIIHQLHTQGLLMAINAMMLSLRQYNRLVQLTKNANNPVVKIGLKTTN
>NC_015554.1|WP_013785880.1|3903424_3905569_+|alpha-galactosidase
MSSLTAFVRLDNAKTTLIFDCQGRMPTLIYYGQQLKTATTPDMLALLNTRQEAKCAPVIEPPISLVPTHGEGVTGSPGLEISGDADQWSAGFTLSDIEQTDTSLTFTAVDADRQMQLITRVVLDAETTVATFTSSIENQGESTLQLNYLNAASLALPTTMSKIKSFEGRWSNEFQTADHDLFFGSYVRENRRGKTSHDTFPGLIAFANGTGELVGECFGFHLGASANHKFRAEMMADGRSYVQFGELLFPGEVTLGAGESYTSPVLYAGFGDAGFSSLSQQFHNFIRNNVLTHSADITSAQHKPRPVHYNTWEGIYFDHDEATLKALADKVAPLGIERFVLDGGWFKGRRNDKAGLGDWTVDEAIYPEGLDGLIDHVTDKGMEFGIWFEPEMVNPDSDLYRAHPEWALHTKNNPHVPFRNQYVLDLTNPEVVEYLYKVITDVLSTYPKISYIKWDMNRDVNHPGNLHGKPAMNGQMAALYTLIDRVKAAHPGIEIESCCSGGGRVDLGILPHTDRFWTSDSNDALDRLYIQRGFSYFFPSEVMGAHVGPRDCHITGRNLPIEIRSAVSMFGHMGIEMDPRELTEHEQDTLKSAISLYKKYRHITHGGDLYRMDDDGLNVKFGYVSKDKAEGIFAYNSVKETGRTTPSRFYFAGLDADKSYTLERVWPGTLKEYSPSILQKTDGQVFSGEALMKYGMQMPVLFPQTSLIYTAKEV
>NC_015554.1|WP_013785881.1|3905612_3906728_-|hypothetical-protein
MFIQRNQNKLTVLHCLCLPAITAFKGANIAALLCLSFFVSFANASALPSDDVLDAMFQAQDYESIVSALEPITSKTPKQYNVLISALMNTDLDDAEDMAAQFVDEHKDNYRAYHMQANVMGAQAMDSVFSALGYAKKAKASLQKAIEVAPDEIEVYQALMQFYIVAPSIAGGDIDEAKKLADKITQMDALEGKFATATIYAADDKAAEAKAMLIELSEKPEFEVRARFELGRLHIDGEEYDDAIAALTPLLNTNVVKAQKADEQAWNTYSESKFTQLYGTYRIGWVAVETSQYTKSGIDALNYYLAELEATDIDTHQLPSKNWANLRLAELFLNADDVSMASSTLEKVTKDGDKRLAKIMKSLKKQIKKRT
>NC_015554.1|WP_013785882.1|3906950_3908228_-|dienelactone-hydrolase-family-protein
MKTLSLLCIAALLAATPAYSAQTLYQDYPSDITPELSEKGAYQVGVKTLTVNYPKPVVTLQGQVVDRVLKLEVWYPTTDSGAATTYENQTRSGNEFSIQADAIRDASVAEPQGSYPVVVLSHGYTGYRTIMYYLGEHLASHGYIVAGIDHTDSTNEDVDFTNAPYAGFPSTLLNRSRDQVLTLNAVSEHALFKDVVDTQNAGLIGYSMGGFGAVNTVGGCYNFGTEATASFTGVTDPAVLSALQNVLNTCAGGNADAESVDTRWKAAMALAPWGGQHKAFSEDALNNIHVPMLYVAGDHDDIAGYQGIQWLFENTGNEDSKLLTYKNARHNIAPHPAPKEAFGNEFDIGHYLEPAWRSETMNDINEHFALAMMECHVKGKADFCAYLNVEGDSGQVAVDDKVPEVWKGFDNRYALGLIMEGKPKK
>NC_015554.1|WP_041452602.1|3908389_3909568_-|MFS-transporter
MNKEHFSPLFKYVVAAIIARTATGGAIVAIVLLARNLELDGKAAGILAACLTLPHLLGPVYGRWLDGVSQPKYLISGAALSYTCFFLLAIFSFERHLAWLLAFSLLLSGVCSSFIMGGLGTQLPSLVSASNTSLRKAQSWDTITYGVGHTLGPFIIASLSALFSTKVAVSVLVFTPLLAGILILTFPKKHVLPKSDASLDIGFKSVFYAFKDSSALVRTLVMTSGAAFSIAALPVLAVYLSEHWQHAEHHGAYLVTAYGVGNLSGALFLIFRPLSKEPLTLLKRSGGFLLVALLATTLSPSFVLGAAGYWLCGVANAIFFTSSLAARTEFAPAHSAAQTYMWVAAAKVGAGAIGALVAGTLLVQGVTVSLVTSCATLALILIVCFAVFRVQK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_015554_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_015554_4

4002040-4002145

Orphan

Consensus_repeat	Method
ATTTCGAGGGGATGGGCACAAAACCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_015554_4

>merge|NC_015554|4|4002040-4002145|CRISPRCasFinder
ATTTCGAGGGGATGGGCACAAAACCCAATCAGAAGTAACTAACAAAACTCCTAGTTGGTCATAAAATAGGCTTGAGGTTCATTTCGAGGGGATGGGCGCAAAACCC

>NC_015554|4|4|4002040-4002145|CRISPRCasFinder
ATTTCGAGGGGATGGGCACAAAACCC	AATCAGAAGTAACTAACAAAACTCCTAGTTGGTCATAAAATAGGCTTGAGGTTC
ATTTCGAGGGGATGGGCGCAAAACCC

Protein	Signature genes	Signature genes Name	Protein_function
NC_015554.1\|WP_013785977.1\|3992044_3992419_-\|hypothetical-protein	unknown	unknown	unknown
NC_015554.1\|WP_013785988.1\|4005245_4005980_-\|outer-membrane-protein-transport-protein	unknown	unknown	gnl\|CDD\|367457
NC_015554.1\|WP_013785985.1\|4004543_4004888_-\|IS66-family-insertion-sequence-element-accessory-protein-TnpB	unknown	unknown	gnl\|CDD\|377551
NC_015554.1\|WP_013785991.1\|4007566_4008154_-\|aromatic-ring-hydroxylating-dioxygenase-subunit-beta	unknown	unknown	gnl\|CDD\|238357
NC_015554.1\|WP_013785987.1\|4002280_4002937_-\|outer-membrane-protein-transport-protein	unknown	unknown	gnl\|CDD\|367457
NC_015554.1\|WP_013785984.1\|3999745_4000036_+\|IS66-family-insertion-sequence-hypothetical-protein	unknown	unknown	unknown
NC_015554.1\|WP_013785989.1\|4005976_4006591_-\|2-hydroxychromene-2-carboxylate-isomerase	unknown	unknown	gnl\|CDD\|239320
NC_015554.1\|WP_013785979.1\|3993069_3993468_-\|hypothetical-protein	unknown	unknown	unknown
NC_015554.1\|WP_013785986.1\|4002951_4004454_-\|IS66-family-transposase	unknown	unknown	gnl\|CDD\|376980
NC_015554.1\|WP_013785985.1\|4000032_4000377_+\|IS66-family-insertion-sequence-element-accessory-protein-TnpB	unknown	unknown	gnl\|CDD\|377551
NC_015554.1\|WP_013785990.1\|4006669_4007467_-\|3-(cis-5,6-dihydroxycyclohexa-1,-3-dien-1-yl)propanoate-dehydrogenase	unknown	unknown	gnl\|CDD\|235739
NC_015554.1\|WP_013785984.1\|4004884_4005175_-\|IS66-family-insertion-sequence-hypothetical-protein	unknown	unknown	unknown
NC_015554.1\|WP_013785986.1\|4000466_4001969_+\|IS66-family-transposase	unknown	unknown	gnl\|CDD\|376980
NC_015554.1\|WP_013785982.1\|3998172_3999018_+\|ACT-domain-containing-protein	unknown	unknown	gnl\|CDD\|223155
NC_015554.1\|WP_013785983.1\|3999555_3999720_-\|hypothetical-protein	unknown	unknown	unknown
NC_015554.1\|WP_148259123.1\|3992677_3993064_+\|hypothetical-protein	unknown	unknown	unknown
NC_015554.1\|WP_013785981.1\|3997363_3997972_+\|glutathione-transferase-GstA	unknown	unknown	gnl\|CDD\|182533
NC_015554.1\|WP_013785993.1\|4009543_4010371_-\|protocatechuate-4,5-dioxygenase-subunit-beta	unknown	unknown	gnl\|CDD\|153380
NC_015554.1\|WP_013785980.1\|3996647_3997163_-\|transposase	unknown	unknown	gnl\|CDD\|379252
NC_015554.1\|WP_013785992.1\|4008168_4009515_-\|aromatic-ring-hydroxylating-dioxygenase-subunit-alpha	unknown	unknown	gnl\|CDD\|176890

Protein	Function_ID	Function_description	E-value
NC_015554.1\|WP_013785988.1\|4005245_4005980_-\|outer-membrane-protein-transport-protein	gnl\|CDD\|367457	pfam03349, Toluene_X, Outer membrane protein transport protein (OMPP1/FadL/TodX). This family includes TodX from Pseudomonas putida F1 and TbuX from Ralstonia pickettii PKO1. These are membrane proteins of uncertain function that are involved in toluene catabolism. Related proteins involved in the degradation of similar aromatic hydrocarbons are also in this family, such as CymD. This family also includes FadL involved in translocation of long-chain fatty acids across the outer membrane. It is also a receptor for the bacteriophage T2.	7.05692e-23
NC_015554.1\|WP_013785985.1\|4004543_4004888_-\|IS66-family-insertion-sequence-element-accessory-protein-TnpB	gnl\|CDD\|377551	pfam05717, TnpB_IS66, IS66 Orf2 like protein. This protein is found in insertion sequences related to IS66. The function of these proteins is uncertain, but they are probably essential for transposition.	2.70299e-53
NC_015554.1\|WP_013785991.1\|4007566_4008154_-\|aromatic-ring-hydroxylating-dioxygenase-subunit-beta	gnl\|CDD\|238357	cd00667, ring_hydroxylating_dioxygenases_beta, Ring hydroxylating dioxygenase beta subunit. This subunit has a similar structure to NTF-2, Ketosteroid isomerase and scytalone dehydratase.The degradation of aromatic compounds by aerobic bacteria frequently begins with the dihydroxylation of the substrate by nonheme iron-containing dioxygenases. These enzymes consist of two or three soluble proteins that interact to form an electron-transport chain that transfers electrons from reduced nucleotides (NADH) via flavin and [2Fe-2S] redox centers to a terminal dioxygenase. Aromatic-ring-hydroxylating dioxygenases oxidize aromatic hydrocarbons and related compounds to cis-arene diols. These enzymes utilize a mononuclear non-heme iron center to catalyze the addition of dioxygen to their respective substrates. The active site of these enzymes however is in the alpha sub-unit. No functional role has been attributed to the beta sub-unit except for a structural role.	1.10219e-31
NC_015554.1\|WP_013785987.1\|4002280_4002937_-\|outer-membrane-protein-transport-protein	gnl\|CDD\|367457	pfam03349, Toluene_X, Outer membrane protein transport protein (OMPP1/FadL/TodX). This family includes TodX from Pseudomonas putida F1 and TbuX from Ralstonia pickettii PKO1. These are membrane proteins of uncertain function that are involved in toluene catabolism. Related proteins involved in the degradation of similar aromatic hydrocarbons are also in this family, such as CymD. This family also includes FadL involved in translocation of long-chain fatty acids across the outer membrane. It is also a receptor for the bacteriophage T2.	3.14442e-30
NC_015554.1\|WP_013785989.1\|4005976_4006591_-\|2-hydroxychromene-2-carboxylate-isomerase	gnl\|CDD\|239320	cd03022, DsbA_HCCA_Iso, DsbA family, 2-hydroxychromene-2-carboxylate (HCCA) isomerase subfamily; HCCA isomerase is a glutathione (GSH) dependent enzyme involved in the naphthalene catabolic pathway. It converts HCCA, a hemiketal formed spontaneously after ring cleavage of 1,2-dihydroxynapthalene by a dioxygenase, into cis-o-hydroxybenzylidenepyruvate (cHBPA). This is the fourth reaction in a six-step pathway that converts napthalene into salicylate. HCCA isomerase is unique to bacteria that degrade polycyclic aromatic compounds. It is closely related to the eukaryotic protein, GSH transferase kappa (GSTK).	1.8191e-57
NC_015554.1\|WP_013785993.1\|4009543_4010371_-\|protocatechuate-4,5-dioxygenase-subunit-beta	gnl\|CDD\|153380	cd07368, PhnC_Bs_like, PhnC is a Class III Extradiol ring-cleavage dioxygenase involved in the polycyclic aromatic hydrocarbon (PAH) catabolic pathway. This subfamily is composed of Burkholderia sp. PhnC and similar poteins. PhnC is one of nine protein products encoded by the phn locus. These proteins are involved in the polycyclic aromatic hydrocarbon (PAH) catabolic pathway. PhnC is a member of the class III extradiol dioxygenase family, a group os enzymes which use a non-heme Fe(II) to cleave aromatic rings between a hydroxylated carbon and an adjacent non-hydroxylated carbon. LigAB-like enzymes are usually composed of two subunits, designated A and B, which form a tetramer composed of two copies of each subunit. This model represents the catalytic subunit, B.	2.35296e-137
NC_015554.1\|WP_013785986.1\|4002951_4004454_-\|IS66-family-transposase	gnl\|CDD\|376980	pfam03050, DDE_Tnp_IS66, Transposase IS66 family. Transposase proteins are necessary for efficient DNA transposition. This family includes IS66 from Agrobacterium tumefaciens.	4.09877e-120
NC_015554.1\|WP_013785985.1\|4000032_4000377_+\|IS66-family-insertion-sequence-element-accessory-protein-TnpB	gnl\|CDD\|377551	pfam05717, TnpB_IS66, IS66 Orf2 like protein. This protein is found in insertion sequences related to IS66. The function of these proteins is uncertain, but they are probably essential for transposition.	2.70299e-53
NC_015554.1\|WP_013785980.1\|3996647_3997163_-\|transposase	gnl\|CDD\|379252	pfam13546, DDE_5, DDE superfamily endonuclease. This family of proteins are related to pfam00665 and are probably endonucleases of the DDE superfamily. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	2.18319e-15
NC_015554.1\|WP_013785986.1\|4000466_4001969_+\|IS66-family-transposase	gnl\|CDD\|376980	pfam03050, DDE_Tnp_IS66, Transposase IS66 family. Transposase proteins are necessary for efficient DNA transposition. This family includes IS66 from Agrobacterium tumefaciens.	4.09877e-120
NC_015554.1\|WP_013785982.1\|3998172_3999018_+\|ACT-domain-containing-protein	gnl\|CDD\|223155	COG0077, PheA, Prephenate dehydratase [Amino acid transport and metabolism].	4.15653e-67
NC_015554.1\|WP_013785981.1\|3997363_3997972_+\|glutathione-transferase-GstA	gnl\|CDD\|182533	PRK10542, PRK10542, glutathionine S-transferase; Provisional.	1.60807e-79
NC_015554.1\|WP_013785990.1\|4006669_4007467_-\|3-(cis-5,6-dihydroxycyclohexa-1,-3-dien-1-yl)propanoate-dehydrogenase	gnl\|CDD\|235739	PRK06200, PRK06200, 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional.	1.80014e-125
NC_015554.1\|WP_013785992.1\|4008168_4009515_-\|aromatic-ring-hydroxylating-dioxygenase-subunit-alpha	gnl\|CDD\|176890	cd08881, RHO_alpha_C_NDO-like, C-terminal catalytic domain of the oxygenase alpha subunit of naphthalene 1,2-dioxygenase (NDO) and related aromatic ring hydroxylating dioxygenases. C-terminal catalytic domain of the oxygenase alpha subunit of naphthalene 1,2-dioxygenase (NDO) and related Rieske-type non-heme iron aromatic ring-hydroxylating oxygenases (RHOs, also known as aromatic ring hydroxylating dioxygenases). This domain binds non-heme Fe(II). RHOs utilize non-heme Fe(II) to catalyze the addition of hydroxyl groups to the aromatic ring, an initial step in the oxidative degradation of aromatic compounds. RHOs are composed of either two or three protein components, and are comprised of an electron transport chain (ETC) and an oxygenase. The ETC transfers reducing equivalents form the electron donor to the oxygenase component, which in turn transfers electrons to the oxygen molecules. The oxygenase components are oligomers, either (alpha)n or (alpha)n(beta)n. The alpha subunits are the catalytic components and have an N-terminal domain, which binds a Rieske-like 2Fe-2S cluster, and a C-terminal domain which binds the non-heme Fe(II). The Fe(II) is co-ordinated by conserved His and Asp residues. Proteins belonging to this subgroup include the terminal oxygenase alpha subunits of biphenyl dioxygenase, cumene dioxygenase from Pseudomonas fluorescens IP01, ethylbenzene dioxygenase, naphthalene 1,2-dioxygenase, nitrobenzene dioxygenase from Comamonas sp. strain JS765, toluene 2,3-dioxygenase from Pseudomonas putida F1, dioxin dioxygenase of Sphingomonas sp. Strain RW1, and the polycyclic aromatic hydrocarbons (PAHs)degrading ring-hydroxylating dioxygenase from Sphingomonas CHY-1. This subfamily belongs to the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket.	3.03751e-74

>NC_015554.1|WP_013785986.1|4000466_4001969_+|IS66-family-transposase
MTDLPDDVAQLKAMLLQLQAKERAQAEEIAELKTTVQLLVEQLNLSKSKRFSSQSEKVAKGTFNEAEQQHALPNVNKSKAKTGRKPLPEALEREVYLHELSAPCCECCQTPLHECGKEVSEELKIIPQKVSVIRHERTKYTCRQCEKTHVSNKVITAPKPASMLPKSMGSAETFAAIVTAKYVDALPLYRQVDILNRSGIEISRGTLANWCVQLGDKVQIIIDAMKAKLLNENLICADETTVQVLREEDRKAETKSYMWVYRSGEFAENPAVIYDYQPSRAAACVKDFLTGYSGYLLTDGYSAYNTLEQVTQAACMAHARRKFTDAQKASPSKKAGKPEKALSYIAKLYGIEKQAKNLTSQARQQLRKQQAEPILNEFYNWLNSQHVLPKGALGKAISYTLNQWPKLLTYLEDGDISIDNNVTERDIRPFTTGRKNWMFSTSVGGAKASANLYSLVMTCRANDLNPYYYFRHLFTELPKRAPSDELSDLLPWNVDLGEAE
>NC_015554.1|WP_013785985.1|4000032_4000377_+|IS66-family-insertion-sequence-element-accessory-protein-TnpB
MTPTGNVYLVSGVTDMRKSIDGLSLIVADTLEMDPFSQAWFIFCNRGRDKLKILFWDTNGFWLYYRRLEKGHFKWPVPKCDGAVHISKQQLQWLLSGLTLDNPKAHRPIFGLEV
>NC_015554.1|WP_013785984.1|3999745_4000036_+|IS66-family-insertion-sequence-hypothetical-protein
MNQLQKHDHWTQILTEFKQSQLPIKQFCTERSIHYQTLYYWVKKLNSKEAKQQVQPIVFDQESADVVVLLLPNGIRAELPSMLSQTQIKHWVAALQ
>NC_015554.1|WP_013785983.1|3999555_3999720_-|hypothetical-protein
MPKPDFYWNVGLINRLLTRVDKSDVLEKIEQTVIDFFTQVMQMDSFTLRQEGIE
>NC_015554.1|WP_013785982.1|3998172_3999018_+|ACT-domain-containing-protein
MIRIVTLGPKNTYSDVATQIYCSLQEHQYNIVYARSITNVLDMMDNNQAELAVLPIENLSEGYISVVLDHFIKSKLYIKKEILLPIKFSLISNKKNPVDIKKLFVQFVAKGQCSKFIDSMDAKIELVLTESNIESLNLFLKNRGNSAAIVPTYAINDDEFNLKINNINDFKNNQTRFLVLTKENNIDIISPDIDYKTTIIVIDDNDYPGFLGNILSSFSKRKINLTSITSRPTKGDFGKYYFLIDLDGHMMEENIKAAINEINSKHNMKNLGSYIKAKLHK
>NC_015554.1|WP_013785981.1|3997363_3997972_+|glutathione-transferase-GstA
MKLYYSPGACSLSTHIVLCETELTYDLVRVDLNTKSLENKQDFYKINPFGYVPALELKNGKILLEGPAIIQYLADQVPEKQLAPVNGTFERYQLQQQLNLISTELHKGLGGLFNPAFSSDTQEIFKNNFSRRLDVLAPKLSDDSYLLGEQFSVADAYLFTVLSWCPMVGFDLAKWPELVTYQQKIARRPSVQKALKEEGLLD
>NC_015554.1|WP_013785980.1|3996647_3997163_-|transposase
MNSATKTLNLQSLTADLLSQTNLKIDNTFSSTWKSIGFNIMLRQAKFSKRSGTPVGDITYLLMLWVWLKVDSVAMFSRDALLSFSAAKKDALYDLLNREDVDWRKLQLLTAKKVLKANSKSRLCAFVIDDTVKTRSGKKMPGVSSHFDHLTARCVMGQQIGVLGIFPSKKT
>NC_015554.1|WP_013785979.1|3993069_3993468_-|hypothetical-protein
MTEDFLGRPESVYGAAIHAGVFGADTYLHDRQMFVDRVLGAWNTQINNYYSCPTEKHENAAEALHELYVMYREFMSICPCDKKGAFSRMFVALAKGDLDAAFGEFGKAKWPIVRILAEERERRRELPTASCS
>NC_015554.1|WP_148259123.1|3992677_3993064_+|hypothetical-protein
MMHPKEQATFQSDVIHVALHHYLKHQNLTPMDALPHAMDAVEWKAILLSMMGATVNDTLRTSEIITSDPVQNRAQFDTQIKEAQARTMEVALIAGMLCHAWTNDAEPPYKNDSKLIETLAFIQLKATL
>NC_015554.1|WP_013785977.1|3992044_3992419_-|hypothetical-protein
MPTTDVKVKNFVSYNAFMRAKFKDKVLRYKNAGITPPSFEEFKSYSIASNGLSPWLESIRGLPATEKQIYSILNTYMKEAKRSLSDIPNILRWLDRYYDIETPVVEGIATEAYWRKRLLAQSKD
>NC_015554.1|WP_013785987.1|4002280_4002937_-|outer-membrane-protein-transport-protein
MSAYVTAKMGLTYKIQKNTTLGMSYSTEGYMKDMTGDATLTVVDAVAGQVPVNGDVRVKDFKLPANITIGISHKISPDWMITSDFSRVFWEDAMKDIDITYSSEMGQLGILLPQNYSDISIWSVGTNYHYQDWEFRAGYRTATTGLNNKTLAPTIPALPTKHLTAGFAYNFSKYSTLDFAYSYGFDGKMKNTSLPMTPVPIEASNTLNNFSISYTRNF
>NC_015554.1|WP_013785986.1|4002951_4004454_-|IS66-family-transposase
MTDLPDDVAQLKAMLLQLQAKERAQAEEIAELKTTVQLLVEQLNLSKSKRFSSQSEKVAKGTFNEAEQQHALPNVNKSKAKTGRKPLPEALEREVYLHELSAPCCECCQTPLHECGKEVSEELKIIPQKVSVIRHERTKYTCRQCEKTHVSNKVITAPKPASMLPKSMGSAETFAAIVTAKYVDALPLYRQVDILNRSGIEISRGTLANWCVQLGDKVQIIIDAMKAKLLNENLICADETTVQVLREEDRKAETKSYMWVYRSGEFAENPAVIYDYQPSRAAACVKDFLTGYSGYLLTDGYSAYNTLEQVTQAACMAHARRKFTDAQKASPSKKAGKPEKALSYIAKLYGIEKQAKNLTSQARQQLRKQQAEPILNEFYNWLNSQHVLPKGALGKAISYTLNQWPKLLTYLEDGDISIDNNVTERDIRPFTTGRKNWMFSTSVGGAKASANLYSLVMTCRANDLNPYYYFRHLFTELPKRAPSDELSDLLPWNVDLGEAE
>NC_015554.1|WP_013785985.1|4004543_4004888_-|IS66-family-insertion-sequence-element-accessory-protein-TnpB
MTPTGNVYLVSGVTDMRKSIDGLSLIVADTLEMDPFSQAWFIFCNRGRDKLKILFWDTNGFWLYYRRLEKGHFKWPVPKCDGAVHISKQQLQWLLSGLTLDNPKAHRPIFGLEV
>NC_015554.1|WP_013785984.1|4004884_4005175_-|IS66-family-insertion-sequence-hypothetical-protein
MNQLQKHDHWTQILTEFKQSQLPIKQFCTERSIHYQTLYYWVKKLNSKEAKQQVQPIVFDQESADVVVLLLPNGIRAELPSMLSQTQIKHWVAALQ
>NC_015554.1|WP_013785988.1|4005245_4005980_-|outer-membrane-protein-transport-protein
MKLIKNKIPLLILSSTIVTCAHATDVFRLEGFGSISKAMGGTATAYDVGPAGMMSNPATLSLMKEGTQFLIGVDIIVTDIYTRNLSTGEKASSHSHSHNRGPYAIPQLAITYRTGKYTVGIGVFGQGGIGTEYGNSSFLSQATGGLDTNLDVFSRLFVLNIPFAISYQFNEKLTIGASIDATWQGLNLNLLLGADQLGSLIQDGRVSGSMLPTLGEFPDLRGAHIGFTENKPVSNGISSWGVTA
>NC_015554.1|WP_013785989.1|4005976_4006591_-|2-hydroxychromene-2-carboxylate-isomerase
MNINFFFDFLSPFSYLASVKLAKLSDDTIHNICYHAIDLARAKKAIGNIGPTNRDMPVKLSYLKKDIDRWAELYDIPLKFIPNFNSEKLNIGMFYTADKDIQAEYVNLAFFLTWGKGNAPDSPLVFDEICKTLNWEIKEFTHFIESDIGIKAYQKSTENAIKKHIFGVPTMMIDENMWWGNDRIIFLEKFLNTNNKQINRRESK
>NC_015554.1|WP_013785990.1|4006669_4007467_-|3-(cis-5,6-dihydroxycyclohexa-1,-3-dien-1-yl)propanoate-dehydrogenase
MKLQNQVAIITGASSGIGLAVAKRFISEGAKLGLLVRTEKDAKMLQDTFADNVVVTIGDVRNYDDNEKLVQSTIDKFGTLDCFIGNAGIWDYMTPINSTEASLLESGYRDLFDVNLLGYILGAKAALPALKKSKGSMIFTASSSSYSLGGGGPLYVASKHAVLGFIRALAWESAPDIRINGVAAGGTLTPLCGPESLDLGGASLETSDGIEEMISAMTPLKFASKPEDHAGIFALLASREDAKYITGTVILSDGGIGLGMRPDQK
>NC_015554.1|WP_013785991.1|4007566_4008154_-|aromatic-ring-hydroxylating-dioxygenase-subunit-beta
MTDTTKNNEPLALESDIAFDELIKNTQVSESLRQEVSSFLARESRLLDSRMYRTWHSEILSPDITYAVVSKELRSIKERRYDQPDTVYLFNDDHRQLGIRIEHDLDPQNWRSSPLERYCRILSNIEIGQEQGSLDLEVRSSCILTRGRRAYQVDQFFYTRTDILIRDDQGQLKLKSRYIEYPERSISGHNMLVYL
>NC_015554.1|WP_013785992.1|4008168_4009515_-|aromatic-ring-hydroxylating-dioxygenase-subunit-alpha
MSNQEENLIDVNHGTQLHKMHGDQKVLEQELENVFGRSWLFLTHESIIPNHGDYVVTKMGTDEVIVSRQENGDVKAFLNVCRHRGAQLCPHEAGNAKGFVCSYHGWGYGNTGELQAVPFDKEVYGGLLDKCKNSLHEVAKVENYNGFIYGCFDENSPSFSDYLGDLKWFLDPYFEHSGGLELIGPPARCLIKANWKCSAENFVGDAYHVGWTHASALRTGESVFTPLAGNSTPPTEGLGLQITSKFGSGLGVLWDAYAGIHDSSLINDMMQWATIKEQQLAEKIGADRARIYRSHLNTTIFPNNSFLTGSGVFKTWQPIDKDTTEVFTWTMVEKDMPEELKQRIAMSVQRTFGVAGYWESDDNDNMESETYMTKGFQARNKNLNAQMGIGNDVYNGKYPGVVCESAIGETSYRGYYRAYSAFINANSWHEIEDKSSNWADILTNAKTK
>NC_015554.1|WP_013785993.1|4009543_4010371_-|protocatechuate-4,5-dioxygenase-subunit-beta
MSQIISGFLMPHDPLIAAMPDAPPVEKRDSCMNAYKDIVERVKEQNIDTVIIIGDDHYTVNGPYCVPQAMIGIGDVEGPKEPWLGIPREKIANNESLAKHIMDYGHTHQVDWAASKTLIVDHSIAIPVEYAVKPIKDLKIVPIYINSGVEPFINSKRAYEIGLSIKAAINSWSGNERIAVYGTGGISHWPGMAQMGSVNEAWDRKIIDLICKGNVDELIAMSDEEILREGGNGGLEIKNFICAMGILDGWTGEEIAYEAVPEWVTGCGYLEMKIK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_015554_3	3.1\|3893778\|29\|NC_015554\|CRISPRCasFinder	3893778-3893806	29	MT661596	Proteus phage 10, complete genome	30134-30162	5	0.828
NC_015554_3	3.1\|3893778\|29\|NC_015554\|CRISPRCasFinder	3893778-3893806	29	NZ_CP043618	Sulfurimonas sp. GYSZ_1 plasmid unnamed, complete sequence	30995-31023	6	0.793
NC_015554_3	3.1\|3893778\|29\|NC_015554\|CRISPRCasFinder	3893778-3893806	29	NZ_CP043618	Sulfurimonas sp. GYSZ_1 plasmid unnamed, complete sequence	5568-5596	6	0.793
NC_015554_3	3.1\|3893778\|29\|NC_015554\|CRISPRCasFinder	3893778-3893806	29	NZ_CP021746	Agarilytica rhodophyticola strain 017 plasmid pSU2, complete sequence	58544-58572	7	0.759
NC_015554_3	3.1\|3893778\|29\|NC_015554\|CRISPRCasFinder	3893778-3893806	29	MK250021	Prevotella phage Lak-B2, complete genome	174474-174502	7	0.759
NC_015554_3	3.1\|3893778\|29\|NC_015554\|CRISPRCasFinder	3893778-3893806	29	MK250024	Prevotella phage Lak-B5, complete genome	168482-168510	7	0.759
NC_015554_3	3.1\|3893778\|29\|NC_015554\|CRISPRCasFinder	3893778-3893806	29	MK250028	Prevotella phage Lak-B9, complete genome	173365-173393	7	0.759
NC_015554_3	3.1\|3893778\|29\|NC_015554\|CRISPRCasFinder	3893778-3893806	29	MK250023	Prevotella phage Lak-B4, complete genome	174377-174405	7	0.759
NC_015554_3	3.1\|3893778\|29\|NC_015554\|CRISPRCasFinder	3893778-3893806	29	MK250025	Prevotella phage Lak-B6, complete genome	171675-171703	7	0.759
NC_015554_3	3.1\|3893778\|29\|NC_015554\|CRISPRCasFinder	3893778-3893806	29	MK250022	Prevotella phage Lak-B3, complete genome	171690-171718	7	0.759
NC_015554_3	3.1\|3893778\|29\|NC_015554\|CRISPRCasFinder	3893778-3893806	29	MK250027	Prevotella phage Lak-B8, complete genome	174588-174616	7	0.759
NC_015554_3	3.1\|3893778\|29\|NC_015554\|CRISPRCasFinder	3893778-3893806	29	MK250026	Prevotella phage Lak-B7, complete genome	174593-174621	7	0.759
NC_015554_3	3.1\|3893778\|29\|NC_015554\|CRISPRCasFinder	3893778-3893806	29	MK250020	Prevotella phage Lak-B1, complete genome	173345-173373	7	0.759

1. spacer 3.1|3893778|29|NC_015554|CRISPRCasFinder matches to MT661596 (Proteus phage 10, complete genome) position: , mismatch: 5, identity: 0.828

--ccatcttttcagataaaagtttgatatac	CRISPR spacer
gacca--ttttcagatacacgtttgatataa	Protospacer
  ***  ********** * **********

2. spacer 3.1|3893778|29|NC_015554|CRISPRCasFinder matches to NZ_CP043618 (Sulfurimonas sp. GYSZ_1 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.793

ccatcttttcagataaaagtttgatatac	CRISPR spacer
tcatcttttcagatgaaagtttattctaa	Protospacer
.*************.*******. * **

3. spacer 3.1|3893778|29|NC_015554|CRISPRCasFinder matches to NZ_CP043618 (Sulfurimonas sp. GYSZ_1 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.793

ccatcttttcagataaaagtttgatatac	CRISPR spacer
tcatcttttcagatgaaagtttattctaa	Protospacer
.*************.*******. * **

4. spacer 3.1|3893778|29|NC_015554|CRISPRCasFinder matches to NZ_CP021746 (Agarilytica rhodophyticola strain 017 plasmid pSU2, complete sequence) position: , mismatch: 7, identity: 0.759

ccatcttttcagataaaagtttgatatac	CRISPR spacer
agatctcttcagataaacgtttgatagca	Protospacer
  ****.********** ********

5. spacer 3.1|3893778|29|NC_015554|CRISPRCasFinder matches to MK250021 (Prevotella phage Lak-B2, complete genome) position: , mismatch: 7, identity: 0.759

ccatcttttcagataaaagtttgatatac	CRISPR spacer
ttttattttaaaataaaagtttgatataa	Protospacer
.. * **** *.****************

6. spacer 3.1|3893778|29|NC_015554|CRISPRCasFinder matches to MK250024 (Prevotella phage Lak-B5, complete genome) position: , mismatch: 7, identity: 0.759

ccatcttttcagataaaagtttgatatac	CRISPR spacer
ttttattttaaaataaaagtttgatataa	Protospacer
.. * **** *.****************

7. spacer 3.1|3893778|29|NC_015554|CRISPRCasFinder matches to MK250028 (Prevotella phage Lak-B9, complete genome) position: , mismatch: 7, identity: 0.759

ccatcttttcagataaaagtttgatatac	CRISPR spacer
ttttattttaaaataaaagtttgatataa	Protospacer
.. * **** *.****************

8. spacer 3.1|3893778|29|NC_015554|CRISPRCasFinder matches to MK250023 (Prevotella phage Lak-B4, complete genome) position: , mismatch: 7, identity: 0.759

ccatcttttcagataaaagtttgatatac	CRISPR spacer
ttttattttaaaataaaagtttgatataa	Protospacer
.. * **** *.****************

9. spacer 3.1|3893778|29|NC_015554|CRISPRCasFinder matches to MK250025 (Prevotella phage Lak-B6, complete genome) position: , mismatch: 7, identity: 0.759

ccatcttttcagataaaagtttgatatac	CRISPR spacer
ttttattttaaaataaaagtttgatataa	Protospacer
.. * **** *.****************

10. spacer 3.1|3893778|29|NC_015554|CRISPRCasFinder matches to MK250022 (Prevotella phage Lak-B3, complete genome) position: , mismatch: 7, identity: 0.759

ccatcttttcagataaaagtttgatatac	CRISPR spacer
ttttattttaaaataaaagtttgatataa	Protospacer
.. * **** *.****************

11. spacer 3.1|3893778|29|NC_015554|CRISPRCasFinder matches to MK250027 (Prevotella phage Lak-B8, complete genome) position: , mismatch: 7, identity: 0.759

ccatcttttcagataaaagtttgatatac	CRISPR spacer
ttttattttaaaataaaagtttgatataa	Protospacer
.. * **** *.****************

12. spacer 3.1|3893778|29|NC_015554|CRISPRCasFinder matches to MK250026 (Prevotella phage Lak-B7, complete genome) position: , mismatch: 7, identity: 0.759

ccatcttttcagataaaagtttgatatac	CRISPR spacer
ttttattttaaaataaaagtttgatataa	Protospacer
.. * **** *.****************

13. spacer 3.1|3893778|29|NC_015554|CRISPRCasFinder matches to MK250020 (Prevotella phage Lak-B1, complete genome) position: , mismatch: 7, identity: 0.759

ccatcttttcagataaaagtttgatatac	CRISPR spacer
ttttattttaaaataaaagtttgatataa	Protospacer
.. * **** *.****************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

443049 : 450416

Bacillus_phage(50.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013782872.1\|443049_444501_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	1.7e-19	25.2
WP_013782873.1\|444494_445178_-	response regulator transcription factor	W8CYM9	Bacillus_phage	8.4e-33	36.5
WP_013782874.1\|445245_446976_-	bifunctional isocitrate dehydrogenase kinase/phosphatase	NA	NA	NA	NA
WP_013782875.1\|447228_447615_+	response regulator	W8CYM9	Bacillus_phage	9.3e-05	29.4
WP_013782876.1\|447742_448756_-	ACR3 family arsenite efflux transporter	NA	NA	NA	NA
WP_013782877.1\|448819_449539_-	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	1.7e-92	77.1
WP_013782878.1\|449538_450009_-	arsenate reductase ArsC	A0A2H4J8A6	uncultured_Caudovirales_phage	4.1e-31	45.8
WP_013782879.1\|450062_450416_-	metalloregulator ArsR/SmtB family transcription factor	A0A2H4J145	uncultured_Caudovirales_phage	3.4e-22	52.0

DBSCAN-SWA_2

1897514 : 1907409

uncultured_Caudovirales_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013784150.1\|1897514_1898180_+	Bax inhibitor-1/YccA family protein	A0A2H4JFM9	uncultured_Caudovirales_phage	1.4e-35	45.2
WP_013784151.1\|1898306_1898696_+	sulfurtransferase complex subunit TusD	A0A2H4JA39	uncultured_Caudovirales_phage	1.6e-12	34.2
WP_013784152.1\|1898695_1899058_+	DsrE family protein	NA	NA	NA	NA
WP_013784153.1\|1899057_1899441_+	hypothetical protein	NA	NA	NA	NA
WP_013784154.1\|1899496_1899844_+	TusE/DsrC/DsvC family sulfur relay protein	NA	NA	NA	NA
WP_013784155.1\|1899916_1900735_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_013784156.1\|1900917_1902210_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	5.0e-95	45.2
WP_041452527.1\|1902220_1902604_-	fluoride efflux transporter CrcB	A0A2H4J148	uncultured_Caudovirales_phage	5.4e-05	32.6
WP_013784158.1\|1902609_1903944_-	replication-associated recombination protein A	G3MBE0	Bacillus_virus	1.2e-72	37.6
WP_013784159.1\|1903954_1904710_-	outer membrane lipoprotein chaperone LolA	NA	NA	NA	NA
WP_013784160.1\|1904715_1907409_-	DNA translocase FtsK	G1FGP1	Mycobacterium_phage	7.3e-88	51.2

DBSCAN-SWA_3

3147841 : 3156749

Staphylococcus_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013785239.1\|3147841_3148642_-	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	1.2e-25	32.1
WP_013785240.1\|3148856_3149894_-	recombinase RecA	A0A2D1GPX2	Mycobacterium_phage	1.8e-119	64.1
WP_013785241.1\|3150157_3150646_-	CinA family protein	B5TK85	Pseudomonas_phage	1.1e-26	45.5
WP_013785242.1\|3150952_3153586_+	DNA mismatch repair protein MutS	A0A1V0SC35	Catovirus	1.2e-31	22.2
WP_013785243.1\|3153764_3155396_+	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	3.4e-149	50.6
WP_013785244.1\|3155456_3156749_+	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	1.6e-133	59.5

DBSCAN-SWA_4

3387290 : 3397218

Turkeypox_virus(16.67%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_148259112.1\|3387290_3388637_-	alkaline phosphatase family protein	A0A0M3PB47	Turkeypox_virus	1.9e-44	32.7
WP_013785434.1\|3388710_3389724_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	4.1e-108	56.9
WP_012517258.1\|3390260_3390476_+	30S ribosomal protein S21	NA	NA	NA	NA
WP_013785435.1\|3390826_3391273_+	GatB/YqeY domain-containing protein	A0A292GL36	Xanthomonas_phage	6.1e-24	42.5
WP_013785436.1\|3391414_3393196_+	DNA primase	A0A1S5RF71	Helicobacter_phage	4.6e-46	32.7
WP_013785437.1\|3393520_3395347_+	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	1.3e-35	33.0
WP_013785438.1\|3395598_3397218_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	2.3e-36	35.2

DBSCAN-SWA_5

3771896 : 3838585

Erysipelothrix_phage(23.08%)

protease,integrase

attL 3837590:3837609|attR 3842010:3842029

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013785767.1\|3771896_3772781_+\|protease	protease HtpX	NA	NA	NA	NA
WP_013785768.1\|3772798_3773479_+	haloacid dehalogenase type II	NA	NA	NA	NA
WP_013785769.1\|3773510_3773774_-	hypothetical protein	NA	NA	NA	NA
WP_013785770.1\|3774185_3775232_-	chemotaxis response regulator protein-glutamate methylesterase	NA	NA	NA	NA
WP_013785771.1\|3775203_3775836_-	chemoreceptor glutamine deamidase CheD	NA	NA	NA	NA
WP_013785772.1\|3775850_3776681_-	chemotaxis protein CheR	NA	NA	NA	NA
WP_013785773.1\|3776684_3779225_-	PAS domain S-box protein	NA	NA	NA	NA
WP_013785774.1\|3779276_3779780_-	chemotaxis protein CheW	NA	NA	NA	NA
WP_013785775.1\|3779776_3781885_-	chemotaxis protein CheW	NA	NA	NA	NA
WP_013785776.1\|3781921_3782287_-	response regulator	Q56AR1	Bacillus_thuringiensis_phage	1.8e-13	41.9
WP_083820162.1\|3782346_3783600_-	chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	4.8e-10	31.8
WP_013785778.1\|3783812_3784550_-	META domain-containing protein	NA	NA	NA	NA
WP_013785779.1\|3784724_3785414_+	response regulator transcription factor	W8CYM9	Bacillus_phage	5.3e-27	32.7
WP_013785780.1\|3785410_3786805_+	sensor histidine kinase	Q8QKV7	Ectocarpus_siliculosus_virus	4.0e-05	23.0
WP_013785781.1\|3786850_3788122_-	PepSY domain-containing protein	NA	NA	NA	NA
WP_041452599.1\|3788140_3790195_-	TonB-dependent receptor	NA	NA	NA	NA
WP_013785783.1\|3790314_3790488_-	DUF2986 domain-containing protein	NA	NA	NA	NA
WP_013785784.1\|3791341_3792619_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_013785785.1\|3792633_3793365_+	hypothetical protein	NA	NA	NA	NA
WP_013785786.1\|3793416_3795066_+	AAA family ATPase	NA	NA	NA	NA
WP_013785787.1\|3795463_3796042_-	hypothetical protein	NA	NA	NA	NA
WP_013785788.1\|3796508_3797594_+	hypothetical protein	NA	NA	NA	NA
WP_013785790.1\|3799615_3800992_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_013785791.1\|3801513_3802092_-	hypothetical protein	NA	NA	NA	NA
WP_013785792.1\|3802088_3802781_-	SOS response-associated peptidase family protein	NA	NA	NA	NA
WP_013785793.1\|3802900_3803302_+	DNA polymerase V	A0A1L5C2A3	Pseudoalteromonas_phage	1.0e-17	50.0
WP_013785794.1\|3803301_3804558_+	Y-family DNA polymerase	I6RSM4	Salmonella_phage	2.1e-82	42.4
WP_013785795.1\|3804692_3804884_+	hypothetical protein	NA	NA	NA	NA
WP_148259119.1\|3805037_3806078_-	hypothetical protein	NA	NA	NA	NA
WP_013785797.1\|3806634_3807297_+	hypothetical protein	NA	NA	NA	NA
WP_013785798.1\|3807618_3808536_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_013785799.1\|3808528_3810556_+	ATP-binding protein	K9MCS8	Sulfolobus_virus	2.1e-10	31.6
WP_013785800.1\|3810571_3811033_+	hypothetical protein	NA	NA	NA	NA
WP_013785801.1\|3811080_3811545_-	hypothetical protein	NA	NA	NA	NA
WP_013785802.1\|3811646_3812060_+	DUF2787 domain-containing protein	NA	NA	NA	NA
WP_013785803.1\|3812124_3812439_+	viroplasmin family protein	NA	NA	NA	NA
WP_013785805.1\|3813107_3814049_+	hypothetical protein	NA	NA	NA	NA
WP_013785806.1\|3814050_3815163_+	hypothetical protein	NA	NA	NA	NA
WP_013785807.1\|3815451_3816798_-	Fic family protein	A0A1V0E025	Clostridioides_phage	1.3e-21	30.0
WP_013785809.1\|3817151_3817520_-	hypothetical protein	NA	NA	NA	NA
WP_148259120.1\|3818441_3819308_+	hypothetical protein	NA	NA	NA	NA
WP_013785811.1\|3819355_3819586_-	hypothetical protein	NA	NA	NA	NA
WP_013785812.1\|3819691_3819952_-	hypothetical protein	NA	NA	NA	NA
WP_013785813.1\|3820330_3820948_-	DUF413 domain-containing protein	NA	NA	NA	NA
WP_013785814.1\|3821325_3824439_-	DEAD/DEAH box helicase family protein	A0A2K5B2C2	Erysipelothrix_phage	1.9e-127	32.3
WP_148259193.1\|3824449_3826321_-	site-specific DNA-methyltransferase	A0A2K5B2C1	Erysipelothrix_phage	3.6e-118	38.9
WP_013785816.1\|3826359_3827073_-	DUF4391 domain-containing protein	NA	NA	NA	NA
WP_013785817.1\|3827129_3830411_-	DEAD/DEAH box helicase family protein	A0A2K5B2B9	Erysipelothrix_phage	7.4e-244	43.6
WP_013785818.1\|3830663_3831056_-	hypothetical protein	NA	NA	NA	NA
WP_013785819.1\|3831094_3831418_-	hypothetical protein	NA	NA	NA	NA
WP_013785820.1\|3831525_3831852_+	hypothetical protein	NA	NA	NA	NA
WP_013785821.1\|3831992_3833744_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_041453080.1\|3833953_3835015_+\|integrase	site-specific integrase	G8C7K6	Escherichia_phage	1.3e-35	31.1
WP_041453081.1\|3835894_3836659_+	NYN domain-containing protein	A0A0R6PGY5	Moraxella_phage	3.1e-36	42.5
WP_013785824.1\|3836672_3837473_+	hypothetical protein	NA	NA	NA	NA
3837590:3837609	attL	NA	NA	NA	NA
WP_013785825.1\|3837643_3838585_-\|integrase	integrase	NA	NA	NA	NA
WP_013785825.1\|3837643_3838585_-\|integrase	integrase	NA	NA	NA	NA
3842010:3842029	attR	NA	NA	NA	NA

DBSCAN-SWA_6

3964319 : 4001969

Leptospira_phage(60.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013785938.1\|3964319_3965375_-\|transposase	transposase	I4AZM3	Saccharomonospora_phage	1.1e-20	35.3
WP_013785939.1\|3965666_3966194_+	hypothetical protein	A0A291LAD4	Escherichia_phage	8.5e-09	34.6
WP_013785940.1\|3966385_3966637_+	hypothetical protein	NA	NA	NA	NA
WP_013785941.1\|3966648_3966951_+	hypothetical protein	NA	NA	NA	NA
WP_013785942.1\|3967192_3967630_+	DUF2384 domain-containing protein	NA	NA	NA	NA
WP_013785943.1\|3967626_3968091_+	RES family NAD+ phosphorylase	NA	NA	NA	NA
WP_013785944.1\|3968318_3968507_+	hypothetical protein	NA	NA	NA	NA
WP_013785945.1\|3968693_3970091_+\|transposase	transposase	NA	NA	NA	NA
WP_013785947.1\|3970416_3970659_+	hypothetical protein	NA	NA	NA	NA
WP_031214864.1\|3970674_3971448_-	RES family NAD+ phosphorylase	NA	NA	NA	NA
WP_013785949.1\|3971450_3971822_-	DUF2384 domain-containing protein	NA	NA	NA	NA
WP_013785950.1\|3971911_3972580_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_158306776.1\|3972624_3973650_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_013785952.1\|3973646_3976688_+	efflux RND transporter permease subunit	S5VL66	Leptospira_phage	3.3e-20	19.8
WP_013785953.1\|3976772_3977387_-	DUF938 domain-containing protein	NA	NA	NA	NA
WP_013785954.1\|3977598_3977832_+	hemerythrin domain-containing protein	NA	NA	NA	NA
WP_013784042.1\|3978055_3979360_-\|transposase	IS1380 family transposase	NA	NA	NA	NA
WP_148259196.1\|3979990_3981169_+\|transposase	transposase	NA	NA	NA	NA
WP_013785956.1\|3981239_3981728_+	hypothetical protein	NA	NA	NA	NA
WP_013785957.1\|3981870_3982071_-	hypothetical protein	NA	NA	NA	NA
WP_013785959.1\|3982308_3982713_+	hypothetical protein	NA	NA	NA	NA
WP_013785960.1\|3982869_3983019_+	hypothetical protein	NA	NA	NA	NA
WP_013785961.1\|3983029_3983179_+	hypothetical protein	NA	NA	NA	NA
WP_013785963.1\|3983718_3984408_+	TrhE protein	NA	NA	NA	NA
WP_013785964.1\|3984397_3985477_+	TrhK protein	NA	NA	NA	NA
WP_013785965.1\|3985476_3986856_+	TraB/VirB10 family protein	NA	NA	NA	NA
WP_013785966.1\|3986858_3987347_+	hypothetical protein	NA	NA	NA	NA
WP_041452604.1\|3987612_3987885_-	hypothetical protein	NA	NA	NA	NA
WP_013785969.1\|3988088_3988355_+	hypothetical protein	NA	NA	NA	NA
WP_013785971.1\|3988509_3989568_-	hypothetical protein	NA	NA	NA	NA
WP_013785972.1\|3989900_3990323_+	hypothetical protein	NA	NA	NA	NA
WP_013785973.1\|3990377_3990704_-	sel1 repeat family protein	NA	NA	NA	NA
WP_148259122.1\|3990743_3991178_-	hypothetical protein	NA	NA	NA	NA
WP_013785975.1\|3991216_3991468_-	hypothetical protein	NA	NA	NA	NA
WP_013785976.1\|3991490_3991658_-	hypothetical protein	NA	NA	NA	NA
WP_013785977.1\|3992044_3992419_-	hypothetical protein	NA	NA	NA	NA
WP_148259123.1\|3992677_3993064_+	hypothetical protein	NA	NA	NA	NA
WP_013785979.1\|3993069_3993468_-	hypothetical protein	NA	NA	NA	NA
WP_013785980.1\|3996647_3997163_-\|transposase	transposase	NA	NA	NA	NA
WP_013785981.1\|3997363_3997972_+	glutathione transferase GstA	NA	NA	NA	NA
WP_013785982.1\|3998172_3999018_+	ACT domain-containing protein	NA	NA	NA	NA
WP_013785983.1\|3999555_3999720_-	hypothetical protein	NA	NA	NA	NA
WP_013785984.1\|3999745_4000036_+	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_013785985.1\|4000032_4000377_+	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	5.9e-19	45.2
WP_013785986.1\|4000466_4001969_+\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	1.1e-77	38.4

DBSCAN-SWA_7

4232412 : 4240413

Enterobacteria_phage(42.86%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013786177.1\|4232412_4233819_+	mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase	M1I5E1	Acanthocystis_turfacea_Chlorella_virus	7.1e-18	40.3
WP_013786178.1\|4233905_4235072_-	nucleotide sugar dehydrogenase	O41091	Paramecium_bursaria_Chlorella_virus	2.2e-110	55.0
WP_041452622.1\|4235135_4236878_-	glycosyltransferase	A0A1V0S9B9	Catovirus	7.7e-06	23.2
WP_013786180.1\|4236960_4238040_-	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	1.1e-95	53.1
WP_013786181.1\|4238058_4238919_-	dTDP-4-dehydrorhamnose reductase	A0A140G5S3	Enterobacteria_phage	1.7e-35	36.2
WP_013786182.1\|4238928_4239474_-	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	1.9e-51	58.5
WP_013786183.1\|4239534_4240413_-	glucose-1-phosphate thymidylyltransferase RfbA	A0A291LA53	Escherichia_phage	3.7e-97	58.9

DBSCAN-SWA_8

4706274 : 4770756

Shigella_phage(27.27%)

integrase,tRNA,transposase

attL 4724068:4724082|attR 4744495:4744509

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_041452637.1\|4706274_4707141_-\|integrase	integrase domain-containing protein	NA	NA	NA	NA
WP_013786595.1\|4708691_4709114_+	hypothetical protein	NA	NA	NA	NA
WP_013786596.1\|4709172_4711017_+	ParB/RepB/Spo0J family partition protein	NA	NA	NA	NA
WP_013786597.1\|4711079_4711367_-	XRE family transcriptional regulator	NA	NA	NA	NA
WP_041453189.1\|4711359_4711713_-	type II toxin-antitoxin system RelE/ParE family toxin	A0A088CBP5	Shigella_phage	3.8e-05	41.7
WP_013786599.1\|4711897_4713127_-\|integrase	tyrosine-type recombinase/integrase	B7SYF8	Stenotrophomonas_phage	7.0e-62	38.0
WP_013786600.1\|4713354_4714995_-	chaperonin GroEL	A0A2I7SAK5	Vibrio_phage	8.1e-183	67.4
WP_013786601.1\|4715035_4715326_-	co-chaperone GroES	A0A221S322	uncultured_virus	4.5e-12	38.9
WP_013786602.1\|4715545_4716076_-	FxsA family protein	NA	NA	NA	NA
WP_013786603.1\|4716277_4718176_+	protein-disulfide reductase DsbD	NA	NA	NA	NA
WP_148259205.1\|4718234_4719056_+	M23 family metallopeptidase	A0A1W6JQH9	Corynebacterium_phage	5.2e-13	39.5
WP_013786605.1\|4719342_4719783_+	type II 3-dehydroquinate dehydratase	NA	NA	NA	NA
WP_013786606.1\|4719797_4720262_+	acetyl-CoA carboxylase biotin carboxyl carrier protein	NA	NA	NA	NA
WP_013786607.1\|4720276_4721620_+	acetyl-CoA carboxylase biotin carboxylase subunit	NA	NA	NA	NA
WP_013786608.1\|4722083_4723022_+	hypothetical protein	NA	NA	NA	NA
WP_013786609.1\|4723272_4723665_+	hypothetical protein	NA	NA	NA	NA
WP_013786610.1\|4723731_4724160_-	TIGR03643 family protein	NA	NA	NA	NA
4724068:4724082	attL	NA	NA	NA	NA
WP_013786611.1\|4724244_4726377_-	VRR-NUC domain-containing protein	A0A0A7RWA3	Clostridium_phage	2.0e-19	32.1
WP_041452638.1\|4726580_4726772_+	CPXCG motif-containing cysteine-rich protein	NA	NA	NA	NA
WP_013786613.1\|4726764_4727448_+	flavin reductase	NA	NA	NA	NA
WP_013786614.1\|4727694_4727988_+	high-potential iron-sulfur protein	NA	NA	NA	NA
WP_013786615.1\|4728072_4729722_-	amidase	NA	NA	NA	NA
WP_013786616.1\|4730476_4731769_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_013786617.1\|4731755_4733507_+	hypothetical protein	NA	NA	NA	NA
WP_013786618.1\|4733506_4735501_+	hypothetical protein	NA	NA	NA	NA
WP_013786619.1\|4735484_4735877_+	hypothetical protein	NA	NA	NA	NA
WP_013786620.1\|4736133_4736274_+	ATP-binding cassette domain-containing protein	NA	NA	NA	NA
WP_007105030.1\|4736675_4737782_-	FUSC family protein	NA	NA	NA	NA
WP_034821493.1\|4737912_4738434_-	cytochrome b	NA	NA	NA	NA
WP_007105033.1\|4738530_4739481_-	aldo/keto reductase	NA	NA	NA	NA
WP_013786623.1\|4739544_4740339_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_007105035.1\|4740384_4741206_-	dioxygenase	NA	NA	NA	NA
WP_007105036.1\|4741324_4742236_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_013782552.1\|4742368_4743133_-	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	1.7e-58	51.3
WP_013786626.1\|4745570_4746338_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
4744495:4744509	attR	NA	NA	NA	NA
WP_013786627.1\|4746614_4747496_+	50S ribosomal protein L11 methyltransferase	NA	NA	NA	NA
WP_013786628.1\|4747731_4748730_+\|tRNA	tRNA dihydrouridine synthase DusB	NA	NA	NA	NA
WP_012520109.1\|4748760_4749054_+	DNA-binding transcriptional regulator Fis	NA	NA	NA	NA
WP_013786629.1\|4749135_4750734_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	1.9e-75	52.1
WP_013786630.1\|4751552_4752368_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_013786631.1\|4752409_4753723_+	phosphoribosylamine--glycine ligase	NA	NA	NA	NA
WP_013786632.1\|4753842_4754589_-	CBM9 family sugar-binding protein	NA	NA	NA	NA
WP_013786633.1\|4754679_4755636_+	ion transporter	NA	NA	NA	NA
WP_013786634.1\|4755742_4756648_+	phosphoribulokinase	NA	NA	NA	NA
WP_013786635.1\|4757068_4757302_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	3.5e-15	55.4
WP_013786636.1\|4757334_4757622_-\|transposase	transposase	U5P4I9	Shigella_phage	3.9e-16	58.4
WP_013786637.1\|4757767_4760884_-	efflux RND transporter permease subunit	NA	NA	NA	NA
WP_148259138.1\|4760880_4761957_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_013786639.1\|4762128_4762701_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_013786640.1\|4762693_4763545_+	hypothetical protein	NA	NA	NA	NA
WP_013786641.1\|4764699_4765983_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_013786642.1\|4765957_4766653_-	response regulator transcription factor	NA	NA	NA	NA
WP_013786643.1\|4766676_4767900_-	pyridoxal-dependent decarboxylase, exosortase A system-associated	NA	NA	NA	NA
WP_041453197.1\|4767910_4769533_-	acyl-CoA ligase (AMP-forming), exosortase A system-associated	A0A1V0SBX8	Catovirus	6.9e-09	20.4
WP_013782999.1\|4769634_4770756_-\|transposase	ISAs1 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_015554

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection