CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NC_015602	Lactobacillus kefiranofaciens ZW3, complete sequence	3 crisprs	cas3,cas2,cas14j,DEDDh,DinG,c2c9_V-U4,cas14k,csa3	7	8
NC_015598	Lactobacillus kefiranofaciens ZW3 plasmid pWW1, complete sequence	1 crisprs	cas14k,cas14j	2	0
NC_015603	Lactobacillus kefiranofaciens ZW3 plasmid pWW2, complete sequence	0 crisprs	NA	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_015602_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_015602_1

666401-666673

TypeV-U4

I-B,III-A,III-B

Consensus_repeat	Method
AGGATCACCTCCACATACGTGGAGAACAC	CRISPRCasFinder
AGGATCACCTCCACATACGTGGAGAACAC	PILER-CR

4 spacers

c2c9_V-U4

The CRISPR arrays of NC_015602_1

>merge|NC_015602|1|666401-666673|CRISPRCasFinder,PILER-CR
ATAGAAACCTCCACATACGTGGAGAACACGAATAAAATCAGTATAGCGCGTAACTTCATTGAGGATCACCTCCACATACGTGGAGAACACCTAAATGACTGTACTGTGTCTGATCAACTTCAAGGATCACCTCCACATACGTGGAGAACACCTAACTAATGCTGTGCTTTTTCTAAGCTATTCAGGATCACCTCCACATACGTGGAGAACACTTTCAAGAACTGAGCCGTATTCCCATGAGGTCAGGATCACCTCCACCTACGTGGAGAATAC

>NC_015602|1|1|666401-666673|CRISPRCasFinder
ATAGAAACCTCCACATACGTGGAGAACAC	GAATAAAATCAGTATAGCGCGTAACTTCATTG
AGGATCACCTCCACATACGTGGAGAACAC	CTAAATGACTGTACTGTGTCTGATCAACTTCA
AGGATCACCTCCACATACGTGGAGAACAC	CTAACTAATGCTGTGCTTTTTCTAAGCTATTC
AGGATCACCTCCACATACGTGGAGAACAC	TTTCAAGAACTGAGCCGTATTCCCATGAGGTC
AGGATCACCTCCACCTACGTGGAGAATAC

>NC_015602|1|1|666462-666612|PILER-CR
AGGATCACCTCCACATACGTGGAGAACAC	CTAAATGACTGTACTGTGTCTGATCAACTTCA
AGGATCACCTCCACATACGTGGAGAACAC	CTAACTAATGCTGTGCTTTTTCTAAGCTATTC
AGGATCACCTCCACATACGTGGAGAACAC

Protein	Signature genes	Signature genes Name	Protein_function
NC_015602.1\|WP_148234231.1\|650977_651415_+\|restriction-endonuclease-subunit-S	unknown	unknown	gnl\|CDD\|341143
NC_015602.1\|WP_013854082.1\|655636_656530_-\|proline-iminopeptidase-family-hydrolase	unknown	unknown	gnl\|CDD\|188121
NC_015602.1\|WP_013854101.1\|673182_673335_-\|hypothetical-protein	unknown	unknown	unknown
NC_015602.1\|WP_013854088.1\|661823_662192_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|224381
NC_015602.1\|WP_013854094.1\|668142_668742_-\|hypothetical-protein	unknown	unknown	unknown
NC_015602.1\|WP_143000321.1\|670174_670621_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|374409
NC_015602.1\|WP_013854093.1\|667723_668113_-\|hypothetical-protein	unknown	unknown	unknown
NC_015602.1\|WP_013854079.1\|651395_651962_-\|restriction-endonuclease-subunit-S	unknown	unknown	gnl\|CDD\|341172
NC_015602.1\|WP_025084198.1\|669597_670035_-\|SLAP-domain-containing-protein	unknown	unknown	gnl\|CDD\|367400
NC_015602.1\|WP_013854095.1\|668751_669291_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|365934
NC_015602.1\|WP_013854090.1\|663659_664274_-\|IS607-family-transposase	unknown	unknown	gnl\|CDD\|239738
NC_015602.1\|WP_013854103.1\|675174_675858_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227872
NC_015602.1\|WP_013854098.1\|670665_671103_-\|hypothetical-protein	unknown	unknown	unknown
NC_015602.1\|WP_013854086.1\|660264_661095_+\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225117
NC_015602.1\|WP_013854080.1\|653756_654542_-\|hypothetical-protein	unknown	unknown	unknown
NC_015602.1\|WP_013854096.1\|669313_669667_-\|hypothetical-protein	unknown	unknown	unknown
NC_015602.1\|WP_013854089.1\|662379_663663_-\|transposase	c2c9_V-U4	-	gnl\|CDD\|223747
NC_015602.1\|WP_013854092.1\|664899_665268_-\|ASCH-domain-containing-protein	unknown	unknown	gnl\|CDD\|119346
NC_015602.1\|WP_013854087.1\|661142_661388_-\|hypothetical-protein	unknown	unknown	unknown
NC_015602.1\|WP_158306206.1\|674322_675009_-\|CPBP-family-intramembrane-metalloprotease	unknown	unknown	gnl\|CDD\|376806

Protein	Function_ID	Function_description	E-value
NC_015602.1\|WP_148234231.1\|650977_651415_+\|restriction-endonuclease-subunit-S	gnl\|CDD\|341143	cd17254, RMtype1_S_FclI-TRD1-CR1_like, Type I restriction-modification system specificity (S) subunit Target Recognition Domain-ConseRved domain (TRD-CR), similar to S.FclI TRD1-CR1. The recognition sequence of Flavobacterium columnare G4 S subunit (S.FclI) is undetermined. The restriction-modification (RM) system S subunit consists of two variable target recognition domains (TRD1 and 2) and two conserved regions (CR1 and CR2) which separate the TRDs. The TRDs each bind to different specific sequences in the DNA. RM systems protect a bacterial cell against invasion of foreign DNA by endonucleolytic cleavage of DNA that lacks a site specific modification. The host genome is protected from cleavage by methylation of specific nucleotides in the target sites. In type I systems, both restriction and modification activities are present in one enzyme complex composed of one DNA specificity (S) subunit (this family), two modification (M) subunits and two restriction (R) subunits. This model contains both TRD1-CR1 and TRD2-CR2. It also contains TRD-CR-like sequence-recognition domains of type I DNA methyltransferases, such as putative Type I N6-adenine DNA methyltransferases from Microbacterium ketosireducens (M.Msp12510ORF408P) and Treponema primitia ZAS-2 (M.TprZAS2ORF3630P). It may also include various type II restriction enzymes and methyltransferases.	1.94012e-56
NC_015602.1\|WP_013854082.1\|655636_656530_-\|proline-iminopeptidase-family-hydrolase	gnl\|CDD\|188121	TIGR01250, Proline_iminopeptidase, proline-specific peptidase, Bacillus coagulans-type subfamily. This model describes a subfamily of the alpha/beta fold family of hydrolases. Characterized members include prolinases (Pro-Xaa dipeptidase, EC 3.4.13.8), prolyl aminopeptidases (EC 3.4.11.5), and a leucyl aminopeptidase.	5.04697e-104
NC_015602.1\|WP_013854103.1\|675174_675858_+\|hypothetical-protein	gnl\|CDD\|227872	COG5585, COG5585, NAD+--asparagine ADP-ribosyltransferase [Signal transduction mechanisms].	0.000236183
NC_015602.1\|WP_013854088.1\|661823_662192_+\|hypothetical-protein	gnl\|CDD\|224381	COG1464, NlpA, ABC-type metal ion transport system, periplasmic component/surface antigen [Inorganic ion transport and metabolism].	4.92403e-25
NC_015602.1\|WP_143000321.1\|670174_670621_+\|hypothetical-protein	gnl\|CDD\|374409	pfam16172, DOCK_N, DOCK N-terminus. This family is found near to the N-terminus of dedicator of cytokinesis (DOCK) proteins, between the variant SH3 domain (pfam07653) and the C2 domain (pfam14429).	0.00829032
NC_015602.1\|WP_013854079.1\|651395_651962_-\|restriction-endonuclease-subunit-S	gnl\|CDD\|341172	cd17283, RMtype1_S_Hpy180ORF7835P_TRD2-CR2_like, Type I restriction-modification system specificity (S) subunit Target Recognition Domain-ConseRved domain (TRD-CR), similar to Helicobacter pylori SJM180 S subunit (S.Hpy180ORF7835P) TRD2-CR2 and Haemophilus influenzae PittGG S subunit (S.HinGGORF3080P) TRD2-CR2. The recognition sequences of Helicobacter pylori SJM180 S subunit (S.Hpy180ORF7835P) and Haemophilus influenzae PittGG S subunit (S.HinGGORF3080P) are undetermined. The restriction-modification (RM) system S subunit consists of two variable target recognition domains (TRD1 and 2) and two conserved regions (CR1 and CR2) which separate the TRDs. The TRDs each bind to different specific sequences in the DNA. RM systems protect a bacterial cell against invasion of foreign DNA by endonucleolytic cleavage of DNA that lacks a site specific modification. The host genome is protected from cleavage by methylation of specific nucleotides in the target sites. In type I systems, both restriction and modification activities are present in one heteromeric enzyme complex composed of one DNA specificity (S) subunit (this family), two modification (M) subunits and two restriction (R) subunits. This model contains both TRD1-CR1 and TRD2-CR2. It may also include TRD-CR-like sequence-recognition domains of various type II restriction enzymes and methyltransferases and type I DNA methyltransferases.	3.37614e-55
NC_015602.1\|WP_013854095.1\|668751_669291_-\|hypothetical-protein	gnl\|CDD\|365934	pfam00188, CAP, Cysteine-rich secretory protein family. This is a large family of cysteine-rich secretory proteins, antigen 5, and pathogenesis-related 1 proteins (CAP) that are found in a wide range of organisms, including prokaryotes and non-vertebrate eukaryotes, The nine subfamilies of the mammalian CAP 'super'family include: the human glioma pathogenesis-related 1 (GLIPR1), Golgi associated pathogenesis related-1 (GAPR1) proteins, peptidase inhibitor 15 (PI15), peptidase inhibitor 16 (PI16), cysteine-rich secretory proteins (CRISPs), CRISP LCCL domain containing 1 (CRISPLD1), CRISP LCCL domain containing 2 (CRISPLD2), mannose receptor like and the R3H domain containing like proteins. Members are most often secreted and have an extracellular endocrine or paracrine function and are involved in processes including the regulation of extracellular matrix and branching morphogenesis, potentially as either proteases or protease inhibitors; in ion channel regulation in fertility; as tumor suppressor or pro-oncogenic genes in tissues including the prostate; and in cell-cell adhesion during fertilisation. The overall protein structural conservation within the CAP 'super'family results in fundamentally similar functions for the CAP domain in all members, yet the diversity outside of this core region dramatically alters the target specificity and, thus, the biological consequences. The Ca++-chelating function would fit with the various signalling processes (e.g. the CRISP proteins) that members of this family are involved in, and also the sequence and structural evidence of a conserved pocket containing two histidines and a glutamate. It also may explain how the cysteine-rich venom protein helothermine blocks the Ca++ transporting ryanodine receptors.	0.000339657
NC_015602.1\|WP_013854090.1\|663659_664274_-\|IS607-family-transposase	gnl\|CDD\|239738	cd03769, SR_IS607_transposase_like, Serine Recombinase (SR) family, IS607-like transposase subfamily, catalytic domain; members contain a DNA binding domain with homology to MerR/SoxR located N-terminal to the catalytic domain. Serine recombinases catalyze site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and the enzyme. They are functionally versatile and include resolvases, invertases, integrases, and transposases. This subfamily is composed of proteins that catalyze the transposition of insertion sequence (IS) elements such as IS607 from Helicobacter and IS1535 from Mycobacterium, and similar proteins from other bacteria and several archaeal species. IS elements are DNA segments that move to new sites in prokaryotic and eukaryotic genomes causing insertion mutations and gene rearrangements.	1.04761e-49
NC_015602.1\|WP_013854086.1\|660264_661095_+\|AraC-family-transcriptional-regulator	gnl\|CDD\|225117	COG2207, AraC, AraC-type DNA-binding domain-containing proteins [Transcription].	3.27081e-26
NC_015602.1\|WP_013854089.1\|662379_663663_-\|transposase	gnl\|CDD\|223747	COG0675, COG0675, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	2.96967e-24
NC_015602.1\|WP_013854092.1\|664899_665268_-\|ASCH-domain-containing-protein	gnl\|CDD\|119346	cd06554, ASCH_ASC-1_like, ASC-1 homology domain, ASC-1-like subfamily. The ASCH domain, a small beta-barrel domain found in all three kingdoms of life, resembles the RNA-binding PUA domain and may also interact with RNA. ASCH has been proposed to function as an RNA-binding domain during coactivation, RNA-processing and the regulation of prokaryotic translation. The domain has been named after the ASC-1 protein, the activating signal cointegrator 1 or thyroid hormone receptor interactor protein 4 (TRIP4). ASC-1 is conserved in many eukaryotes and has been suggested to participate in a protein complex that interacts with RNA. It has been shown that ASC-1 mediates the interaction between various transciption factors and the basal transcriptional machinery.	8.71199e-10
NC_015602.1\|WP_025084198.1\|669597_670035_-\|SLAP-domain-containing-protein	gnl\|CDD\|367400	pfam03217, SLAP, SLAP domain. This short domain is found in a variety of bacterial cell surface proteins. The domain is about 60 residues in length (although previously defined as 2 copies of this domain). It usually occurs in tandem pairs. It may be distantly related to the SH3 domain.	5.49332e-08
NC_015602.1\|WP_158306206.1\|674322_675009_-\|CPBP-family-intramembrane-metalloprotease	gnl\|CDD\|376806	pfam02517, Abi, CAAX protease self-immunity. Members of this family are probably proteases (after a isoprenyl group is attached to the Cys residue in the C-terminal CAAX motif of a protein to attach it to the membrane, the AAX tripeptide being removed by one of the CAAX prenyl proteases). The family contains the CAAX prenyl protease. The proteins contain a highly conserved Glu-Glu motif at the amino end of the alignment. The alignment also contains two histidine residues that may be involved in zinc binding. While they are involved in membrane anchoring of proteins in eukaryotes, little is known about their function in prokaryotes. In some known bacteriocin loci, Abi genes have been found downstream of bacteriocin structural genes where they are probably involved in self-immunity. Investigation of the bacteriocin-like loci in the Gram positive bacteria locus from Lactobacillus sakei 23K confirmed that the bacteriocin-like genes (sak23Kalphabeta) exhibited antimicrobial activity when expressed in a heterologous host and that the associated Abi gene (sak23Ki) conferred immunity against the cognate bacteriocin. Interestingly, the immunity genes from three similar systems conferred a high degree of cross-immunity against each other's bacteriocins, suggesting the recognition of a common receptor. Site-directed mutagenesis demonstrated that the conserved motifs constituting the putative proteolytic active site of the Abi proteins are essential for the immunity function of Sak23Ki - thus a new concept in self-immunity.	1.17439e-07

>NC_015602.1|WP_013854092.1|664899_665268_-|ASCH-domain-containing-protein
MKALSVRGDYVMSMISGRKKVEYRSWKTNYRGPILMCSTTKKVAGAAPGYALCVMNLDHIIWSDFDQCYYWYINLENVIEPIHVKGQLKLFNVDDKLIKPISHKEFDRKVKSLIYYPKKKKT
>NC_015602.1|WP_013854090.1|663659_664274_-|IS607-family-transposase
MAMLKPREMADRLGITVRTLQEWDRKGIFPAHRTPTNKRYYTEQDYLRYVNGQSSSEEDKRKIVGYARVSTANQKGDLKDQEDFIRQYANAKGIILDEMITDIGSGLNYKRKKWNRLLDEVMQGKIKTIYITYQDRFIRFGYDWFEKLCNQNGTEIVVLNNQETSPNDELVQDVLSILHVFSCRLYGLRKYKHKISEDKELSQK
>NC_015602.1|WP_013854089.1|662379_663663_-|transposase
MIVKTRIYQLYPNQTMKQVLDDWCDYRRYCWNQALALWQDLYMAHTILDKVVATVFIPKQDKKTKKWKAIHRDQHLNPSPNWRLVRDRMIEQKNDWQYAYSARTLQLAVQDLGKAWESFFNQAQPDWGKPKFRSKRNPRQGFKTDRAKIKDGRLWLEMPRETPYKDDWTGIKLSEKPLPGKIGVVSIVRINDKYYACVPYKLETPVSKAKTGKEAGIDVNVGHFNYQDGQCLILPDSLKHLYLKIKFYQKRLAKKRTVNGRIKGTQSNKYLKTKAKLQACYQRATNIQRDLMHKFTTKMADEYDQIVIESLDVKAMLMSHVASKGMQRSMFGLFRQLLAYKCAWYGKELILADQHYPSTQRCAVCGTVKKGADKITLKGNQKHGTKHNEYICYNPACPNYGKTVDRDVNAMKNLTLLISHPELNKAL
>NC_015602.1|WP_013854088.1|661823_662192_+|hypothetical-protein
MRKRRYKNTLILSLFAIFILIAGYFSFFYTPKSQGPRVIKVGIVGANKADIAIWKNVAKKVKQKYHVTVKTVSFDGYDQPDKALKSGDVDLNAFQHYAFLNAWNKSNHGGISPIGQTYIAAI
>NC_015602.1|WP_013854087.1|661142_661388_-|hypothetical-protein
MKQYIKDTVISTVISMIITMIVSAIGKQIKNRKDKIVHPKRREVSSSVRIYEDEIPVKEQSSEISDLKADAINHGYWPVKY
>NC_015602.1|WP_013854086.1|660264_661095_+|AraC-family-transcriptional-regulator
MKYYRWGFNNQDYNAQFYVSSGGFEKPHPCHSYGPMGRSGYMIHCVTGGHGIFKSNGKVYHLKKGDIFYIQPHKTTYMEADAVDPWTFYWVRFIGNLVPQYMKRINLSYQNPIIRQEDLPTVFQDVVDIVEYSQQTGPRDFYYQSKMFSILHALQLHFPKESTKNKVLQTTDIYDRALRYIANNYEEQISVHDLVGYLNIDRSYLFRIFKKHSQTNPQEFITNYRLAKASELLKSKNNTVEYVALSCGFLSYQSFFRFFKKKYGISPTQYKKKYLK
>NC_015602.1|WP_013854082.1|655636_656530_-|proline-iminopeptidase-family-hydrolase
MSGETKIVTLQDNYHVWTRREGEGPIKILLLHGGPGMTHEYLEPFSDYIKNHPEIEIIYYDQLGSYFSDQPNDPTLWNIPRFIDEIEEVRKAWHLEQFYLYGQSFGGLFALEYAASQYGKHAKAVIDSNMVDSYQDYAKYINKYRETMDSDDVAYMKKIEATGDYEDSHYNELLQKLYNRCICRIHPWPDAVQRTFDHLNEQVYVTLQGPTEFNITGLCRNWTIRDRLKKITVPTLVLGAKYDSMNPEEIKAVAKRLPNGESHICPNGSHFSIFDDQKDYFNAITKFIEKVEDRELD
>NC_015602.1|WP_013854080.1|653756_654542_-|hypothetical-protein
MKLTTQISKFAQQAKFLPKVKIIGSKDFVVKSLSRDAFITKDEETISPSEVGTIVDYLTRYVVLADEHAFDVANIKAREDFQSHVASINQVKKLFAEENKLAKMVVNLSDIEDLPDDAIILATDICAWEVAYRSGKYIAPKEYPDKLTINHIRTMINRVEQFFEEYGWPTKDAFTAYTKNGCLVGDGDYLLSSTLVDLKVSTSQKMQMYWVRQLLLYYALGFYNHVNDEQIDRLMIFNARNNGVYYVDISSIDKSVIGFVY
>NC_015602.1|WP_013854079.1|651395_651962_-|restriction-endonuclease-subunit-S
MTDWKQRKAPVLRFKGFTDVWEQRKLGEVAQIVRGASPRPINNPKWFDSESNIGWLRISDVTSQKGKIYHLEQHISKLGQQKTRVVTTPHLLLSIAASVGYPVINYVPTGVHDGFIIFENLKLNIDFGFFWLQNFRPIWKKYGQPGSQVNLNRSIVSNTKICFPSNIEQRKEDRRSFESNHKITIYEP
>NC_015602.1|WP_148234231.1|650977_651415_+|restriction-endonuclease-subunit-S
MLQNLFTCKSFPKVRFKGFLNAWEQRKLGDVAIFFNGRAFRQNELLENGKYKVLRVGNFYTNNSWYYSNLELDNKYYINKGDLIYTWSASFGPHIWNGEKVIYHYHIWKIQPSQFIDKNFLMQVLENDKNKLIANVNGSTMVHKL
>NC_015602.1|WP_013854093.1|667723_668113_-|hypothetical-protein
MKKVVVFLLSLVMLTTGSIVFINDGSNEVQASSLKAYNVPKRYRGHWKNKNCWLTISKRHISGNYFTKHGTTYRWTAKAQRHVSNHIVLCSRYRKGITIGLAGGERSYLVRKGKNLKLYIDTWVETLHR
>NC_015602.1|WP_013854094.1|668142_668742_-|hypothetical-protein
MKKKKIFSIIITLLLVVACGLGTRSRQVDAKTITLKAYTAKRYLNVTPKRAEGLGSGGSWIEKQVDKTIRVNHGKYFTYVPMVYTITKNMRAVYDTESLTSDQGEKMTFKRGYLYVARMPLHISHLKPNQKYRFRTDTLGDNTPYVQYHWITKRANRKGVISFGGPSVDIYLNCNVNKSFLKKALHDKRRILNRKIQIL
>NC_015602.1|WP_013854095.1|668751_669291_-|hypothetical-protein
MGAKKDATSASNIKAALTNMEKANRARKQYDVPALKVSPVLVAISMIDADYQKSGLTHPQYYKQGLENLAAGAEPVNMWLGEKSNWKWNVKKNPSLAAYEFVPNWGGVYNDVAMGTNGYKTSGHYLNLLNRTHTVMGMAHMTGNSDYGSVDAFNASSDDPNGALSLSQYKNLVNEWLSK
>NC_015602.1|WP_013854096.1|669313_669667_-|hypothetical-protein
MDWWYIYVYQKKTDKHGTGWYKVSKKSWIKASDTNRPYGKAGNDSNNAASSSAKKVANNKATQPKKAVKHASTNNATKNAASLMDFLANNQTLTAAQRAEAQKAMTLNRTIGLSICT
>NC_015602.1|WP_025084198.1|669597_670035_-|SLAP-domain-containing-protein
MKKSLLISLTASSLFALGLTASGVNSESVQAATKTAYLKNKAYIYTYRGHRTRKSIAKSKHVKITSTKRIKGHKYYRLSKNRYIRAANATTPYLFKVTIREDYDDDNVGEVHVSPSQQSKVTGWIGGTYMFIKRRLINMELVGIR
>NC_015602.1|WP_143000321.1|670174_670621_+|hypothetical-protein
MKKKQQRHQKHRKYLAMKVELVNGQPKWFRISPKFFQIIITEQRLRKIHPRKMLTNCLINIPLTTYSRHNQAVIGVGRVIKMEYRAHTDTRLCVRGQFTPPEKLKKEFFLTYHYLRHDYGKLSKINIMFDLYFWRRKVKQNHLTNSFF
>NC_015602.1|WP_013854098.1|670665_671103_-|hypothetical-protein
MLKDQQKFDQLGEKLFMDGVLQDFEKKHGPIKGRMMVTEGKIPPEMLMKLQPELMKNPKWIVVDGSFDFSNYTIGMVVGLNPVRPISNGWLTPQLNHPGVAPTKNWQEFFMEKVMQNIDENGKIDLPLYSLISDKSDLTLNGKEK
>NC_015602.1|WP_013854101.1|673182_673335_-|hypothetical-protein
MPIDFEKQIKPQRKVIELRGLQGIMTNLPHEYDHENFTNDLFGDDVVNFE
>NC_015602.1|WP_158306206.1|674322_675009_-|CPBP-family-intramembrane-metalloprotease
MVKTGILSKNYGWTLILIRYIIAIVALILYSQKVVHNKFNFEFDLKWPSIIGWVVTLIFIVFNFWYIGDNDFTLSNNGLSSLLYCLGPAIFEELWLRGLIFNRLRIVNKLDHPLFKATFISAALFAVLHLILPDYSNWLDLLTQIITAFGLGVLFAGIYCITNNLALTMLIHFSENFNSYFITYLPWFDDFDLNDFIVNLIQTFIYLIIGIFLLWLFWRKKNSVKRND
>NC_015602.1|WP_013854103.1|675174_675858_+|hypothetical-protein
MDYLSKKKEYIFLNNRQALVRVHVKQVSKQPYSIWVEGKSKNYRDCVALLNRTLVKFDPQLVPPIVVVSNKKLGNGAISSYAFEDNVIFFNNFYHSTEQIDEITHQNLFIATDLKEIIRHELGHKLHWDAIKRFYRSHKKQYNNLQEAKNDFDSNLESYITHQLNNNYSYLIENVSTYANLAFEYAKANYKNNSVNEVIAEVYAIHGSKDPILNDLIMEELNYGRKH

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_015602_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_015602_2

1237775-1237965

Orphan

Consensus_repeat	Method
ATGTGGGATTTGAACCCACGC	PILER-CR

2 spacers

The CRISPR arrays of NC_015602_2

>merge|NC_015602|2|1237775-1237965|PILER-CR
ATGTGGGATTCGAACCCACGCATGCTGGATCCACAAACCAGTGTGTTAACCCCTTCACCAATTCCGCCATAAACGGTCCATGTGGGATTTGAACCCACGATCTCCTCCGTGACAGGGAGGCGAGATAAACCACTGCTCCAATGGACCTCCAATGGACCAATCAGAGGAGGATGTGGGATTTGAACCCACGC

>NC_015602|2|2|1237775-1237965|PILER-CR
ATGTGGGATTCGAACCCACGC	ATGCTGGATCCACAAACCAGTGTGTTAACCCCTTCACCAATTCCGCCATAAACGGTCC
ATGTGGGATTTGAACCCACGA	TCTCCTCCGTGACAGGGAGGCGAGATAAACCACTGCTCCAATGGACCTCCAATGGACCAATCAGAGGAGG
ATGTGGGATTTGAACCCACGC

Protein	Signature genes	Signature genes Name	Protein_function
NC_015602.1\|WP_013854580.1\|1220224_1220947_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|236523
NC_015602.1\|WP_013854592.1\|1242783_1245759_-\|type-III-restriction-modification-system-endonuclease	unknown	unknown	gnl\|CDD\|237972
NC_015602.1\|WP_013854594.1\|1247677_1247923_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|379188
NC_015602.1\|WP_003633097.1\|1238133_1238634_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NC_015602.1\|WP_013854585.1\|1228192_1229422_-\|IS110-like-element-ISLhe4-family-transposase	unknown	unknown	gnl\|CDD\|376564
NC_015602.1\|WP_013854590.1\|1236160_1237627_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|129794
NC_015602.1\|WP_013854587.1\|1232380_1233658_+\|ISL3-family-transposase	unknown	unknown	gnl\|CDD\|225995
NC_015602.1\|WP_013854583.1\|1224677_1226273_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224055
NC_015602.1\|WP_013854593.1\|1245762_1247667_-\|site-specific-DNA-methyltransferase	unknown	unknown	gnl\|CDD\|225100
NC_015602.1\|WP_003674720.1\|1249948_1250395_-\|hypothetical-protein	unknown	unknown	unknown
NC_015602.1\|WP_013854598.1\|1250603_1250804_+\|cold-shock-protein	unknown	unknown	gnl\|CDD\|224197
NC_015602.1\|WP_013854591.1\|1239238_1239616_-\|hypothetical-protein	unknown	unknown	unknown
NC_015602.1\|WP_013854599.1\|1250898_1252230_-\|ISL3-family-transposase	unknown	unknown	gnl\|CDD\|376574
NC_015602.1\|WP_074484248.1\|1249100_1249397_-\|CPBP-family-intramembrane-metalloprotease	unknown	unknown	gnl\|CDD\|376806
NC_015602.1\|WP_013854586.1\|1231079_1231811_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|213234
NC_015602.1\|WP_034536270.1\|1247903_1248302_-\|DUF2326-domain-containing-protein	unknown	unknown	gnl\|CDD\|378384
NC_015602.1\|WP_013854588.1\|1233758_1235531_-\|oleate-hydratase	unknown	unknown	gnl\|CDD\|237575
NC_015602.1\|WP_013854584.1\|1226262_1227840_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224055
NC_015602.1\|WP_013854581.1\|1222017_1224300_-\|serine/threonine-protein-kinase	unknown	unknown	gnl\|CDD\|270622
NC_015602.1\|WP_013854589.1\|1235640_1236153_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228

Protein	Function_ID	Function_description	E-value
NC_015602.1\|WP_013854580.1\|1220224_1220947_-\|hypothetical-protein	gnl\|CDD\|236523	PRK09452, potA, spermidine/putrescine ABC transporter ATP-binding protein PotA.	0.00916034
NC_015602.1\|WP_013854592.1\|1242783_1245759_-\|type-III-restriction-modification-system-endonuclease	gnl\|CDD\|237972	PRK15483, PRK15483, type III restriction-modification system endonuclease.	0
NC_015602.1\|WP_013854594.1\|1247677_1247923_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|379188	pfam13443, HTH_26, Cro/C1-type HTH DNA-binding domain. This is a helix-turn-helix domain that probably binds to DNA.	1.95339e-12
NC_015602.1\|WP_003633097.1\|1238133_1238634_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	3.72017e-13
NC_015602.1\|WP_013854585.1\|1228192_1229422_-\|IS110-like-element-ISLhe4-family-transposase	gnl\|CDD\|376564	pfam01548, DEDD_Tnp_IS110, Transposase. Transposase proteins are necessary for efficient DNA transposition. This family includes an amino-terminal region of the pilin gene inverting protein (PIVML) and of members of the IS111A/IS1328/IS1533 family of transposases. The C-terminus is represented by family pfam02371.	5.46947e-31
NC_015602.1\|WP_013854590.1\|1236160_1237627_-\|MFS-transporter	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	5.80947e-41
NC_015602.1\|WP_013854587.1\|1232380_1233658_+\|ISL3-family-transposase	gnl\|CDD\|225995	COG3464, COG3464, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	8.32298e-48
NC_015602.1\|WP_013854583.1\|1224677_1226273_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	1.07954e-64
NC_015602.1\|WP_013854593.1\|1245762_1247667_-\|site-specific-DNA-methyltransferase	gnl\|CDD\|225100	COG2189, COG2189, Adenine specific DNA methylase Mod [DNA replication, recombination, and repair].	2.38608e-45
NC_015602.1\|WP_013854598.1\|1250603_1250804_+\|cold-shock-protein	gnl\|CDD\|224197	COG1278, CspC, Cold shock proteins [Transcription].	6.85189e-34
NC_015602.1\|WP_013854599.1\|1250898_1252230_-\|ISL3-family-transposase	gnl\|CDD\|376574	pfam01610, DDE_Tnp_ISL3, Transposase. Transposase proteins are necessary for efficient DNA transposition. Contains transposases for IS204, IS1001, IS1096 and IS1165.	1.49333e-50
NC_015602.1\|WP_074484248.1\|1249100_1249397_-\|CPBP-family-intramembrane-metalloprotease	gnl\|CDD\|376806	pfam02517, Abi, CAAX protease self-immunity. Members of this family are probably proteases (after a isoprenyl group is attached to the Cys residue in the C-terminal CAAX motif of a protein to attach it to the membrane, the AAX tripeptide being removed by one of the CAAX prenyl proteases). The family contains the CAAX prenyl protease. The proteins contain a highly conserved Glu-Glu motif at the amino end of the alignment. The alignment also contains two histidine residues that may be involved in zinc binding. While they are involved in membrane anchoring of proteins in eukaryotes, little is known about their function in prokaryotes. In some known bacteriocin loci, Abi genes have been found downstream of bacteriocin structural genes where they are probably involved in self-immunity. Investigation of the bacteriocin-like loci in the Gram positive bacteria locus from Lactobacillus sakei 23K confirmed that the bacteriocin-like genes (sak23Kalphabeta) exhibited antimicrobial activity when expressed in a heterologous host and that the associated Abi gene (sak23Ki) conferred immunity against the cognate bacteriocin. Interestingly, the immunity genes from three similar systems conferred a high degree of cross-immunity against each other's bacteriocins, suggesting the recognition of a common receptor. Site-directed mutagenesis demonstrated that the conserved motifs constituting the putative proteolytic active site of the Abi proteins are essential for the immunity function of Sak23Ki - thus a new concept in self-immunity.	2.31481e-07
NC_015602.1\|WP_013854586.1\|1231079_1231811_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|213234	cd03267, ABC_NatA_like, ATP-binding cassette domain of an uncharacterized transporter similar in sequence to NatA. NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake. NatB possess six putative membrane spanning regions at its C-terminus. In B. subtilis, NatAB is inducible by agents such as ethanol and protonophores, which lower the proton-motive force across the membrane. The closest sequence similarity to NatA is exhibited by DrrA of the two-component daunorubicin- and doxorubicin-efflux system. Hence, the functional NatAB is presumably assembled with two copies of the single ATP-binding protein and the single integral membrane protein.	8.37685e-103
NC_015602.1\|WP_034536270.1\|1247903_1248302_-\|DUF2326-domain-containing-protein	gnl\|CDD\|378384	pfam10088, DUF2326, Uncharacterized protein conserved in bacteria (DUF2326). This domain, found in various hypothetical bacterial proteins, has no known function.	3.29038e-13
NC_015602.1\|WP_013854588.1\|1233758_1235531_-\|oleate-hydratase	gnl\|CDD\|237575	PRK13977, PRK13977, myosin-cross-reactive antigen; Provisional.	0
NC_015602.1\|WP_013854584.1\|1226262_1227840_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	1.80614e-57
NC_015602.1\|WP_013854581.1\|1222017_1224300_-\|serine/threonine-protein-kinase	gnl\|CDD\|270622	cd00180, PKc, Catalytic domain of Protein Kinases. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. PKs make up a large family of serine/threonine kinases (STKs), protein tyrosine kinases (PTKs), and dual-specificity PKs that phosphorylate both serine/threonine and tyrosine residues of target proteins. Majority of protein phosphorylation occurs on serine residues while only 1% occurs on tyrosine residues. Protein phosphorylation is a mechanism by which a wide variety of cellular proteins, such as enzymes and membrane channels, are reversibly regulated in response to certain stimuli. PKs often function as components of signal transduction pathways in which one kinase activates a second kinase, which in turn, may act on other kinases; this sequential action transmits a signal from the cell surface to target proteins, which results in cellular responses. The PK family is one of the largest known protein families with more than 100 homologous yeast enzymes and more than 500 human proteins. A fraction of PK family members are pseudokinases that lack crucial residues for catalytic activity. The mutiplicity of kinases allows for specific regulation according to substrate, tissue distribution, and cellular localization. PKs regulate many cellular processes including proliferation, division, differentiation, motility, survival, metabolism, cell-cycle progression, cytoskeletal rearrangement, immunity, and neuronal functions. Many kinases are implicated in the development of various human diseases including different types of cancer. The PK family is part of a larger superfamily that includes the catalytic domains of RIO kinases, aminoglycoside phosphotransferase, choline kinase, phosphoinositide 3-kinase (PI3K), and actin-fragmin kinase.	5.88663e-10
NC_015602.1\|WP_013854589.1\|1235640_1236153_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	2.32543e-07

>NC_015602.1|WP_013854590.1|1236160_1237627_-|MFS-transporter
MNKKQITMVTIALMLGNVMSGLDGTIINTAIPTIVAALHGIQFMGWIVAIFLLGMSISIPIWTKIGEKITNKKAFEISLVLFVLGAALQGMAPNIIFFLCSRFIMGIGAGGMGSLPYIIAGYVFKNIKTRTKVLGYLTASWNGAAILGPLVGGWLIDAFSWHWVFYINIPIGLIALIICLIYYKPVTPEKTPVFDIPGAGLLVIGLLLFLMGVQLVGLTANWIVISLIIISLVFIVLFFIRENHAANPIIPVSLFKNKDLDGDFLLFAFTWGAFIAVNTYMPMWAQALLGLSALLGGMTLIPNSIVEIIASQSVAAIQEHMSTFKLALIGIIAMMISSAGLFLADIHTPVQMLTFIGAFSGIGVGFIFVAMQLKVQLDAGLKNMATATSTSYLIRILAQTVMAAVYGVIMNLNLASGVHTYKGITMAMMNKLSDAKSAKLLPQELVPTMRTIFHAGIKEIMLVSLILLIIAFVLNFYFNFGKKRKKLQ
>NC_015602.1|WP_013854589.1|1235640_1236153_+|TetR/AcrR-family-transcriptional-regulator
MNMKSLHTQQHIEKALFSLLQKKPYAEISIAEITRKAHVSRTSFYRNYSQKNDVLTLFLANQYKKFIVDINEHKLKTLTKQLVAYLTFFKGNPKVMKILLDAGFEGSLLNFQTRYLKKLLSVYHPDLNLPDYAIAYQSGGIYMLLIWWVKQDYATPLEDLINYAEKHIML
>NC_015602.1|WP_013854588.1|1233758_1235531_-|oleate-hydratase
MHYSNGNYEAFVKAEKPKDVDQKSAYIVGSGLAALASAVFLIRDGQMKGEHIHILEELGLPGGSMDGIYNKEKESYIIRGGREMEPHFECLWDLFRSIPSTEHEGESILDEFYRLNRRDPSYAKTRVIVNRGQALPTDGQLLLTPKAVKEIVDLCLTPEKDLQNKKINEVFTKEFFESNFWLYWSTMFAFEPWASAMEMRRYLMRFVQHVATLKNLSSLRFTKYNQYESLILPMVKYLKDHGVQFHYNTIVDNVFVNRSNGEKVAKQIILTENGEKKSIDLTPNDLVFVTNGSITESTTYGDNTHPAPAEYELGASWQLWKNLAAQDEDFGHPEVFCHDIPKANWRMSATITFKNDDIVPFIEAVNKKDPHSGSIVTSGPTTIKDSNWLLGYSISRQPHFKAQKPNELIVWLYGLFSDTKGNYIQKTMPDCSGMEMCEEWLYHMGVPEGKIPEMAAAATTIPAHMPYITSYFMPRALGDRPKVVPDHSKNLAFIGNFAETPRDTVFTTEYSVRTAMEAVYTLLDIDRGVPEVFASAFDVRMLMNAMYYLNDQKKLEDLDVSMPEKLAIKGILKKVKGTYIEELMKKYKLI
>NC_015602.1|WP_013854587.1|1232380_1233658_+|ISL3-family-transposase
MSSFNNCIKFDLDIKEKNIVFKDYFYKMVQMKKHKIYEAELIQPACPYCGSLALLHNGHLITNIRYLTANASHPVTIRLAKQRVRCRDCSRWSIAPSELASKYCSISNASKLKILSALTEDRSMTSIARENNVSVNTVQRVLGSCSHRFLDSYEYLPAHLAFDEFKGVDRQLHFICLDGDSHQIVQILRTRYKKNLLKYFGRFSPQARANVRTVTMDLNFYYQDIVRACFPNAQIVIDRFHMIQMLTRSFNSLRVKVMKTFDKRSRQYQLLQSPWKLYLKKYDELEKIHPRYNWHYKACLTQAQVVMEGISANTALENSYNLMQSFIQAIETNNTQELKSLITSKDSIGTLMHKTLLTFKYNLKAVLNGAALPYSNGCLEGFNRKIKQIERTAFGYSNFINLLTRIRLEENQYTEKEPNILLMTA
>NC_015602.1|WP_013854586.1|1231079_1231811_-|ATP-binding-cassette-domain-containing-protein
MIEMKNVSFDYVTFEKNPGLKGALKDFFRRKSHKKRAINTLNLTIKDGEVIGLIGPNGAGKTTFAKLLTGIIEATEGNIKIDNINPALHCKSFYQNIGVMFGQKTQLSWNLPPIDTFNMLSAIYELTDKNYKNRLNYLVEVLNLKDIIKIPVRKLSLGQRVKCELLCALIHSPKYLFLDEPTLGLDIETQKNIYDFLLEENRINKTTIIFTSHNLRDIEAISKRLLILVQGHIILKLSNLLCK
>NC_015602.1|WP_013854585.1|1228192_1229422_-|IS110-like-element-ISLhe4-family-transposase
MMKQNIIFGIDVSSKSSTVCVVIDRIKQGETFKITNDSFGYQDLLDRLNQYLITPLVVFEATGVYSLSLQAFLEDYHIKYLKLNPLKAKKLMDNNLRHNKTDKVDAYRLALIQFNAPQKLRAPQPKEYHELQNASRYYEELTQALIINKNQLHRNLQSTFPQIESILSTSSGRVYWTIVSLFPHAQYVLNHNENQVFQSLLAISGIGRQRAHYLTTRLYALARQAYPYDNESSITIRAIQRNIANLLSLSAERDNVINYMEKLAMQANARSLNIYESIPGIAKTTAVRLVAELGDLRRFDTSAQIDAFVGIDPGRYQSGEKDSHLGITKHGNHLARKILYRTITQMETVKATQPCHITDYYDKKKRSSNSRGYKKIAIASVHKLIRTMFALIKHDQLYDYNVATHNQRL
>NC_015602.1|WP_013854584.1|1226262_1227840_+|ABC-transporter-ATP-binding-protein
MTIKELYRVNPLRFILATISYVLIPLSAIGQSYLLMYEVTALSNRNLKLWLWLTAGELLILLVTNLTQSSSNYLATKQIQNYNHQVRANTIKHYYFDGQDHTVAAMQNRLTTDLKNTNENYLLNFFRSVQMACYILFAVIVLLLIHWSLLLVTLVLVGISIYLPQLIAKPIQAAFSKISDSNKKYLDVAEKWLNGLNTLQRYMAGGHLFKVMDEAAQEVQESKVQQTRINQRLAVMNGLVSSLLMLALFAFTAVLIANKLVVFGTITTVGNLQFYMATGLQYLGNYRGQIKSTKPLNAKIAEDSNAIEQQKENELGTAVAFSGKNLSVAFPNGEKIAFPDFSVKAGEKILLTGDSGTGKSTLFKLILGELKPATGTITYFDKDNNKIDPNLAKIGYIAQTPRLFPVTIADNVTMFDSKLNQKVDQVLSEVDLTDDVKKFKNGDQQKVDLDHLNVSGGQRQKIVLARAKIHDSDIILIDEGTSAIDQKATIEILKKLMQSKATIVFIAHNFSEEMHQMFNREIHLG
>NC_015602.1|WP_013854583.1|1224677_1226273_+|ABC-transporter-ATP-binding-protein
MTISGLIKSQKWRFALIFLLFILVAGLNTAASYFFKPATDALVKGNLNTSLSFFVVMIGAGIISIILDAIVQTIYSHQVQDYIGLLRQKIVHHFYQKNDQTVTEMQNELGNNFDMLTDNYATPVQTLISNSFTLIFTIGVLVQLNWTLVILTAILAILNLLTPRIMEKATSKANQQVSIENSKLLKTIDHWLGGIQELRRYSSFSELFRTMNKTDSNFEGSNIHSAKVQSLSLFISSLANTISQIAISLWAGVLFFQGKMTIGAALVVGDFASQIFNAIWIYEQAMTQLKSVKSVNEETKKLEKAVPKNIEKLSDDLAELDINDLDVKYEHGEEIHYPNIKIKQGEKVLLTGDSGTGKSTLFKVILGQLKPKSGTVVFKDSSGKVIKPDLGKIGYIAQDSILFPESIQNNITMFNSALDSKVEEFVEKVQLKKDILKFPDGLETAVDLDKDNLSGGQKQKVVLARSQIHHSKFVLMDEATSAIDSEATKKILQELLKSDVTLILIAHNFDQNLRAMFDREIHLKGVKSNDN
>NC_015602.1|WP_013854581.1|1222017_1224300_-|serine/threonine-protein-kinase
MTSLINNKTLLNLQNKIFTTDLLPDNIIQSSLFDITRDKKHYFLQFNLSDKKLPHQGFKIHVSCTEENFQSILNTIYNFCIQHKVSFKYISNLENLLNNLSGKSSIWSSGKFITIYPESLSSFKEIITQLYSLKAFQLKKGITISSDRRYKDSNILFYRYGIISGPDVNIYNPNSHTIEYRDYTQTTYKLPSWVKEPFPDNIDDKKTSKYLFKSIIPFKALNARASGSTFLAIDKRKNRKIVLKDAKPGFSEGGISVITSLKNEERNLKKLAKFNFIPNYLGSFTEDKDYFLCEQQMPGISIDAFRANGNKDFLDSNQRKNTIQIYKNVITDIISKLNELHKNNIFLGDLSSTNILIDEEKQTSSFIDISQSFNVKENKGKTLSSFRTTGFYDKNIDILPALEQDNQQLGYIIISMFCRANMFLFIDKTGEMTINFFKKYASLNQIPKIFVNVVTKLIKEPNLDLTKLQDLLSDDKYYPYTMNDDIYSINSFELSLQKNIYLSQLNHLNFVEEKLTSIDSNTDFIFSDKLQFVVKNIIRNNKVTFEEDIQNKLIDSVKLLNHLLVNNLTDPQIKQLSIQNIFALLLCSIIQAKPQHKEDIKALIHAVNISYQYSSPTEGIFYKTTLLSNRLSPYLSDGTAGMLMILLKFKKKFQDSTYDNEIYKLSDTLGKHYMPQNASLMHGLSGILLGLMNYTKVFHNNGFTDFIKENIQTLPYYAFHFNNQSIIVNPSFQTLDINFENGNKGIIYVIDLAKKMKIIS
>NC_015602.1|WP_013854580.1|1220224_1220947_-|hypothetical-protein
MFVYSPKRFKGSLSLSENDMQLLQLICNFGFVNDSQLDMLYSIVQHYPTRFFHPILLKWCQYSGLLQKKKKPLHPSSSSVLRNVYIPTKNCRAFLNANGFVLGDDPLVAINSHNEQAIEVVVQGLYTAMFKASAYNLYSAYLGSKSSYRLLVNPERSIRKVHPERDNQINQKNQILLNPEGLRLPESFNQFNQITQMEHPEKTARSSKAPTFTASNPLWYKRHFAFMRSISNTPIDKYLS
>NC_015602.1|WP_003633097.1|1238133_1238634_-|GNAT-family-N-acetyltransferase
MIIKPLISEDEAKETSRLFQKCWQNTYKDILPDVFLDNIPENAWVKRLNESGRHNLIFIDDDNKIRAAVSYGRPRDTRMLGCGELMALYVEPDFQGFNIGKTLLNAAENELKKMGYGKIYLWCIDGDENARQFFEHFGWVNNATEKFVEIAGKEYKYLLYQKNLHD
>NC_015602.1|WP_013854591.1|1239238_1239616_-|hypothetical-protein
METIQLIKDIILNELQDRVKYILSFKNKLEILEENDIQQGVTVARALQSFINAEDKEVTKTRYDRLMKSNNYLLNYKGFILEFRQFNGQITKRNLHSFIFEITSAHESTVLNALFPNGNVQFKDL
>NC_015602.1|WP_013854592.1|1242783_1245759_-|type-III-restriction-modification-system-endonuclease
MKIKLETLQHQTAALAAIDKAFPGMDTMSSDPNANYIYANPLIKYRYNDKANIDIKMETGTGKTYVYTRMMYDLHQKYGLFKFVIAVPSPSIKEGTRSFITSDYAKQHFSEFYENTRVQLNVINAGDFSARSGRRNFPAQLSEFVEATRQNANQIEVLLVNQGMLHSKSMHRDDYDQTLLGGETSPIKAIAATRPVVIIDEPQRFPRGKKFYEDIEAMKPQLIVRFGATFPETTTGRGKNKITKIDYYRGEPQFNLDAVASFNQGLVKGIDIDYPDMPEEQANNWYKVKQVKAKELVLTKGGKDYPLNVGENLADVDAGFEGNITYAGGTDRELSNGLALSKDMKLIPGTFAENYQDEIISQALDCHFKAEEENFLRLNSGENAPKIKTLSLFFIDSISSFRGENSGKGWLAQHFEDILTKKLKKLIDRFELAIDDREKEYRSFLQATLKSLQSEHQDVYAGYFSEDRGSSDADIQAEVEDILSNKEKLLSFKDKDGNWLTRRFLFSKWTLREGWDNPNVFTIAKLRTSGSEISKIQEVGRGLRLPVDETGHRLNQDEWPSRLSFLIGYDERDFAQKLVGEINDDSPIQLNQEELTDDMIKLIVKAKQKTDPKFDEDQLLDDLDDHNVITRSNKFKDEVKLDGQTMSGYDALCHLYPELVQETKVAKDKVRDKNSKDSTTVKLRKQNWQQLKNLWLQLAKRQMIRFDPSVNKDAETVAWNVFNDSDNKIFVLQCPQMVHQEVDTTSGNAIVKETQADYSTEYLTMKYGKFLKILAKQTDLSVNLLNNLMIKAIKRLRNNTNYINEKTLGNLIQTFNNQFNERIKTSYSYEPLKFSASTSIYNAKKHEFVDSIPASVLGVYQSNSTSDEKYLYDRPPLRYDSADPELKILQRSYGPKISVFGKLPKKAIKIPRFDNGTTTPDFIFKIEHGSKPIYLVIETKAENMRLGDEEIRIIQQKYFDHLKESGVYYQMATSEQEVHDLINKLENGELN
>NC_015602.1|WP_013854593.1|1245762_1247667_-|site-specific-DNA-methyltransferase
MQTDNEKYNETVQPNTAFLNELKEKLPEFFTKEGSFDLDKFRNQLKDKNVNELSEGYQLDFIGKDYARRQAGEMPSTVIVPDEKQNQGEGKNSKNLFFTGDNLEVLRHLQTSYQNKIDVIYIDPPYNTGSDGFVYPDSFEYSDEQLKDMFGLDDDQVERLKSIQGKSSHSAWLTFMYPRLVLAKRLLTDKGVIFISIDDNEQADLRFACDEIFGEANLISQICHKSRASISNDKIVSNSHNQILLYAKNERLVFDSRKEIGTTPKLNGFNHQDGNGKYKLVPVDGPGGAKKGNPFYNFLGVSGYWRFSKERMQKMYDQGLIVKTDNNLQQKYYLSKAKKSRKTVDSWWDEKFYTSSATSRLSKLMGGNYFDTPKPVSLIIKMLQMFTCFNKNATVLDFFAGSSTTADAVMQLNSEDDGHRKFIMVQLPEKTYHINKDGKEVPTKGGQAAYDAGFKSIDEISRERIRRAAKKIREDNELTLPENFDGSFKHYRVVKPVKQTLEEIDDFDPNNTNLFTNMVDGFSSHALAVDGDATGEETILATWLAKDGYSFDADVEEIKFSNYTAYKVEDNRLYLINEGWRAEQTKELLNKLGTYQLEIQSVVLFGYSFNVAELRELENGLKQLDSKVTLIKRY
>NC_015602.1|WP_013854594.1|1247677_1247923_-|helix-turn-helix-transcriptional-regulator
MSKQPNNLKIKYKVSYKKLWKLLIDRGLQKKDLQTKCDVSAASVAKLGKDANVTTDLLMKICTGLDCNLNDICETVPINEE
>NC_015602.1|WP_034536270.1|1247903_1248302_-|DUF2326-domain-containing-protein
MASLNEQVCGSNSFQPPRIELKPKEYNFETINDQGTGTSFKGLIIFDQACLDLTRLPFFIHDSLLFSNIEIDRRNRIIEMYAQETKQIFISIDSIEVLSEKAQEIIRENTVLTLERGGKELFGRSWNEQATK
>NC_015602.1|WP_074484248.1|1249100_1249397_-|CPBP-family-intramembrane-metalloprotease
MNDWWLQLTFTVISAPLVEEYTFRGYIFGVLDNIFNQTATIWITSFIFSLIHLSSLGKAAWYNAVFLVVAYTANGNVLYLSRCCSTEYVGKFYCACSK
>NC_015602.1|WP_003674720.1|1249948_1250395_-|hypothetical-protein
MINNWVSSSKELQLLVDDYLLTVNYRSVIENDLVNYTQGIESYFRNERLTLRDKINKFIEELPESYRELLSEHVGNTDDWIGKLVSTRVFLTHGDRENMAVSNPYKLVQMTKIFGFMVRIFILQKLGITIDKPKILNKFKNVLTTHYY
>NC_015602.1|WP_013854598.1|1250603_1250804_+|cold-shock-protein
MQTGTVKWFNADKGFGFITGSDGKDVFVHFSAIKTDGFKSLEEGQKVSYDVEQGGRGPQATNVVPQ
>NC_015602.1|WP_013854599.1|1250898_1252230_-|ISL3-family-transposase
MDYSTRTALGIKDSHLELDTAHFKNVIESHDNQVVVHLIQSYPLRCPRCGQLMLKNGFKIVNVLGPSLHYQPTIWSIRNQKYLCKPSSACPSTITELAKVKDIKYRHHISQAIKQQVMIQLTANESQIDIAKELGISDWTVRRVIFNLDQFFKPNYHWLPRHIAFDDFKSGRFAPSGMSMILMNIENHRTIDIILSRRNRYLRNYFLRYDRAARLAVRTVTVDLYTPYRHLIHGLFPHAIIIADHFHVVAQAYRALNKIRVKAMNQAGNGSHQWRALKHFWKLILTPAGLLKYDNYWSRRNFGYTQLTDVEVIQRLLAFNDDLKQAYRYYQDLILAINHRSKDELNHLLAIKWTQLPQSLQKVQRTLRRHRKEIITSFKYGDYTNGPVEGTNNKIKVIKRTAYGFRNFFNFRARILLALPNSYFAINWKNKRTAHVQSQTRAV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_015602_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_015602_3

1688512-1688723

Orphan

I-B,III-A,III-B

Consensus_repeat	Method
GGATCACCTCCACATACGTGGAGAACAC	PILER-CR
GTGTTCTCCACGTATGTGGAGGTGATCCT	CRISPRCasFinder
GTGTTCTCCACGTATGTGGAGGTGATCCT	CRT

3 spacers

The CRISPR arrays of NC_015602_3

>merge|NC_015602|3|1688512-1688723|PILER-CR,CRISPRCasFinder,CRT
GTGTTCTCCACGTATGTGGAGGTGATCCCCGACATACTTGTAATTGGTAGTGTCAATATCAGTGTTCTCCACGTATGTGGAGGTGATCCTCTTCAAGGCTTGGGCCTTTTAGATCCCATTCGGTGTTCTCCACGTATGTGGAGGTGATCCTAGCTATTTAATTTTTCCTACCACTGCCCACCCGTGTTCTCCACGTATGTGGAGGTGATCCT

>NC_015602|3|3|1688512-1688722|PILER-CR
GTGTTCTCCACGTATGTGGAGGTGATCC	CCGACATACTTGTAATTGGTAGTGTCAATATCA
GTGTTCTCCACGTATGTGGAGGTGATCC	TCTTCAAGGCTTGGGCCTTTTAGATCCCATTCG
GTGTTCTCCACGTATGTGGAGGTGATCC	TAGCTATTTAATTTTTCCTACCACTGCCCACCC
GTGTTCTCCACGTATGTGGAGGTGATCC

>NC_015602|3|2|1688512-1688723|CRISPRCasFinder
GTGTTCTCCACGTATGTGGAGGTGATCCC	CGACATACTTGTAATTGGTAGTGTCAATATCA
GTGTTCTCCACGTATGTGGAGGTGATCCT	CTTCAAGGCTTGGGCCTTTTAGATCCCATTCG
GTGTTCTCCACGTATGTGGAGGTGATCCT	AGCTATTTAATTTTTCCTACCACTGCCCACCC
GTGTTCTCCACGTATGTGGAGGTGATCCT

>NC_015602|3|1|1688512-1688723|CRT
GTGTTCTCCACGTATGTGGAGGTGATCCC	CGACATACTTGTAATTGGTAGTGTCAATATCA
GTGTTCTCCACGTATGTGGAGGTGATCCT	CTTCAAGGCTTGGGCCTTTTAGATCCCATTCG
GTGTTCTCCACGTATGTGGAGGTGATCCT	AGCTATTTAATTTTTCCTACCACTGCCCACCC
GTGTTCTCCACGTATGTGGAGGTGATCCT

Protein	Signature genes	Signature genes Name	Protein_function
NC_015602.1\|WP_013854988.1\|1698975_1699752_+\|Fic-family-protein	unknown	unknown	gnl\|CDD\|376885
NC_015602.1\|WP_013854990.1\|1702346_1703483_+\|5-(carboxyamino)imidazole-ribonucleotide-synthase	unknown	unknown	gnl\|CDD\|235674
NC_015602.1\|WP_143000353.1\|1684548_1684773_+\|hypothetical-protein	unknown	unknown	unknown
NC_015602.1\|WP_013854982.1\|1691325_1691871_-\|cysteine-hydrolase	unknown	unknown	gnl\|CDD\|238245
NC_015602.1\|WP_013854989.1\|1700193_1701855_+\|formate--tetrahydrofolate-ligase	unknown	unknown	gnl\|CDD\|237403
NC_015602.1\|WP_013854977.1\|1687579_1687855_+\|hypothetical-protein	unknown	unknown	unknown
NC_015602.1\|WP_013854972.1\|1682880_1683567_-\|hypothetical-protein	unknown	unknown	unknown
NC_015602.1\|WP_013854983.1\|1692134_1692368_+\|prevent-host-death-protein	unknown	unknown	unknown
NC_015602.1\|WP_003636323.1\|1673523_1674234_-\|ECF-transporter-S-component	unknown	unknown	gnl\|CDD\|227064
NC_015602.1\|WP_013854991.1\|1703679_1704396_+\|phosphoribosylaminoimidazolesuccinocarboxamide-synthase	unknown	unknown	gnl\|CDD\|181800
NC_015602.1\|WP_013854955.1\|1686032_1687439_+\|ISLre2-family-transposase	unknown	unknown	gnl\|CDD\|284250
NC_015602.1\|WP_013854980.1\|1689647_1690565_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223656
NC_015602.1\|WP_049776011.1\|1680333_1681038_+\|SLAP-domain-containing-protein	unknown	unknown	gnl\|CDD\|367400
NC_015602.1\|WP_013854987.1\|1697656_1698922_+\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|224292
NC_015602.1\|WP_013854966.1\|1672460_1673504_-\|hypothetical-protein	unknown	unknown	unknown
NC_015602.1\|WP_013854967.1\|1674241_1675906_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|213192
NC_015602.1\|WP_013854965.1\|1671994_1672423_-\|EutP/PduV-family-microcompartment-system-protein	unknown	unknown	gnl\|CDD\|371185
NC_015602.1\|WP_003627031.1\|1701865_1702354_+\|5-(carboxyamino)imidazole-ribonucleotide-mutase	unknown	unknown	gnl\|CDD\|376377
NC_015602.1\|WP_013854986.1\|1696217_1697423_+\|amidohydrolase-family-protein	unknown	unknown	gnl\|CDD\|238624
NC_015602.1\|WP_013854968.1\|1675893_1676790_-\|energy-coupling-factor-transporter-transmembrane-protein-EcfT	unknown	unknown	gnl\|CDD\|223692

Protein	Function_ID	Function_description	E-value
NC_015602.1\|WP_013854988.1\|1698975_1699752_+\|Fic-family-protein	gnl\|CDD\|376885	pfam02661, Fic, Fic/DOC family. This family consists of the Fic (filamentation induced by cAMP) protein and doc (death on curing). The Fic protein is involved in cell division and is suggested to be involved in the synthesis of PAB or folate, indicating that the Fic protein and cAMP are involved in a regulatory mechanism of cell division via folate metabolism. This family contains a central conserved motif HPFXXGNG in most members. The exact molecular function of these proteins is uncertain. P1 lysogens of Escherichia coli carry the prophage as a stable low copy number plasmid. The frequency with which viable cells cured of prophage are produced is about 10(-5) per cell per generation. A significant part of this remarkable stability can be attributed to a plasmid-encoded mechanism that causes death of cells that have lost P1. In other words, the lysogenic cells appear to be addicted to the presence of the prophage. The plasmid withdrawal response depends on a gene named doc (death on curing) that is represented by this family. Doc induces a reversible growth arrest of E. coli cells by targetting the protein synthesis machinery. Doc hosts the C-terminal domain of its antitoxin partner Phd (prevents host death) through fold complementation, a domain that is intrinsically disordered in solution but that folds into an alpha-helix on binding to Doc.This domain forms complexes with Phd antitoxins containing pfam02604.	2.78627e-07
NC_015602.1\|WP_013854990.1\|1702346_1703483_+\|5-(carboxyamino)imidazole-ribonucleotide-synthase	gnl\|CDD\|235674	PRK06019, PRK06019, phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed.	0
NC_015602.1\|WP_013854989.1\|1700193_1701855_+\|formate--tetrahydrofolate-ligase	gnl\|CDD\|237403	PRK13505, PRK13505, formate--tetrahydrofolate ligase; Provisional.	0
NC_015602.1\|WP_013854982.1\|1691325_1691871_-\|cysteine-hydrolase	gnl\|CDD\|238245	cd00431, cysteine_hydrolases, Cysteine hydrolases; This family contains amidohydrolases, like CSHase (N-carbamoylsarcosine amidohydrolase), involved in creatine metabolism and nicotinamidase, converting nicotinamide to nicotinic acid and ammonia in the pyridine nucleotide cycle. It also contains isochorismatase, an enzyme that catalyzes the conversion of isochorismate to 2,3-dihydroxybenzoate and pyruvate, via the hydrolysis of the vinyl ether bond, and other related enzymes with unknown function.	9.42354e-47
NC_015602.1\|WP_003636323.1\|1673523_1674234_-\|ECF-transporter-S-component	gnl\|CDD\|227064	COG4720, COG4720, Predicted membrane protein [Function unknown].	2.1864e-06
NC_015602.1\|WP_013854991.1\|1703679_1704396_+\|phosphoribosylaminoimidazolesuccinocarboxamide-synthase	gnl\|CDD\|181800	PRK09362, PRK09362, phosphoribosylaminoimidazole-succinocarboxamide synthase; Reviewed.	1.00951e-133
NC_015602.1\|WP_013854955.1\|1686032_1687439_+\|ISLre2-family-transposase	gnl\|CDD\|284250	pfam06782, UPF0236, Uncharacterized protein family (UPF0236).	7.32011e-26
NC_015602.1\|WP_013854980.1\|1689647_1690565_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|223656	COG0583, LysR, Transcriptional regulator [Transcription].	6.88963e-24
NC_015602.1\|WP_049776011.1\|1680333_1681038_+\|SLAP-domain-containing-protein	gnl\|CDD\|367400	pfam03217, SLAP, SLAP domain. This short domain is found in a variety of bacterial cell surface proteins. The domain is about 60 residues in length (although previously defined as 2 copies of this domain). It usually occurs in tandem pairs. It may be distantly related to the SH3 domain.	9.72061e-09
NC_015602.1\|WP_013854987.1\|1697656_1698922_+\|ATP-binding-protein	gnl\|CDD\|224292	COG1373, COG1373, Predicted ATPase (AAA+ superfamily) [General function prediction only].	2.34071e-56
NC_015602.1\|WP_013854967.1\|1674241_1675906_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|213192	cd03225, ABC_cobalt_CbiO_domain1, First domain of the ATP-binding cassette component of cobalt transport system. Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota. The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed. This ABC transport system of the CbiMNQO family is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways. Most of cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO. Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.	8.72088e-72
NC_015602.1\|WP_013854965.1\|1671994_1672423_-\|EutP/PduV-family-microcompartment-system-protein	gnl\|CDD\|371185	pfam10662, PduV-EutP, Ethanolamine utilisation - propanediol utilisation. Members of this family function in ethanolamine and propanediol degradation pathways. PduV may be involved in the association of the bacterial microcompartments (BMCs) to filaments.	5.94302e-62
NC_015602.1\|WP_003627031.1\|1701865_1702354_+\|5-(carboxyamino)imidazole-ribonucleotide-mutase	gnl\|CDD\|376377	pfam00731, AIRC, AIR carboxylase. Members of this family catalyze the decarboxylation of 1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR). This family catalyze the sixth step of de novo purine biosynthesis. Some members of this family contain two copies of this domain.	2.94575e-89
NC_015602.1\|WP_013854986.1\|1696217_1697423_+\|amidohydrolase-family-protein	gnl\|CDD\|238624	cd01299, Met_dep_hydrolase_A, Metallo-dependent hydrolases, subgroup A is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site. The vast majority of the members have a conserved metal binding site, involving four histidines and one aspartic acid residue. In the common reaction mechanism, the metal ion (or ions) deprotonate a water molecule for a nucleophilic attack on the substrate. The function of this subgroup is unknown.	1.79351e-97
NC_015602.1\|WP_013854968.1\|1675893_1676790_-\|energy-coupling-factor-transporter-transmembrane-protein-EcfT	gnl\|CDD\|223692	COG0619, CbiQ, ABC-type cobalt transport system, permease component CbiQ and related transporters [Inorganic ion transport and metabolism].	4.94671e-09

>NC_015602.1|WP_013854977.1|1687579_1687855_+|hypothetical-protein
MLYPYAEFPGELSITYSQVIKDSEMKNGEKIFVHFEKPTDFGFKEARYILPGFKEVYNYDFTPSETKKNLDILKRNAPLIIECAKEKKTSA
>NC_015602.1|WP_013854955.1|1686032_1687439_+|ISLre2-family-transposase
MESIITDIVKIIKSENNVIAREKALMCYFFGLIRELMKLALEEVDAGLVEETKKQGYQIEKKNKRSVVTAFGEISYWRRRYACPGKKAKYPLDKLMGYDKYKRYSVLAVKDVLQVSAVATYRNTALAVNTLSCFKISHSQVGKLIVQAGKQIKVQQQSEERYDGITQKKKVPVLYLEGDGVVIKGTKKRLEFHRYQVCEDIINLSKTRRKRVQVKEFVSLSRLDALQEIKAYLANPYDLSDTLIISNADGGAGYAKKDFDEIVGYCRQHEPFLDVFHLNKKIKDRLGFMPAMPSKLISAVEFKYDRHLTDVILDTIESNLVDELNTPENHENLKRLRSYLHRRWVDIKPFKMRHLSVIKAIGCCESNHRKYTYRVKGQGKYWSENGAEGILRVLTCIKNKELEYWLSSEFAGGQLDIGDQEELKGAVRASLRKTHEAHLGIHHGAIESLTAGHSYLNDFSRKINQINI
>NC_015602.1|WP_143000353.1|1684548_1684773_+|hypothetical-protein
MRVYLNKTTTQAVAAGAVGGVGALIANYVSGGLATFAVGAISSSVSALVGSSIKGGVWVDYNFLARTVTSCGWQ
>NC_015602.1|WP_013854972.1|1682880_1683567_-|hypothetical-protein
MKVKNAHEEYRDLLTRKQLVSQGLIPTDKGIELWTNQYCEHSAIYYDPAKAIKLESVYFWKNSFSDDYGLNVVEVGVVDQLGNELFSKVVKPCRGYLSEGSNADLWLKIEKDHSFSMADIICADNRVAVDRQLASVIKKQKYVKNLISYNVGFNVPNVLLANQAYKQIDMMELFANIIKEPYEDYYGEKSYKWQKLSKCLEYYDVKLNSYRAVDYARALQKCYEKMPK
>NC_015602.1|WP_049776011.1|1680333_1681038_+|SLAP-domain-containing-protein
MDIKVFELCIHKLKATNIDGVTRKITHNAYIYRTSTGRTSYNGRWKLYKGQTVTTYGGSYKFKNGKHYFRVGGPQKQYIKSYNLGPVVKVNTVQGRTSNNDNTNITANSKPTSSTLTSTEETTITVDANYSTPIITFDKNGKVVKVRTATPGEKFTVDRLEKGTRADKVASYIGQFGGDQSIYRIKGTNNWLYSMGVKAASKITAHDYDLEETSIIKFTQTTDLYNRVTAKHLL
>NC_015602.1|WP_013854968.1|1675893_1676790_-|energy-coupling-factor-transporter-transmembrane-protein-EcfT
MTHTPIKMTFFSQLHPVALTLYFTELIVCLLLFNHVAVAVAEFIALTITATYYLGGRKTARQLKYAVSFLLMIPFFNTLLNQKFPPILWHFKWGILTFKFSYPAFLYGIAMAIVLIAMQFVFSVLNAVLIPSKLIYVFSPIAPRLAVLVTISFTLVTSFTDRLKRILRLQKTRNVDVVNGSLKTRTQKTLHIFEILLQDALSSAMETANLMDARGFGAAKRTHYRSYHWQFSDLLFITIATVMLVATIGVRILSMGTSRSVANFTTIFTPGDTWPIVVTALLFLLPLISEGVYRSCKN
>NC_015602.1|WP_013854967.1|1674241_1675906_-|ATP-binding-cassette-domain-containing-protein
MQKLATVTHLTFTYPDQSTPVLDDVNFTIDPGDFIVIAGNTGSGKTTLLNHLKKELMPKGARTGDVQIAETPVADMPKLVSAQTVGYVAQDPQTQSVMATVIEELAFPLENIGCPSNEIERRITELANFLGFDQNLDRQIHQLSGGQLQLVNLASVLILRPKLILLDEPTSQLDPLTAQHFLTVLGRINQELGITIMLTEHRLSTVAAMANRMILLQDHHLTFDGDPHSGLAKMATDAHLTYFVPSIPKLFLDQQIRTSQLPISVADAQSAIRTHHLQFQSVTTGGKVAQLPPAEKPILTVNNISFSFDGQHNVLHHLNLAINPGTWLAIIGKNGSGKSTLLTLICGLMTPQHGKIRFVHQLVWKMAINQRMAKLAFLSQTPRLQFTADTVREELEVQAAELRLPDAKAQVDHMINQFHLNRIEKQNPFDISGGQQQLVGLAIALMATPDLLVLDEPTKGLDPYTKIQVGNLLKQYQQAGMTIVIASHDMEFCAKFADKCTFMFDGHLNTLLATQSFFADNFFFTTPINRIARDQVKDALLPVDLKLANHPERG
>NC_015602.1|WP_003636323.1|1673523_1674234_-|ECF-transporter-S-component
MKQSSLLNRYRLLIALLLMFIFLLFIVLLKGKHYLLFSFMCLICSLLPAYWRFEHDPISTQTLMFVAVLIALAVATRVPLGAIPGVQGASFVVILSGVSLGPELGFITGSTTALVSNMFMGQGPWTPWQMVAWGLMGLTAGLFMKARLSHSLIFMIVFACVWGYLFGWIMDLWYALAYVSPLTIKSFILAFAASFFPFDTFHAASNAFLIALFYKPWEKLFHRLVTKYNILPDKNQ
>NC_015602.1|WP_013854966.1|1672460_1673504_-|hypothetical-protein
MKLTSKLLMISASTLLGFGSIAPAFTANAASVETASRAYQNSKIKANYRYAKNLMIKNKTGLSGKTTALFSKKANPTIGAASGYADLLVGLKGWGYKFTTTQKKRIAANLVINSKSTAADYANAIQGLKAVGLNPTKFKPAGAKKAVNLVSGLYRQSMSKQTPNVKSQVLLALTMSSTFKRPSNAKFSKTSLAKSLVKDQQSNNGWAYNNTAASVDSDTTSMAIAALAHSKSSLSAVKTALVKGQSYLKSNITASGAYGYVFNGKTVANSTAEAIIALSSKQATVKYANGYFTTKQAASPLRAMLGYVNKTGSIKGATSQLIGVGQVNLATAAYRQALKGHSVYTVK
>NC_015602.1|WP_013854965.1|1671994_1672423_-|EutP/PduV-family-microcompartment-system-protein
MKKAMFIGAIGCGKTSFIQKLNELQMTYNKTQTIEFYNNVIDTPGEYVEHRAMYSNLMTTAIEADVIVLMQSATDPRIVLPTGFSTMFTKETIGVVTKTDIATNQQIEMVTERLRDAGAEKMFEISAKTGANVQQLIDYLRN
>NC_015602.1|WP_013854980.1|1689647_1690565_+|LysR-family-transcriptional-regulator
MMENKLIYKILTAVSTNNTISNVANGLYLSQPYVSQIISKTEKKYETKLVNRNEKPISLTAAGIKLLQDLDDEIKLHEKTKRDLSFFASKNGRVICVAITPIWISNLTAKVIHDLQAMFPEVQFQIERFFTAENAPALLQSNKIDIFWGAFLHQDQITSQYLYRSKAYVIIPFNHPLYDQSQKYLAYTPELFAKLNKSNYVALTDNSLYQTIVDHVFEDDGLKVKKIIRTNDFIGAGLLAIEGMGITITLGDILLYLGNKHNYNLMELPESLINLDVGISINATSPDLVKKVAEKLQLIIQKSVG
>NC_015602.1|WP_013854982.1|1691325_1691871_-|cysteine-hydrolase
MTKALLIIDYTNDFVADDGSLTCGKPAQAIEDYLLSLANDFFDNGDYVIFPTDGHTGDKFSPEYKLFPPHNIVGTPGQELYGKLKTWFQEHKDSNRVYQFNKNRYSSFQNTNLDNYLRERKIDDLWLTGVCTDICVLHTAIAAYNLNYKITIPKKGVATFTKYGNEWAFDHFRNSLGAKLI
>NC_015602.1|WP_013854983.1|1692134_1692368_+|prevent-host-death-protein
MAQIKPVSELKNYQTVLDKVKKGKPTFLNQDGQLKYALVDINEYDEFITALDLLKRLKNAAALEHYDFDAIKKDLFE
>NC_015602.1|WP_013854986.1|1696217_1697423_+|amidohydrolase-family-protein
MTKTVFVNCNLFVGNSEELLENAWFVVDNETGKLTAKGTGKVTITAEQTVDLNGQYVMSGLINAHTHVGLVNAAKDHYPETETLVTYKALKDLKSGLKGGVTYIISCGVPFDVDVKLKNMRDAYPFEGPGMRPAGMPISILGGHADQPLGENHELNAAHLVNSPDDVRKAVREQFKKGAENVKLMATGGIMSQGDQIDDTELSLEEMKMAVEEAHSKHMTVCAHAEGRLGIHYAVVAGVDSVEHGFYVSDEDIELMKKQGTFLSPTLIAGHQLAVYGKGKMTDFSYQKMCEHVDAFYAHVGKAIKSGVKLALGTDAGTFMNPLKNTAKELTELVRAGASNYQALHAAGLGSAELLKIDNEYGSLEEGKYADFLVLKANPLENVSAVEQDDKQVYQHGVRKF
>NC_015602.1|WP_013854987.1|1697656_1698922_+|ATP-binding-protein
MNPDLLAAIIIEGQKNIRNISIIPRDYHFEDSLNYVLVGLRRSGKSTLLFKRAQDLVNKQNVDWSQIVYLNFEDERLDGFQLSDCNNILIAANQLTTKKHYFLFDEIQNIEGWEKFARRLADQGESVYLTGSNSKVLGHDIVLRLGGRYMAKYIAPFNFSEYLTAKNISHDKLALLDTVNNGQIRAVANEYLRYGGLPESILLSDKRNYLTNIYQNVFLADIIVRNKIRNEKTISLLIRKIADTVMHIVSYANLYKNVKSVINTVSRNAIIDYIDYAKEAYLIFSTKNYFAKFNERESSPKYYFTDNGILNLFYIDKLPALLENIVAIKLHNKYQKKLFYLKSKKTGVDIDFYVPASKTAIQVAWEVNDTSKEREIGNLLKLADNFTEVENLVIVTHGEEETIEKEGKTIQLVPLYKFLLE
>NC_015602.1|WP_013854988.1|1698975_1699752_+|Fic-family-protein
MDDNLSLANFIVSFGSMNGYSSTVLQTKLALDFHNLSQLKNQHHDGELLKDALDGITVAQKMGFSTKSIIEINKTFVHNQNEDPNIPGHLRKASSNPDDAVIVVTDPNDTTDGAYYAPENVCPQDLDDIVNEFKSSEQSVKDAWRVFAELSKLQPFQDGNKRTALIAANTALNTWGSKDYLILPFDNIEHAAFMVNLMRFYRATTKEQENIALDRIIDTLPTSKEIQYYLSNSIEQKDEGINKLKNKRVKSFFKKNLD
>NC_015602.1|WP_013854989.1|1700193_1701855_+|formate--tetrahydrofolate-ligase
MPTDIEIADAAKMQPITEIAAKLALKKDDFEQYGKYKAKINFPVKEISGKKHKLILVTGINPTPAGEGKSTVLVGLGDAMNQLGHQTTIAMREPSMGPVFGIKGGATGGGYSQIIPMEDINLHFTGDLHALTSANNTLAALIDNYIMRDNKLGLDPRRIIWRRVEDVNDRALRTVVTGLGGLSQGVPRETGFDITAASEMMAILCLSESLHDLKRRIGRIVVGYSYEKKPVTVNELGFTGAITLLLKDAIKPNLVQSLGHTPAIIHGGPFANIAHGCNSVLATQIAMARSDYTVTESGFGADLGAEKFLDIKCRVLKKIPDAAVIVATARALKYNGGVDKKDLTKENISALKKGMANLARHVHNIQKYGIPVVVAINHFDSDTEAEIQTIKDACQEMDIKGIRVDAWAKGGNGTQDLAKEVIALTKKTYDFIPLYDENDSIEEKITTIATKIYGAKRVVFSKKARKQMKQFAKFGWEKLPVCIAKTQYSFTDDQTKLGAPTDFDFHIRDLVPKLGAGFIVALSGTIMTMPGLAKHPAAENMDIDDNGQISGLF
>NC_015602.1|WP_003627031.1|1701865_1702354_+|5-(carboxyamino)imidazole-ribonucleotide-mutase
MTVKIAVIMGSKSDWPTMKHACDLLDQFNVGYEKHVISAHRMPTEMYDFAQKAEERGIRVIIAGAGMAAHLPGMTAANTVLPVIGVPGQTKALGGMDSLLSIVQMPTGIPVATTAIGNAGASNAALLALEILGTNDEKLRGRLKNYRQKLHDLAKESSGELE
>NC_015602.1|WP_013854990.1|1702346_1703483_+|5-(carboxyamino)imidazole-ribonucleotide-synthase
MSRTDFIGQGKTIGIIGGGQLGQMMAISAKYSGMKVITLDPTPNCPCGQVADDQIVANYSDTSAIEELAERSDVLTYEFENVDLKALEDVKDKVAIPQGTKLLYITKHRIREKNFLRSAGCQTAPYIPVKNKSDLQAAVKTIGYNCVLKTCEGGYDGHGQEVLHSDADLTNDHIKQILSTGDCILEGWVPFKVEASVMVARNAMGEVSVFPVSENYNKDEILHMSIVPARISPDVYQKAQKIAVQIAEAIDLRGILGVEMFVLNNGEIYINELAPRPHNSGHYSIEACNFSQFDLHDRAICNWPLPKIKLMSKVVMVNVLGQHVAGIHKIIAEKRGWHFHDYGKAEIRHNRKMGHVTILTDNIAKTISDINATHIWDR
>NC_015602.1|WP_013854991.1|1703679_1704396_+|phosphoribosylaminoimidazolesuccinocarboxamide-synthase
MDKLLYTGKVKQMWSTNDPEVLRVVYTDQATAGNGKKKDNFKDKAELNNQISTLIFQYLEKNGVPTHFIKKISDKEELVKKCEMFPLEVVTRNIAAGHFSSRYGLDEGMRFAIPVEELFFKSDELDDPILNSSDAVALNVATKSEQEQMWSLSRQVNQLLINLFDEAGMDLVDFKLEFGKLHNGQIVLADEFSPDNCRLWDKKTKSHMDKDVYRRDIGDLTAVYKKVLARIEEVLEED

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_015602_3	3.4\|1688541\|32\|NC_015602\|CRISPRCasFinder,CRT	1688541-1688572	32	MG770379	Klebsiella virus vB_KpnM_KpS110, complete genome	145244-145275	7	0.781
NC_015602_1	1.1\|666430\|32\|NC_015602\|CRISPRCasFinder	666430-666461	32	KT264814	Gokushovirus WZ-2015a isolate 66Brd04, complete genome	861-892	8	0.75
NC_015602_1	1.1\|666430\|32\|NC_015602\|CRISPRCasFinder	666430-666461	32	MH617057	Microviridae sp. isolate ctjj715, complete genome	906-937	8	0.75
NC_015602_1	1.3\|666552\|32\|NC_015602\|CRISPRCasFinder,PILER-CR	666552-666583	32	DQ517338	Staphylococcus phage 80alpha, complete sequence	38336-38367	8	0.75
NC_015602_1	1.3\|666552\|32\|NC_015602\|CRISPRCasFinder,PILER-CR	666552-666583	32	AY954952	Bacteriophage 53, complete genome	22084-22115	8	0.75
NC_015602_1	1.3\|666552\|32\|NC_015602\|CRISPRCasFinder,PILER-CR	666552-666583	32	AF513856	Staphylococcus aureus bacteriophage phi 53 phiETA ORF57-like protein, phiETA ORF58-like protein, phiETA ORF59-like protein, phiPVL ORF17-like protein, and peptidoglycan hydrolase genes, complete cds	4404-4435	8	0.75
NC_015602_1	1.3\|666552\|32\|NC_015602\|CRISPRCasFinder,PILER-CR	666552-666583	32	NC_007049	Staphylococcus phage 53, complete genome	22084-22115	8	0.75
NC_015602_1	1.3\|666552\|32\|NC_015602\|CRISPRCasFinder,PILER-CR	666552-666583	32	DQ530360	Staphylococcus aureus phage phiNM2, complete genome	38558-38589	8	0.75
NC_015602_1	1.3\|666552\|32\|NC_015602\|CRISPRCasFinder,PILER-CR	666552-666583	32	MH321492	Staphylococcusphage Lorac, complete genome	21980-22011	8	0.75
NC_015602_1	1.3\|666552\|32\|NC_015602\|CRISPRCasFinder,PILER-CR	666552-666583	32	NC_008583	Staphylococcus aureus phage phiNM1, complete genome	38564-38595	8	0.75
NC_015602_1	1.3\|666552\|32\|NC_015602\|CRISPRCasFinder,PILER-CR	666552-666583	32	NC_009526	Staphylococcus phage 80alpha, complete genome	38336-38367	8	0.75
NC_015602_3	3.6\|1688663\|32\|NC_015602\|CRISPRCasFinder,CRT	1688663-1688694	32	KU686197	Synechococcus phage S-CAM3 isolate 0808SB25, complete genome	75310-75341	8	0.75
NC_015602_3	3.6\|1688663\|32\|NC_015602\|CRISPRCasFinder,CRT	1688663-1688694	32	KU686199	Synechococcus phage S-CAM3 isolate 1010CC42, complete genome	75296-75327	8	0.75
NC_015602_3	3.6\|1688663\|32\|NC_015602\|CRISPRCasFinder,CRT	1688663-1688694	32	KU686198	Synechococcus phage S-CAM3 isolate 0910TB04, complete genome	75302-75333	8	0.75
NC_015602_1	1.2\|666491\|32\|NC_015602\|CRISPRCasFinder,PILER-CR	666491-666522	32	NZ_AP019725	Bacteroides uniformis strain NBRC 113350 plasmid pBUN1, complete sequence	11323-11354	9	0.719
NC_015602_3	3.3\|1688662\|33\|NC_015602\|PILER-CR	1688662-1688694	33	KU686197	Synechococcus phage S-CAM3 isolate 0808SB25, complete genome	75309-75341	9	0.727
NC_015602_3	3.3\|1688662\|33\|NC_015602\|PILER-CR	1688662-1688694	33	KU686199	Synechococcus phage S-CAM3 isolate 1010CC42, complete genome	75295-75327	9	0.727
NC_015602_3	3.3\|1688662\|33\|NC_015602\|PILER-CR	1688662-1688694	33	KU686198	Synechococcus phage S-CAM3 isolate 0910TB04, complete genome	75301-75333	9	0.727
NC_015602_3	3.4\|1688541\|32\|NC_015602\|CRISPRCasFinder,CRT	1688541-1688572	32	NC_020157	Anabaena cylindrica PCC 7122 plasmid pANACY.02, complete sequence	159625-159656	9	0.719
NC_015602_1	1.4\|666613\|32\|NC_015602\|CRISPRCasFinder	666613-666644	32	NZ_AF135182	Serratia entomophila strain A1MO2 plasmid pADAP, complete sequence	104993-105024	10	0.688
NC_015602_1	1.4\|666613\|32\|NC_015602\|CRISPRCasFinder	666613-666644	32	NC_002523	Serratia entomophila plasmid pADAP, complete sequence	104555-104586	10	0.688

1. spacer 3.4|1688541|32|NC_015602|CRISPRCasFinder,CRT matches to MG770379 (Klebsiella virus vB_KpnM_KpS110, complete genome) position: , mismatch: 7, identity: 0.781

cgacatacttgtaattggtagtgtcaatatca	CRISPR spacer
cgccacctgtgaaattggtggtgtcaatatca	Protospacer
** **. . ** *******.************

2. spacer 1.1|666430|32|NC_015602|CRISPRCasFinder matches to KT264814 (Gokushovirus WZ-2015a isolate 66Brd04, complete genome) position: , mismatch: 8, identity: 0.75

gaataaaatcagtatagcgcgtaacttcattg	CRISPR spacer
gaataatttcagtatagcgcgtaccaccacga	Protospacer
******  *************** * .**. .

3. spacer 1.1|666430|32|NC_015602|CRISPRCasFinder matches to MH617057 (Microviridae sp. isolate ctjj715, complete genome) position: , mismatch: 8, identity: 0.75

gaataaaatcagtatagcgcgtaacttcattg	CRISPR spacer
gaattaattcagtatagcgcgtaccaccacgc	Protospacer
**** ** *************** * .**.

4. spacer 1.3|666552|32|NC_015602|CRISPRCasFinder,PILER-CR matches to DQ517338 (Staphylococcus phage 80alpha, complete sequence) position: , mismatch: 8, identity: 0.75

ctaactaatgctgtgctttttctaagctattc	CRISPR spacer
ttcattaatgctgtgctttttacaagcttctg	Protospacer
.* *.**************** .***** .*

5. spacer 1.3|666552|32|NC_015602|CRISPRCasFinder,PILER-CR matches to AY954952 (Bacteriophage 53, complete genome) position: , mismatch: 8, identity: 0.75

ctaactaatgctgtgctttttctaagctattc	CRISPR spacer
ttcattaatgctgtgctttttacaagcttctg	Protospacer
.* *.**************** .***** .*

6. spacer 1.3|666552|32|NC_015602|CRISPRCasFinder,PILER-CR matches to AF513856 (Staphylococcus aureus bacteriophage phi 53 phiETA ORF57-like protein, phiETA ORF58-like protein, phiETA ORF59-like protein, phiPVL ORF17-like protein, and peptidoglycan hydrolase genes, complete cds) position: , mismatch: 8, identity: 0.75

ctaactaatgctgtgctttttctaagctattc	CRISPR spacer
ttcattaatgctgtgctttttacaagcttctg	Protospacer
.* *.**************** .***** .*

7. spacer 1.3|666552|32|NC_015602|CRISPRCasFinder,PILER-CR matches to NC_007049 (Staphylococcus phage 53, complete genome) position: , mismatch: 8, identity: 0.75

ctaactaatgctgtgctttttctaagctattc	CRISPR spacer
ttcattaatgctgtgctttttacaagcttctg	Protospacer
.* *.**************** .***** .*

8. spacer 1.3|666552|32|NC_015602|CRISPRCasFinder,PILER-CR matches to DQ530360 (Staphylococcus aureus phage phiNM2, complete genome) position: , mismatch: 8, identity: 0.75

ctaactaatgctgtgctttttctaagctattc	CRISPR spacer
ttcattaatgctgtgctttttacaagcttctg	Protospacer
.* *.**************** .***** .*

9. spacer 1.3|666552|32|NC_015602|CRISPRCasFinder,PILER-CR matches to MH321492 (Staphylococcusphage Lorac, complete genome) position: , mismatch: 8, identity: 0.75

ctaactaatgctgtgctttttctaagctattc	CRISPR spacer
ttcattaatgctgtgctttttacaagcttctg	Protospacer
.* *.**************** .***** .*

10. spacer 1.3|666552|32|NC_015602|CRISPRCasFinder,PILER-CR matches to NC_008583 (Staphylococcus aureus phage phiNM1, complete genome) position: , mismatch: 8, identity: 0.75

ctaactaatgctgtgctttttctaagctattc	CRISPR spacer
ttcattaatgctgtgctttttacaagcttctg	Protospacer
.* *.**************** .***** .*

11. spacer 1.3|666552|32|NC_015602|CRISPRCasFinder,PILER-CR matches to NC_009526 (Staphylococcus phage 80alpha, complete genome) position: , mismatch: 8, identity: 0.75

ctaactaatgctgtgctttttctaagctattc	CRISPR spacer
ttcattaatgctgtgctttttacaagcttctg	Protospacer
.* *.**************** .***** .*

12. spacer 3.6|1688663|32|NC_015602|CRISPRCasFinder,CRT matches to KU686197 (Synechococcus phage S-CAM3 isolate 0808SB25, complete genome) position: , mismatch: 8, identity: 0.75

agctatttaatttttcctaccactgcccaccc	CRISPR spacer
aactatttaattttacctacaactgcggtatc	Protospacer
*.************ ***** *****    .*

13. spacer 3.6|1688663|32|NC_015602|CRISPRCasFinder,CRT matches to KU686199 (Synechococcus phage S-CAM3 isolate 1010CC42, complete genome) position: , mismatch: 8, identity: 0.75

agctatttaatttttcctaccactgcccaccc	CRISPR spacer
aactatttaattttacctacaactgcggtatc	Protospacer
*.************ ***** *****    .*

14. spacer 3.6|1688663|32|NC_015602|CRISPRCasFinder,CRT matches to KU686198 (Synechococcus phage S-CAM3 isolate 0910TB04, complete genome) position: , mismatch: 8, identity: 0.75

agctatttaatttttcctaccactgcccaccc	CRISPR spacer
aactatttaattttacctacaactgcggtatc	Protospacer
*.************ ***** *****    .*

15. spacer 1.2|666491|32|NC_015602|CRISPRCasFinder,PILER-CR matches to NZ_AP019725 (Bacteroides uniformis strain NBRC 113350 plasmid pBUN1, complete sequence) position: , mismatch: 9, identity: 0.719

ctaaatgactgtactgtgtctgatcaacttca	CRISPR spacer
ataaatgtctgtactctgtctgataaccggtc	Protospacer
 ****** ******* ******** * *  .

16. spacer 3.3|1688662|33|NC_015602|PILER-CR matches to KU686197 (Synechococcus phage S-CAM3 isolate 0808SB25, complete genome) position: , mismatch: 9, identity: 0.727

tagctatttaatttttcctaccactgcccaccc	CRISPR spacer
aaactatttaattttacctacaactgcggtatc	Protospacer
 *.************ ***** *****    .*

17. spacer 3.3|1688662|33|NC_015602|PILER-CR matches to KU686199 (Synechococcus phage S-CAM3 isolate 1010CC42, complete genome) position: , mismatch: 9, identity: 0.727

tagctatttaatttttcctaccactgcccaccc	CRISPR spacer
aaactatttaattttacctacaactgcggtatc	Protospacer
 *.************ ***** *****    .*

18. spacer 3.3|1688662|33|NC_015602|PILER-CR matches to KU686198 (Synechococcus phage S-CAM3 isolate 0910TB04, complete genome) position: , mismatch: 9, identity: 0.727

tagctatttaatttttcctaccactgcccaccc	CRISPR spacer
aaactatttaattttacctacaactgcggtatc	Protospacer
 *.************ ***** *****    .*

19. spacer 3.4|1688541|32|NC_015602|CRISPRCasFinder,CRT matches to NC_020157 (Anabaena cylindrica PCC 7122 plasmid pANACY.02, complete sequence) position: , mismatch: 9, identity: 0.719

cgacatacttgtaattggtagtgtcaatatca	CRISPR spacer
tgatgtaattgtaattgctagtgtcaatcggt	Protospacer
.**..** ********* **********

20. spacer 1.4|666613|32|NC_015602|CRISPRCasFinder matches to NZ_AF135182 (Serratia entomophila strain A1MO2 plasmid pADAP, complete sequence) position: , mismatch: 10, identity: 0.688

tttcaagaactgagccgtattcccatgaggtc	CRISPR spacer
cagaaagaactgaaccgtattcccgtgctgca	Protospacer
.   *********.**********.**  *.

21. spacer 1.4|666613|32|NC_015602|CRISPRCasFinder matches to NC_002523 (Serratia entomophila plasmid pADAP, complete sequence) position: , mismatch: 10, identity: 0.688

tttcaagaactgagccgtattcccatgaggtc	CRISPR spacer
cagaaagaactgaaccgtattcccgtgctgca	Protospacer
.   *********.**********.**  *.

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

275280 : 353116

Bacillus_phage(15.38%)

tRNA,protease,transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013853763.1\|275280_276330_+\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2K9L3A8	Tupanvirus	1.2e-33	37.1
WP_013853764.1\|276333_278748_+\|tRNA	phenylalanine--tRNA ligase subunit beta	NA	NA	NA	NA
WP_013853765.1\|278822_279299_+	transcription elongation factor GreA	NA	NA	NA	NA
WP_013853766.1\|279353_280265_+	L-lactate dehydrogenase	NA	NA	NA	NA
WP_143000326.1\|280416_280635_+	type II toxin-antitoxin system HicA family toxin	K7PH44	Enterobacterial_phage	2.7e-09	44.4
WP_013853768.1\|280667_280892_+	hypothetical protein	NA	NA	NA	NA
WP_013853769.1\|281126_282050_-	N-acetylglucosamine kinase	NA	NA	NA	NA
WP_013853770.1\|282148_284743_-	YfhO family protein	NA	NA	NA	NA
WP_013853771.1\|284831_286940_+	penicillin-binding protein 2	NA	NA	NA	NA
WP_006351577.1\|287015_287165_+	50S ribosomal protein L33	NA	NA	NA	NA
WP_013853772.1\|287218_287785_+	5-formyltetrahydrofolate cyclo-ligase	NA	NA	NA	NA
WP_013853773.1\|287818_288499_+\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_013853774.1\|288498_288735_+	YqgQ family protein	NA	NA	NA	NA
WP_013853775.1\|288793_289195_+	rhodanese-like domain-containing protein	NA	NA	NA	NA
WP_025084208.1\|289264_290185_+\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
WP_013853777.1\|290177_291428_+	aminotransferase class V-fold PLP-dependent enzyme	NA	NA	NA	NA
WP_013853778.1\|291574_292912_+	type I glutamate--ammonia ligase	NA	NA	NA	NA
WP_013853779.1\|293029_293917_+	hypothetical protein	NA	NA	NA	NA
WP_013853780.1\|294037_295051_+	hypothetical protein	NA	NA	NA	NA
WP_081462963.1\|295091_296378_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	7.3e-54	43.4
WP_013853782.1\|296573_297779_-	acetate kinase	NA	NA	NA	NA
WP_013853783.1\|299283_299553_+	type II toxin-antitoxin system RelB/DinJ family antitoxin	NA	NA	NA	NA
WP_013853784.1\|299552_299795_+	type II toxin-antitoxin system YafQ family toxin	NA	NA	NA	NA
WP_013853785.1\|299934_301206_+\|transposase	transposase	Q5ULQ4	Lactobacillus_virus	2.7e-64	38.3
WP_013853786.1\|302117_303110_-	UDP-glucose 4-epimerase GalE	A0A1V0SG19	Hokovirus	2.5e-49	37.1
WP_013853787.1\|303207_304170_-	hypothetical protein	NA	NA	NA	NA
WP_013853788.1\|304153_306040_-	beta galactosidase jelly roll domain-containing protein	L0N6M2	Herpes_simplex_virus	8.1e-94	33.5
WP_013853789.1\|306231_307260_+	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_013853790.1\|307449_309363_+	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_013853791.1\|309369_311376_+	beta-galactosidase	NA	NA	NA	NA
WP_013853792.1\|311473_312637_+	galactokinase	NA	NA	NA	NA
WP_013853793.1\|312647_314111_+	UDP-glucose--hexose-1-phosphate uridylyltransferase	NA	NA	NA	NA
WP_013853794.1\|314114_315101_+	galactose mutarotase	NA	NA	NA	NA
WP_013853795.1\|315336_315945_+	hypothetical protein	NA	NA	NA	NA
WP_013853796.1\|316077_316917_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_013853797.1\|319063_321265_+	alpha-galactosidase	NA	NA	NA	NA
WP_013853798.1\|322873_323485_+	GTP pyrophosphokinase	NA	NA	NA	NA
WP_013853799.1\|323493_324159_+	response regulator transcription factor	W8CYM9	Bacillus_phage	7.7e-23	29.2
WP_013853800.1\|324167_325445_+	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_013853801.1\|325494_326667_+	MFS transporter	NA	NA	NA	NA
WP_013853803.1\|327105_327813_+	aldo/keto reductase	NA	NA	NA	NA
WP_013853804.1\|327898_328639_+	hypothetical protein	NA	NA	NA	NA
WP_013853805.1\|328883_329249_+	pyridoxamine 5'-phosphate oxidase family protein	NA	NA	NA	NA
WP_013853808.1\|331038_332598_+	N-6 DNA methylase	J7I0U9	Acinetobacter_phage	5.2e-38	31.5
WP_013853810.1\|332972_334553_-	SH3-like domain-containing protein	NA	NA	NA	NA
WP_003626431.1\|334701_335139_+	hypothetical protein	NA	NA	NA	NA
WP_176752298.1\|335746_336976_-\|transposase	transposase	Q5ULQ4	Lactobacillus_virus	4.9e-116	55.1
WP_041817200.1\|337124_338189_-	BMP family protein	A0A0A7DN02	Lactobacillus_phage	6.0e-78	49.2
WP_013853815.1\|340948_341326_+	hypothetical protein	NA	NA	NA	NA
WP_025084343.1\|341927_342194_-	hypothetical protein	NA	NA	NA	NA
WP_013853818.1\|342195_342675_-	hypothetical protein	NA	NA	NA	NA
WP_143445839.1\|342965_343070_+	type I toxin-antitoxin system Fst family toxin	NA	NA	NA	NA
WP_013853819.1\|343464_344979_+	ABC-F family ATP-binding cassette domain-containing protein	A0A2I4R674	Erysipelothrix_phage	3.5e-23	24.2
WP_013853821.1\|345950_348239_+	ThiF family adenylyltransferase	NA	NA	NA	NA
WP_013853822.1\|348254_349832_+	ABC transporter ATP-binding protein	A0A1V0SE00	Indivirus	2.0e-24	33.3
WP_013853823.1\|350085_351135_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	2.0e-49	36.6
WP_013853824.1\|351937_353116_+\|transposase	IS256 family transposase	NA	NA	NA	NA

DBSCAN-SWA_2

717177 : 761607

Staphylococcus_phage(16.67%)

integrase,tRNA,protease,transposase

attL 731252:731268|attR 752942:752958

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_081462963.1\|717177_718464_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	7.3e-54	43.4
WP_013854150.1\|718525_718756_-	hypothetical protein	NA	NA	NA	NA
WP_013854153.1\|720941_722348_+\|transposase	ISLre2 family transposase	NA	NA	NA	NA
WP_013854154.1\|722599_722953_+	hypothetical protein	NA	NA	NA	NA
WP_013854155.1\|723011_724220_-	L,D-transpeptidase family protein	NA	NA	NA	NA
WP_013854156.1\|724302_724860_-	ECF transporter S component	NA	NA	NA	NA
WP_013854157.1\|724861_725695_-	bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase	NA	NA	NA	NA
WP_013854158.1\|726982_727597_-	sugar O-acetyltransferase	NA	NA	NA	NA
WP_013854159.1\|727695_728328_+	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_013854160.1\|728559_729552_-	homocysteine S-methyltransferase	NA	NA	NA	NA
WP_013854161.1\|729674_730127_-	Trp operon repressor	NA	NA	NA	NA
731252:731268	attL	NA	NA	NA	NA
WP_013854162.1\|731628_733404_-	DNA helicase RecQ	A0A1V0SBK0	Catovirus	2.4e-79	41.0
WP_013854163.1\|734828_735512_+	TrkA family potassium uptake protein	NA	NA	NA	NA
WP_013854164.1\|735571_736831_-	methionine gamma-lyase family protein	NA	NA	NA	NA
WP_013854165.1\|736844_738938_-	putative ornithine decarboxylase	NA	NA	NA	NA
WP_013854166.1\|739167_740625_+	APC family permease	NA	NA	NA	NA
WP_013854167.1\|740682_741168_-	pyridoxamine 5'-phosphate oxidase family protein	NA	NA	NA	NA
WP_013854168.1\|741251_741626_-	fluoride efflux transporter CrcB	A0A2H4PQR0	Staphylococcus_phage	1.2e-09	34.5
WP_013854169.1\|741627_742017_-	CrcB family protein	NA	NA	NA	NA
WP_013854170.1\|742232_743054_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_013854171.1\|743109_744012_-	aldose 1-epimerase family protein	NA	NA	NA	NA
WP_013854172.1\|744159_745575_-\|protease	ATP-dependent protease ATPase subunit HslU	A0A1B2IB03	Erwinia_phage	5.8e-28	25.2
WP_013854173.1\|745584_746109_-	HslU--HslV peptidase proteolytic subunit	NA	NA	NA	NA
WP_013854174.1\|746117_747026_-\|integrase	tyrosine-type recombinase/integrase	A0A1P8DJJ6	Virus_Rctr41k	1.3e-17	27.9
WP_013854175.1\|747018_748341_-\|tRNA	methylenetetrahydrofolate--tRNA-(uracil(54)- C(5))-methyltransferase (FADH(2)-oxidizing) TrmFO	NA	NA	NA	NA
WP_013854176.1\|748421_750554_-	type I DNA topoisomerase	A0A1V0SCS0	Indivirus	9.8e-96	35.5
WP_013854177.1\|750627_751476_-	DNA-protecting protein DprA	S6BFL3	Thermus_phage	5.7e-31	37.6
WP_013854178.1\|751533_752286_-	ribonuclease HII	G4YAY0	Emiliania_huxleyi_virus	1.7e-26	39.2
WP_013854179.1\|752282_753122_-	ribosome biogenesis GTPase YlqF	NA	NA	NA	NA
752942:752958	attR	NA	NA	NA	NA
WP_013854180.1\|753142_754741_-	cation:proton antiporter	NA	NA	NA	NA
WP_013854181.1\|754785_755016_-	YozE family protein	NA	NA	NA	NA
WP_025084227.1\|755018_755870_-	DegV family protein	A0A0N9SI50	Staphylococcus_phage	4.7e-17	39.5
WP_013854183.1\|755978_756644_+	hemolysin III family protein	NA	NA	NA	NA
WP_013854184.1\|756677_757877_-\|tRNA	CCA tRNA nucleotidyltransferase	H7BUW3	unidentified_phage	7.3e-48	34.1
WP_013854185.1\|757968_758856_+	YitT family protein	M1Q1P6	Streptococcus_phage	1.4e-51	38.0
WP_013854186.1\|758884_760132_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_013854187.1\|760329_761607_+\|transposase	ISL3 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.9e-10	21.5

DBSCAN-SWA_3

1177104 : 1216881

Lactobacillus_virus(14.29%)

integrase,transposase

attL 1197824:1197883|attR 1216899:1217839

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_081462950.1\|1177104_1178358_-\|transposase	transposase	Q5ULQ4	Lactobacillus_virus	7.7e-117	56.4
WP_013854552.1\|1179903_1180755_-	Rgg/GadR/MutR family transcriptional regulator	NA	NA	NA	NA
WP_013854553.1\|1180863_1181553_-	SLAP domain-containing protein	NA	NA	NA	NA
WP_013854554.1\|1181717_1182266_-	hypothetical protein	NA	NA	NA	NA
WP_013854555.1\|1182392_1182863_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_013854556.1\|1183123_1184401_+\|transposase	ISL3 family transposase	Q6V7R1	Burkholderia_virus	2.2e-10	23.2
WP_013854557.1\|1184922_1185312_-	type II toxin-antitoxin system PemK/MazF family toxin	NA	NA	NA	NA
WP_013854558.1\|1185301_1185559_-	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
WP_013854559.1\|1185921_1186818_-	MFS transporter	NA	NA	NA	NA
WP_023061312.1\|1186772_1187114_-	MFS transporter	NA	NA	NA	NA
WP_025084327.1\|1187116_1187551_-	hypothetical protein	NA	NA	NA	NA
WP_013854560.1\|1187554_1188664_-	beta-ketoacyl synthase	NA	NA	NA	NA
WP_013854561.1\|1188678_1188840_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_013854562.1\|1190761_1191886_-	hypothetical protein	NA	NA	NA	NA
WP_013854563.1\|1191946_1197448_-	DEAD/DEAH box helicase family protein	A0A248SL14	Klebsiella_phage	4.5e-201	30.7
1197824:1197883	attL	NA	NA	NA	NA
WP_013854565.1\|1197900_1198752_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_013854566.1\|1198861_1200106_-	hypothetical protein	NA	NA	NA	NA
WP_013854567.1\|1200425_1201130_-	hypothetical protein	NA	NA	NA	NA
WP_025084306.1\|1201223_1201838_-	hypothetical protein	A0A0E3XCL7	Enterococcus_phage	7.3e-20	66.7
WP_025084305.1\|1201869_1202145_-	hypothetical protein	NA	NA	NA	NA
WP_013854569.1\|1202162_1202807_-	hypothetical protein	NA	NA	NA	NA
WP_013854571.1\|1203915_1204542_-\|integrase	tyrosine-type recombinase/integrase	A0A1B1P7Y2	Bacillus_phage	4.7e-14	31.9
WP_005726889.1\|1204897_1205275_-	type II toxin-antitoxin system PemK/MazF family toxin	NA	NA	NA	NA
WP_013854572.1\|1205307_1205520_-	hypothetical protein	NA	NA	NA	NA
WP_013854573.1\|1205789_1206284_+	hypothetical protein	NA	NA	NA	NA
WP_013851233.1\|1206569_1208117_-	hypothetical protein	A0A0H3UZB6	Geobacillus_virus	5.2e-06	23.6
WP_013851234.1\|1208275_1208788_-	hypothetical protein	NA	NA	NA	NA
WP_013851235.1\|1209079_1209457_-	hypothetical protein	NA	NA	NA	NA
WP_013851236.1\|1209487_1210141_-	hypothetical protein	NA	NA	NA	NA
WP_013851237.1\|1210151_1210742_-	hypothetical protein	NA	NA	NA	NA
WP_049775987.1\|1211078_1211387_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_013854575.1\|1211386_1211755_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_013854576.1\|1211866_1213030_-	DNA polymerase III subunit beta	NA	NA	NA	NA
WP_005730021.1\|1213343_1213694_-	hypothetical protein	NA	NA	NA	NA
WP_013854577.1\|1213895_1214945_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	5.4e-47	34.6
WP_013854578.1\|1215044_1215722_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_013854565.1\|1216029_1216881_-\|transposase	IS982 family transposase	NA	NA	NA	NA
1216899:1217839	attR	NA	NA	NA	NA

DBSCAN-SWA_4

1245762 : 1255061

Enterobacteria_phage(16.67%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013854593.1\|1245762_1247667_-	site-specific DNA-methyltransferase	Q1MVP0	Enterobacteria_phage	5.5e-82	33.0
WP_013854594.1\|1247677_1247923_-	helix-turn-helix transcriptional regulator	A0A2K5B263	Erysipelothrix_phage	2.2e-15	58.0
WP_034536270.1\|1247903_1248302_-	DUF2326 domain-containing protein	NA	NA	NA	NA
WP_074484248.1\|1249100_1249397_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003674720.1\|1249948_1250395_-	hypothetical protein	NA	NA	NA	NA
WP_013854598.1\|1250603_1250804_+	cold-shock protein	Q9AZD3	Lactococcus_phage	4.8e-21	73.0
WP_013854599.1\|1250898_1252230_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	9.3e-52	31.9
WP_013854600.1\|1252325_1253249_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	2.6e-29	31.7
WP_013854601.1\|1253690_1255061_-	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	F5CA72	Streptococcus_phi-m46.1-like_phage	7.9e-115	47.8

DBSCAN-SWA_5

1401048 : 1458189

Planktothrix_phage(22.22%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013854718.1\|1401048_1401729_+\|protease	matrixin family metalloprotease	NA	NA	NA	NA
WP_013854719.1\|1401792_1402443_+	histidine phosphatase family protein	NA	NA	NA	NA
WP_013854720.1\|1402482_1404285_-	FtsX-like permease family protein	NA	NA	NA	NA
WP_013854721.1\|1404295_1405045_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.2e-34	39.9
WP_013854722.1\|1405194_1406460_-	hypothetical protein	NA	NA	NA	NA
WP_013854723.1\|1406548_1407229_+	hypothetical protein	NA	NA	NA	NA
WP_013854725.1\|1410326_1410719_-	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_013854726.1\|1410855_1410993_-	hypothetical protein	NA	NA	NA	NA
WP_013854727.1\|1411093_1412089_-	asparaginase	NA	NA	NA	NA
WP_013854729.1\|1416016_1416508_+	hypothetical protein	NA	NA	NA	NA
WP_013854730.1\|1416547_1417111_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_013854731.1\|1417486_1419013_-	hypothetical protein	NA	NA	NA	NA
WP_074484251.1\|1419976_1420468_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_013851264.1\|1420640_1421249_+\|transposase	IS607 family transposase	A0A1V0SJI5	Klosneuvirus	1.2e-33	42.6
WP_013851263.1\|1421278_1422604_+	IS200/IS605 family accessory protein TnpB-related protein	G3MB42	Bacillus_virus	8.1e-56	36.0
WP_013854735.1\|1424019_1425360_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_013854736.1\|1425466_1426684_-	extracellular solute-binding protein	NA	NA	NA	NA
WP_013854737.1\|1426932_1428111_+\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_074484277.1\|1428198_1428480_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_013854739.1\|1428605_1429466_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_013854740.1\|1429477_1430218_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.9e-31	34.4
WP_013854741.1\|1430227_1430902_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_003615004.1\|1430882_1431542_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_013854742.1\|1431916_1432324_+	MerR family transcriptional regulator	NA	NA	NA	NA
WP_013854743.1\|1432334_1432703_+	DUF2255 family protein	NA	NA	NA	NA
WP_013854744.1\|1432713_1433322_+	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
WP_013854745.1\|1433296_1433902_+	sugar O-acetyltransferase	NA	NA	NA	NA
WP_013853732.1\|1436406_1437057_-\|transposase	IS607-like element ISLhe9 family transposase	A0A7Q0	Microcystis_virus	6.8e-40	45.2
WP_013854747.1\|1437209_1437440_+	amidohydrolase family protein	NA	NA	NA	NA
WP_013854748.1\|1437514_1438693_-\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_013854750.1\|1439241_1440333_-	glycosyltransferase	NA	NA	NA	NA
WP_013854751.1\|1440340_1441156_-	LicD family protein	NA	NA	NA	NA
WP_013854752.1\|1441179_1442643_-	flippase	NA	NA	NA	NA
WP_013854753.1\|1442639_1443641_-	glycosyltransferase	A0A1V0SAH6	Catovirus	1.3e-10	35.1
WP_013854754.1\|1443630_1444596_-	hypothetical protein	NA	NA	NA	NA
WP_013854755.1\|1444592_1445756_-	hypothetical protein	NA	NA	NA	NA
WP_148234238.1\|1445752_1446289_-	acyltransferase	NA	NA	NA	NA
WP_013854757.1\|1446493_1446805_-	acyltransferase	NA	NA	NA	NA
WP_013854758.1\|1447020_1448046_-	glycosyltransferase	NA	NA	NA	NA
WP_013854759.1\|1448063_1448561_-	multidrug MFS transporter	NA	NA	NA	NA
WP_013854760.1\|1448560_1449010_-	UDP-N-acetylglucosamine--LPS N-acetylglucosamine transferase	NA	NA	NA	NA
WP_013854761.1\|1449024_1449675_-	sugar transferase	NA	NA	NA	NA
WP_013854762.1\|1449794_1450565_-	exopolysaccharide biosynthesis protein	NA	NA	NA	NA
WP_013854763.1\|1450565_1451351_-	CpsD/CapB family tyrosine-protein kinase	NA	NA	NA	NA
WP_013854764.1\|1451361_1452249_-	exopolysaccharide biosynthesis protein	NA	NA	NA	NA
WP_013854765.1\|1452260_1453316_-	LCP family protein	A0A1X9I5X1	Streptococcus_phage	2.5e-15	30.2
WP_013854766.1\|1453658_1454924_+	GTPase HflX	NA	NA	NA	NA
WP_025084270.1\|1454947_1455955_+	CAP domain-containing protein	NA	NA	NA	NA
WP_013851263.1\|1456225_1457551_-	IS200/IS605 family accessory protein TnpB-related protein	G3MB42	Bacillus_virus	8.1e-56	36.0
WP_013851264.1\|1457580_1458189_-\|transposase	IS607 family transposase	A0A1V0SJI5	Klosneuvirus	1.2e-33	42.6

DBSCAN-SWA_6

1701865 : 1712162

Tetraselmis_virus(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003627031.1\|1701865_1702354_+	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	4.8e-22	45.1
WP_013854990.1\|1702346_1703483_+	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_013854991.1\|1703679_1704396_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A1D7SPE1	Cyanophage	2.8e-39	38.7
WP_003627027.1\|1704395_1704647_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_013854992.1\|1704646_1705318_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_013854993.1\|1705314_1707546_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	1.6e-141	38.7
WP_013854994.1\|1707521_1708955_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.8e-61	34.9
WP_013854995.1\|1708980_1710030_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F0L1	Synechococcus_phage	1.6e-62	43.6
WP_013854996.1\|1710026_1712162_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	2.1e-74	46.0

DBSCAN-SWA_7

1841977 : 1874676

Lactobacillus_virus(22.22%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013855101.1\|1841977_1843240_+\|transposase	transposase	Q5ULQ4	Lactobacillus_virus	2.2e-63	38.0
WP_013855102.1\|1843419_1843614_+	hypothetical protein	NA	NA	NA	NA
WP_013855103.1\|1843610_1843982_+	SLAP domain-containing protein	NA	NA	NA	NA
WP_013855104.1\|1844202_1844814_+	type IV toxin-antitoxin system AbiEi family antitoxin domain-containing protein	NA	NA	NA	NA
WP_013855105.1\|1844810_1845698_+	nucleotidyl transferase AbiEii/AbiGii toxin family protein	NA	NA	NA	NA
WP_013855106.1\|1845707_1846592_-	proline iminopeptidase-family hydrolase	NA	NA	NA	NA
WP_013855107.1\|1846597_1847251_-	energy-coupling factor transporter transmembrane protein EcfT	NA	NA	NA	NA
WP_013855108.1\|1847254_1848604_-	ABC transporter ATP-binding protein	A0A1V0SI78	Klosneuvirus	4.7e-11	21.7
WP_013855109.1\|1848763_1849705_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_013855110.1\|1849733_1850630_-\|protease	zinc metalloprotease HtpX	NA	NA	NA	NA
WP_013855111.1\|1850641_1851202_-	LemA family protein	A0A1X9IGG1	Lactococcus_phage	1.1e-11	30.2
WP_013855112.1\|1851304_1852411_-	cation transporter	NA	NA	NA	NA
WP_013855113.1\|1852597_1852999_+	iron-sulfur cluster biosynthesis family protein	NA	NA	NA	NA
WP_013855114.1\|1853077_1854868_+	glycerophosphoryl diester phosphodiesterase membrane domain-containing protein	NA	NA	NA	NA
WP_003548644.1\|1854938_1855079_+	hypothetical protein	NA	NA	NA	NA
WP_013855115.1\|1855233_1855878_+	HD domain-containing protein	NA	NA	NA	NA
WP_143000324.1\|1855878_1856799_+	HNH endonuclease	NA	NA	NA	NA
WP_013855117.1\|1856958_1857714_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.0e-26	36.7
WP_013855118.1\|1857713_1859327_-	ABC transporter substrate-binding protein/permease	NA	NA	NA	NA
WP_013855119.1\|1859659_1860292_-	DNA-3-methyladenine glycosylase	NA	NA	NA	NA
WP_013855120.1\|1860360_1860720_+	DUF488 family protein	NA	NA	NA	NA
WP_013855121.1\|1860772_1861558_-	TerC family protein	A0A068EP98	Bacillus_phage	2.2e-40	44.5
WP_013855122.1\|1861544_1862063_-	methylated-DNA--[protein]-cysteine S-methyltransferase	A0A1S5V092	Saudi_moumouvirus	1.1e-13	37.6
WP_013855123.1\|1862106_1862808_-	NAD-dependent protein deacylase	NA	NA	NA	NA
WP_013855124.1\|1862893_1863373_+	hypothetical protein	NA	NA	NA	NA
WP_013855125.1\|1863367_1864825_-	cardiolipin synthase	NA	NA	NA	NA
WP_013855126.1\|1865869_1866649_+	viroplasmin family protein	C1KFJ1	Lactobacillus_virus	1.3e-29	34.0
WP_013855127.1\|1866692_1867649_-	DUF1002 domain-containing protein	NA	NA	NA	NA
WP_013855128.1\|1867804_1868620_+	glycosyltransferase	NA	NA	NA	NA
WP_013855129.1\|1868632_1869289_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_013855130.1\|1869767_1870625_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_013855131.1\|1870939_1871437_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_013855132.1\|1871688_1872327_+	NAD(P)H-binding protein	NA	NA	NA	NA
WP_013855133.1\|1872328_1872748_+	hypothetical protein	NA	NA	NA	NA
WP_013851363.1\|1872783_1873248_-\|transposase	IS200/IS605 family transposase	A0A0P0IQC6	Lactobacillus_phage	9.1e-31	47.7
WP_013855134.1\|1873347_1874676_+\|transposase	transposase	A0A288TXV8	Enterococcus_phage	1.2e-59	37.5

DBSCAN-SWA_8

1915444 : 1965621

unidentified_phage(25.0%)

bacteriocin,holin,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004561985.1\|1915444_1916434_+\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	9.9e-59	40.5
WP_013855174.1\|1916394_1916967_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	8.1e-05	25.6
WP_013855175.1\|1917061_1917205_-	hypothetical protein	NA	NA	NA	NA
WP_013439000.1\|1917216_1917468_-	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
WP_003596522.1\|1918053_1918239_-	DUF2273 domain-containing protein	NA	NA	NA	NA
WP_143000358.1\|1918925_1919684_-	FRG domain-containing protein	NA	NA	NA	NA
WP_013855177.1\|1919652_1919883_-	hypothetical protein	NA	NA	NA	NA
WP_143000359.1\|1920010_1920082_+\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_013855178.1\|1921708_1922536_-	hypothetical protein	NA	NA	NA	NA
WP_013855179.1\|1922908_1923283_-	glycosyltransferase	NA	NA	NA	NA
WP_013855181.1\|1926966_1928010_+	acyltransferase family protein	NA	NA	NA	NA
WP_013855182.1\|1928006_1929236_+	glycosyltransferase	NA	NA	NA	NA
WP_025084304.1\|1929239_1929530_+	hypothetical protein	NA	NA	NA	NA
WP_034536635.1\|1929513_1930446_+	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_025084303.1\|1932913_1933600_+	Type 1 glutamine amidotransferase-like domain-containing protein	NA	NA	NA	NA
WP_013855188.1\|1933797_1934385_+	recombinase family protein	M4QQC6	Vibrio_phage	5.9e-19	42.4
WP_002831196.1\|1934892_1935141_+	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
WP_013855189.1\|1935356_1936286_+\|transposase	IS30 family transposase	H7BW47	unidentified_phage	8.8e-25	33.7
WP_013855190.1\|1937091_1937352_+	hypothetical protein	NA	NA	NA	NA
WP_013855191.1\|1937926_1938154_-	helix-turn-helix domain-containing protein	Q5ULQ4	Lactobacillus_virus	4.9e-14	52.9
WP_013855194.1\|1941813_1942821_+	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A160DHK0	Gordonia_phage	9.3e-97	54.0
WP_005720082.1\|1942801_1943227_+	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	J9PTY0	Bacillus_phage	1.1e-11	38.3
WP_013855195.1\|1943219_1945388_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	A0A0D3MSW9	Lactococcus_phage	5.5e-171	47.3
WP_013855196.1\|1945452_1945722_-\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_013855199.1\|1946279_1947227_+	sugar-binding transcriptional regulator	NA	NA	NA	NA
WP_013855200.1\|1947322_1948624_+	pyrimidine-nucleoside phosphorylase	A0A0H3UZD4	Geobacillus_virus	1.5e-115	52.0
WP_003625233.1\|1949133_1949580_+	3-hydroxyacyl-ACP dehydratase FabZ	NA	NA	NA	NA
WP_013855202.1\|1949609_1950077_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_013855203.1\|1950073_1951057_+	ketoacyl-ACP synthase III	NA	NA	NA	NA
WP_013855204.1\|1951115_1951358_+	acyl carrier protein	NA	NA	NA	NA
WP_013855205.1\|1951367_1952285_+	ACP S-malonyltransferase	NA	NA	NA	NA
WP_013855206.1\|1952284_1953016_+	3-oxoacyl-ACP reductase FabG	Q06VL0	Trichoplusia_ni_ascovirus	1.6e-13	30.0
WP_013855207.1\|1953037_1954267_+	beta-ketoacyl-ACP synthase II	NA	NA	NA	NA
WP_013855208.1\|1954270_1954741_+	acetyl-CoA carboxylase biotin carboxyl carrier protein	NA	NA	NA	NA
WP_013855209.1\|1954745_1955162_+	beta-hydroxyacyl-ACP dehydratase	NA	NA	NA	NA
WP_013855210.1\|1955175_1956555_+	acetyl-CoA carboxylase biotin carboxylase subunit	NA	NA	NA	NA
WP_013855211.1\|1956535_1957378_+	acetyl-CoA carboxylase carboxyltransferase subunit beta	NA	NA	NA	NA
WP_013855212.1\|1957370_1958141_+	acetyl-CoA carboxylase carboxyl transferase subunit alpha	NA	NA	NA	NA
WP_013855213.1\|1958392_1959151_+	enoyl-ACP reductase FabI	NA	NA	NA	NA
WP_003630368.1\|1959198_1960188_+	biotin--[acetyl-CoA-carboxylase] ligase	NA	NA	NA	NA
WP_148234236.1\|1960969_1961542_-	hypothetical protein	NA	NA	NA	NA
WP_013855218.1\|1962451_1963291_-	carboxylating nicotinate-nucleotide diphosphorylase	NA	NA	NA	NA
WP_013855219.1\|1963287_1964475_-	MFS transporter	A0A2H4UVM2	Bodo_saltans_virus	4.4e-05	22.1
WP_013855189.1\|1964691_1965621_+\|transposase	IS30 family transposase	H7BW47	unidentified_phage	8.8e-25	33.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NC_015598

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_015598_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_015598_1

211-436

Orphan

Consensus_repeat	Method
TCTACACAGAATTTAGGGTCAAACTACACAAAATTTAGG	CRISPRCasFinder

2 spacers

The CRISPR arrays of NC_015598_1

>merge|NC_015598|1|211-436|CRISPRCasFinder
TCTACACAGAATTTAGGGTCAAACTACACAAAATTTAGGCAGCTCTACACAAAATTTAGGGTAGCTCTCCCATGAAACTCGATTTGCTCTACACAGAATTTAGGGTCAAACTACACAAAATTTAGGGTTTTAACGAGTGAATTCAAGCGTTTTCACCAGAGTTATCCACAGGCTAGTGGGAGCTTTTTTTGTTTTTCATTTTACCTCAAACTACACAAAATTTAGG

>NC_015598|1|1|211-436|CRISPRCasFinder
TCTACACAGAATTTAGGGTCAAACTACACAAAATTTAGG	CAGCTCTACACAAAATTTAGGGTAGCTCTCCCATGAAACTCGATTTGC
TCTACACAGAATTTAGGGTCAAACTACACAAAATTTAGG	GTTTTAACGAGTGAATTCAAGCGTTTTCACCAGAGTTATCCACAGGCTAGTGGGAGCTTTT
TTTGTTTTTCATTTTACCTCAAACTACACAAAATTTAGG

Protein	Signature genes	Signature genes Name	Protein_function
NC_015598.1\|WP_013851174.1\|5455_6103_+\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224715
NC_015598.1\|WP_013851172.1\|2425_3268_-\|fructosamine-kinase-family-protein	unknown	unknown	gnl\|CDD\|367711
NC_015598.1\|WP_013851173.1\|3630_5412_+\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|180854
NC_015598.1\|WP_013851177.1\|7140_7761_+\|hypothetical-protein	unknown	unknown	unknown
NC_015598.1\|WP_013851181.1\|12066_15531_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|274377
NC_015598.1\|WP_013851171.1\|750_2151_+\|replication-initiation-protein	unknown	unknown	gnl\|CDD\|376444
NC_015598.1\|WP_081462965.1\|15543_17571_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|197275
NC_015598.1\|WP_013851176.1\|6939_7140_+\|hypothetical-protein	unknown	unknown	unknown
NC_015598.1\|WP_013851175.1\|6104_6743_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187577
NC_015598.1\|WP_013851179.1\|8811_10098_-\|peptidase-T	unknown	unknown	gnl\|CDD\|237371

Protein	Function_ID	Function_description	E-value
NC_015598.1\|WP_013851174.1\|5455_6103_+\|GntR-family-transcriptional-regulator	gnl\|CDD\|224715	COG1802, GntR, Transcriptional regulators [Transcription].	7.21478e-34
NC_015598.1\|WP_013851172.1\|2425_3268_-\|fructosamine-kinase-family-protein	gnl\|CDD\|367711	pfam03881, Fructosamin_kin, Fructosamine kinase. This family includes eukaryotic fructosamine-3-kinase enzymes. The family also includes bacterial members that have not been characterized but probably have a similar or identical function.	2.32908e-77
NC_015598.1\|WP_013851173.1\|3630_5412_+\|FAD-dependent-oxidoreductase	gnl\|CDD\|180854	PRK07121, PRK07121, FAD-binding protein.	2.08966e-66
NC_015598.1\|WP_081462965.1\|15543_17571_+\|hypothetical-protein	gnl\|CDD\|197275	cd09178, PLDc_N_Snf2_like, N-terminal putative catalytic domain of uncharacterized HKD family nucleases fused to putative helicases from the Snf2-like family. N-terminal putative catalytic domain of uncharacterized archaeal and prokaryotic HKD family nucleases fused to putative helicases from the Snf2-like family, which belong to the DNA/RNA helicase superfamily II (SF2). Although Snf2-like family enzymes do not possess helicase activity, they contain a helicase-like region, where seven helicase-related sequence motifs are found, similar to those in DEAD/DEAH box helicases, which represent the biggest family within the SF2 superfamily. In addition to the helicase-like region, members of this family also contain an N-terminal putative catalytic domain with one copy of the conserved HKD motif (H-x-K-x(4)-D, where x represents any amino acid residue), and have been classified as members of the phospholipase D (PLD, EC 3.1.4.4) superfamily.	1.12169e-33
NC_015598.1\|WP_013851181.1\|12066_15531_+\|hypothetical-protein	gnl\|CDD\|274377	TIGR02987, m6_adenine_and_m5_cytosine_DNA_methyltransferase, type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family. Members of this family are the m6-adenine DNA methyltransferase protein, or domain of a fusion protein that also carries m5 cytosine methyltransferase activity, of type II restriction systems of the Alw26I/Eco31I/Esp3I family. A methyltransferase of this family is alway accompanied by a type II restriction endonuclease from the Alw26I/Eco31I/Esp3I family (TIGR02986) and by an adenine-specific modification methyltransferase. Members of this family are unusual in that regions of similarity to homologs outside this family are circularly permuted. [DNA metabolism, Restriction/modification].	0.000624377
NC_015598.1\|WP_013851171.1\|750_2151_+\|replication-initiation-protein	gnl\|CDD\|376444	pfam01051, Rep_3, Initiator Replication protein. This protein is an initiator of plasmid replication. RepB possesses nicking-closing (topoisomerase I) like activity. It is also able to perform a strand transfer reaction on ssDNA that contains its target. This family also includes RepA which is an E.coli protein involved in plasmid replication. The RepA protein binds to DNA repeats that flank the repA gene.	1.31144e-16
NC_015598.1\|WP_013851175.1\|6104_6743_+\|SDR-family-oxidoreductase	gnl\|CDD\|187577	cd05267, SDR_a6, atypical (a) SDRs, subgroup 6. These atypical SDR family members of unknown function have only a partial match to a prototypical glycine-rich NAD(P)-binding motif consensus, GXXG, which conserves part of the motif of extended SDR. Furthermore, they lack the characteristic active site residues of the SDRs. This subgroup is related to phenylcoumaran benzylic ether reductase, an NADPH-dependent aromatic alcohol reductase. One member is identified as a putative NAD-dependent epimerase/dehydratase. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	8.17133e-84
NC_015598.1\|WP_013851179.1\|8811_10098_-\|peptidase-T	gnl\|CDD\|237371	PRK13381, PRK13381, peptidase T; Provisional.	0

>NC_015598.1|WP_013851171.1|750_2151_+|replication-initiation-protein
MDEKKKEQEKIRELLNFPDRKKNLVKYNNDLNDSKQYYGVSSLTKYELDIFFFLVAQLQGQDGAVVDIKIKDLKRYLHMPRTMSYRTFQKVVVQTFAHLENIKTGFLKNDEDNREYLQLRPIFDYTNIYTDSLDVEVKVNKEYRYLFNGLIRSADPSMQIRYTRFDLQQMIKIKRQNSKNMYRLLMQNMYRGEREFTEEEIYEQLGLFTVRKGKRVKKYENGKLYNRVLKPALIDLSPFFRNLRLKKQYGPNHTVEKYHFFWAKESARNSRLIYNPEDADIRAVVNIKTNVHLTLKEKNEAIDRYFGQKIGTSHLEKQSGNKEYLKSFFEDTPFNQSGLDIETKKLTDLELKNMISTYGYLESLDLLKDHDKTFLKLLKTEKLKREGKLEEEKPVKGTFLQSFLNVPKPLESMTDTELNHYQDLLLAKIADPDHDISASERLDLSNIRKMLLGLNDLKNNMPKSDK
>NC_015598.1|WP_013851172.1|2425_3268_-|fructosamine-kinase-family-protein
MRLNQKWLSQLPVDKIISCRTVHGGDMNEAYQIQTDKQIYFMKVQPNKPASFFDHEKRGLREIAKANVNTLSVIASGQIAGDAYLLLNWLLPSSGSQADLGKLVAKLHQHHSEQFGFGDTYETRILKKDNHWNKSWTDFYINQRLLPEVEYAKKVGRWNDYREQHFPKMVAAFEKYYQRHPVVPSLCHGDLWFGNVMFSNNMPYLIDPDAVYADREFDLAMTTVFGGFTDEFYAAYNSVYPLKPGLNQRLNWHRFYYLCMHLDLFGETYGTAVDDILSNF
>NC_015598.1|WP_013851173.1|3630_5412_+|FAD-dependent-oxidoreductase
MKDGKYIAKAKGFHGPITVEALIENNQIQKIVAKDIAHNTVGELAVKRTLDKMNSAKSVDVDAVTGATFSSSAALKAAKKAVAVAEDELTETEALDAEIEPKSQVKVSVYAKPLSRRIYQDDVDFEDEYDVIIAGSGISGLSAAVEAARNGAKTVVFEKAGMIGGTSNYSQGIIQAAGTKWQKKYTTYQNDSPAKHLAEYLQTGEGHVNRNLLADFIQDAANSIDWLSELGLKWKNVYGHKVIPYEDKQNFAPRIHVYENGGVNGAGVIMMTKIWKAAKEAGVKIIYDTPVVGLITENKTNNHVVGVAVDHLGKKMNFRAKKGVVLATASIDHNEELAKQIDPWQYRDIQKHTLLNSKYDTGDGIVLGMIQGAGLAGVSGAMDADFKFAAGFADIIKTFPMFYVNGLGNRYVNEDTTYGYLTRANYQQETNLDKPTWMIFGKNSIGQGAMPYHSEEDMKKDMAGGYLHKADTIEELAKKMDVSSENLANTLASWNRYAAKGVDPTFGRKEGVAVLQGPFYAYQNRDMNIGSIAGLKVNVDLQVLDNLDNPIQGLYAIGQNAGGWIGGYYPGSGTALGGSLNQGRKVGKELAEK
>NC_015598.1|WP_013851174.1|5455_6103_+|GntR-family-transcriptional-regulator
MTNEDRAYQFIKNQITSGMYRPGHVLSENQMCIKLDMSRTPVREAFKKLENDGLIERDGQETRVTQIKKEELRENYDLRSMLEGYALEKSFSNLDKSKSEKFRMGFTNALDSKNWEDYLKLDEQFHHFLTKNNDQSTLQKSLDLLQSQTNQMRYAIRDDQRCMISSVDEILQIIDAIAENDRYEAVCRLNKHVKSVYDWEVEYLTIQQEEKTEAN
>NC_015598.1|WP_013851175.1|6104_6743_+|SDR-family-oxidoreductase
MVKVIVLGAHGQVAQLAEQMLFTDGDVQTTLFLRNAKRLAKDKDKATIIEGDTTNEAELEKAIAGQDIVYANLGGTSTIVKQAEAVIEAMKKTGVKRLIWISTLGIYDEVAGKFGEWNKSVLGNYITEYAKAAKKVEESGLDYTIIRPSWMTNKDKVDYQKTKKGQPITNTEVSRKSVASYIYKLIKKPDEDVQESIGLEKPGTQGNKPSWY
>NC_015598.1|WP_013851176.1|6939_7140_+|hypothetical-protein
MKKRKYLSVIAAALLTISPVVATTLASNTTVVKAASTEEGKTITFTKVPTLRFKVGTEEGLQTIAD
>NC_015598.1|WP_013851177.1|7140_7761_+|hypothetical-protein
MKGVKVSDGYIDATGNVLDFSDQGFYKNDANGNPIMDWPLDWNDFRRGDEGTALIYVPIKGLKPLTHYRVLCQKPWHGKKGNGNFQNGALYWRTMKTDLDGELNSEFGSPTSDESSIPVIKAHFVVGSKKVAKKSSTVKVSKKGYVDVRKNKKVRTYTSTGKFSKHYVYGHHTYKLNRKKHIKGHGTCYKIYGKNQWIPAKYLDLR
>NC_015598.1|WP_013851179.1|8811_10098_-|peptidase-T
MTFYDLNFIQKTFIHYAKENTRSDPNNSDQIPSSPNQIKMAKELTKQLKEIGLDAYFNDKSCFAIGHLTSNVSDKVTPIGFFSHMDTADFNAVNIQPHVHKNYDGGRVALDKEAGIFLDPKEFPALKSCQGETLITSDGHTLLGVDDKAGIVGILGMLKYLVAHPKVEHGDIYVGFGPDEEIGYGGKRFDPKDFPNVELAYTLENGRPGDFEYETFNATLAKIHIHGTVVHPGEAYGLMVNATTLMNKFLDQMPADEVPEKSKGHDGYYMVVNSSSCVDHADIDIIIRDFDWDKYLAKEQFIKDLVAKLNKKYGADRFKLTLRREYENIYNVIKDHPYVVNLALDAYKKAGIKPNVKTFRGGTDGNFITQKGIPTPNLFNGGGNYHGRYEYVTVEQIDKLSKVLTTICKEHLYQTRHGRDNTPLKKYW
>NC_015598.1|WP_013851181.1|12066_15531_+|hypothetical-protein
MSNIKDMIESLQGDPTSIDILAGFLGYRVGENPINPDSDWKMYFTDKADTNDHAVMAVFPEPELDNETKTPQIRKLYQKVIELKDTFGASFAAEVAAFIGENRVVFFPVNNGNRDTRLDLNPETIKKDLYLRDLSYLKNDNIKVTTDDFGFGTNIDVSQDKAFRQELTEQFLYVVEFYRKKLSELITGSKLKNQLLDLLSDKAKFYAENNDLNNLVQSDSYLSVLSTVVDTIILRQLMRRFLEGYYGPNSFEVDGIALGVGSGTLDEAIKETVNVAVNLGEEKDFKKMNRQENTIQQLDLFSDAFSQDELDHTSQVEPVTKSKKEQLEEITKKATKQFELAYDGDLFAGSIAQATNNVENQLTKQFPEFMAKLWVDTASGNFSFRYQDMPPESLEKQYEDSMSKNVQIKIDSKTKKPVVFYGDDKSEQKSKGAYYTDQRFVDYMINKTVEVEFDKRYKAIQEAIKTKDNQKIKAALEHLLDLKIADFTCGGGSFLRGAFLKLADQYKMLQSLCIPDELKADYPMITAEDDGYLWEKYILENMIYGVDIDYKAIMITSLTLTLSSLQHRPKDTKLSQLIGRTLIHQNALINAVPYYSRKEVFASYQQDIAKLRKLKKTNFTQFNKLRVKLQNKVIPDSGDVAEDASFLHVESIELNLPEVYFNEDGSLKEHGGMDIVVGNPPWDIWKANSDDFFSEYDNGFRGLPNKRVKTSKMKELFASLPGLKDKWDTEQQRFKDGSKYFRSDDTYKYQRWTVNGRKTSSDLNLYKISVERFAQLASTYARFSILVPDNFATDNGPTGIRHLVLDHYHLEEFLSFENRRGIFPAIDSRYKFAVLTFDYDQTRSNSFKAFFYRHSLDDLSNAEIKLNYPVEFIKQTEPERYAFVEARTPKLFDLFKKIRTKFPDLNHTKLLKFSRDFDANKESGKFTTKDSNENLISVYEGKTFKQFTIEPQKIVHYVTPEKLEDKDNEDYKFLRLAFRGIASSTNKRSLIATLLPRNSSGTYSVWIQRNFTKTDITHQLFYLSFYNSYTLDFIIRQIVTININLPFSMQLPIPKYEDIADADKLVQISKALLQENKGYYTDLDELVPGNDYAGKSHEELIAELNARVMLDFDLTRDEVITLMHTFESAKWKSFVEEETQRIVDVYDKLSAARK
>NC_015598.1|WP_081462965.1|15543_17571_+|hypothetical-protein
MEEMNIDQLYRERVIDNRQLKMVDVLKYLLQREDVRSLDVAVGYFYLSGLLLIKDEFIKFMDEKNGQLRILMGNETNGQTANVLSGSKYKDYASYISNETQKDTDTIDDGEFLARLAGWIKEGRIKVQVYTGDANYFHAKSYLFAYSQDETHGTAIVGSSNFSRNGLEGNTELNVLSQDNYYALHRWYSNLWLSDETQAFSPDLLKIVKNNISPRDALKRDYKPVNQTYYEFANLYAKPYAKLDEQKDWVKELFPHQRSGVISIKDKLDSFGTAVLADGVGLGKTRIAGGVMRLYKDDSAPYKTLIVADKKLKIQWAEELDICGIESADYDWMSREEFVNIPWKQIRNMKYSLVIIDEAHIGFKNNNTQAYQKMRWLKDQHPELRGLMITATPWNNRREDVINIGTLFLNIDDIPNDRNYKQYLLLGGRTNKAVRKIAADDKAFNQLWEDIFLQRTRKTYGGKQAQFATRTFPTVDIQFEPRKNKIFSDNFDAIAGLKFPYMDPIKYLDPKKEPLGAKQLKLLLLKRADSSWVAYRNTLQNIIDKLTQLKTNLSYVTSMPGKKLTDRFKGMLSEAYELPDYQAKNQLTSLFNISADDTADEHELRSRNKKRIYLDKITKQIEDITNAKAKKAVASMLADCNEDLEVLNLVLNKLNQAYQHIDEKMDKIISVVSKE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_015598_1	1.1\|250\|48\|NC_015598\|CRISPRCasFinder	250-297	48	NC_015598	Lactobacillus kefiranofaciens ZW3 plasmid pWW1, complete sequence	250-297	0	1.0
NC_015598_1	1.2\|337\|61\|NC_015598\|CRISPRCasFinder	337-397	61	NC_015598	Lactobacillus kefiranofaciens ZW3 plasmid pWW1, complete sequence	337-397	1	0.984

1. spacer 1.1|250|48|NC_015598|CRISPRCasFinder matches to NC_015598 (Lactobacillus kefiranofaciens ZW3 plasmid pWW1, complete sequence) position: , mismatch: 0, identity: 1.0

cagctctacacaaaatttagggtagctctcccatgaaactcgatttgc	CRISPR spacer
cagctctacacaaaatttagggtagctctcccatgaaactcgatttgc	Protospacer
************************************************

2. spacer 1.2|337|61|NC_015598|CRISPRCasFinder matches to NC_015598 (Lactobacillus kefiranofaciens ZW3 plasmid pWW1, complete sequence) position: , mismatch: 1, identity: 0.984

gttttaacgagtgaattcaagcgttttcaccagagttatccacaggctagtgggagcttt	CRISPR spacer
gttttaacgagtgaattcaagcgttttcaccagagttatccacaggctagtgggagcttt	Protospacer
************************************************************

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_015602

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NC_015598

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection