CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NC_015857	Brucella pinnipedialis B2/94 chromosome 1, complete sequence	1 crisprs	csa3,WYL,DEDDh	0	1	3	0
NC_015858	Brucella pinnipedialis B2/94 chromosome 2, complete sequence	0 crisprs	csa3,cas3,DEDDh	0	0	1	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_015857_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_015857_1

664489-664571

Orphan

Consensus_repeat	Method
ATCCCGAAAAGTGCGAAGCGGTTTTCGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_015857_1

>merge|NC_015857|1|664489-664571|CRISPRCasFinder
ATCCCGAAAAGTGCGAAGCGGTTTTCGGATAAGATGCGCGCAAGGAAAGATCTGTATCCCGAAAAGTGCGAAGCGGTGTTCGG

>NC_015857|1|1|664489-664571|CRISPRCasFinder
ATCCCGAAAAGTGCGAAGCGGTTTTCGG	ATAAGATGCGCGCAAGGAAAGATCTGT
ATCCCGAAAAGTGCGAAGCGGTGTTCGG

Protein	Signature genes	Signature genes Name	Protein_function
NC_015857.1\|WP_002963792.1\|664612_665284_-\|uracil-DNA-glycosylase	unknown	unknown	gnl\|CDD\|381681
NC_015857.1\|WP_004688165.1\|666928_669181_+\|bifunctional-(p)ppGpp-synthetase/guanosine-3',5'-bis(diphosphate)-3'-pyrophosphohydrolase	unknown	unknown	gnl\|CDD\|223394
NC_015857.1\|WP_006160811.1\|665314_665890_-\|NYN-domain-containing-protein	unknown	unknown	gnl\|CDD\|350235
NC_015857.1\|WP_002963787.1\|659514_659697_+\|hypothetical-protein	unknown	unknown	unknown
NC_015857.1\|WP_002963795.1\|666286_666688_+\|DNA-directed-RNA-polymerase-subunit-omega	unknown	unknown	gnl\|CDD\|234744
NC_015857.1\|WP_002963789.1\|660494_662552_-\|lytic-transglycosylase-domain-containing-protein	unknown	unknown	gnl\|CDD\|381604
NC_015857.1\|WP_002963786.1\|658817_659459_+\|hypothetical-protein	unknown	unknown	unknown
NC_015857.1\|WP_002963803.1\|675503_675908_+\|holo-ACP-synthase	unknown	unknown	gnl\|CDD\|234610
NC_015857.1\|WP_004689573.1\|663027_663909_+\|4-hydroxy-tetrahydrodipicolinate-synthase	unknown	unknown	gnl\|CDD\|235107
NC_015857.1\|WP_002963791.1\|663999_664476_+\|SsrA-binding-protein-SmpB	unknown	unknown	gnl\|CDD\|235455
NC_015857.1\|WP_002971509.1\|659775_660432_+\|endonuclease	unknown	unknown	gnl\|CDD\|237082
NC_015857.1\|WP_004689567.1\|652947_654081_-\|pyridoxal-phosphate-dependent-aminotransferase	unknown	unknown	gnl\|CDD\|181255
NC_015857.1\|WP_006185956.1\|657585_658674_+\|porin	unknown	unknown	gnl\|CDD\|308243
NC_015857.1\|WP_002971501.1\|674042_674882_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380379
NC_015857.1\|WP_002967515.1\|654443_655370_-\|site-specific-integrase	unknown	unknown	gnl\|CDD\|271177
NC_015857.1\|WP_006160814.1\|669926_670682_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|236494
NC_015857.1\|WP_002966733.1\|674931_675507_+\|DUF2062-domain-containing-protein	unknown	unknown	gnl\|CDD\|225757
NC_015857.1\|WP_002963797.1\|669188_669767_+\|orotate-phosphoribosyltransferase	unknown	unknown	gnl\|CDD\|273579
NC_015857.1\|WP_004689569.1\|655643_656747_-\|porin	unknown	unknown	gnl\|CDD\|308243
NC_015857.1\|WP_002967519.1\|672579_673791_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|341031

Protein	Function_ID	Function_description	E-value
NC_015857.1\|WP_002963792.1\|664612_665284_-\|uracil-DNA-glycosylase	gnl\|CDD\|381681	cd10031, UDG-F5_TTUDGB_like, Uracil DNA glycosylase family 5, includes Thermotoga maritima TTUDGB and similar proteins. Uracil DNA glycosylase family 5 includes Thermus thermophilus HB8 TTUDGB (also called UDGb) which is not only a UDG acting on double-stranded uracil-containing DNA, but also a hypoxanthine DNA glycosylase acting on double-stranded hypoxanthine-containing DNA (except for the C/I base pair), as well as a xanthine DNA glycosylase acting on both, double-stranded and single-stranded xanthine-containing DNA. TTUDGB also excises thymine from G:T mismatched DNA, and removes analogs of uracil from DNA, including 5-hydroxymethyluracil (hmU) and 5-fluorouracil (fU). This subfamily also contains Bradyrhizobium diazoefficiens family 5 homolog Blr5068 (UdgB) which has been found to efficiently excise uracil from ssDNA and dsDNA. Uracil-DNA glycosylases (UDGs) initiate repair of uracils in DNA. Similar to family 4 UDGs, members of this family possess four conserved cysteine residues required to coordinate the [4Fe-4S] iron-sulfur cluster. Uracil in DNA can arise as a result of mis-incorporation of dUMP residues by DNA polymerase or via deamination of cytosine. Uracil in DNA mispaired with guanine is one of the major pro-mutagenic events, causing G:C->A:T mutations. Thus, UDG is an essential enzyme for maintaining the integrity of genetic information. UDGs have been classified into various families on the basis of their substrate specificity, conserved motifs, and structural similarities. Although these families demonstrate different substrate specificities, often the function of one enzyme can be complemented by the other.	7.75632e-104
NC_015857.1\|WP_004688165.1\|666928_669181_+\|bifunctional-(p)ppGpp-synthetase/guanosine-3',5'-bis(diphosphate)-3'-pyrophosphohydrolase	gnl\|CDD\|223394	COG0317, SpoT, Guanosine polyphosphate pyrophosphohydrolases/synthetases [Signal transduction mechanisms / Transcription].	0
NC_015857.1\|WP_006160811.1\|665314_665890_-\|NYN-domain-containing-protein	gnl\|CDD\|350235	cd10911, PIN_LabA, PIN domain of Synechococcus elongatus LabA (low-amplitude and bright) and related proteins. This subfamily contains Synechococcus elongatus PCC 7942 LabA which participates in cyanobacterial circadian timing, it is required for negative feedback regulation of the autokinase/autophosphatase KaiC, a central component of the circadian clock system, and appears to be necessary for KaiC-dependent repression of gene expression. This subfamily belongs to the LabA-like domain family which includes the N-terminal domain of limkain b1, a human autoantigen localized to a subset of ABCD3 and PXF marked peroxisomes. Also included in the LabA-like domain family are human ZNF451, uncharacterized Bacillus subtilis YqxD, uncharacterized Escherichia coli YaiI, and the N-terminal domain of a well-conserved group of mainly bacterial proteins with no defined function, which contain a C-terminal LabA_like_C domain. Curiously Pseudomonas putida S16 NicB , which is described as a putative NADH-dependent hydroxylase involved in the microbial degradation of nicotine also falls into the LabA-like family. The PIN (PilT N terminus) domain belongs to a large nuclease superfamily. The structural properties of the PIN domain indicate its active center, consisting of three highly conserved catalytic residues which coordinate metal ions; in some members, additional metal coordinating residues can be found while some others lack several of these key catalytic residues. The PIN active site is geometrically similar in the active center of structure-specific 5' nucleases, PIN-domain ribonucleases of eukaryotic rRNA editing proteins, and bacterial toxins of toxin-antitoxin (TA) operons.	9.27373e-60
NC_015857.1\|WP_002963795.1\|666286_666688_+\|DNA-directed-RNA-polymerase-subunit-omega	gnl\|CDD\|234744	PRK00392, rpoZ, DNA-directed RNA polymerase subunit omega; Reviewed.	1.70484e-25
NC_015857.1\|WP_002963789.1\|660494_662552_-\|lytic-transglycosylase-domain-containing-protein	gnl\|CDD\|381604	cd13401, Slt70-like, 70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.	2.60661e-60
NC_015857.1\|WP_002971501.1\|674042_674882_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|380379	cd06124, cupin_NimR-like_N, AraC/XylS family transcriptional regulators similar to NimR, N-terminal cupin domain. This family contains mostly bacterial proteins containing an AraC/XylS family helix-turn-helix (HTH) DNA-binding domain C-terminal to a cupin domain, and may be possible transcriptional regulators. Included in this family is Escherichia coli HTH-type transcriptional regulator NimR (also called YeaM) that negatively regulates expression of the nimT operon and its own expression. Proteins in this family belong to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold capable of homodimerization.	5.72308e-33
NC_015857.1\|WP_002963803.1\|675503_675908_+\|holo-ACP-synthase	gnl\|CDD\|234610	PRK00070, acpS, 4'-phosphopantetheinyl transferase; Provisional.	7.50792e-67
NC_015857.1\|WP_004689573.1\|663027_663909_+\|4-hydroxy-tetrahydrodipicolinate-synthase	gnl\|CDD\|235107	PRK03170, PRK03170, dihydrodipicolinate synthase; Provisional.	3.51802e-178
NC_015857.1\|WP_002963791.1\|663999_664476_+\|SsrA-binding-protein-SmpB	gnl\|CDD\|235455	PRK05422, smpB, SsrA-binding protein SmpB.	1.57135e-88
NC_015857.1\|WP_002971509.1\|659775_660432_+\|endonuclease	gnl\|CDD\|237082	PRK12373, PRK12373, NADH-quinone oxidoreductase subunit E.	2.3845e-28
NC_015857.1\|WP_004689567.1\|652947_654081_-\|pyridoxal-phosphate-dependent-aminotransferase	gnl\|CDD\|181255	PRK08153, PRK08153, pyridoxal phosphate-dependent aminotransferase.	0
NC_015857.1\|WP_006185956.1\|657585_658674_+\|porin	gnl\|CDD\|308243	pfam02530, Porin_2, Porin subfamily. This family consists of porins from the alpha subdivision of Proteobacteria the members of this family are related to pfam00267. The porins form large aqueous channels in the cell membrane allowing the selective entry of hydrophilic compounds this so called 'molecular sieve' is found in the cell walls of gram negative bacteria.	2.94766e-116
NC_015857.1\|WP_002967515.1\|654443_655370_-\|site-specific-integrase	gnl\|CDD\|271177	cd00796, INT_Rci_Hp1_C, Shufflon-specific DNA recombinase Rci and Bacteriophage Hp1_like integrase, C-terminal catalytic domain. Rci protein is a tyrosine recombinase specifically involved in Shufflon type of DNA rearrangement in bacteria. The shufflon of plasmid R64 consists of four invertible DNA segments which are separated and flanked by seven 19-bp repeat sequences. RCI recombinase facilitates the site-specific recombination between any inverted repeats results in an inversion of the DNA segment(s) either independently or in groups. HP1 integrase promotes site-specific recombination of the HP1 genome into that of Haemophilus influenza. Bacteriophage Hp1_like integrases are tyrosine based site specific recombinases. They belong to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The catalytic domain contains six conserved active site residues. Their overall reaction mechanism is essentially identical and involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA.	1.4048e-42
NC_015857.1\|WP_006160814.1\|669926_670682_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|236494	PRK09391, fixK, transcriptional regulator FixK; Provisional.	6.18589e-48
NC_015857.1\|WP_002966733.1\|674931_675507_+\|DUF2062-domain-containing-protein	gnl\|CDD\|225757	COG3216, COG3216, Uncharacterized protein conserved in bacteria [Function unknown].	5.43979e-83
NC_015857.1\|WP_002963797.1\|669188_669767_+\|orotate-phosphoribosyltransferase	gnl\|CDD\|273579	TIGR01367, Orotate_phosphoribosyltransferase, orotate phosphoribosyltransferase, Thermus family. This model represents a distinct clade of orotate phosphoribosyltransferases. Members include the experimentally determined example from Thermus aquaticus and additional examples from Caulobacter crescentus, Helicobacter pylori, Mesorhizobium loti, and related species. [Purines, pyrimidines, nucleosides, and nucleotides, Pyrimidine ribonucleotide biosynthesis].	2.00708e-76
NC_015857.1\|WP_004689569.1\|655643_656747_-\|porin	gnl\|CDD\|308243	pfam02530, Porin_2, Porin subfamily. This family consists of porins from the alpha subdivision of Proteobacteria the members of this family are related to pfam00267. The porins form large aqueous channels in the cell membrane allowing the selective entry of hydrophilic compounds this so called 'molecular sieve' is found in the cell walls of gram negative bacteria.	4.46283e-105
NC_015857.1\|WP_002967519.1\|672579_673791_-\|MFS-transporter	gnl\|CDD\|341031	cd17478, MFS_FsR, Fosmidomycin resistance protein of the Major Facilitator Superfamily of transporters. Fosmidomycin resistance protein (FsR) confers resistance against fosmidomycin. It shows sequence similarity with the bacterial drug-export proteins that mediate resistance to tetracycline and chloramphenicol. This FsR family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	2.71471e-108

>NC_015857.1|WP_002963791.1|663999_664476_+|SsrA-binding-protein-SmpB
MNKPKNSPARKMIAENRKARFNFEILDTLEAGLVLTGTEVKSLRANQANIAESYASFEDGEFWLINSYIPEYTQGNRFNHEPRRLRKLLVSRREMSRLFNSVSREGMTVVPLKLYFNDRGRAKLELALARGKKTHDKRETEKKRDWNREKARLLRDRG
>NC_015857.1|WP_004689573.1|663027_663909_+|4-hydroxy-tetrahydrodipicolinate-synthase
MLKGSITALVTPFDREGAFDEKAFRAFVNWQIEEGTKGLVPVGTTGETPTLSHDEHKRVIEVCIEVAAGRVPVIAGAGSNNTVEAIELAQHAEKAGADAVLVVTPYYNKPNQRGLYEHFSRVARSISIPLVIYNIPGRSIIDMTPETMGALVRDCKNIVGVKDATGKIERVSEQRAICGKEFIQLSGEDATALGFNAHGGVGCISVTSNIAPRLCAEFQEACQAGNFAKALELQDRLMPLHKALFLEPNPSGPKYALSRLGRIENVLRSPMVTIEAATAEKIDHAMKHAGLIN
>NC_015857.1|WP_002963789.1|660494_662552_-|lytic-transglycosylase-domain-containing-protein
MVSLAQSSLPPEIPTPLARPFAPTATHQSPISLVTPRPRPIAPDPMATSAVSRTDNPAVIGGTLKNGLDALSAKNVASAIASRNNLPRGSLDRQILTWAIATSGMDGVPSTEIAAAASELSGWPGMATLRRNSERALFKENPSSATIIATFGSTRPQTTEGMIALARAYVATGNSTKAHQLLSPWWTRKRLSSDDEQKILKEFSAILTREDHQRRLLHSLYNGRLQSARLLAGPAQAQSLYNAYAAVAQKSPNAASAIAAVDRSWQANPVYQFLKIRYLRRAERYNEAAELLLKAPRKASVLVDPDAWWVERRILSRELLDLGKPQLAYRLAAAHAAETPTMAAEAEFHAGWYALRALNQPKLAAPHFAKITQISARPISASRAYYWLGRAAEAGSGGDARAYYRRSAHFGTTFYGQLAAAKLNEKAPELAYPKPTEAERVRFASRPAVQAIKRLEQVGYGNKAAALYTQLSQELDSVGELALLAVMAERNDNHYMALRVGKTAAMRGLDVGALSHPLGAIPASANIKGSGKALAYAIARQESEFNVSAVSKAGARGLLQLMPATAKTVATRNGMSFSAQKLTADAAYNATLGAHFLGEQLDRFNGSYVLTFAGYNAGPRRASEWVEKYGDPRGKSVEQVVDWIERIPYSETRNYVQRVMENYEVYKTRLTGRADIKTDLVYGRR
>NC_015857.1|WP_002971509.1|659775_660432_+|endonuclease
MPLLIVQLAILIAVAFVVGCFLGRILRRRKSAGSDHERTIVAAALSTPPLAEKPEPVPPAEPVRADSDPLKRKAGLEKARIEPVEGSADSDVAAAPVLQKVPAETPDDAGRPQWREAPRRGKADELTAIEGIGKAIEAVLHELGIFHYDQIAQWTREEAIWIERRIGFPGRVEREGWIAQAAKLAEPPAKSTTKRGAKTKKAANNVRSGTRRAKKQAG
>NC_015857.1|WP_002963787.1|659514_659697_+|hypothetical-protein
MTVFPIRPFLCYDYSAKGLKCLAKYYAESLMLYLVETFWPVLVLAILIGAATGWLTAGER
>NC_015857.1|WP_002963786.1|658817_659459_+|hypothetical-protein
MKKWFWPCLTWTACLTALALWFGADRVETDIAEQTAKALEPYVWAGFYVDGRDVVLKGMAPDPDMQRAAHAALEHVWAIRDITDLTTVLQLASPYRFKIGRNAQGLVLSGFIPNNESRDQVMTAAGEVAPDIFIDDEMAVARGNQPEFMERVLFAIDLAKKLPEAEIEIVDEKLSIRGTVSDEAIYDEIEALKAAQLPYGLKLAVLDVKKSVQ
>NC_015857.1|WP_006185956.1|657585_658674_+|porin
MNIKSLLLGSAAALVAASGAQAADAIVAPEPEAVEYVRVCDAYGAGYFYIPGTETCLRISGYVRYDVKGGDDVYTGSDRKGWDKSARFALRVSTGSETELGTLKTFTELRFNYAANNSGVDGKYGNETSSGTVMEFAYIQLGGLRVGIDESEFHTFTGYLGDVINDDVISAGSYRTGKISYTFTGGNGFSAVIALEQGGDNDGGYTGTTNYHIDGYMPDVVGGLKYAGGWGSIAGVVAYDSVIEEWAAKVRGDVNITDRFSVWLQGAYSSAATPNQNYGQWGGDWAVWGGAKFIATEKATFNLQAAHDDWGKTAVTANVAYQLVPGFTVTPEVSYTKFGGEWKNTVAEDNAWGGIVRFQRSF
>NC_015857.1|WP_004689569.1|655643_656747_-|porin
MNIKSLLLGSAAALVAASGAQAADAIVAPEPEAVEYVRVCDAYGAGYFYIPGTETCLRISGYVRYDVKGGDDVYTGSDRKGWDKGARFALMFNTNSETELGTLGTYTQLRFNYTSNNSRHDGQYGDFSDDRDVADGGVSTGTDLQFAYITLGGFKVGIDESEFHTFTGYLGDVINDDVVAAGSYRTGKIAYTFTGGNGFSAVIALEQGGEDVDNDYTIDGYMPHVVGGLKYAGGWGSIAGVVAYDSVIEEWATKVRGDVNITDRFSVWLQGAYSSAATPNQNYGQWGGDWAVWGGAKFIATEKATFNLQAAHDDWGKTAVTANVAYQLVPGFTITPEVSYTKFGGEWKDTVAEDNAWGGIVRFQRSF
>NC_015857.1|WP_002967515.1|654443_655370_-|site-specific-integrase
MIIVGETKIDTGDKYAPIIDYNLNYISGKNPKHRLVEHYSVAELTAKYINILWDDGSHKYNVRSFLGEIDEILKGARFSGFDQEMLDSIIGTLRERGNSNATINRKMAALSKLLRKAHKMGDIFNLPEFIRQKERVGRIRFLEQEEEKRLFAAIKSRCEDSYRLSVFLVDTGCRLGEAIGLTWNDIQEQRVTFWVTKSNRSRTVPLTRRARKASHIPRERLKGPFSMLNQVRFRQIWNEAKAEVGLGADDQIVPHILRHTCASRLVRGGIDIRRVQMWLGHQTLQMTMRYAHLATHDLDSCVKVLEIH
>NC_015857.1|WP_004689567.1|652947_654081_-|pyridoxal-phosphate-dependent-aminotransferase
MAQPRLTPLVESLPSTVPFIGPETLELQRGKPFKARIGANESSFGPAPSVIEAMRNEATEVWKYGDPENYALRHAIAAHHGLKAEHIMPGAGVDALLGLIVRQYVQQGDKVINSLGGYPTFNYHVAGYGGQLVTVPYRDDKPDLDALIDAAAREKPALLYIANPDNPMGTWHEGADIQSFIERLPETTLLILDEAYCETAPASAFPPFETDRPNVLRMRTFSKAYGLAGIRCGYAVGNPVAIKTFDKVRDHFAVSRMAQAAAIAALKDQAYLHEVVGKICAGRDRIAAIAEANGLHAVASATNFVAIDCGRGKDFAQAVLNGLISRDIFVRKPGTPVLDRCIRVSVGVKEQLDQFEAAFPEALEEARKICAANAENT
>NC_015857.1|WP_002963792.1|664612_665284_-|uracil-DNA-glycosylase
MISEPSPNCSICPRLHAFLQEWRQKEPAWHNAPVPPFLPGSDEDVRLLIVGLAPGLRGANRTGRPFTGDYAGELLYSTLCEFGFATGKFEARPDDSLRLLDACIVNAVRCVPPENKPVGSEINNCRQFLTPMLTRFPNLDAVVTLGTIAHQSTVRALGVPVSRHPFGHGKATDIGPLRIFSSYHCSRYNTNTGVLTDAMFRDVFKNVRAYLSEKAAGSARLSV
>NC_015857.1|WP_006160811.1|665314_665890_-|NYN-domain-containing-protein
MFDSREKIALFIDGANLYAASKTLGFDIDYRKLLKAFQKRGYLLRAYYYTALVEDQEYSSIRPLIDWLDYNGYKVGTKAAKEFTDSTGRRKVKGNMDIELTVDAKQLTDTVDHFVIFSGDGDFRSLVEALQRKGRKVSVVSTLTTQPAMISDELRRQADHFIDLVSLKAEIGRDPSERAPRRQEEDFDESY
>NC_015857.1|WP_002963795.1|666286_666688_+|DNA-directed-RNA-polymerase-subunit-omega
MARVTVEDCVDKVENRFELVLLAGHRARQISQGAPITVDRDNDKNPVVALREIADETLSPDDLKEDLIHSLQKHVEVDEPEAAPAQIANAAEEIAEGIAEAGEEDVVTFDRMSEEELLAGIEGLVAPEKNDGF
>NC_015857.1|WP_004688165.1|666928_669181_+|bifunctional-(p)ppGpp-synthetase/guanosine-3',5'-bis(diphosphate)-3'-pyrophosphohydrolase
MMRQYELVERVQRYKPDVNEALLNKAYVYAMQKHGSQKRASGDPYFSHPLEVAAILTDMHLDEATIAIALLHDTIEDTTATRQEIDQLFGPEIGKLVEGLTKLKKLDLVSKKAVQAENLRKLLLAISEDVRVLLVKLADRLHNMRTLGVMREDKRLRIAEETMDIYAPLAGRMGMQDMREELEELAFRYINPDAWRAVTDRLAELLEKNRGLLQKIETDLSEIFEKNGIKASVKSRQKKPWSVFRKMETKGLSFEQLSDIFGFRVMVDTVQDCYRALGLIHTTWSMVPGRFKDYISTPKQNDYRSIHTTIIGPSRQRIELQIRTREMDEIAEFGVAAHSIYKDRGSANNPHKISTETNAYAWLRQTIEQLSEGDNPEEFLEHTKLELFQDQVFCFTPKGRLIALPRGATPIDFAYAVHTDIGDSCVGAKVNGRIMPLMTELKNGDEVDIIRSKAQVPPAAWESLVATGKARAAIRRATRSAVRKQYSGLGMRILERAFERAGKPFSKDILKPGLPRLARKDVEDVLAAVGRGELPSTDVVKAVYPDYQDTRVTTQNNPAKAGEKGWFNIQNAAGMIFKVPEGGEGAAAKVDPAATTPKPGKRALPIRGTNPDLPVRFAPEGAVPGDRIVGILQPGAGITIYPIQSPALTAYDDQPERWIDVRWDIDDQMSERFPARISVSAINSPGSLAEIAQIAAANDANIHNLSMVRTAPDFTEMIIDVEVWDLKHLNRIISQLKESASVSSAKRVNG
>NC_015857.1|WP_002963797.1|669188_669767_+|orotate-phosphoribosyltransferase
MNTDDVLAVFREAGAILEGHFILTSGLRSPVFLQKARVFMHADKTEKLCKALAEKIRAADLGPIDYVVGPAIGGLIPSYETSRHLGVPSVWVERENGVFRLRRFDVPKGARVVIVEDIVTTGLSIRETIDCMKDLGIEVVAAACIVDRSAGKADVGTRLISLAEYEVPAYPADKLPPELAAIPAVKPGSRNI
>NC_015857.1|WP_006160814.1|669926_670682_+|helix-turn-helix-domain-containing-protein
MVVVPFALDQNQKLAARTPCNVCEDCCVRSMAVCSALDDGDLAALEAIMTSKKLDTNEMLVEEGEPKLRVYSLTSGMLRIYTSLPDGRRQIAGFLFPGDFLGLADDEVYSQSAEAVVPSALCAFSAKEMERLMERFPKLKERLYQMTRLALRTARDNQLVLGRLAPVEKLASFLLVLSARAEKRGEKPNPVHLLINRTDIADYLGLTIETVSRSFTKLKTQGLIQLCDANTVEILSRRSLAVVAGLDPDNL
>NC_015857.1|WP_002967519.1|672579_673791_-|MFS-transporter
MSVSAAQQPSNSSADNTVLTIILATSLGHFLNDMMQSLLPAIYPMLKENYSLSFWQIGLLTFTFQMTASILQPLVGIYTDRKPMPYSLTFGMGCTLIGLVFLATAHHYSFLLLGAACVGFGSSVFHPEAARVARLASGGRHGFAQSLFQVGGNFGSSIGPLLAAFIVLPFGQISVSWFSVAALIGMFVLWYVGNWYNRYRLANASKPKPDKTLPLPRNRVIASVAVLALLVFTKYIYMASLTSYYTFYTISHFGVSVQTSQLLLFLFLGAVAAGTIIGGPIGDKIGARKVIWASILGVLPFTLALPYANLEMTAVLTIIIGLILASAFPAIIVFAQELLPGRVGMVSGLFFGFAFGMAGIAAAVLGIVADQKGIEFVYRICSYLPFLGLLTIFLPKLERRRKA
>NC_015857.1|WP_002971501.1|674042_674882_+|helix-turn-helix-transcriptional-regulator
MPENEDLQRFHEHRIAMLESMTGPAIALPTRYPDGYFVPRHSHSRAQLLCASQGVVLVTTDAGRWMIPSDHAMWIPAGVEHSVAILGDVFMRSIYISVDAISGVPNYLHVVGLTDLMRCLIIDATSHDSIPAPESRDGLVIELILRDLHTLPEYPLGLPFPSDPRLQKLCRDFVKKPSSRATIDEWADRMAMSRRSFTRHFQRETGVSLSVWRQQACLFAAVPRLSEGEPVTSVALDLGYDSVSAFTTMFRRMLGVPPKFYQPRLDVAPFERSDKAAFG
>NC_015857.1|WP_002966733.1|674931_675507_+|DUF2062-domain-containing-protein
MLFQRRYPPTRWERLRLYLWPRRSFSRSFRYGGKRILRITASPHAVAAGLAVGVFSAFTPFFGFHLIIAIVLAYFLAGNVAAAALGTTLANPLTLPFIWGSTFELGRFIMSGSVDSVPPVHLGHALETMRFEEVWTPLLKPMLFGSTILGAAFAVLVYFVTRYAVSVFRRRRLERLAEKHRLHRQRELQKA
>NC_015857.1|WP_002963803.1|675503_675908_+|holo-ACP-synthase
MIVGIGSDLIDIRRVEKTLERHGSRFRDRVFTEIEQRKSEGRKQRAASYAKRFAAKEACAKALGTGIAEGVFWRDMGVVNTPSGKPTMHLTGGAAKQLQKLLPAGTNAAIHLTITDDFPLAQAFVIIEALPVLE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_015857_1	1.1\|664517\|27\|NC_015857\|CRISPRCasFinder	664517-664543	27	NZ_CP013986	Klebsiella variicola strain LMG 23571 plasmid unnamed, complete sequence	45587-45613	5	0.815

1. spacer 1.1|664517|27|NC_015857|CRISPRCasFinder matches to NZ_CP013986 (Klebsiella variicola strain LMG 23571 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.815

ataagatgcgcgcaaggaaagatctgt	CRISPR spacer
aacagatgctctcaaggaaagatctga	Protospacer
*  ****** * **************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

484694 : 610280

115

Paenibacillus_phage(17.86%)

protease,capsid,tail,head,transposase,portal,holin

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006160718.1\|484694_486107_-\|protease	metalloprotease TldD	NA	NA	NA	NA
WP_002963624.1\|486248_486875_-	invasion associated locus B family protein	NA	NA	NA	NA
WP_005969785.1\|487308_488163_+	cytochrome c oxidase subunit II	NA	NA	NA	NA
WP_006179067.1\|488300_489959_+	cytochrome c oxidase subunit I	R9VX24	Flavobacterium_phage	3.2e-09	36.3
WP_004683131.1\|491132_491318_+	hypothetical protein	NA	NA	NA	NA
WP_006179070.1\|491337_491943_+	cytochrome c oxidase assembly protein	NA	NA	NA	NA
WP_002963630.1\|492151_493030_+	cytochrome c oxidase subunit 3	NA	NA	NA	NA
WP_004688061.1\|493143_493527_+	DUF983 domain-containing protein	NA	NA	NA	NA
WP_004683138.1\|493523_494273_+	SURF1 family protein	NA	NA	NA	NA
WP_002963633.1\|494381_495422_+	4-hydroxy-3-methylbut-2-enyl diphosphate reductase	NA	NA	NA	NA
WP_004690619.1\|495427_496408_+	homoserine kinase	NA	NA	NA	NA
WP_002963635.1\|496404_496869_+	ribonuclease HI	J9Q745	Salmonella_phage	1.7e-40	53.6
WP_002963636.1\|496898_497384_-	peroxiredoxin	M1I839	Pelagibacter_phage	3.0e-24	46.8
WP_002963637.1\|497563_498364_-	hypothetical protein	NA	NA	NA	NA
WP_004683145.1\|498498_499101_+	YqgE/AlgH family protein	NA	NA	NA	NA
WP_006160720.1\|499198_502093_-	sensor domain-containing phosphodiesterase	NA	NA	NA	NA
WP_002963640.1\|502089_502710_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_006179071.1\|502880_504173_-	insulinase family protein	A0A2K9L1M6	Tupanvirus	3.8e-34	28.4
WP_006160724.1\|504226_505618_-	threonine synthase	NA	NA	NA	NA
WP_004688070.1\|506039_506618_+	hypothetical protein	NA	NA	NA	NA
WP_004691963.1\|506931_508566_+	EAL domain-containing protein	NA	NA	NA	NA
WP_002963647.1\|508694_508880_+	hypothetical protein	NA	NA	NA	NA
WP_004689516.1\|511882_513016_+	site-specific DNA-methyltransferase	A0A249XUJ2	Enterococcus_phage	4.7e-28	30.4
WP_002963651.1\|513098_513716_-	HAD family phosphatase	NA	NA	NA	NA
WP_004683167.1\|513712_514789_-	A/G-specific adenine glycosylase	NA	NA	NA	NA
WP_002971552.1\|514754_514901_-	hypothetical protein	NA	NA	NA	NA
WP_004689517.1\|515062_515590_+	DUF721 domain-containing protein	NA	NA	NA	NA
WP_002971551.1\|515827_516481_+	DsbA family protein	NA	NA	NA	NA
WP_004688076.1\|516559_520018_+	chromosome segregation protein SMC	NA	NA	NA	NA
WP_006160731.1\|520040_520934_+	cation transporter	NA	NA	NA	NA
WP_002967466.1\|521043_521385_-	glyoxalase	NA	NA	NA	NA
WP_006072289.1\|521648_524312_+	pyruvate, phosphate dikinase	A0A2D2W2B1	Stenotrophomonas_phage	3.1e-91	41.7
WP_006172905.1\|524544_525363_+	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_004683182.1\|525586_525991_-	hypothetical protein	NA	NA	NA	NA
WP_002963662.1\|526344_527133_+	DUF1499 domain-containing protein	NA	NA	NA	NA
WP_006160736.1\|527133_528039_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_002967469.1\|528239_528839_+	biotin transporter BioY	NA	NA	NA	NA
WP_004688080.1\|528992_529502_+	ureidoglycolate lyase	NA	NA	NA	NA
WP_002966708.1\|529513_529870_+	hydroxyisourate hydrolase	NA	NA	NA	NA
WP_002963667.1\|529940_530777_+	DUF2793 domain-containing protein	A0A0B5A0F6	Paracoccus_phage	1.5e-39	45.2
WP_004691955.1\|531313_533182_+	polysaccharide biosynthesis protein	A0A1V0SAI8	Catovirus	4.2e-18	28.4
WP_002963669.1\|533168_534176_-	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_129171622.1\|534057_534330_+	hypothetical protein	NA	NA	NA	NA
WP_077281772.1\|536264_536615_+\|transposase	transposase	NA	NA	NA	NA
WP_134790775.1\|536641_537399_-\|transposase	IS5 family transposase	A0A0N9SJT9	Paenibacillus_phage	6.1e-16	40.2
WP_002963675.1\|538886_539666_-	LPS biosynthesis N-formyltransferase WbkC	E3SNR5	Prochlorococcus_phage	3.3e-09	31.4
WP_004688086.1\|539692_540547_-	hypothetical protein	NA	NA	NA	NA
WP_002963677.1\|540543_541302_-	ABC transporter ATP-binding protein	NA	NA	NA	NA
WP_006160746.1\|541298_542081_-	ABC transporter permease	NA	NA	NA	NA
WP_006179594.1\|542095_543199_-	DegT/DnrJ/EryC1/StrS aminotransferase family protein	A0A2K9L470	Tupanvirus	2.0e-44	31.9
WP_002963680.1\|543206_544295_-	GDP-mannose 4,6-dehydratase	M1IBC3	Acanthocystis_turfacea_Chlorella_virus	3.4e-137	68.4
WP_029097245.1\|545420_546359_+\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_134790775.1\|546428_547185_+\|transposase	IS5 family transposase	A0A0N9SJT9	Paenibacillus_phage	6.1e-16	40.2
WP_002963682.1\|547556_548675_+	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_077281774.1\|549432_549585_-	hypothetical protein	NA	NA	NA	NA
WP_005969645.1\|549627_550182_-\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	3.9e-12	33.9
WP_148260384.1\|550345_551108_+\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	1.3e-21	40.8
WP_002975117.1\|551005_551323_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_134790775.1\|552793_553551_-\|transposase	IS5 family transposase	A0A0N9SJT9	Paenibacillus_phage	6.1e-16	40.2
WP_006641438.1\|554205_555630_+	mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase	A0A1V0SH58	Hokovirus	1.2e-52	30.8
WP_002963690.1\|555662_556835_+	AGE family epimerase/isomerase	NA	NA	NA	NA
WP_002969456.1\|556917_558027_+	glycosyltransferase	NA	NA	NA	NA
WP_109790518.1\|558375_558579_+	hypothetical protein	NA	NA	NA	NA
WP_002967480.1\|560273_561275_+	ABC transporter permease	NA	NA	NA	NA
WP_006179954.1\|561353_562316_+	substrate-binding domain-containing protein	NA	NA	NA	NA
WP_004688100.1\|562373_563426_+	sugar phosphate isomerase/epimerase	NA	NA	NA	NA
WP_004683244.1\|563433_564606_+	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_002966715.1\|564647_565955_-	xylose isomerase	NA	NA	NA	NA
WP_004688103.1\|566001_567453_-	xylulokinase	NA	NA	NA	NA
WP_004688104.1\|567485_568517_-	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_016769451.1\|568778_569819_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002963701.1\|570386_571850_-	betaine-aldehyde dehydrogenase	NA	NA	NA	NA
WP_004689534.1\|572035_573685_-\|holin	choline dehydrogenase	A0A1V0S9M4	Catovirus	5.0e-63	32.3
WP_004688107.1\|573687_574284_-	transcriptional regulator BetI	NA	NA	NA	NA
WP_002963705.1\|574474_575497_+	asparaginase	NA	NA	NA	NA
WP_002967489.1\|575541_576012_+	GreA/GreB family elongation factor	NA	NA	NA	NA
WP_002963707.1\|576008_576398_-	type II toxin-antitoxin system death-on-curing family toxin	A0A1B3AYM0	Gordonia_phage	3.5e-07	44.6
WP_002963708.1\|576394_576625_-	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
WP_002963710.1\|577832_578510_+	FadR family transcriptional regulator	NA	NA	NA	NA
WP_006160766.1\|578506_579817_+	CynX/NimT family MFS transporter	NA	NA	NA	NA
WP_002963712.1\|579873_580236_-	hypothetical protein	NA	NA	NA	NA
WP_002963713.1\|581417_582929_+	DUF853 domain-containing protein	A0A248XCZ8	Klebsiella_phage	1.4e-83	44.3
WP_002963714.1\|583134_583851_-	L,D-transpeptidase	NA	NA	NA	NA
WP_006179998.1\|583909_584152_+	hypothetical protein	NA	NA	NA	NA
WP_002963715.1\|584153_584807_-	haloacid dehalogenase type II	NA	NA	NA	NA
WP_004689540.1\|585029_585629_+	superoxide dismutase	Q56AR7	Bacillus_thuringiensis_phage	6.9e-39	42.6
WP_002963717.1\|585800_586136_-	hypothetical protein	NA	NA	NA	NA
WP_002967492.1\|586253_588362_-	S9 family peptidase	NA	NA	NA	NA
WP_004688116.1\|588934_589363_+	MucR family transcriptional regulator	A0A1P8VVG0	Erythrobacter_phage	1.0e-20	47.6
WP_002969861.1\|589570_589882_-	hypothetical protein	NA	NA	NA	NA
WP_004683273.1\|590063_590519_+	hypothetical protein	NA	NA	NA	NA
WP_006180004.1\|590515_590656_+	hypothetical protein	NA	NA	NA	NA
WP_006641442.1\|590656_591289_+	hypothetical protein	NA	NA	NA	NA
WP_002967494.1\|591401_592739_+	amidase	NA	NA	NA	NA
WP_002963725.1\|592779_593205_-	SufE family protein	NA	NA	NA	NA
WP_004683280.1\|593284_593749_-	hypothetical protein	NA	NA	NA	NA
WP_004691943.1\|594039_595869_+	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	7.3e-23	29.3
WP_002971535.1\|595843_596812_+	peptidoglycan-binding protein	NA	NA	NA	NA
WP_002963729.1\|596825_597173_+	DUF1491 family protein	NA	NA	NA	NA
WP_006160775.1\|597183_598260_-	DUF2336 domain-containing protein	NA	NA	NA	NA
WP_134790775.1\|598474_599232_-\|transposase	IS5 family transposase	A0A0N9SJT9	Paenibacillus_phage	6.1e-16	40.2
WP_002963731.1\|599301_599844_-	hypothetical protein	NA	NA	NA	NA
WP_002963732.1\|599836_600448_-	DUF1214 domain-containing protein	NA	NA	NA	NA
WP_002969866.1\|600454_602629_-	penicillin-binding protein 1A	NA	NA	NA	NA
WP_002963734.1\|602968_603481_+	hypothetical protein	NA	NA	NA	NA
WP_006176495.1\|603419_604679_+	DNA-packaging protein	A0A1V0DY66	Dinoroseobacter_phage	3.4e-72	40.6
WP_006160779.1\|604710_605904_+\|portal	phage portal protein	W8ECU7	Geobacillus_phage	9.1e-67	40.0
WP_002967499.1\|605900_606278_+	hypothetical protein	NA	NA	NA	NA
WP_002963738.1\|606264_606933_+\|head,protease	HK97 family phage prohead protease	A0A2H4JAI0	uncultured_Caudovirales_phage	1.7e-30	41.1
WP_006185934.1\|606954_608229_+\|capsid	phage major capsid protein	Q8HAD2	Salmonella_phage	1.1e-81	43.1
WP_002963740.1\|608393_608960_+\|head,tail	phage head-tail connector protein	NA	NA	NA	NA
WP_004688127.1\|608956_609295_+\|head	phage head closure protein	NA	NA	NA	NA
WP_004688128.1\|609291_609459_+	hypothetical protein	NA	NA	NA	NA
WP_006072374.1\|609418_609826_+	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_002963743.1\|609866_610280_+\|tail	phage major tail protein, TP901-1 family	NA	NA	NA	NA

DBSCAN-SWA_2

881818 : 894524

uncultured_Mediterranean_phage(80.0%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002968731.1\|881818_882670_+	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	4.4e-31	33.5
WP_002964011.1\|882662_883388_+	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	1.5e-43	45.7
WP_002964012.1\|883533_883752_+	twin-arginine translocase TatA/TatE family subunit	A0A1B1IVR9	uncultured_Mediterranean_phage	1.5e-07	65.1
WP_004686803.1\|883862_884444_+	twin-arginine translocase subunit TatB	NA	NA	NA	NA
WP_002964014.1\|884440_885265_+	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	9.8e-44	41.1
WP_002964015.1\|885341_886625_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	1.2e-104	47.2
WP_004683704.1\|887472_888141_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	6.6e-14	38.5
WP_134790775.1\|888255_889013_-\|transposase	IS5 family transposase	A0A0N9SJT9	Paenibacillus_phage	6.1e-16	40.2
WP_002964018.1\|889129_889315_+	hypothetical protein	NA	NA	NA	NA
WP_002964019.1\|889363_890662_+	peptidoglycan DD-metalloendopeptidase family protein	Q8SBN9	Clostridium_phage	1.0e-18	41.1
WP_002964020.1\|890710_891577_-	ATP-binding protein	NA	NA	NA	NA
WP_006161065.1\|891736_892078_+	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	9.1e-12	40.2
WP_006642797.1\|892196_894524_+	protein translocase subunit SecDF	A0A1B1IVP7	uncultured_Mediterranean_phage	6.2e-51	43.5

DBSCAN-SWA_3

965252 : 973603

Brucella_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006072696.1\|965252_965972_+	hypothetical protein	A0A076GD06	Sinorhizobium_phage	4.6e-05	46.8
WP_002964091.1\|965968_966199_+	hypothetical protein	NA	NA	NA	NA
WP_002964092.1\|966195_966471_+	hypothetical protein	NA	NA	NA	NA
WP_004683738.1\|966493_967081_+	hypothetical protein	NA	NA	NA	NA
WP_002964095.1\|968372_968543_-	DUF1508 domain-containing protein	A0A2P1N580	Mycobacterium_phage	3.1e-05	45.1
WP_002969999.1\|968541_968775_+	hypothetical protein	NA	NA	NA	NA
WP_006161014.1\|968890_969205_-	BrnA antitoxin family protein	K4NZP3	Burkholderia_phage	3.4e-05	42.1
WP_004688321.1\|969204_969450_-	BrnT family toxin	NA	NA	NA	NA
WP_134790775.1\|970290_971047_+\|transposase	IS5 family transposase	A0A0N9SJT9	Paenibacillus_phage	6.1e-16	40.2
WP_002967634.1\|971048_971822_+	hypothetical protein	A0A141GEY5	Brucella_phage	1.3e-122	97.8
WP_004689673.1\|971956_973603_+	hypothetical protein	A0A141GEY6	Brucella_phage	1.3e-175	62.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NC_015858

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

498555 : 636423

111

Planktothrix_phage(22.22%)

tRNA,holin,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_134790775.1\|498555_499313_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_002966098.1\|499544_500183_-	DNA oxidative demethylase AlkB	NA	NA	NA	NA
WP_002966097.1\|500264_501875_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.5e-19	33.5
WP_004688985.1\|501876_503010_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_002966095.1\|503002_503926_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_006162038.1\|504140_505718_-	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_004690193.1\|505827_507405_-	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_134790775.1\|507805_508562_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_002966091.1\|508675_509023_-	RcnB family protein	NA	NA	NA	NA
WP_002966088.1\|509817_510831_+	SDR family oxidoreductase	A0A2K9KZK0	Tupanvirus	2.7e-83	47.8
WP_002966087.1\|510830_511817_+	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	9.6e-46	36.1
WP_006162033.1\|511813_513658_+	glycosyltransferase	M1I7Q5	Paramecium_bursaria_Chlorella_virus	5.5e-71	39.8
WP_006179154.1\|513672_515097_+	UDP-glucose/GDP-mannose dehydrogenase family protein	A0A127AXI2	Bacillus_phage	6.6e-80	38.5
WP_002966084.1\|515086_515632_+	DUF995 domain-containing protein	NA	NA	NA	NA
WP_004692280.1\|515681_516626_+	glycoside hydrolase family 26 protein	NA	NA	NA	NA
WP_002972060.1\|516742_517240_+	DUF995 domain-containing protein	NA	NA	NA	NA
WP_004688990.1\|517356_517683_-	hypothetical protein	NA	NA	NA	NA
WP_134790775.1\|519312_520070_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_006093842.1\|520723_520972_+	WGR domain-containing protein	NA	NA	NA	NA
WP_006186855.1\|521301_522126_-	DNA cytosine methyltransferase	A0A1B1IR13	uncultured_Mediterranean_phage	2.0e-12	40.5
WP_139027748.1\|522135_522228_-	DNA cytosine methyltransferase	NA	NA	NA	NA
WP_006015837.1\|523113_523503_-	hypothetical protein	NA	NA	NA	NA
WP_006186854.1\|524132_525095_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_134790775.1\|527164_527921_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_006187730.1\|530208_531564_+	hypothetical protein	NA	NA	NA	NA
WP_006093827.1\|531599_532976_+	aspartate aminotransferase family protein	NA	NA	NA	NA
WP_006187738.1\|536812_537994_-	beta-ketothiolase BktB	NA	NA	NA	NA
WP_025199947.1\|538005_538935_-	electron transfer flavoprotein subunit alpha/FixB family protein	NA	NA	NA	NA
WP_004684482.1\|539087_539834_-	electron transfer flavoprotein subunit beta/FixA family protein	NA	NA	NA	NA
WP_006188563.1\|539962_541153_-	3-hydroxyacyl-CoA dehydrogenase family protein	NA	NA	NA	NA
WP_006188561.1\|541162_542737_-	acetolactate synthase large subunit	NA	NA	NA	NA
WP_006188559.1\|542804_544952_-	acetate--CoA ligase family protein	NA	NA	NA	NA
WP_006188557.1\|544995_545691_-	TetR family transcriptional regulator	NA	NA	NA	NA
WP_006188555.1\|545732_546890_-	acyl-CoA/acyl-ACP dehydrogenase	NA	NA	NA	NA
WP_006188552.1\|546902_547682_-	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_006188551.1\|547744_548566_-	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_006188550.1\|548567_549374_-	ABC transporter permease	NA	NA	NA	NA
WP_006188549.1\|549382_550312_-	ABC transporter permease	NA	NA	NA	NA
WP_006188548.1\|550311_551409_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.3e-23	34.1
WP_006188545.1\|551530_552562_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_006188543.1\|552666_553641_-	nitronate monooxygenase	NA	NA	NA	NA
WP_006188540.1\|554080_554746_+	DMT family transporter	NA	NA	NA	NA
WP_148260388.1\|554685_555006_+	DMT family transporter	NA	NA	NA	NA
WP_006188536.1\|554974_555760_+	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_006188534.1\|555839_557294_+	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_006641563.1\|557712_559392_+	deoxycytidylate deaminase	A0A0A0RR52	Acinetobacter_phage	7.9e-08	48.3
WP_006188530.1\|559807_560149_-	hypothetical protein	NA	NA	NA	NA
WP_087923330.1\|561001_561764_+\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	3.4e-22	40.8
WP_006189420.1\|562333_563611_-	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_006189421.1\|563860_565171_-	SEC-C domain-containing protein	NA	NA	NA	NA
WP_006641570.1\|566583_567159_+	hypothetical protein	NA	NA	NA	NA
WP_044556607.1\|567383_568460_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_006189470.1\|568583_569699_+\|transposase	transposase	NA	NA	NA	NA
WP_006165144.1\|569705_570062_-	hypothetical protein	NA	NA	NA	NA
WP_006015924.1\|570394_570826_-	hypothetical protein	NA	NA	NA	NA
WP_006015926.1\|570827_571091_-	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_006641515.1\|572332_572632_-\|transposase	transposase	NA	NA	NA	NA
WP_006189472.1\|573439_574426_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.1e-20	30.0
WP_006015932.1\|574418_575399_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	8.4e-10	29.2
WP_006015934.1\|575395_576217_-	ABC transporter permease	NA	NA	NA	NA
WP_006165153.1\|576221_577157_-	ABC transporter permease	NA	NA	NA	NA
WP_006015938.1\|577250_578846_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_006189473.1\|578988_580620_-	amidohydrolase	NA	NA	NA	NA
WP_006165158.1\|581790_582336_-	YbjN domain-containing protein	NA	NA	NA	NA
WP_006165159.1\|582332_582995_-	peptidoglycan-binding protein	NA	NA	NA	NA
WP_006015952.1\|583118_583850_-	hypothetical protein	NA	NA	NA	NA
WP_006189474.1\|583925_585002_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_006189475.1\|584990_586655_-	hypothetical protein	NA	NA	NA	NA
WP_148260386.1\|586701_587459_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_014008518.1\|587493_589458_-	hemagglutinin	NA	NA	NA	NA
WP_002966079.1\|590033_590639_-	YecA family protein	NA	NA	NA	NA
WP_004688994.1\|590635_592207_-\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	2.3e-73	35.6
WP_002966077.1\|592256_592610_-	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	3.9e-18	42.1
WP_002968421.1\|592606_593074_-	IS66 family insertion sequence hypothetical protein	A0A1B0YZU7	Pseudomonas_phage	5.1e-05	47.9
WP_025198282.1\|593612_593936_-	hypothetical protein	NA	NA	NA	NA
WP_002972070.1\|594281_594689_+	hypothetical protein	NA	NA	NA	NA
WP_002966074.1\|595161_595620_+	YbaK/EbsC family protein	NA	NA	NA	NA
WP_004681881.1\|595865_596327_+	iron-responsive transcriptional regulator RirA	NA	NA	NA	NA
WP_002966072.1\|596443_596758_+	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
WP_002966070.1\|597214_597526_+	(2Fe-2S)-binding protein	NA	NA	NA	NA
WP_002968422.1\|597491_597977_+	bacterioferritin	NA	NA	NA	NA
WP_002966068.1\|598140_599454_+	30S ribosomal protein S12 methylthiotransferase RimO	NA	NA	NA	NA
WP_004688996.1\|599593_600661_-	BMP family ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_004681885.1\|600743_601664_-	ABC transporter permease	NA	NA	NA	NA
WP_002971245.1\|601668_602751_-	ABC transporter permease	NA	NA	NA	NA
WP_006162015.1\|602750_604313_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.5e-11	27.3
WP_004689000.1\|604416_605391_-	quinone oxidoreductase	NA	NA	NA	NA
WP_004686877.1\|605387_606218_-\|holin	phosphatidylcholine/phosphatidylserine synthase	NA	NA	NA	NA
WP_002969339.1\|606517_607762_+	UbiH/UbiF family hydroxylase	NA	NA	NA	NA
WP_004689002.1\|607834_608173_+	heat shock protein HspQ	NA	NA	NA	NA
WP_002971243.1\|608305_608923_-	invasion associated locus B family protein	NA	NA	NA	NA
WP_002968428.1\|609267_611115_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_004681889.1\|611293_611968_+	DsbA family protein	NA	NA	NA	NA
WP_004687281.1\|612143_612563_-	FosX/FosE/FosI family fosfomycin resistance thiol transferase	NA	NA	NA	NA
WP_006161995.1\|612634_616147_-	transcription-repair coupling factor	NA	NA	NA	NA
WP_002966054.1\|616157_616445_-	succinate dehydrogenase assembly factor 2	NA	NA	NA	NA
WP_006171287.1\|616583_618704_+	ATP-dependent DNA helicase RecG	NA	NA	NA	NA
WP_006161992.1\|618858_620682_-	glutamine--fructose-6-phosphate transaminase (isomerizing)	A7IW18	Paramecium_bursaria_Chlorella_virus	8.6e-109	39.6
WP_004689006.1\|620785_622150_-	bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU	A0A0N7G7I9	Chrysochromulina_ericina_virus	1.7e-24	30.0
WP_002966050.1\|622231_622978_-	cytochrome c biogenesis protein CcdA	NA	NA	NA	NA
WP_004689007.1\|623165_625784_+	bifunctional lysylphosphatidylglycerol flippase/synthetase MprF	NA	NA	NA	NA
WP_006161990.1\|625780_627193_+	virulence factor family protein	NA	NA	NA	NA
WP_004687275.1\|627696_628197_-	BA14K family protein	NA	NA	NA	NA
WP_002971240.1\|628436_629906_+	PAS domain-containing protein	NA	NA	NA	NA
WP_006076582.1\|630078_630837_+	lipoyl(octanoyl) transferase LipB	NA	NA	NA	NA
WP_004687273.1\|630840_631770_-	EamA family transporter	NA	NA	NA	NA
WP_006178955.1\|632074_634174_+	DNA topoisomerase IV subunit B	G3M9Z3	Bacillus_virus	2.9e-108	38.7
WP_002966041.1\|634179_634362_-	hypothetical protein	NA	NA	NA	NA
WP_002966040.1\|634346_634571_-	hypothetical protein	NA	NA	NA	NA
WP_004689008.1\|634595_636077_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA	NA	NA	NA	NA
WP_002966038.1\|636135_636423_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_015857

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NC_015858

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection