CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number
NC_015917	Borreliella bissettii DN127 plasmid lp28-4, complete sequence	0 crisprs	NA	0	0	0
NC_015907	Borreliella bissettii DN127 plasmid cp26, complete sequence	0 crisprs	NA	0	0	0
NC_015921	Borreliella bissettii DN127, complete sequence	0 crisprs	NA	0	0	1
NC_015904	Borreliella bissettii DN127 plasmid cp32-4, complete sequence	0 crisprs	NA	0	0	0
NC_015915	Borreliella bissettii DN127 plasmid lp17, complete sequence	0 crisprs	NA	0	0	0
NC_015916	Borreliella bissettii DN127 plasmid lp28-3, complete sequence	0 crisprs	NA	0	0	0
NC_015919	Borreliella bissettii DN127 plasmid lp54, complete sequence	0 crisprs	NA	0	0	0
NC_015909	Borreliella bissettii DN127 plasmid cp32-5, complete sequence	1 crisprs	NA	3	3	0
NC_015918	Borreliella bissettii DN127 plasmid lp28-7, complete sequence	0 crisprs	NA	0	0	0
NC_015906	Borreliella bissettii DN127 plasmid cp32-quad, complete sequence	0 crisprs	NA	0	0	0
NC_015903	Borreliella bissettii DN127 plasmid cp32-11, complete sequence	0 crisprs	NA	0	0	0
NC_015922	Borreliella bissettii DN127 plasmid lp25, complete sequence	0 crisprs	NA	0	0	0
NC_015920	Borreliella bissettii DN127 plasmid lp56, complete sequence	0 crisprs	NA	0	0	0
NC_015910	Borreliella bissettii DN127 plasmid cp32-7, complete sequence	0 crisprs	NA	0	0	0
NC_015905	Borreliella bissettii DN127 plasmid cp32-6, complete sequence	0 crisprs	NA	0	0	0
NC_015908	Borreliella bissettii DN127 plasmid cp32-3, complete sequence	0 crisprs	NA	0	0	0
NC_015911	Borreliella bissettii DN127 plasmid cp9, complete sequence	0 crisprs	NA	0	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

445793 : 455219

Streptococcus_phage(28.57%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014023660.1\|445793_446468_-	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	6.1e-36	41.3
WP_014023661.1\|446674_446992_+	hypothetical protein	NA	NA	NA	NA
WP_014023662.1\|447021_447411_-	DUF1893 domain-containing protein	NA	NA	NA	NA
WP_014023663.1\|447524_448130_+	YigZ family protein	A0A1X9I5T8	Streptococcus_phage	3.7e-16	29.9
WP_014023664.1\|448239_448992_+	ParA family protein	H7BUL8	unidentified_phage	2.5e-17	27.9
WP_014023665.1\|448994_449708_+	hypothetical protein	A0A1P8CWU6	Bacillus_phage	3.6e-26	42.2
WP_044054957.1\|449971_450754_-	ParB/RepB/Spo0J family partition protein	I3NLC2	Bifidobacterium_phage	5.0e-13	30.7
WP_014023667.1\|450870_453303_-	DNA topoisomerase (ATP-hydrolyzing) subunit A	G3M9Z5	Bacillus_virus	3.8e-104	31.9
WP_014023668.1\|453314_455219_-	DNA topoisomerase (ATP-hydrolyzing) subunit B	G3M9Z3	Bacillus_virus	4.9e-131	43.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NC_015904

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NC_015909

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_015909_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_015909_1

22160-22360

Orphan

Consensus_repeat	Method
ATACCAAGATAGATAATGTAGAAAAAA	CRISPRCasFinder

3 spacers

The CRISPR arrays of NC_015909_1

>merge|NC_015909|1|22160-22360|CRISPRCasFinder
ATACCAAGATAGATAATGTAGAAAAAAGTTTAAATGCTAAAATAGATAGTTTAGATACCAAAATAGATAATGTAGAAAAAACTTTGCAAAAAGATATATCCAGTTTAGATACTAAAATAGATAGTGTAAAAAACGAACTTAATTCTAAAATAGATAGTGTAAAAAACGAACTTAATTCTAAAATAGATAGCGTAAAAAACG

>NC_015909|1|1|22160-22360|CRISPRCasFinder
ATACCAAGATAGATAATGTAGAAAAAA	GTTTAAATGCTAAAATAGATAGTTTAG
ATACCAAAATAGATAATGTAGAAAAAA	CTTTGCAAAAAGATATATCCAGTTTAG
ATACTAAAATAGATAGTGTAAAAAACG	AACTTAATTCTAAAATAGATAGTGTAAAAAACGAACTTA
ATTCTAAAATAGATAGCGTAAAAAACG

Protein	Signature genes	Signature genes Name	Protein_function
NC_015909.1\|WP_014017724.1\|26026_27127_+\|Erp-family-protein	unknown	unknown	gnl\|CDD\|311003
NC_015909.1\|WP_014017717.1\|18936_20010_+\|partition-protein	unknown	unknown	gnl\|CDD\|367076
NC_015909.1\|WP_014017711.1\|15384_15732_+\|holin,-BlyB-family	unknown	unknown	gnl\|CDD\|368373
NC_015909.1\|WP_014017461.1\|15721_16057_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|368373
NC_015909.1\|WP_014017721.1\|23013_24336_+\|DUF244-domain-containing-protein	unknown	unknown	gnl\|CDD\|281152
NC_015909.1\|WP_014017712.1\|16049_16403_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|308571
NC_015909.1\|WP_014017701.1\|28583_29936_+\|PBSX-family-phage-terminase-large-subunit	unknown	unknown	gnl\|CDD\|273684
NC_015909.1\|WP_014017719.1\|21395_21920_+\|chromosome-replication/partitioning-protein	unknown	unknown	gnl\|CDD\|376591
NC_015909.1\|WP_010257938.1\|20020_20587_+\|DUF226-domain-containing-protein	unknown	unknown	gnl\|CDD\|308504
NC_015909.1\|WP_014017725.1\|27311_27839_+\|DUF643-domain-containing-protein	unknown	unknown	gnl\|CDD\|282691
NC_015909.1\|WP_014017726.1\|28020_28587_+\|DUF603-domain-containing-protein	unknown	unknown	gnl\|CDD\|282496
NC_015909.1\|WP_014017723.1\|24818_25595_-\|site-specific-integrase	unknown	unknown	gnl\|CDD\|271175
NC_015909.1\|WP_014017718.1\|20562_21336_+\|ParA-family-protein	unknown	unknown	gnl\|CDD\|224113
NC_015909.1\|WP_014017713.1\|16507_16954_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|371241
NC_015909.1\|WP_014017714.1\|17059_17506_+\|Mlp-family-lipoprotein	unknown	unknown	gnl\|CDD\|308750
NC_015909.1\|WP_014017722.1\|24387_24813_+\|DUF261-domain-containing-protein	unknown	unknown	gnl\|CDD\|281224
NC_015909.1\|WP_014017715.1\|17542_18556_-\|ERF-family-protein	unknown	unknown	gnl\|CDD\|377346

Protein	Function_ID	Function_description	E-value
NC_015909.1\|WP_014017724.1\|26026_27127_+\|Erp-family-protein	gnl\|CDD\|311003	pfam06780, Erp_C, Erp protein C-terminus. This family represents the C-terminus of bacterial Erp proteins that seem to be specific to Borrelia burgdorferi (a causative agent of Lyme disease). Borrelia Erp proteins are particularly heterogeneous, which might enable them to interact with a wide variety of host components.	1.77072e-41
NC_015909.1\|WP_014017717.1\|18936_20010_+\|partition-protein	gnl\|CDD\|367076	pfam02414, Borrelia_orfA, Borrelia ORF-A. This protein is encoded by an open reading frame in plasmid borne DNA repeats of Borrelia species. This protein is known as ORF-A. The function of this putative protein is unknown.	4.67105e-64
NC_015909.1\|WP_014017711.1\|15384_15732_+\|holin,-BlyB-family	gnl\|CDD\|368373	pfam05289, BLYB, Borrelia hemolysin accessory protein. This family consists of several borrelia hemolysin accessory proteins (BLYB). BLYB was thought to be an accessory protein, which was proposed to comprise a hemolysis system but it is now thought that BlyA and BlyB function instead as a prophage-encoded holin or holin-like system.	8.41232e-38
NC_015909.1\|WP_014017461.1\|15721_16057_+\|hypothetical-protein	gnl\|CDD\|368373	pfam05289, BLYB, Borrelia hemolysin accessory protein. This family consists of several borrelia hemolysin accessory proteins (BLYB). BLYB was thought to be an accessory protein, which was proposed to comprise a hemolysis system but it is now thought that BlyA and BlyB function instead as a prophage-encoded holin or holin-like system.	3.45724e-28
NC_015909.1\|WP_014017721.1\|23013_24336_+\|DUF244-domain-containing-protein	gnl\|CDD\|281152	pfam03112, DUF244, Uncharacterized protein family (ORF7) DUF. Several members of this family are Borrelia burgdorferi plasmid proteins of uncharacterized function.	2.69079e-75
NC_015909.1\|WP_014017712.1\|16049_16403_+\|hypothetical-protein	gnl\|CDD\|308571	pfam02999, Borrelia_orfD, Borrelia orf-D family. Borrelia burgdorferi supercoiled plasmids encode multicopy tandem open reading frames called Orf-A, Orf-B, Orf-C and Orf-D. This family corresponds to Orf-D. The putative product of this gene has no known function.	4.5713e-36
NC_015909.1\|WP_014017701.1\|28583_29936_+\|PBSX-family-phage-terminase-large-subunit	gnl\|CDD\|273684	TIGR01547, Uncharacterized_protein_YqaT, phage terminase, large subunit, PBSX family. This model detects members of a highly divergent family of the large subunit of phage terminase. All members are encoded by phage genomes or within prophage regions of bacterial genomes. This is a distinct family from pfam03354. [Mobile and extrachromosomal element functions, Prophage functions].	1.61712e-45
NC_015909.1\|WP_014017719.1\|21395_21920_+\|chromosome-replication/partitioning-protein	gnl\|CDD\|376591	pfam01672, Plasmid_parti, Putative plasmid partition protein. This family consists of conserved hypothetical proteins from Borrelia burgdorferi the lyme disease spirochaete, some of which are putative plasmid partition proteins.	3.51544e-37
NC_015909.1\|WP_010257938.1\|20020_20587_+\|DUF226-domain-containing-protein	gnl\|CDD\|308504	pfam02890, DUF226, Borrelia family of unknown function DUF226. This family of proteins are found in Borrelia. The proteins are about 190 amino acids long and have no known function.	1.55168e-59
NC_015909.1\|WP_014017725.1\|27311_27839_+\|DUF643-domain-containing-protein	gnl\|CDD\|282691	pfam04867, DUF643, Protein of unknown function (DUF643). Protein of unknown function found in Borrelia burgdorferi, the Lyme disease spirochete.	2.39289e-53
NC_015909.1\|WP_014017726.1\|28020_28587_+\|DUF603-domain-containing-protein	gnl\|CDD\|282496	pfam04645, DUF603, Protein of unknown function, DUF603. This family includes several uncharacterized proteins from Borrelia species.	1.08445e-96
NC_015909.1\|WP_014017723.1\|24818_25595_-\|site-specific-integrase	gnl\|CDD\|271175	cd00397, DNA_BRE_C, DNA breaking-rejoining enzymes, C-terminal catalytic domain. The DNA breaking-rejoining enzyme superfamily includes type IB topoisomerases and tyrosine based site-specific recombinases (integrases) that share the same fold in their catalytic domain containing conserved active site residues. The best-studied members of this diverse superfamily include Human topoisomerase I, the bacteriophage lambda integrase, the bacteriophage P1 Cre recombinase, the yeast Flp recombinase, and the bacterial XerD/C recombinases. Their overall reaction mechanism is essentially identical and involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA. The enzymes differ in that topoisomerases cleave and then rejoin the same 5' and 3' termini, whereas a site-specific recombinase transfers a 5' hydroxyl generated by recombinase cleavage to a new 3' phosphate partner located in a different duplex region. Many DNA breaking-rejoining enzymes also have N-terminal domains, which show little sequence or structure similarity.	6.50005e-07
NC_015909.1\|WP_014017718.1\|20562_21336_+\|ParA-family-protein	gnl\|CDD\|224113	COG1192, Soj, ATPases involved in chromosome partitioning [Cell division and chromosome partitioning].	1.72299e-50
NC_015909.1\|WP_014017713.1\|16507_16954_+\|hypothetical-protein	gnl\|CDD\|371241	pfam10779, XhlA, Haemolysin XhlA. XhlA is a cell-surface associated haemolysin that lyses the two most prevalent types of insect immune cells (granulocytes and plasmatocytes) as well as rabbit and horse erythrocytes. This family has had DUF1267, pfam06895, merged into it.	0.00398985
NC_015909.1\|WP_014017714.1\|17059_17506_+\|Mlp-family-lipoprotein	gnl\|CDD\|308750	pfam03304, Mlp, Mlp lipoprotein family. The Mlp (for Multicopy Lipoprotein) family of lipoproteins is found in Borrelia species. This family were previously known as 2.9 lipoprotein genes. These surface expressed genes may represent new candidate vaccinogens for Lyme disease. Members of this family generally are downstream of four ORFs called A,B,C and D that are involved in hemolytic activity.	7.44589e-37
NC_015909.1\|WP_014017722.1\|24387_24813_+\|DUF261-domain-containing-protein	gnl\|CDD\|281224	pfam03196, DUF261, Protein of unknown function, DUF261.	7.46253e-71
NC_015909.1\|WP_014017715.1\|17542_18556_-\|ERF-family-protein	gnl\|CDD\|377346	pfam04404, ERF, ERF superfamily. The DNA single-strand annealing proteins (SSAPs), such as RecT, Red-beta, ERF and Rad52, function in RecA-dependent and RecA-independent DNA recombination pathways. This family includes proteins related to ERF.	2.47798e-34

>NC_015909.1|WP_014017719.1|21395_21920_+|chromosome-replication/partitioning-protein
MNIQLNKRNLSADNDVMVRYKSLKSQLTINVKSEICSRLETMKILKEIKDNEYYKLDGYKSFEDFTKDYKLAKTQAYDYLRIANAIEEGIIEEEFLVQNGFRQTLFVLRNKESVTIKKSKQNWIKPLRFQLKKQESYDFYKKHAKFTSFMMDEIFENQKDFLNKLLKKYKELKG
>NC_015909.1|WP_014017718.1|20562_21336_+|ParA-family-protein
MDNKKPKIITIASLKGGVGKSTTSIILATLLSKSKKILLIDIDTQASITSFYFNNIQNKNVNLENFNIYEILKEGALEIRDVIINIDNNLDLIPSYLSLHKFNQEAIPFKELRLKKKLESIQDNYDYIIIDTPPSLDFALTNALVSSQYVLVPITAEKWAVESLDLLEFYSKKIGTNAPIFVLVTRFKKNNTHKQLLDILQLRDDYLGIISEREDLNRRIAENDKFDLDKDYVCEYKKILECFLNKMQVTPSFGWSI
>NC_015909.1|WP_010257938.1|20020_20587_+|DUF226-domain-containing-protein
MENAPEPIETVKKGKCKVECQNKERFILIEKENGKAMYHTKIMMDIYKFGVYEKKHEFRLSLRALFNGERIVEETHLYPIKEGDKFIGIFYGYRKPIKKPLIKYQINGTRKAYALARAYYMEFRFKAGSVFCYFKGLYRLLDKKRTNNHYNKVLFSMFTDLEQQVYKFYGKKYPEQGPLIKWIIKNLK
>NC_015909.1|WP_014017717.1|18936_20010_+|partition-protein
MKDFPNKTKNPTCHNKHQHKLISLTSTLDFLNKKDKKYTQQNILYYFNENLKRNGLAPTTLRTMQNYLYKLEKVLKVTTNYYQHMGVNCGTEIYYKLKYPKKECYQKINKYFKERKNSRFKSRVNNHFKDNISINGSVNSVECINNKNNQKEKYQLRNYFNNCNFKTEEALSILNLNADKNTKIEAMNILKQNEIALIKKFNIKKSCMKEKQNTLKNILNNTQKEFEQNGYNSEQLKINLQKVYENYKFKPHFIIENHKYSDLNNIKRRLEKSIERKKQNSQQNYQNLKANIFNILIEQLKKETNIEILKPIIKEYLNKQKKIEYNKVFGTYYLELLELIKNEKNSLIVEEFNIKAV
>NC_015909.1|WP_014017715.1|17542_18556_-|ERF-family-protein
MENLSNKNNPQSNIQAKISFRRDMKTLKMNLPGIDKSLKGYGYKYQNFNEIVEEIENVIEKHNLELDFEQYPISKFVDGQKEHVIRTTFYSTSTGYEFSFDTPMLTENLQWNSESGSKNVVNTVPQLVGSAITYFKRYALVACLHIKSEVDTDAAPIYNNHENVNSMPSKQVSVNQKQEQKREQKQEINQIQKNNTIQNQKRDIKQEQKKDRLYYYGVFKEALSNIKDWVNSPTIKDNINSIIQKISFIQNIDPNNFDDIKKIESDLISYFEKNSDFKSVNYWAEIIKNYFKKNNRLKDLQDFEKFMAFKRTAYGPSPLIFFSVLKEYERFDEIFAA
>NC_015909.1|WP_014017714.1|17059_17506_+|Mlp-family-lipoprotein
MKIINILFCLFLLMLNGCNSNDNDTLKNNAQQTKSRGKRDLTQKEATQEKPKSKEELLREKLSDDQKTQLDWLKEALGNDGEFDKFLGYDKDKIKLALDHIKSELDSCTGDKANEQKTTFKTLVKEGIKSGIDNFTSEIDSTCGTDNS
>NC_015909.1|WP_014017713.1|16507_16954_+|hypothetical-protein
METVSTNIAGVSQEQIYKEFLRLGMEQLIAQDLSKRYYHNELTYRDLENLEKQFDIKFDNLVSKIDTVEKNLNVKIDAVKSELNTKIDNVEKNLNLKIDSVKNELTAKIDNIEKNLMSLTEMLKWVLGIMGAMSITMIAGLIFAFISK
>NC_015909.1|WP_014017712.1|16049_16403_+|hypothetical-protein
MLKKLHSLLIVLLLCCTTIASLPEEPKPPLIQTLNSLAKYETQLSEYVMYLVTFLAKTKVKVNDPNYPEYPYPDLSTLKDEHSITAVKHNIKIYLEYIKKTKPIAEKVYNQYSQLKM
>NC_015909.1|WP_014017461.1|15721_16057_+|hypothetical-protein
MQNNTIGLGLNLLSSLTNIAKTDTNIDHNYINTFSKVIDFFYKTYISTLKSMETAESMKIFEEIKDILKYNIEIIEAISADKNKKIITSLKATRNKIMKEYIKMLKRSENA
>NC_015909.1|WP_014017711.1|15384_15732_+|holin,-BlyB-family
MKLSKDNVELGLTSLSTLIDIFSKFEDEFDEIAHKGFFLVYELYSHYKLIYTANMERLESALTPAINAALAPLNAKINTVIDLVNSDEKNLKISNDLKFNQEGIPIYKERTNNAK
>NC_015909.1|WP_014017721.1|23013_24336_+|DUF244-domain-containing-protein
MENLSNKNNPQEINQGELKMISVEQQSFTGCEIFEEKSSPIKEKSKLSKIGKKLPGISSQECFRFNRNIDFSVQRNELDRYGASEVGNVLIGGAGLKDLMINRVLKYFGMSLPFEENLYMLKGKELENLGFREFVKAHGDNIDILYKNKYANGVDKYNYYKKTGKSEMFVGSTIDGWFINSNGTAELLEIKSSDSNYMSGAIAEYNKNGNFLSSKYFFKYYVQAQMQLACTGLEYCNLFFLIDAAPVNCKIKRNDGLIAKVLEYVHKCETEAFNIRTQIFKNNNINLQTLNNDNNEVIKLVEDLVERSEFYSSGVEFDWAREFVEYVDCVELEIRDNQAAENLACDLMEIDSIQKELNRIQNENKKREKPYKDRLKMLIYNITNTCPLIEQVNYRFGEFVFTLDPKKRAISDRLRGLLPTSGALFFPNNIAFANNVSVPM
>NC_015909.1|WP_014017722.1|24387_24813_+|DUF261-domain-containing-protein
MIINKIKQDNRTLRPEIQKWGCYFLCLHYYTSLFKKREFNAYDINTAYYRFIGLGYIKSNCFIINPCMILNYYGIRSSVRYESLNYLGAANEFEISEVKIDKVNGYHFIATKNKEILYDSLDLKPRGKIFKVTSKRIFKLK
>NC_015909.1|WP_014017723.1|24818_25595_-|site-specific-integrase
MDMNNYFNLNNFNIDFMLKLFQDYQNVVNENKILKNSLKNSSKNKKESSKPTPKFYLTPKIGKLIEKCIKTLKQTDPISGWFLHLLAISGCRGAELQKVKMQDITPFLSKTGKTLYNIKVNVAKKRNVTCIREIVINSEEFEAIQTAHKNHFNEQNLDTRRTYFFQKSKHKFKDNQISIIHISNKFKNLLKKSGFRVNKSLHLCRNLFISNLKSNGYNSFQIKELMKYSSTNEIDNIYGLSSANKIQAYECAKKCLKL
>NC_015909.1|WP_014017724.1|26026_27127_+|Erp-family-protein
MNKIMKIFTIWFVFAMIISCKNFAADKDIKQNAEGKIKGFLDKILDPVKDKIASNGPKVDELVKKLQEEEKELMQGDDPDNGVINPPPVLPASDHDNTPVPAVKVAEQNGGQQKEQAKESEAKVEEEKVEDKKEKQDSEKGKVEEKKEEQNKEEQKKKQEEAKAKEAKEKEAKEKQKRQQAESERRAREEKQRQEQEEVERKAEEEREREEAERKAKDKIKDLVDKIAKINGDIDDIKGEKSVGATKVKNKVTGPVYDDFVDGENSIRKTWGNGDLEEDEEDSELGKVLKELSDSRDKLRNKLNVGNQAYDGYTEPPLKENVNVNDIKDDLEKVKSGLEKVKSYLEDNSKFEEIKGYIEESNDDYE
>NC_015909.1|WP_014017725.1|27311_27839_+|DUF643-domain-containing-protein
MYINEISDFYDCLSPGTKKEISKLYGVKQLTLEQKKDFYRGFVSIQEYKRKTGKSFDEIINAIVDPAKNFIEDVLKDKHIIEKYKNFQNMKFDCRYKKGMLEKCLEKMGEKYSDRFLSIVSDIMDEIGKKDPKRESISVVLDFVEILFIIMHYYDKGICTRKYLIKTMKDFSEFV
>NC_015909.1|WP_014017726.1|28020_28587_+|DUF603-domain-containing-protein
MKKGKRSFDDYVAYFSEGLLSDVEIADKLGVSKVNVWRMRQKWESGGNFINEDSRVTISEDTFEHLLSQTFRSEVNARKVKSELDLERANLELGFINAFKQYSSVELVSMHTKIKNLRAEIDALNKSSRKKSKIVDNGEIDSLKSELDEYIKECSIREMELYYECMKKLATANEAESKSNYKNSKGHK
>NC_015909.1|WP_014017701.1|28583_29936_+|PBSX-family-phage-terminase-large-subunit
MNLYQTKLFTTLQKEYKNKYGVDISQFVKLTNCSINFAKFEEKQLTLKQKNVIKSIQKNNEKKIILSGGIASGKTYLACYLFLKSLIENKKLYSSDTNNFIIGNSQRSVEVNVLGQFEKLCKLLKIPYIPRHTNNSYILIDSLRINLYGGDKASDFERFRGSNSALIFVNEATTLHKQTLEEVLKRLRCGQETIIFDTNPDHPEHYFKTDYIDNIATFKTYNFTTYDNVLLSKGFIETQEKLYKDIPSYKARVLLGEWIASTDSIFTQINITEDYVFTSPIAYLDPAFSVGGDNTALCVMERVDDKYYAFVFQDQRPANDPYIMNMIKTVLENFNVHTLYLEDRDNTKGAGGLTREYMLLRNNMSQYFRIVPVKPKSNKFSRITTLITPFTYKKLYITKYSSSSVFNDIYSYKGDNKTHDDALDAISAAYLMLSLGYRERSVHFGNQRFL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NC_015909_1	1.3\|22295\|39\|NC_015909\|CRISPRCasFinder	22295-22333	39	NC_015909.1	22328-22366	1	0.974
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_015906.1	22316-22342	2	0.926
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_015906.1	58447-58473	2	0.926
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_015904.1	22383-22409	2	0.926
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_015908.1	22977-23003	2	0.926
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_015908.1	23010-23036	2	0.926
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NC_015906.1	58501-58527	2	0.926
NC_015909_1	1.3\|22295\|39\|NC_015909\|CRISPRCasFinder	22295-22333	39	NC_015905.1	22311-22349	2	0.949
NC_015909_1	1.3\|22295\|39\|NC_015909\|CRISPRCasFinder	22295-22333	39	NC_015905.1	22344-22382	2	0.949

1. spacer 1.3|22295|39|NC_015909|CRISPRCasFinder matches to position: 22328-22366, mismatch: 1, identity: 0.974

aacttaattctaaaatagatagtgtaaaaaacgaactta	CRISPR spacer
aacttaattctaaaatagatagcgtaaaaaacgaactta	Protospacer
**********************.****************

2. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to position: 22316-22342, mismatch: 2, identity: 0.926

gtttaaatgctaaaatagatagtttag	CRISPR spacer
gtttaactgccaaaatagatagtttag	Protospacer
****** ***.****************

3. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to position: 58447-58473, mismatch: 2, identity: 0.926

gtttaaatgctaaaatagatagtttag	CRISPR spacer
gtttaactgccaaaatagatagtttag	Protospacer
****** ***.****************

4. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to position: 22383-22409, mismatch: 2, identity: 0.926

gtttaaatgctaaaatagatagtttag	CRISPR spacer
gtttaaatgctaagatagatagcttag	Protospacer
*************.********.****

5. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to position: 22977-23003, mismatch: 2, identity: 0.926

gtttaaatgctaaaatagatagtttag	CRISPR spacer
gtttaaataccaaaatagatagtttag	Protospacer
********.*.****************

6. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to position: 23010-23036, mismatch: 2, identity: 0.926

gtttaaatgctaaaatagatagtttag	CRISPR spacer
gtttaaataccaaaatagatagtttag	Protospacer
********.*.****************

7. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to position: 58501-58527, mismatch: 2, identity: 0.926

ctttgcaaaaagatatatccagtttag	CRISPR spacer
ctttgcaaaaagatatctctagtttag	Protospacer
**************** **.*******

8. spacer 1.3|22295|39|NC_015909|CRISPRCasFinder matches to position: 22311-22349, mismatch: 2, identity: 0.949

aacttaattctaaaatagatagtgtaaaaaacgaactta	CRISPR spacer
aacttaattctaaaatagatagtgttaaaaatgaactta	Protospacer
************************* *****.*******

9. spacer 1.3|22295|39|NC_015909|CRISPRCasFinder matches to position: 22344-22382, mismatch: 2, identity: 0.949

aacttaattctaaaatagatagtgtaaaaaacgaactta	CRISPR spacer
aacttaattctaaaatagatagtgttaaaaatgaactta	Protospacer
************************* *****.*******

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_015909	Borreliella bissettii DN127 plasmid cp32-5, complete sequence	22187-22213	0	1.0
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NC_015909	Borreliella bissettii DN127 plasmid cp32-5, complete sequence	22241-22267	0	1.0
NC_015909_1	1.3\|22295\|39\|NC_015909\|CRISPRCasFinder	22295-22333	39	NC_015909	Borreliella bissettii DN127 plasmid cp32-5, complete sequence	22295-22333	0	1.0
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NZ_CP019918	Borreliella burgdorferi strain PAbe plasmid p_cp32-5-1, complete sequence	46489-46515	1	0.963
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NZ_CP019919	Borreliella burgdorferi strain PAbe plasmid p_cp32-2, complete sequence	23042-23068	1	0.963
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_018980	Borrelia burgdorferi 297 plasmid 297_cp32-7, complete sequence	13809-13835	1	0.963
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_019003	Borrelia burgdorferi 297 plasmid 297_cp32-1, complete sequence	22720-22746	1	0.963
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_017422	Borreliella burgdorferi N40 plasmid N40_cp32-7, complete sequence	10132-10158	1	0.963
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_017394	Borreliella burgdorferi JD1 plasmid JD1 cp32-1+5, complete sequence	22815-22841	1	0.963
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NZ_CP031407	Borreliella burgdorferi strain MM1 plasmid plsm_cp32-7, complete sequence	7425-7451	1	0.963
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NZ_CP031408	Borreliella burgdorferi strain MM1 plasmid plsm_cp32-1, complete sequence	12016-12042	1	0.963
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NZ_CP028881	Borreliella bavariensis PBi plasmid cp32-7, complete sequence	11219-11245	1	0.963
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_000948	Borreliella burgdorferi B31 plasmid cp32-1, complete sequence	22537-22563	1	0.963
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_000952	Borreliella burgdorferi B31 plasmid cp32-7, complete sequence	22365-22391	1	0.963
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NZ_CP019846	Borreliella burgdorferi plasmid cp32-1, complete sequence	22513-22539	1	0.963
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NZ_CP019756	Borreliella burgdorferi strain B31_NRZ isolate B31 plasmid p_cp32-1_1, complete sequence	53205-53231	1	0.963
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NZ_CP019757	Borreliella burgdorferi strain B31_NRZ isolate B31 plasmid p_cp32-2, complete sequence	23042-23068	1	0.963
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_011731	Borreliella burgdorferi ZS7 plasmid ZS7_cp32-1, complete sequence	22731-22757	1	0.963
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NZ_CP017209	Borreliella burgdorferi strain B331 plasmid B331_cp32_7, complete sequence	22377-22403	1	0.963
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NC_017423	Borreliella burgdorferi N40 plasmid N40_cp32-12, complete sequence	21181-21207	1	0.963
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NZ_CP019919	Borreliella burgdorferi strain PAbe plasmid p_cp32-2, complete sequence	23096-23122	1	0.963
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NC_018980	Borrelia burgdorferi 297 plasmid 297_cp32-7, complete sequence	13863-13889	1	0.963
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NC_017422	Borreliella burgdorferi N40 plasmid N40_cp32-7, complete sequence	10186-10212	1	0.963
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NZ_CP031407	Borreliella burgdorferi strain MM1 plasmid plsm_cp32-7, complete sequence	7479-7505	1	0.963
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NZ_CP028881	Borreliella bavariensis PBi plasmid cp32-7, complete sequence	11273-11299	1	0.963
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NC_000952	Borreliella burgdorferi B31 plasmid cp32-7, complete sequence	22419-22445	1	0.963
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NZ_CP019757	Borreliella burgdorferi strain B31_NRZ isolate B31 plasmid p_cp32-2, complete sequence	23096-23122	1	0.963
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NZ_CP017209	Borreliella burgdorferi strain B331 plasmid B331_cp32_7, complete sequence	22431-22457	1	0.963
NC_015909_1	1.3\|22295\|39\|NC_015909\|CRISPRCasFinder	22295-22333	39	NC_015909	Borreliella bissettii DN127 plasmid cp32-5, complete sequence	22328-22366	1	0.974
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_018979	Borrelia burgdorferi 297 plasmid 297_cp32-12, complete sequence	22349-22375	2	0.926
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_018979	Borrelia burgdorferi 297 plasmid 297_cp32-12, complete sequence	22403-22429	2	0.926
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_018979	Borrelia burgdorferi 297 plasmid 297_cp32-12, complete sequence	22457-22483	2	0.926
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_018979	Borrelia burgdorferi 297 plasmid 297_cp32-12, complete sequence	22511-22537	2	0.926
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_018979	Borrelia burgdorferi 297 plasmid 297_cp32-12, complete sequence	22565-22591	2	0.926
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_018981	Borrelia burgdorferi 297 plasmid 297_cp32-5, complete sequence	16793-16819	2	0.926
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_018981	Borrelia burgdorferi 297 plasmid 297_cp32-5, complete sequence	16880-16906	2	0.926
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_019006	Borrelia burgdorferi 297 plasmid 297_cp32-3, complete sequence	17359-17385	2	0.926
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_019006	Borrelia burgdorferi 297 plasmid 297_cp32-3, complete sequence	17479-17505	2	0.926
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_017427	Borreliella burgdorferi JD1 plasmid JD1 cp32-3, complete sequence	16824-16850	2	0.926
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_017427	Borreliella burgdorferi JD1 plasmid JD1 cp32-3, complete sequence	16944-16970	2	0.926
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_017396	Borreliella burgdorferi JD1 plasmid JD1 cp32-12, complete sequence	22392-22418	2	0.926
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_017396	Borreliella burgdorferi JD1 plasmid JD1 cp32-12, complete sequence	22446-22472	2	0.926
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_017425	Borreliella burgdorferi JD1 plasmid JD1 cp32-6, complete sequence	16824-16850	2	0.926
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_017425	Borreliella burgdorferi JD1 plasmid JD1 cp32-6, complete sequence	16944-16970	2	0.926
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_017425	Borreliella burgdorferi JD1 plasmid JD1 cp32-6, complete sequence	22478-22504	2	0.926
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_017425	Borreliella burgdorferi JD1 plasmid JD1 cp32-6, complete sequence	22619-22645	2	0.926
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_017426	Borreliella burgdorferi JD1 plasmid JD1 cp32-8, complete sequence	16824-16850	2	0.926
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_017426	Borreliella burgdorferi JD1 plasmid JD1 cp32-8, complete sequence	16944-16970	2	0.926
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_011735	Borreliella burgdorferi ZS7 plasmid ZS7_cp32-12, complete sequence	22493-22519	2	0.926
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_011735	Borreliella burgdorferi ZS7 plasmid ZS7_cp32-12, complete sequence	22547-22573	2	0.926
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NZ_CP017205	Borreliella burgdorferi strain B331 plasmid B331_cp32_11, complete sequence	16825-16851	2	0.926
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NZ_CP017205	Borreliella burgdorferi strain B331 plasmid B331_cp32_11, complete sequence	16912-16938	2	0.926
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_019005	Borrelia burgdorferi 297 plasmid 297_cp32-6, complete sequence	22562-22588	2	0.926
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_019005	Borrelia burgdorferi 297 plasmid 297_cp32-6, complete sequence	22703-22729	2	0.926
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NZ_CP009071	Borreliella afzelii K78 plasmid cp32-5, complete sequence	16819-16845	2	0.926
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_015904	Borreliella bissettii DN127 plasmid cp32-4, complete sequence	22383-22409	2	0.926
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_015906	Borreliella bissettii DN127 plasmid cp32-quad, complete sequence	22316-22342	2	0.926
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_015906	Borreliella bissettii DN127 plasmid cp32-quad, complete sequence	58447-58473	2	0.926
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_015908	Borreliella bissettii DN127 plasmid cp32-3, complete sequence	22977-23003	2	0.926
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_015908	Borreliella bissettii DN127 plasmid cp32-3, complete sequence	23010-23036	2	0.926
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NZ_CP031405	Borreliella burgdorferi strain MM1 plasmid plsm_cp32-6, complete sequence	10807-10833	2	0.926
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NZ_CP031405	Borreliella burgdorferi strain MM1 plasmid plsm_cp32-6, complete sequence	10948-10974	2	0.926
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_000951	Borreliella burgdorferi B31 plasmid cp32-6, complete sequence	22367-22393	2	0.926
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_000951	Borreliella burgdorferi B31 plasmid cp32-6, complete sequence	22508-22534	2	0.926
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NZ_CP015802	Borrelia mayonii strain MN14-1539 plasmid cp32-6, complete sequence	9242-9268	2	0.926
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NZ_CP015802	Borrelia mayonii strain MN14-1539 plasmid cp32-6, complete sequence	9383-9409	2	0.926
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NZ_CP017208	Borreliella burgdorferi strain B331 plasmid B331_cp32_6, complete sequence	22321-22347	2	0.926
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NZ_CP017208	Borreliella burgdorferi strain B331 plasmid B331_cp32_6, complete sequence	22462-22488	2	0.926
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NC_015904	Borreliella bissettii DN127 plasmid cp32-4, complete sequence	22437-22463	2	0.926
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NC_015906	Borreliella bissettii DN127 plasmid cp32-quad, complete sequence	10699-10725	2	0.926
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NC_015906	Borreliella bissettii DN127 plasmid cp32-quad, complete sequence	58501-58527	2	0.926
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NZ_CP019918	Borreliella burgdorferi strain PAbe plasmid p_cp32-5-1, complete sequence	15672-15698	2	0.926
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NZ_CP019921	Borreliella burgdorferi strain PAbe plasmid p_cp32-9-4, complete sequence	52864-52890	2	0.926
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NC_018981	Borrelia burgdorferi 297 plasmid 297_cp32-5, complete sequence	22377-22403	2	0.926
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NC_018984	Borrelia burgdorferi 297 plasmid 297_cp32-4, complete sequence	22887-22913	2	0.926
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NC_017398	Borreliella burgdorferi N40 plasmid N40_cp32-5, complete sequence	22352-22378	2	0.926
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NC_017400	Borreliella burgdorferi N40 plasmid N40_cp32-4, complete sequence	8199-8225	2	0.926
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NC_017394	Borreliella burgdorferi JD1 plasmid JD1 cp32-1+5, complete sequence	53081-53107	2	0.926
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NZ_CP031411	Borreliella burgdorferi strain MM1 plasmid plsm_cp32-5, complete sequence	10277-10303	2	0.926
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NZ_CP015799	Borrelia mayonii strain MN14-1539 plasmid cp32-13, complete sequence	20983-21009	2	0.926
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NZ_CP015801	Borrelia mayonii strain MN14-1539 plasmid cp32-4, complete sequence	22317-22343	2	0.926
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NZ_CP019848	Borreliella burgdorferi plasmid cp32-4, complete sequence	22206-22232	2	0.926
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NZ_CP019849	Borreliella burgdorferi plasmid cp32-5, complete sequence	22387-22413	2	0.926
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NZ_CP019756	Borreliella burgdorferi strain B31_NRZ isolate B31 plasmid p_cp32-1_1, complete sequence	22388-22414	2	0.926
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NZ_CP019759	Borreliella burgdorferi strain B31_NRZ isolate B31 plasmid p_cp32-4, complete sequence	22207-22233	2	0.926
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NC_011736	Borreliella burgdorferi ZS7 plasmid ZS7_cp32-4, complete sequence	22680-22706	2	0.926
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NZ_CP017207	Borreliella burgdorferi strain B331 plasmid B331_cp32_5, complete sequence	11317-11343	2	0.926
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NC_017224	Borreliella afzelii PKo plasmid cp32-11, complete sequence	22091-22117	2	0.926
NC_015909_1	1.3\|22295\|39\|NC_015909\|CRISPRCasFinder	22295-22333	39	NC_015905	Borreliella bissettii DN127 plasmid cp32-6, complete sequence	22311-22349	2	0.949
NC_015909_1	1.3\|22295\|39\|NC_015909\|CRISPRCasFinder	22295-22333	39	NC_015905	Borreliella bissettii DN127 plasmid cp32-6, complete sequence	22344-22382	2	0.949
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_019006	Borrelia burgdorferi 297 plasmid 297_cp32-3, complete sequence	17446-17472	3	0.889
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_017427	Borreliella burgdorferi JD1 plasmid JD1 cp32-3, complete sequence	16911-16937	3	0.889
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_017425	Borreliella burgdorferi JD1 plasmid JD1 cp32-6, complete sequence	16911-16937	3	0.889
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_017426	Borreliella burgdorferi JD1 plasmid JD1 cp32-8, complete sequence	16911-16937	3	0.889
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_019005	Borrelia burgdorferi 297 plasmid 297_cp32-6, complete sequence	16852-16878	3	0.889
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_017428	Borreliella burgdorferi JD1 plasmid JD1 cp32-10, complete sequence	16715-16741	3	0.889
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_017428	Borreliella burgdorferi JD1 plasmid JD1 cp32-10, complete sequence	16802-16828	3	0.889
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_015905	Borreliella bissettii DN127 plasmid cp32-6, complete sequence	22431-22457	3	0.889
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_017227	Borreliella afzelii PKo plasmid cp32-5, complete sequence	16842-16868	3	0.889
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NC_017423	Borreliella burgdorferi N40 plasmid N40_cp32-12, complete sequence	21094-21120	3	0.889
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NZ_CP019918	Borreliella burgdorferi strain PAbe plasmid p_cp32-5-1, complete sequence	46240-46266	3	0.889
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NZ_CP019918	Borreliella burgdorferi strain PAbe plasmid p_cp32-5-1, complete sequence	46402-46428	3	0.889
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NZ_CP019921	Borreliella burgdorferi strain PAbe plasmid p_cp32-9-4, complete sequence	22341-22367	3	0.889
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NC_018979	Borrelia burgdorferi 297 plasmid 297_cp32-12, complete sequence	22619-22645	3	0.889
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NC_018981	Borrelia burgdorferi 297 plasmid 297_cp32-5, complete sequence	16739-16765	3	0.889
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NC_018984	Borrelia burgdorferi 297 plasmid 297_cp32-4, complete sequence	22779-22805	3	0.889
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NC_018984	Borrelia burgdorferi 297 plasmid 297_cp32-4, complete sequence	22833-22859	3	0.889
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NC_017394	Borreliella burgdorferi JD1 plasmid JD1 cp32-1+5, complete sequence	53243-53269	3	0.889
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NC_017394	Borreliella burgdorferi JD1 plasmid JD1 cp32-1+5, complete sequence	22512-22538	3	0.889
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NC_017394	Borreliella burgdorferi JD1 plasmid JD1 cp32-1+5, complete sequence	22728-22754	3	0.889
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NC_017396	Borreliella burgdorferi JD1 plasmid JD1 cp32-12, complete sequence	22500-22526	3	0.889
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NC_015905	Borreliella bissettii DN127 plasmid cp32-6, complete sequence	22485-22511	3	0.889
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NC_015905	Borreliella bissettii DN127 plasmid cp32-6, complete sequence	22224-22250	3	0.889
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NZ_CP031410	Borreliella burgdorferi strain MM1 plasmid plsm_cp32-4, complete sequence	8333-8359	3	0.889
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NZ_CP031410	Borreliella burgdorferi strain MM1 plasmid plsm_cp32-4, complete sequence	8279-8305	3	0.889
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NZ_CP015801	Borrelia mayonii strain MN14-1539 plasmid cp32-4, complete sequence	22263-22289	3	0.889
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NZ_CP015801	Borrelia mayonii strain MN14-1539 plasmid cp32-4, complete sequence	22209-22235	3	0.889
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NZ_CP019756	Borreliella burgdorferi strain B31_NRZ isolate B31 plasmid p_cp32-1_1, complete sequence	52956-52982	3	0.889
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NZ_CP019756	Borreliella burgdorferi strain B31_NRZ isolate B31 plasmid p_cp32-1_1, complete sequence	53118-53144	3	0.889
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NC_011735	Borreliella burgdorferi ZS7 plasmid ZS7_cp32-12, complete sequence	22601-22627	3	0.889
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NC_011736	Borreliella burgdorferi ZS7 plasmid ZS7_cp32-4, complete sequence	22572-22598	3	0.889
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NC_011736	Borreliella burgdorferi ZS7 plasmid ZS7_cp32-4, complete sequence	22626-22652	3	0.889
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NC_019005	Borrelia burgdorferi 297 plasmid 297_cp32-6, complete sequence	16798-16824	3	0.889
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NZ_CP019926	Borreliella burgdorferi strain PAbe plasmid p_lp56, complete sequence	20254-20280	3	0.889
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NC_019003	Borrelia burgdorferi 297 plasmid 297_cp32-1, complete sequence	22471-22497	3	0.889
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NC_019003	Borrelia burgdorferi 297 plasmid 297_cp32-1, complete sequence	22633-22659	3	0.889
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NC_019006	Borrelia burgdorferi 297 plasmid 297_cp32-3, complete sequence	17305-17331	3	0.889
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NC_017427	Borreliella burgdorferi JD1 plasmid JD1 cp32-3, complete sequence	16770-16796	3	0.889
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NC_017402	Borreliella burgdorferi N40 plasmid N40_cp32-9, complete sequence	22322-22348	3	0.889
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NC_017397	Borreliella burgdorferi JD1 plasmid JD1 cp32-9, complete sequence	22180-22206	3	0.889
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NC_017408	Borreliella burgdorferi JD1 plasmid JD1 lp28-6, complete sequence	25294-25320	3	0.889
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NC_017425	Borreliella burgdorferi JD1 plasmid JD1 cp32-6, complete sequence	16770-16796	3	0.889
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NC_017426	Borreliella burgdorferi JD1 plasmid JD1 cp32-8, complete sequence	16770-16796	3	0.889
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NC_017426	Borreliella burgdorferi JD1 plasmid JD1 cp32-8, complete sequence	22579-22605	3	0.889
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NC_015915	Borreliella bissettii DN127 plasmid lp17, complete sequence	25763-25789	3	0.889
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NC_015915	Borreliella bissettii DN127 plasmid lp17, complete sequence	25817-25843	3	0.889
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NZ_CP031406	Borreliella burgdorferi strain MM1 plasmid plsm_cp32-9, complete sequence	22225-22251	3	0.889
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NZ_CP031408	Borreliella burgdorferi strain MM1 plasmid plsm_cp32-1, complete sequence	11713-11739	3	0.889
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NZ_CP031408	Borreliella burgdorferi strain MM1 plasmid plsm_cp32-1, complete sequence	11929-11955	3	0.889
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NC_011722	Borreliella burgdorferi ZS7 plasmid ZS7_cp32-9, complete sequence	22289-22315	3	0.889
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NC_000948	Borreliella burgdorferi B31 plasmid cp32-1, complete sequence	22288-22314	3	0.889
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NC_000948	Borreliella burgdorferi B31 plasmid cp32-1, complete sequence	22450-22476	3	0.889
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NC_000953	Borreliella burgdorferi B31 plasmid cp32-8, complete sequence	22357-22383	3	0.889
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NC_000954	Borreliella burgdorferi B31 plasmid cp32-9, complete sequence	22341-22367	3	0.889
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NC_000956	Borreliella burgdorferi B31 plasmid lp56, complete sequence	20254-20280	3	0.889
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NZ_CP019846	Borreliella burgdorferi plasmid cp32-1, complete sequence	22264-22290	3	0.889
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NZ_CP019846	Borreliella burgdorferi plasmid cp32-1, complete sequence	22426-22452	3	0.889
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NZ_CP019850	Borreliella burgdorferi plasmid cp32-9, complete sequence	22270-22296	3	0.889
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NZ_CP019855	Borreliella burgdorferi plasmid lp56, complete sequence	20254-20280	3	0.889
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NZ_CP019760	Borreliella burgdorferi strain B31_NRZ isolate B31 plasmid p_cp32-9, complete sequence	22341-22367	3	0.889
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NZ_CP019766	Borreliella burgdorferi strain B31_NRZ isolate B31 plasmid p_lp56, complete sequence	20234-20260	3	0.889
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NC_011731	Borreliella burgdorferi ZS7 plasmid ZS7_cp32-1, complete sequence	22428-22454	3	0.889
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NC_011731	Borreliella burgdorferi ZS7 plasmid ZS7_cp32-1, complete sequence	22644-22670	3	0.889
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NZ_CP017203	Borreliella burgdorferi strain B331 plasmid B331_cp32_1, complete sequence	22588-22614	3	0.889
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NZ_CP017205	Borreliella burgdorferi strain B331 plasmid B331_cp32_11, complete sequence	16771-16797	3	0.889
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NZ_CP017206	Borreliella burgdorferi strain B331 plasmid B331_cp32_4, complete sequence	22885-22911	3	0.889
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NZ_CP017206	Borreliella burgdorferi strain B331 plasmid B331_cp32_4, complete sequence	22939-22965	3	0.889
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NC_017240	Borreliella afzelii PKo plasmid lp32-10, complete sequence	19832-19858	3	0.889
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NZ_CP028875	Borreliella bavariensis PBi plasmid lp28-4_cp32-1, complete sequence	18272-18298	3	0.889
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NZ_CP017215	Borreliella burgdorferi strain B331 plasmid B331_lp28_6, complete sequence	1341-1367	3	0.889
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NZ_CP017215	Borreliella burgdorferi strain B331 plasmid B331_lp28_6, complete sequence	1482-1508	3	0.889
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NZ_CP017215	Borreliella burgdorferi strain B331 plasmid B331_lp28_6, complete sequence	1536-1562	3	0.889
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_017225	Borreliella afzelii PKo plasmid cp32-12, complete sequence	21784-21810	4	0.852
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NZ_CP019926	Borreliella burgdorferi strain PAbe plasmid p_lp56, complete sequence	20374-20400	4	0.852
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_000953	Borreliella burgdorferi B31 plasmid cp32-8, complete sequence	16930-16956	4	0.852
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_000956	Borreliella burgdorferi B31 plasmid lp56, complete sequence	20374-20400	4	0.852
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NZ_CP019855	Borreliella burgdorferi plasmid lp56, complete sequence	20374-20400	4	0.852
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NZ_CP019766	Borreliella burgdorferi strain B31_NRZ isolate B31 plasmid p_lp56, complete sequence	20354-20380	4	0.852
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NZ_CP019918	Borreliella burgdorferi strain PAbe plasmid p_cp32-5-1, complete sequence	15834-15860	4	0.852
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NZ_CP019921	Borreliella burgdorferi strain PAbe plasmid p_cp32-9-4, complete sequence	22515-22541	4	0.852
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NC_018981	Borrelia burgdorferi 297 plasmid 297_cp32-5, complete sequence	22539-22565	4	0.852
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NC_017398	Borreliella burgdorferi N40 plasmid N40_cp32-5, complete sequence	22514-22540	4	0.852
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NZ_CP031410	Borreliella burgdorferi strain MM1 plasmid plsm_cp32-4, complete sequence	8387-8413	4	0.852
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NZ_CP031411	Borreliella burgdorferi strain MM1 plasmid plsm_cp32-5, complete sequence	10439-10465	4	0.852
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NZ_CP015799	Borrelia mayonii strain MN14-1539 plasmid cp32-13, complete sequence	21091-21117	4	0.852
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NZ_CP019849	Borreliella burgdorferi plasmid cp32-5, complete sequence	22549-22575	4	0.852
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NZ_CP019756	Borreliella burgdorferi strain B31_NRZ isolate B31 plasmid p_cp32-1_1, complete sequence	22550-22576	4	0.852
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NZ_CP017207	Borreliella burgdorferi strain B331 plasmid B331_cp32_5, complete sequence	11479-11505	4	0.852
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NC_019005	Borrelia burgdorferi 297 plasmid 297_cp32-6, complete sequence	22757-22783	4	0.852
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NC_017402	Borreliella burgdorferi N40 plasmid N40_cp32-9, complete sequence	22529-22555	4	0.852
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NC_017425	Borreliella burgdorferi JD1 plasmid JD1 cp32-6, complete sequence	22673-22699	4	0.852
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NC_017426	Borreliella burgdorferi JD1 plasmid JD1 cp32-8, complete sequence	22633-22659	4	0.852
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NC_017426	Borreliella burgdorferi JD1 plasmid JD1 cp32-8, complete sequence	22687-22713	4	0.852
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NC_017426	Borreliella burgdorferi JD1 plasmid JD1 cp32-8, complete sequence	22741-22767	4	0.852
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NZ_CP031406	Borreliella burgdorferi strain MM1 plasmid plsm_cp32-9, complete sequence	22399-22425	4	0.852
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NC_011722	Borreliella burgdorferi ZS7 plasmid ZS7_cp32-9, complete sequence	22343-22369	4	0.852
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NC_000953	Borreliella burgdorferi B31 plasmid cp32-8, complete sequence	22411-22437	4	0.852
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NC_000953	Borreliella burgdorferi B31 plasmid cp32-8, complete sequence	22465-22491	4	0.852
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NC_000953	Borreliella burgdorferi B31 plasmid cp32-8, complete sequence	22519-22545	4	0.852
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NC_000954	Borreliella burgdorferi B31 plasmid cp32-9, complete sequence	22515-22541	4	0.852
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NZ_CP019850	Borreliella burgdorferi plasmid cp32-9, complete sequence	22444-22470	4	0.852
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NZ_CP019760	Borreliella burgdorferi strain B31_NRZ isolate B31 plasmid p_cp32-9, complete sequence	22515-22541	4	0.852
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NZ_CP017203	Borreliella burgdorferi strain B331 plasmid B331_cp32_1, complete sequence	22642-22668	4	0.852
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NZ_CP017203	Borreliella burgdorferi strain B331 plasmid B331_cp32_1, complete sequence	22696-22722	4	0.852
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NZ_CP017203	Borreliella burgdorferi strain B331 plasmid B331_cp32_1, complete sequence	22750-22776	4	0.852
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NZ_CP017206	Borreliella burgdorferi strain B331 plasmid B331_cp32_4, complete sequence	22993-23019	4	0.852
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NC_015903	Borreliella bissettii DN127 plasmid cp32-11, complete sequence	17100-17126	4	0.852
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NZ_CP028864	Borreliella garinii strain 20047 plasmid cp32-3, complete sequence	13209-13235	4	0.852
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NC_000951	Borreliella burgdorferi B31 plasmid cp32-6, complete sequence	22562-22588	4	0.852
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NZ_CP017208	Borreliella burgdorferi strain B331 plasmid B331_cp32_6, complete sequence	22516-22542	4	0.852
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NZ_CP018747	Borreliella garinii strain CIP 103362 isolate 20047 plasmid unnamed2	6282-6308	4	0.852
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NZ_CP028874	Borreliella bavariensis PBi plasmid lp25_cp32-3, complete sequence	22871-22897	4	0.852
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NC_023559	Oenococcus phage phi9805, complete genome	6796-6822	4	0.852
NC_015909_1	1.3\|22295\|39\|NC_015909\|CRISPRCasFinder	22295-22333	39	NC_015904	Borreliella bissettii DN127 plasmid cp32-4, complete sequence	16761-16799	4	0.897
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_017425	Borreliella burgdorferi JD1 plasmid JD1 cp32-6, complete sequence	22565-22591	5	0.815
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_017426	Borreliella burgdorferi JD1 plasmid JD1 cp32-8, complete sequence	22459-22485	5	0.815
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_017426	Borreliella burgdorferi JD1 plasmid JD1 cp32-8, complete sequence	22546-22572	5	0.815
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_019005	Borrelia burgdorferi 297 plasmid 297_cp32-6, complete sequence	16939-16965	5	0.815
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_019005	Borrelia burgdorferi 297 plasmid 297_cp32-6, complete sequence	22649-22675	5	0.815
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NZ_CP009071	Borreliella afzelii K78 plasmid cp32-5, complete sequence	16798-16824	5	0.815
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NZ_CP031405	Borreliella burgdorferi strain MM1 plasmid plsm_cp32-6, complete sequence	10894-10920	5	0.815
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_000951	Borreliella burgdorferi B31 plasmid cp32-6, complete sequence	22454-22480	5	0.815
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NZ_CP015802	Borrelia mayonii strain MN14-1539 plasmid cp32-6, complete sequence	9329-9355	5	0.815
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NZ_CP017208	Borreliella burgdorferi strain B331 plasmid B331_cp32_6, complete sequence	22408-22434	5	0.815
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_017428	Borreliella burgdorferi JD1 plasmid JD1 cp32-10, complete sequence	16889-16915	5	0.815
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NZ_CP019921	Borreliella burgdorferi strain PAbe plasmid p_cp32-9-4, complete sequence	22461-22487	5	0.815
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_015905	Borreliella bissettii DN127 plasmid cp32-6, complete sequence	22377-22403	5	0.815
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_017227	Borreliella afzelii PKo plasmid cp32-5, complete sequence	22646-22672	5	0.815
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NZ_CP009063	Borreliella afzelii K78 plasmid lp28-2, complete sequence	1505-1531	5	0.815
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NZ_CP018746	Borreliella garinii strain CIP 103362 isolate 20047 plasmid unnamed1	29453-29479	5	0.815
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_017402	Borreliella burgdorferi N40 plasmid N40_cp32-9, complete sequence	22475-22501	5	0.815
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_017397	Borreliella burgdorferi JD1 plasmid JD1 cp32-9, complete sequence	22300-22326	5	0.815
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_015903	Borreliella bissettii DN127 plasmid cp32-11, complete sequence	17274-17300	5	0.815
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NZ_CP031406	Borreliella burgdorferi strain MM1 plasmid plsm_cp32-9, complete sequence	22345-22371	5	0.815
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NZ_CP028865	Borreliella garinii strain 20047 plasmid lp36, complete sequence	7549-7575	5	0.815
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_000953	Borreliella burgdorferi B31 plasmid cp32-8, complete sequence	22324-22350	5	0.815
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_000954	Borreliella burgdorferi B31 plasmid cp32-9, complete sequence	22461-22487	5	0.815
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NZ_CP019850	Borreliella burgdorferi plasmid cp32-9, complete sequence	22390-22416	5	0.815
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NZ_CP019760	Borreliella burgdorferi strain B31_NRZ isolate B31 plasmid p_cp32-9, complete sequence	22461-22487	5	0.815
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NZ_CP015798	Borrelia mayonii strain MN14-1539 plasmid cp32-1, complete sequence	16882-16908	5	0.815
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NZ_CP017203	Borreliella burgdorferi strain B331 plasmid B331_cp32_1, complete sequence	16975-17001	5	0.815
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NZ_CP017203	Borreliella burgdorferi strain B331 plasmid B331_cp32_1, complete sequence	22555-22581	5	0.815
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_017239	Borreliella afzelii PKo plasmid lp28-2, complete sequence	25119-25145	5	0.815
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	MN693532	Marine virus AFVG_25M340, complete genome	31738-31764	5	0.815
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NZ_CP026601	Clostridiaceae bacterium 14S0207 plasmid unnamed1, complete sequence	6026-6052	5	0.815
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NC_048753	Lactobacillus phage 3-521, complete genome	64410-64436	5	0.815
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	KY883638	Vibrio phage JSF13, complete genome	1100-1126	5	0.815
NC_015909_1	1.2\|22241\|27\|NC_015909\|CRISPRCasFinder	22241-22267	27	NZ_CP031405	Borreliella burgdorferi strain MM1 plasmid plsm_cp32-6, complete sequence	11002-11028	5	0.815
NC_015909_1	1.3\|22295\|39\|NC_015909\|CRISPRCasFinder	22295-22333	39	NZ_CP028880	Borreliella bavariensis PBi plasmid cp32-5, complete sequence	5232-5270	5	0.872
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	NZ_CP020460	Lactobacillus sakei strain FAM18311 plasmid pFAM18311_1	25966-25992	6	0.778
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	MN694659	Marine virus AFVG_250M322, complete genome	1303-1329	6	0.778
NC_015909_1	1.1\|22187\|27\|NC_015909\|CRISPRCasFinder	22187-22213	27	MG209611	Aphanizomenon phage vB_AphaS-CL131, complete genome	52388-52414	6	0.778
NC_015909_1	1.3\|22295\|39\|NC_015909\|CRISPRCasFinder	22295-22333	39	NC_015909	Borreliella bissettii DN127 plasmid cp32-5, complete sequence	22262-22300	6	0.846
NC_015909_1	1.3\|22295\|39\|NC_015909\|CRISPRCasFinder	22295-22333	39	NZ_CP019919	Borreliella burgdorferi strain PAbe plasmid p_cp32-2, complete sequence	23117-23155	6	0.846
NC_015909_1	1.3\|22295\|39\|NC_015909\|CRISPRCasFinder	22295-22333	39	NZ_CP019919	Borreliella burgdorferi strain PAbe plasmid p_cp32-2, complete sequence	23150-23188	6	0.846
NC_015909_1	1.3\|22295\|39\|NC_015909\|CRISPRCasFinder	22295-22333	39	NC_018980	Borrelia burgdorferi 297 plasmid 297_cp32-7, complete sequence	13884-13922	6	0.846
NC_015909_1	1.3\|22295\|39\|NC_015909\|CRISPRCasFinder	22295-22333	39	NC_018980	Borrelia burgdorferi 297 plasmid 297_cp32-7, complete sequence	13917-13955	6	0.846
NC_015909_1	1.3\|22295\|39\|NC_015909\|CRISPRCasFinder	22295-22333	39	NC_017422	Borreliella burgdorferi N40 plasmid N40_cp32-7, complete sequence	10207-10245	6	0.846
NC_015909_1	1.3\|22295\|39\|NC_015909\|CRISPRCasFinder	22295-22333	39	NC_017422	Borreliella burgdorferi N40 plasmid N40_cp32-7, complete sequence	10240-10278	6	0.846
NC_015909_1	1.3\|22295\|39\|NC_015909\|CRISPRCasFinder	22295-22333	39	NZ_CP031407	Borreliella burgdorferi strain MM1 plasmid plsm_cp32-7, complete sequence	7500-7538	6	0.846
NC_015909_1	1.3\|22295\|39\|NC_015909\|CRISPRCasFinder	22295-22333	39	NZ_CP031407	Borreliella burgdorferi strain MM1 plasmid plsm_cp32-7, complete sequence	7533-7571	6	0.846
NC_015909_1	1.3\|22295\|39\|NC_015909\|CRISPRCasFinder	22295-22333	39	NZ_CP028881	Borreliella bavariensis PBi plasmid cp32-7, complete sequence	11294-11332	6	0.846
NC_015909_1	1.3\|22295\|39\|NC_015909\|CRISPRCasFinder	22295-22333	39	NZ_CP028881	Borreliella bavariensis PBi plasmid cp32-7, complete sequence	11327-11365	6	0.846
NC_015909_1	1.3\|22295\|39\|NC_015909\|CRISPRCasFinder	22295-22333	39	NC_000952	Borreliella burgdorferi B31 plasmid cp32-7, complete sequence	22440-22478	6	0.846
NC_015909_1	1.3\|22295\|39\|NC_015909\|CRISPRCasFinder	22295-22333	39	NC_000952	Borreliella burgdorferi B31 plasmid cp32-7, complete sequence	22473-22511	6	0.846
NC_015909_1	1.3\|22295\|39\|NC_015909\|CRISPRCasFinder	22295-22333	39	NZ_CP019757	Borreliella burgdorferi strain B31_NRZ isolate B31 plasmid p_cp32-2, complete sequence	23117-23155	6	0.846
NC_015909_1	1.3\|22295\|39\|NC_015909\|CRISPRCasFinder	22295-22333	39	NZ_CP019757	Borreliella burgdorferi strain B31_NRZ isolate B31 plasmid p_cp32-2, complete sequence	23150-23188	6	0.846
NC_015909_1	1.3\|22295\|39\|NC_015909\|CRISPRCasFinder	22295-22333	39	NZ_CP017209	Borreliella burgdorferi strain B331 plasmid B331_cp32_7, complete sequence	22452-22490	6	0.846
NC_015909_1	1.3\|22295\|39\|NC_015909\|CRISPRCasFinder	22295-22333	39	NZ_CP017209	Borreliella burgdorferi strain B331 plasmid B331_cp32_7, complete sequence	22485-22523	6	0.846
NC_015909_1	1.3\|22295\|39\|NC_015909\|CRISPRCasFinder	22295-22333	39	NZ_CP019918	Borreliella burgdorferi strain PAbe plasmid p_cp32-5-1, complete sequence	15693-15731	7	0.821
NC_015909_1	1.3\|22295\|39\|NC_015909\|CRISPRCasFinder	22295-22333	39	NZ_CP009071	Borreliella afzelii K78 plasmid cp32-5, complete sequence	22408-22446	7	0.821
NC_015909_1	1.3\|22295\|39\|NC_015909\|CRISPRCasFinder	22295-22333	39	NC_018981	Borrelia burgdorferi 297 plasmid 297_cp32-5, complete sequence	22398-22436	7	0.821
NC_015909_1	1.3\|22295\|39\|NC_015909\|CRISPRCasFinder	22295-22333	39	NC_017398	Borreliella burgdorferi N40 plasmid N40_cp32-5, complete sequence	22373-22411	7	0.821
NC_015909_1	1.3\|22295\|39\|NC_015909\|CRISPRCasFinder	22295-22333	39	NC_017400	Borreliella burgdorferi N40 plasmid N40_cp32-4, complete sequence	8220-8258	7	0.821
NC_015909_1	1.3\|22295\|39\|NC_015909\|CRISPRCasFinder	22295-22333	39	NC_017394	Borreliella burgdorferi JD1 plasmid JD1 cp32-1+5, complete sequence	53102-53140	7	0.821
NC_015909_1	1.3\|22295\|39\|NC_015909\|CRISPRCasFinder	22295-22333	39	NZ_CP031411	Borreliella burgdorferi strain MM1 plasmid plsm_cp32-5, complete sequence	10298-10336	7	0.821
NC_015909_1	1.3\|22295\|39\|NC_015909\|CRISPRCasFinder	22295-22333	39	NZ_CP015799	Borrelia mayonii strain MN14-1539 plasmid cp32-13, complete sequence	21004-21042	7	0.821
NC_015909_1	1.3\|22295\|39\|NC_015909\|CRISPRCasFinder	22295-22333	39	NZ_CP019849	Borreliella burgdorferi plasmid cp32-5, complete sequence	22408-22446	7	0.821
NC_015909_1	1.3\|22295\|39\|NC_015909\|CRISPRCasFinder	22295-22333	39	NZ_CP019756	Borreliella burgdorferi strain B31_NRZ isolate B31 plasmid p_cp32-1_1, complete sequence	22409-22447	7	0.821
NC_015909_1	1.3\|22295\|39\|NC_015909\|CRISPRCasFinder	22295-22333	39	NC_017227	Borreliella afzelii PKo plasmid cp32-5, complete sequence	22451-22489	7	0.821
NC_015909_1	1.3\|22295\|39\|NC_015909\|CRISPRCasFinder	22295-22333	39	NC_015909	Borreliella bissettii DN127 plasmid cp32-5, complete sequence	16785-16823	8	0.795
NC_015909_1	1.3\|22295\|39\|NC_015909\|CRISPRCasFinder	22295-22333	39	NC_015906	Borreliella bissettii DN127 plasmid cp32-quad, complete sequence	22283-22321	8	0.795
NC_015909_1	1.3\|22295\|39\|NC_015909\|CRISPRCasFinder	22295-22333	39	NZ_CP019921	Borreliella burgdorferi strain PAbe plasmid p_cp32-9-4, complete sequence	16994-17032	8	0.795
NC_015909_1	1.3\|22295\|39\|NC_015909\|CRISPRCasFinder	22295-22333	39	NC_011722	Borreliella burgdorferi ZS7 plasmid ZS7_cp32-9, complete sequence	16942-16980	8	0.795
NC_015909_1	1.3\|22295\|39\|NC_015909\|CRISPRCasFinder	22295-22333	39	NC_000954	Borreliella burgdorferi B31 plasmid cp32-9, complete sequence	16994-17032	8	0.795
NC_015909_1	1.3\|22295\|39\|NC_015909\|CRISPRCasFinder	22295-22333	39	NZ_CP019850	Borreliella burgdorferi plasmid cp32-9, complete sequence	16923-16961	8	0.795
NC_015909_1	1.3\|22295\|39\|NC_015909\|CRISPRCasFinder	22295-22333	39	NZ_CP019760	Borreliella burgdorferi strain B31_NRZ isolate B31 plasmid p_cp32-9, complete sequence	16994-17032	8	0.795
NC_015909_1	1.3\|22295\|39\|NC_015909\|CRISPRCasFinder	22295-22333	39	NC_017226	Borreliella afzelii PKo plasmid cp32-3, complete sequence	16785-16823	8	0.795
NC_015909_1	1.3\|22295\|39\|NC_015909\|CRISPRCasFinder	22295-22333	39	NC_017230	Borreliella afzelii PKo plasmid cp32-1, complete sequence	16783-16821	8	0.795
NC_015909_1	1.3\|22295\|39\|NC_015909\|CRISPRCasFinder	22295-22333	39	NC_015908	Borreliella bissettii DN127 plasmid cp32-3, complete sequence	17497-17535	8	0.795
NC_015909_1	1.3\|22295\|39\|NC_015909\|CRISPRCasFinder	22295-22333	39	NC_015906	Borreliella bissettii DN127 plasmid cp32-quad, complete sequence	58522-58560	9	0.769
NC_015909_1	1.3\|22295\|39\|NC_015909\|CRISPRCasFinder	22295-22333	39	NZ_CP009071	Borreliella afzelii K78 plasmid cp32-5, complete sequence	22495-22533	9	0.769
NC_015909_1	1.3\|22295\|39\|NC_015909\|CRISPRCasFinder	22295-22333	39	NC_015903	Borreliella bissettii DN127 plasmid cp32-11, complete sequence	22628-22666	9	0.769
NC_015909_1	1.3\|22295\|39\|NC_015909\|CRISPRCasFinder	22295-22333	39	NC_017226	Borreliella afzelii PKo plasmid cp32-3, complete sequence	22943-22981	9	0.769
NC_015909_1	1.3\|22295\|39\|NC_015909\|CRISPRCasFinder	22295-22333	39	NC_017226	Borreliella afzelii PKo plasmid cp32-3, complete sequence	23030-23068	9	0.769
NC_015909_1	1.3\|22295\|39\|NC_015909\|CRISPRCasFinder	22295-22333	39	NZ_CP009070	Borreliella afzelii K78 plasmid cp32-3, complete sequence	22137-22175	9	0.769
NC_015909_1	1.3\|22295\|39\|NC_015909\|CRISPRCasFinder	22295-22333	39	NZ_CP009070	Borreliella afzelii K78 plasmid cp32-3, complete sequence	22224-22262	9	0.769
NC_015909_1	1.3\|22295\|39\|NC_015909\|CRISPRCasFinder	22295-22333	39	NC_017227	Borreliella afzelii PKo plasmid cp32-5, complete sequence	22484-22522	10	0.744
NC_015909_1	1.3\|22295\|39\|NC_015909\|CRISPRCasFinder	22295-22333	39	NC_017227	Borreliella afzelii PKo plasmid cp32-5, complete sequence	22538-22576	10	0.744
NC_015909_1	1.3\|22295\|39\|NC_015909\|CRISPRCasFinder	22295-22333	39	NZ_CP009071	Borreliella afzelii K78 plasmid cp32-5, complete sequence	22441-22479	11	0.718

1. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NC_015909 (Borreliella bissettii DN127 plasmid cp32-5, complete sequence) position: , mismatch: 0, identity: 1.0

gtttaaatgctaaaatagatagtttag	CRISPR spacer
gtttaaatgctaaaatagatagtttag	Protospacer
***************************

2. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NC_015909 (Borreliella bissettii DN127 plasmid cp32-5, complete sequence) position: , mismatch: 0, identity: 1.0

ctttgcaaaaagatatatccagtttag	CRISPR spacer
ctttgcaaaaagatatatccagtttag	Protospacer
***************************

3. spacer 1.3|22295|39|NC_015909|CRISPRCasFinder matches to NC_015909 (Borreliella bissettii DN127 plasmid cp32-5, complete sequence) position: , mismatch: 0, identity: 1.0

aacttaattctaaaatagatagtgtaaaaaacgaactta	CRISPR spacer
aacttaattctaaaatagatagtgtaaaaaacgaactta	Protospacer
***************************************

4. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NZ_CP019918 (Borreliella burgdorferi strain PAbe plasmid p_cp32-5-1, complete sequence) position: , mismatch: 1, identity: 0.963

gtttaaatgctaaaatagatagtttag	CRISPR spacer
gtttaaatgccaaaatagatagtttag	Protospacer
**********.****************

5. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NZ_CP019919 (Borreliella burgdorferi strain PAbe plasmid p_cp32-2, complete sequence) position: , mismatch: 1, identity: 0.963

gtttaaatgctaaaatagatagtttag	CRISPR spacer
gtttaaatgccaaaatagatagtttag	Protospacer
**********.****************

6. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NC_018980 (Borrelia burgdorferi 297 plasmid 297_cp32-7, complete sequence) position: , mismatch: 1, identity: 0.963

gtttaaatgctaaaatagatagtttag	CRISPR spacer
gtttaaatgccaaaatagatagtttag	Protospacer
**********.****************

7. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NC_019003 (Borrelia burgdorferi 297 plasmid 297_cp32-1, complete sequence) position: , mismatch: 1, identity: 0.963

gtttaaatgctaaaatagatagtttag	CRISPR spacer
gtttaaatgccaaaatagatagtttag	Protospacer
**********.****************

8. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NC_017422 (Borreliella burgdorferi N40 plasmid N40_cp32-7, complete sequence) position: , mismatch: 1, identity: 0.963

gtttaaatgctaaaatagatagtttag	CRISPR spacer
gtttaaatgccaaaatagatagtttag	Protospacer
**********.****************

9. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NC_017394 (Borreliella burgdorferi JD1 plasmid JD1 cp32-1+5, complete sequence) position: , mismatch: 1, identity: 0.963

gtttaaatgctaaaatagatagtttag	CRISPR spacer
gtttaaatgccaaaatagatagtttag	Protospacer
**********.****************

10. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NZ_CP031407 (Borreliella burgdorferi strain MM1 plasmid plsm_cp32-7, complete sequence) position: , mismatch: 1, identity: 0.963

gtttaaatgctaaaatagatagtttag	CRISPR spacer
gtttaaatgccaaaatagatagtttag	Protospacer
**********.****************

11. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NZ_CP031408 (Borreliella burgdorferi strain MM1 plasmid plsm_cp32-1, complete sequence) position: , mismatch: 1, identity: 0.963

gtttaaatgctaaaatagatagtttag	CRISPR spacer
gtttaaatgccaaaatagatagtttag	Protospacer
**********.****************

12. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NZ_CP028881 (Borreliella bavariensis PBi plasmid cp32-7, complete sequence) position: , mismatch: 1, identity: 0.963

gtttaaatgctaaaatagatagtttag	CRISPR spacer
gtttaaatgccaaaatagatagtttag	Protospacer
**********.****************

13. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NC_000948 (Borreliella burgdorferi B31 plasmid cp32-1, complete sequence) position: , mismatch: 1, identity: 0.963

gtttaaatgctaaaatagatagtttag	CRISPR spacer
gtttaaatgccaaaatagatagtttag	Protospacer
**********.****************

14. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NC_000952 (Borreliella burgdorferi B31 plasmid cp32-7, complete sequence) position: , mismatch: 1, identity: 0.963

gtttaaatgctaaaatagatagtttag	CRISPR spacer
gtttaaatgccaaaatagatagtttag	Protospacer
**********.****************

15. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NZ_CP019846 (Borreliella burgdorferi plasmid cp32-1, complete sequence) position: , mismatch: 1, identity: 0.963

gtttaaatgctaaaatagatagtttag	CRISPR spacer
gtttaaatgccaaaatagatagtttag	Protospacer
**********.****************

16. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NZ_CP019756 (Borreliella burgdorferi strain B31_NRZ isolate B31 plasmid p_cp32-1_1, complete sequence) position: , mismatch: 1, identity: 0.963

gtttaaatgctaaaatagatagtttag	CRISPR spacer
gtttaaatgccaaaatagatagtttag	Protospacer
**********.****************

17. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NZ_CP019757 (Borreliella burgdorferi strain B31_NRZ isolate B31 plasmid p_cp32-2, complete sequence) position: , mismatch: 1, identity: 0.963

gtttaaatgctaaaatagatagtttag	CRISPR spacer
gtttaaatgccaaaatagatagtttag	Protospacer
**********.****************

18. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NC_011731 (Borreliella burgdorferi ZS7 plasmid ZS7_cp32-1, complete sequence) position: , mismatch: 1, identity: 0.963

gtttaaatgctaaaatagatagtttag	CRISPR spacer
gtttaaatgccaaaatagatagtttag	Protospacer
**********.****************

19. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NZ_CP017209 (Borreliella burgdorferi strain B331 plasmid B331_cp32_7, complete sequence) position: , mismatch: 1, identity: 0.963

gtttaaatgctaaaatagatagtttag	CRISPR spacer
gtttaaatgccaaaatagatagtttag	Protospacer
**********.****************

20. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NC_017423 (Borreliella burgdorferi N40 plasmid N40_cp32-12, complete sequence) position: , mismatch: 1, identity: 0.963

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttgcaaaaagatatatccagtttag	Protospacer
 **************************

21. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NZ_CP019919 (Borreliella burgdorferi strain PAbe plasmid p_cp32-2, complete sequence) position: , mismatch: 1, identity: 0.963

ctttgcaaaaagatatatccagtttag	CRISPR spacer
ctttacaaaaagatatatccagtttag	Protospacer
****.**********************

22. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NC_018980 (Borrelia burgdorferi 297 plasmid 297_cp32-7, complete sequence) position: , mismatch: 1, identity: 0.963

ctttgcaaaaagatatatccagtttag	CRISPR spacer
ctttacaaaaagatatatccagtttag	Protospacer
****.**********************

23. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NC_017422 (Borreliella burgdorferi N40 plasmid N40_cp32-7, complete sequence) position: , mismatch: 1, identity: 0.963

ctttgcaaaaagatatatccagtttag	CRISPR spacer
ctttacaaaaagatatatccagtttag	Protospacer
****.**********************

24. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NZ_CP031407 (Borreliella burgdorferi strain MM1 plasmid plsm_cp32-7, complete sequence) position: , mismatch: 1, identity: 0.963

ctttgcaaaaagatatatccagtttag	CRISPR spacer
ctttacaaaaagatatatccagtttag	Protospacer
****.**********************

25. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NZ_CP028881 (Borreliella bavariensis PBi plasmid cp32-7, complete sequence) position: , mismatch: 1, identity: 0.963

ctttgcaaaaagatatatccagtttag	CRISPR spacer
ctttacaaaaagatatatccagtttag	Protospacer
****.**********************

26. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NC_000952 (Borreliella burgdorferi B31 plasmid cp32-7, complete sequence) position: , mismatch: 1, identity: 0.963

ctttgcaaaaagatatatccagtttag	CRISPR spacer
ctttacaaaaagatatatccagtttag	Protospacer
****.**********************

27. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NZ_CP019757 (Borreliella burgdorferi strain B31_NRZ isolate B31 plasmid p_cp32-2, complete sequence) position: , mismatch: 1, identity: 0.963

ctttgcaaaaagatatatccagtttag	CRISPR spacer
ctttacaaaaagatatatccagtttag	Protospacer
****.**********************

28. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NZ_CP017209 (Borreliella burgdorferi strain B331 plasmid B331_cp32_7, complete sequence) position: , mismatch: 1, identity: 0.963

ctttgcaaaaagatatatccagtttag	CRISPR spacer
ctttacaaaaagatatatccagtttag	Protospacer
****.**********************

29. spacer 1.3|22295|39|NC_015909|CRISPRCasFinder matches to NC_015909 (Borreliella bissettii DN127 plasmid cp32-5, complete sequence) position: , mismatch: 1, identity: 0.974

aacttaattctaaaatagatagtgtaaaaaacgaactta	CRISPR spacer
aacttaattctaaaatagatagcgtaaaaaacgaactta	Protospacer
**********************.****************

30. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NC_018979 (Borrelia burgdorferi 297 plasmid 297_cp32-12, complete sequence) position: , mismatch: 2, identity: 0.926

gtttaaatgctaaaatagatagtttag	CRISPR spacer
atttaaatgccaaaatagatagtttag	Protospacer
.*********.****************

31. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NC_018979 (Borrelia burgdorferi 297 plasmid 297_cp32-12, complete sequence) position: , mismatch: 2, identity: 0.926

gtttaaatgctaaaatagatagtttag	CRISPR spacer
gcttaaatgccaaaatagatagtttag	Protospacer
*.********.****************

32. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NC_018979 (Borrelia burgdorferi 297 plasmid 297_cp32-12, complete sequence) position: , mismatch: 2, identity: 0.926

gtttaaatgctaaaatagatagtttag	CRISPR spacer
gcttaaatgccaaaatagatagtttag	Protospacer
*.********.****************

33. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NC_018979 (Borrelia burgdorferi 297 plasmid 297_cp32-12, complete sequence) position: , mismatch: 2, identity: 0.926

gtttaaatgctaaaatagatagtttag	CRISPR spacer
gcttaaatgccaaaatagatagtttag	Protospacer
*.********.****************

34. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NC_018979 (Borrelia burgdorferi 297 plasmid 297_cp32-12, complete sequence) position: , mismatch: 2, identity: 0.926

gtttaaatgctaaaatagatagtttag	CRISPR spacer
gcttaaatgccaaaatagatagtttag	Protospacer
*.********.****************

35. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NC_018981 (Borrelia burgdorferi 297 plasmid 297_cp32-5, complete sequence) position: , mismatch: 2, identity: 0.926

gtttaaatgctaaaatagatagtttag	CRISPR spacer
atttaaatgccaaaatagatagtttag	Protospacer
.*********.****************

36. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NC_018981 (Borrelia burgdorferi 297 plasmid 297_cp32-5, complete sequence) position: , mismatch: 2, identity: 0.926

gtttaaatgctaaaatagatagtttag	CRISPR spacer
atttaaatgccaaaatagatagtttag	Protospacer
.*********.****************

37. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NC_019006 (Borrelia burgdorferi 297 plasmid 297_cp32-3, complete sequence) position: , mismatch: 2, identity: 0.926

gtttaaatgctaaaatagatagtttag	CRISPR spacer
atttaaatgccaaaatagatagtttag	Protospacer
.*********.****************

38. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NC_019006 (Borrelia burgdorferi 297 plasmid 297_cp32-3, complete sequence) position: , mismatch: 2, identity: 0.926

gtttaaatgctaaaatagatagtttag	CRISPR spacer
atttaaatgccaaaatagatagtttag	Protospacer
.*********.****************

39. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NC_017427 (Borreliella burgdorferi JD1 plasmid JD1 cp32-3, complete sequence) position: , mismatch: 2, identity: 0.926

gtttaaatgctaaaatagatagtttag	CRISPR spacer
atttaaatgccaaaatagatagtttag	Protospacer
.*********.****************

40. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NC_017427 (Borreliella burgdorferi JD1 plasmid JD1 cp32-3, complete sequence) position: , mismatch: 2, identity: 0.926

gtttaaatgctaaaatagatagtttag	CRISPR spacer
atttaaatgccaaaatagatagtttag	Protospacer
.*********.****************

41. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NC_017396 (Borreliella burgdorferi JD1 plasmid JD1 cp32-12, complete sequence) position: , mismatch: 2, identity: 0.926

gtttaaatgctaaaatagatagtttag	CRISPR spacer
atttaaatgccaaaatagatagtttag	Protospacer
.*********.****************

42. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NC_017396 (Borreliella burgdorferi JD1 plasmid JD1 cp32-12, complete sequence) position: , mismatch: 2, identity: 0.926

gtttaaatgctaaaatagatagtttag	CRISPR spacer
gcttaaatgccaaaatagatagtttag	Protospacer
*.********.****************

43. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NC_017425 (Borreliella burgdorferi JD1 plasmid JD1 cp32-6, complete sequence) position: , mismatch: 2, identity: 0.926

gtttaaatgctaaaatagatagtttag	CRISPR spacer
atttaaatgccaaaatagatagtttag	Protospacer
.*********.****************

44. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NC_017425 (Borreliella burgdorferi JD1 plasmid JD1 cp32-6, complete sequence) position: , mismatch: 2, identity: 0.926

gtttaaatgctaaaatagatagtttag	CRISPR spacer
atttaaatgccaaaatagatagtttag	Protospacer
.*********.****************

45. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NC_017425 (Borreliella burgdorferi JD1 plasmid JD1 cp32-6, complete sequence) position: , mismatch: 2, identity: 0.926

gtttaaatgctaaaatagatagtttag	CRISPR spacer
gcttaaatgccaaaatagatagtttag	Protospacer
*.********.****************

46. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NC_017425 (Borreliella burgdorferi JD1 plasmid JD1 cp32-6, complete sequence) position: , mismatch: 2, identity: 0.926

gtttaaatgctaaaatagatagtttag	CRISPR spacer
gcttaaatgccaaaatagatagtttag	Protospacer
*.********.****************

47. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NC_017426 (Borreliella burgdorferi JD1 plasmid JD1 cp32-8, complete sequence) position: , mismatch: 2, identity: 0.926

gtttaaatgctaaaatagatagtttag	CRISPR spacer
atttaaatgccaaaatagatagtttag	Protospacer
.*********.****************

48. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NC_017426 (Borreliella burgdorferi JD1 plasmid JD1 cp32-8, complete sequence) position: , mismatch: 2, identity: 0.926

gtttaaatgctaaaatagatagtttag	CRISPR spacer
atttaaatgccaaaatagatagtttag	Protospacer
.*********.****************

49. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NC_011735 (Borreliella burgdorferi ZS7 plasmid ZS7_cp32-12, complete sequence) position: , mismatch: 2, identity: 0.926

gtttaaatgctaaaatagatagtttag	CRISPR spacer
atttaaatgccaaaatagatagtttag	Protospacer
.*********.****************

50. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NC_011735 (Borreliella burgdorferi ZS7 plasmid ZS7_cp32-12, complete sequence) position: , mismatch: 2, identity: 0.926

gtttaaatgctaaaatagatagtttag	CRISPR spacer
gcttaaatgccaaaatagatagtttag	Protospacer
*.********.****************

51. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NZ_CP017205 (Borreliella burgdorferi strain B331 plasmid B331_cp32_11, complete sequence) position: , mismatch: 2, identity: 0.926

gtttaaatgctaaaatagatagtttag	CRISPR spacer
atttaaatgccaaaatagatagtttag	Protospacer
.*********.****************

52. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NZ_CP017205 (Borreliella burgdorferi strain B331 plasmid B331_cp32_11, complete sequence) position: , mismatch: 2, identity: 0.926

gtttaaatgctaaaatagatagtttag	CRISPR spacer
atttaaatgccaaaatagatagtttag	Protospacer
.*********.****************

53. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NC_019005 (Borrelia burgdorferi 297 plasmid 297_cp32-6, complete sequence) position: , mismatch: 2, identity: 0.926

gtttaaatgctaaaatagatagtttag	CRISPR spacer
gcttaaatgccaaaatagatagtttag	Protospacer
*.********.****************

54. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NC_019005 (Borrelia burgdorferi 297 plasmid 297_cp32-6, complete sequence) position: , mismatch: 2, identity: 0.926

gtttaaatgctaaaatagatagtttag	CRISPR spacer
gcttaaatgccaaaatagatagtttag	Protospacer
*.********.****************

55. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NZ_CP009071 (Borreliella afzelii K78 plasmid cp32-5, complete sequence) position: , mismatch: 2, identity: 0.926

gtttaaatgctaaaatagatagtttag	CRISPR spacer
gtttaaatgctaagatagatggtttag	Protospacer
*************.******.******

56. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NC_015904 (Borreliella bissettii DN127 plasmid cp32-4, complete sequence) position: , mismatch: 2, identity: 0.926

gtttaaatgctaaaatagatagtttag	CRISPR spacer
gtttaaatgctaagatagatagcttag	Protospacer
*************.********.****

57. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NC_015906 (Borreliella bissettii DN127 plasmid cp32-quad, complete sequence) position: , mismatch: 2, identity: 0.926

gtttaaatgctaaaatagatagtttag	CRISPR spacer
gtttaactgccaaaatagatagtttag	Protospacer
****** ***.****************

58. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NC_015906 (Borreliella bissettii DN127 plasmid cp32-quad, complete sequence) position: , mismatch: 2, identity: 0.926

gtttaaatgctaaaatagatagtttag	CRISPR spacer
gtttaactgccaaaatagatagtttag	Protospacer
****** ***.****************

59. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NC_015908 (Borreliella bissettii DN127 plasmid cp32-3, complete sequence) position: , mismatch: 2, identity: 0.926

gtttaaatgctaaaatagatagtttag	CRISPR spacer
gtttaaataccaaaatagatagtttag	Protospacer
********.*.****************

60. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NC_015908 (Borreliella bissettii DN127 plasmid cp32-3, complete sequence) position: , mismatch: 2, identity: 0.926

gtttaaatgctaaaatagatagtttag	CRISPR spacer
gtttaaataccaaaatagatagtttag	Protospacer
********.*.****************

61. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NZ_CP031405 (Borreliella burgdorferi strain MM1 plasmid plsm_cp32-6, complete sequence) position: , mismatch: 2, identity: 0.926

gtttaaatgctaaaatagatagtttag	CRISPR spacer
gcttaaatgccaaaatagatagtttag	Protospacer
*.********.****************

62. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NZ_CP031405 (Borreliella burgdorferi strain MM1 plasmid plsm_cp32-6, complete sequence) position: , mismatch: 2, identity: 0.926

gtttaaatgctaaaatagatagtttag	CRISPR spacer
gcttaaatgccaaaatagatagtttag	Protospacer
*.********.****************

63. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NC_000951 (Borreliella burgdorferi B31 plasmid cp32-6, complete sequence) position: , mismatch: 2, identity: 0.926

gtttaaatgctaaaatagatagtttag	CRISPR spacer
gcttaaatgccaaaatagatagtttag	Protospacer
*.********.****************

64. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NC_000951 (Borreliella burgdorferi B31 plasmid cp32-6, complete sequence) position: , mismatch: 2, identity: 0.926

gtttaaatgctaaaatagatagtttag	CRISPR spacer
gcttaaatgccaaaatagatagtttag	Protospacer
*.********.****************

65. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NZ_CP015802 (Borrelia mayonii strain MN14-1539 plasmid cp32-6, complete sequence) position: , mismatch: 2, identity: 0.926

gtttaaatgctaaaatagatagtttag	CRISPR spacer
gcttaaatgccaaaatagatagtttag	Protospacer
*.********.****************

66. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NZ_CP015802 (Borrelia mayonii strain MN14-1539 plasmid cp32-6, complete sequence) position: , mismatch: 2, identity: 0.926

gtttaaatgctaaaatagatagtttag	CRISPR spacer
gcttaaatgccaaaatagatagtttag	Protospacer
*.********.****************

67. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NZ_CP017208 (Borreliella burgdorferi strain B331 plasmid B331_cp32_6, complete sequence) position: , mismatch: 2, identity: 0.926

gtttaaatgctaaaatagatagtttag	CRISPR spacer
gcttaaatgccaaaatagatagtttag	Protospacer
*.********.****************

68. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NZ_CP017208 (Borreliella burgdorferi strain B331 plasmid B331_cp32_6, complete sequence) position: , mismatch: 2, identity: 0.926

gtttaaatgctaaaatagatagtttag	CRISPR spacer
gcttaaatgccaaaatagatagtttag	Protospacer
*.********.****************

69. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NC_015904 (Borreliella bissettii DN127 plasmid cp32-4, complete sequence) position: , mismatch: 2, identity: 0.926

ctttgcaaaaagatatatccagtttag	CRISPR spacer
ctttgcaaaaagatatatctagtttaa	Protospacer
*******************.******.

70. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NC_015906 (Borreliella bissettii DN127 plasmid cp32-quad, complete sequence) position: , mismatch: 2, identity: 0.926

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttgcaaaaagatatatctagtttag	Protospacer
 ******************.*******

71. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NC_015906 (Borreliella bissettii DN127 plasmid cp32-quad, complete sequence) position: , mismatch: 2, identity: 0.926

ctttgcaaaaagatatatccagtttag	CRISPR spacer
ctttgcaaaaagatatctctagtttag	Protospacer
**************** **.*******

72. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NZ_CP019918 (Borreliella burgdorferi strain PAbe plasmid p_cp32-5-1, complete sequence) position: , mismatch: 2, identity: 0.926

ctttgcaaaaagatatatccagtttag	CRISPR spacer
ctttgcaaaaagatatatctagtttgg	Protospacer
*******************.*****.*

73. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NZ_CP019921 (Borreliella burgdorferi strain PAbe plasmid p_cp32-9-4, complete sequence) position: , mismatch: 2, identity: 0.926

ctttgcaaaaagatatatccagtttag	CRISPR spacer
ctttgcaaaaagatatatctagtctag	Protospacer
*******************.***.***

74. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NC_018981 (Borrelia burgdorferi 297 plasmid 297_cp32-5, complete sequence) position: , mismatch: 2, identity: 0.926

ctttgcaaaaagatatatccagtttag	CRISPR spacer
ctttgcaaaaagatatatctagtttgg	Protospacer
*******************.*****.*

75. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NC_018984 (Borrelia burgdorferi 297 plasmid 297_cp32-4, complete sequence) position: , mismatch: 2, identity: 0.926

ctttgcaaaaagatatatccagtttag	CRISPR spacer
ctttgcaaaaagatatatctagtctag	Protospacer
*******************.***.***

76. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NC_017398 (Borreliella burgdorferi N40 plasmid N40_cp32-5, complete sequence) position: , mismatch: 2, identity: 0.926

ctttgcaaaaagatatatccagtttag	CRISPR spacer
ctttgcaaaaagatatatctagtttgg	Protospacer
*******************.*****.*

77. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NC_017400 (Borreliella burgdorferi N40 plasmid N40_cp32-4, complete sequence) position: , mismatch: 2, identity: 0.926

ctttgcaaaaagatatatccagtttag	CRISPR spacer
ctttgcaaaaagatatatctagtttgg	Protospacer
*******************.*****.*

78. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NC_017394 (Borreliella burgdorferi JD1 plasmid JD1 cp32-1+5, complete sequence) position: , mismatch: 2, identity: 0.926

ctttgcaaaaagatatatccagtttag	CRISPR spacer
ctttgcaaaaagatatatctagtttgg	Protospacer
*******************.*****.*

79. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NZ_CP031411 (Borreliella burgdorferi strain MM1 plasmid plsm_cp32-5, complete sequence) position: , mismatch: 2, identity: 0.926

ctttgcaaaaagatatatccagtttag	CRISPR spacer
ctttgcaaaaagatatatctagtttgg	Protospacer
*******************.*****.*

80. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NZ_CP015799 (Borrelia mayonii strain MN14-1539 plasmid cp32-13, complete sequence) position: , mismatch: 2, identity: 0.926

ctttgcaaaaagatatatccagtttag	CRISPR spacer
ctttgcaaaaagatatatctagtttgg	Protospacer
*******************.*****.*

81. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NZ_CP015801 (Borrelia mayonii strain MN14-1539 plasmid cp32-4, complete sequence) position: , mismatch: 2, identity: 0.926

ctttgcaaaaagatatatccagtttag	CRISPR spacer
ctttgcaaaaagatatatctagtctag	Protospacer
*******************.***.***

82. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NZ_CP019848 (Borreliella burgdorferi plasmid cp32-4, complete sequence) position: , mismatch: 2, identity: 0.926

ctttgcaaaaagatatatccagtttag	CRISPR spacer
ctttgcaaaaagatatatctagtctag	Protospacer
*******************.***.***

83. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NZ_CP019849 (Borreliella burgdorferi plasmid cp32-5, complete sequence) position: , mismatch: 2, identity: 0.926

ctttgcaaaaagatatatccagtttag	CRISPR spacer
ctttgcaaaaagatatatctagtttgg	Protospacer
*******************.*****.*

84. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NZ_CP019756 (Borreliella burgdorferi strain B31_NRZ isolate B31 plasmid p_cp32-1_1, complete sequence) position: , mismatch: 2, identity: 0.926

ctttgcaaaaagatatatccagtttag	CRISPR spacer
ctttgcaaaaagatatatctagtttgg	Protospacer
*******************.*****.*

85. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NZ_CP019759 (Borreliella burgdorferi strain B31_NRZ isolate B31 plasmid p_cp32-4, complete sequence) position: , mismatch: 2, identity: 0.926

ctttgcaaaaagatatatccagtttag	CRISPR spacer
ctttgcaaaaagatatatctagtctag	Protospacer
*******************.***.***

86. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NC_011736 (Borreliella burgdorferi ZS7 plasmid ZS7_cp32-4, complete sequence) position: , mismatch: 2, identity: 0.926

ctttgcaaaaagatatatccagtttag	CRISPR spacer
ctttgcaaaaagatatatctagtctag	Protospacer
*******************.***.***

87. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NZ_CP017207 (Borreliella burgdorferi strain B331 plasmid B331_cp32_5, complete sequence) position: , mismatch: 2, identity: 0.926

ctttgcaaaaagatatatccagtttag	CRISPR spacer
ctttgcaaaaagatatatctagtttgg	Protospacer
*******************.*****.*

88. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NC_017224 (Borreliella afzelii PKo plasmid cp32-11, complete sequence) position: , mismatch: 2, identity: 0.926

ctttgcaaaaagatatatccagtttag	CRISPR spacer
ctttacaaaaagatatatccaatttag	Protospacer
****.****************.*****

89. spacer 1.3|22295|39|NC_015909|CRISPRCasFinder matches to NC_015905 (Borreliella bissettii DN127 plasmid cp32-6, complete sequence) position: , mismatch: 2, identity: 0.949

aacttaattctaaaatagatagtgtaaaaaacgaactta	CRISPR spacer
aacttaattctaaaatagatagtgttaaaaatgaactta	Protospacer
************************* *****.*******

90. spacer 1.3|22295|39|NC_015909|CRISPRCasFinder matches to NC_015905 (Borreliella bissettii DN127 plasmid cp32-6, complete sequence) position: , mismatch: 2, identity: 0.949

aacttaattctaaaatagatagtgtaaaaaacgaactta	CRISPR spacer
aacttaattctaaaatagatagtgttaaaaatgaactta	Protospacer
************************* *****.*******

91. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NC_019006 (Borrelia burgdorferi 297 plasmid 297_cp32-3, complete sequence) position: , mismatch: 3, identity: 0.889

gtttaaatgctaaaatagatagtttag	CRISPR spacer
atttaaatgccaaaatagatagtgtag	Protospacer
.*********.************ ***

92. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NC_017427 (Borreliella burgdorferi JD1 plasmid JD1 cp32-3, complete sequence) position: , mismatch: 3, identity: 0.889

gtttaaatgctaaaatagatagtttag	CRISPR spacer
atttaaatgccaaaatagatagtgtag	Protospacer
.*********.************ ***

93. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NC_017425 (Borreliella burgdorferi JD1 plasmid JD1 cp32-6, complete sequence) position: , mismatch: 3, identity: 0.889

gtttaaatgctaaaatagatagtttag	CRISPR spacer
atttaaatgccaaaatagatagtgtag	Protospacer
.*********.************ ***

94. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NC_017426 (Borreliella burgdorferi JD1 plasmid JD1 cp32-8, complete sequence) position: , mismatch: 3, identity: 0.889

gtttaaatgctaaaatagatagtttag	CRISPR spacer
atttaaatgccaaaatagatagtgtag	Protospacer
.*********.************ ***

95. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NC_019005 (Borrelia burgdorferi 297 plasmid 297_cp32-6, complete sequence) position: , mismatch: 3, identity: 0.889

gtttaaatgctaaaatagatagtttag	CRISPR spacer
atttaaatgccaaaatagatagtgtag	Protospacer
.*********.************ ***

96. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NC_017428 (Borreliella burgdorferi JD1 plasmid JD1 cp32-10, complete sequence) position: , mismatch: 3, identity: 0.889

gtttaaatgctaaaatagatagtttag	CRISPR spacer
atttaaatgccaaaatagatagtgtag	Protospacer
.*********.************ ***

97. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NC_017428 (Borreliella burgdorferi JD1 plasmid JD1 cp32-10, complete sequence) position: , mismatch: 3, identity: 0.889

gtttaaatgctaaaatagatagtttag	CRISPR spacer
atttaaatgccaaaatagatagtgtag	Protospacer
.*********.************ ***

98. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NC_015905 (Borreliella bissettii DN127 plasmid cp32-6, complete sequence) position: , mismatch: 3, identity: 0.889

gtttaaatgctaaaatagatagtttag	CRISPR spacer
gcttaaatgccaaaatagagagtttag	Protospacer
*.********.******** *******

99. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NC_017227 (Borreliella afzelii PKo plasmid cp32-5, complete sequence) position: , mismatch: 3, identity: 0.889

gtttaaatgctaaaatagatagtttag	CRISPR spacer
gcttaaatgctaagatagatggtttag	Protospacer
*.***********.******.******

100. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NC_017423 (Borreliella burgdorferi N40 plasmid N40_cp32-12, complete sequence) position: , mismatch: 3, identity: 0.889

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttgcaaaaagatatatctaatttag	Protospacer
 ******************.*.*****

101. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NZ_CP019918 (Borreliella burgdorferi strain PAbe plasmid p_cp32-5-1, complete sequence) position: , mismatch: 3, identity: 0.889

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttgcaaaaagatatatctagtttgg	Protospacer
 ******************.*****.*

102. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NZ_CP019918 (Borreliella burgdorferi strain PAbe plasmid p_cp32-5-1, complete sequence) position: , mismatch: 3, identity: 0.889

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttgaaaaaagatatatctagtttag	Protospacer
 **** *************.*******

103. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NZ_CP019921 (Borreliella burgdorferi strain PAbe plasmid p_cp32-9-4, complete sequence) position: , mismatch: 3, identity: 0.889

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttgcaaaaagacatatctagtttag	Protospacer
 ************.*****.*******

104. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NC_018979 (Borrelia burgdorferi 297 plasmid 297_cp32-12, complete sequence) position: , mismatch: 3, identity: 0.889

ctttgcaaaaagatatatccagtttag	CRISPR spacer
ctttgcaaaaagatatatctagtttga	Protospacer
*******************.*****..

105. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NC_018981 (Borrelia burgdorferi 297 plasmid 297_cp32-5, complete sequence) position: , mismatch: 3, identity: 0.889

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttacaaaaagatatatccaatttag	Protospacer
 ***.****************.*****

106. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NC_018984 (Borrelia burgdorferi 297 plasmid 297_cp32-4, complete sequence) position: , mismatch: 3, identity: 0.889

ctttgcaaaaagatatatccagtttag	CRISPR spacer
ctttgcaaaaagatatatctagtttga	Protospacer
*******************.*****..

107. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NC_018984 (Borrelia burgdorferi 297 plasmid 297_cp32-4, complete sequence) position: , mismatch: 3, identity: 0.889

ctttgcaaaaagatatatccagtttag	CRISPR spacer
ctttgcaaaaagatatatctagtttga	Protospacer
*******************.*****..

108. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NC_017394 (Borreliella burgdorferi JD1 plasmid JD1 cp32-1+5, complete sequence) position: , mismatch: 3, identity: 0.889

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttgcaaaaagatatatctagtttaa	Protospacer
 ******************.******.

109. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NC_017394 (Borreliella burgdorferi JD1 plasmid JD1 cp32-1+5, complete sequence) position: , mismatch: 3, identity: 0.889

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttgcaaaaagatatatctagtttgg	Protospacer
 ******************.*****.*

110. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NC_017394 (Borreliella burgdorferi JD1 plasmid JD1 cp32-1+5, complete sequence) position: , mismatch: 3, identity: 0.889

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttgaaaaaagatatatctagtttag	Protospacer
 **** *************.*******

111. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NC_017396 (Borreliella burgdorferi JD1 plasmid JD1 cp32-12, complete sequence) position: , mismatch: 3, identity: 0.889

ctttgcaaaaagatatatccagtttag	CRISPR spacer
ctttgcaaaaagatatatctagtttga	Protospacer
*******************.*****..

112. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NC_015905 (Borreliella bissettii DN127 plasmid cp32-6, complete sequence) position: , mismatch: 3, identity: 0.889

ctttgcaaaaagatatatccagtttag	CRISPR spacer
ctttgcaaaaagatatatctagtttga	Protospacer
*******************.*****..

113. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NC_015905 (Borreliella bissettii DN127 plasmid cp32-6, complete sequence) position: , mismatch: 3, identity: 0.889

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttgcaaaaagacatatctagtttag	Protospacer
 ************.*****.*******

114. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NZ_CP031410 (Borreliella burgdorferi strain MM1 plasmid plsm_cp32-4, complete sequence) position: , mismatch: 3, identity: 0.889

ctttgcaaaaagatatatccagtttag	CRISPR spacer
ctttgcaaaaagatatatctagtttga	Protospacer
*******************.*****..

115. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NZ_CP031410 (Borreliella burgdorferi strain MM1 plasmid plsm_cp32-4, complete sequence) position: , mismatch: 3, identity: 0.889

ctttgcaaaaagatatatccagtttag	CRISPR spacer
ctttgcaaaaagatatatctagtgtaa	Protospacer
*******************.*** **.

116. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NZ_CP015801 (Borrelia mayonii strain MN14-1539 plasmid cp32-4, complete sequence) position: , mismatch: 3, identity: 0.889

ctttgcaaaaagatatatccagtttag	CRISPR spacer
ctttgcaaaaagatatatctagtttga	Protospacer
*******************.*****..

117. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NZ_CP015801 (Borrelia mayonii strain MN14-1539 plasmid cp32-4, complete sequence) position: , mismatch: 3, identity: 0.889

ctttgcaaaaagatatatccagtttag	CRISPR spacer
ctttgcaaaaagatatatctagtgtaa	Protospacer
*******************.*** **.

118. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NZ_CP019756 (Borreliella burgdorferi strain B31_NRZ isolate B31 plasmid p_cp32-1_1, complete sequence) position: , mismatch: 3, identity: 0.889

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttgcaaaaagatatatctagtttgg	Protospacer
 ******************.*****.*

119. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NZ_CP019756 (Borreliella burgdorferi strain B31_NRZ isolate B31 plasmid p_cp32-1_1, complete sequence) position: , mismatch: 3, identity: 0.889

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttgaaaaaagatatatctagtttag	Protospacer
 **** *************.*******

120. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NC_011735 (Borreliella burgdorferi ZS7 plasmid ZS7_cp32-12, complete sequence) position: , mismatch: 3, identity: 0.889

ctttgcaaaaagatatatccagtttag	CRISPR spacer
ctttgcaaaaagatatatctagtttga	Protospacer
*******************.*****..

121. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NC_011736 (Borreliella burgdorferi ZS7 plasmid ZS7_cp32-4, complete sequence) position: , mismatch: 3, identity: 0.889

ctttgcaaaaagatatatccagtttag	CRISPR spacer
ctttgcaaaaagatatatctagtttga	Protospacer
*******************.*****..

122. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NC_011736 (Borreliella burgdorferi ZS7 plasmid ZS7_cp32-4, complete sequence) position: , mismatch: 3, identity: 0.889

ctttgcaaaaagatatatccagtttag	CRISPR spacer
ctttgcaaaaagatatatctagtttga	Protospacer
*******************.*****..

123. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NC_019005 (Borrelia burgdorferi 297 plasmid 297_cp32-6, complete sequence) position: , mismatch: 3, identity: 0.889

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttacaaaaagatatatccaatttag	Protospacer
 ***.****************.*****

124. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NZ_CP019926 (Borreliella burgdorferi strain PAbe plasmid p_lp56, complete sequence) position: , mismatch: 3, identity: 0.889

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttacaaaaagatatatccaatttag	Protospacer
 ***.****************.*****

125. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NC_019003 (Borrelia burgdorferi 297 plasmid 297_cp32-1, complete sequence) position: , mismatch: 3, identity: 0.889

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttgcaaaaagatatatctagtttgg	Protospacer
 ******************.*****.*

126. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NC_019003 (Borrelia burgdorferi 297 plasmid 297_cp32-1, complete sequence) position: , mismatch: 3, identity: 0.889

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttgaaaaaagatatatctagtttag	Protospacer
 **** *************.*******

127. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NC_019006 (Borrelia burgdorferi 297 plasmid 297_cp32-3, complete sequence) position: , mismatch: 3, identity: 0.889

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttacaaaaagatatatccaatttag	Protospacer
 ***.****************.*****

128. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NC_017427 (Borreliella burgdorferi JD1 plasmid JD1 cp32-3, complete sequence) position: , mismatch: 3, identity: 0.889

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttacaaaaagatatatccaatttag	Protospacer
 ***.****************.*****

129. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NC_017402 (Borreliella burgdorferi N40 plasmid N40_cp32-9, complete sequence) position: , mismatch: 3, identity: 0.889

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttgcaaaaagacatatctagtttag	Protospacer
 ************.*****.*******

130. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NC_017397 (Borreliella burgdorferi JD1 plasmid JD1 cp32-9, complete sequence) position: , mismatch: 3, identity: 0.889

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttgcaaaaagacatatctagtttag	Protospacer
 ************.*****.*******

131. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NC_017408 (Borreliella burgdorferi JD1 plasmid JD1 lp28-6, complete sequence) position: , mismatch: 3, identity: 0.889

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttacaaaaagatatatccaatttag	Protospacer
 ***.****************.*****

132. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NC_017425 (Borreliella burgdorferi JD1 plasmid JD1 cp32-6, complete sequence) position: , mismatch: 3, identity: 0.889

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttacaaaaagatatatccaatttag	Protospacer
 ***.****************.*****

133. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NC_017426 (Borreliella burgdorferi JD1 plasmid JD1 cp32-8, complete sequence) position: , mismatch: 3, identity: 0.889

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttacaaaaagatatatccaatttag	Protospacer
 ***.****************.*****

134. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NC_017426 (Borreliella burgdorferi JD1 plasmid JD1 cp32-8, complete sequence) position: , mismatch: 3, identity: 0.889

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttacaaaaagatatatctagtttag	Protospacer
 ***.**************.*******

135. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NC_015915 (Borreliella bissettii DN127 plasmid lp17, complete sequence) position: , mismatch: 3, identity: 0.889

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttacaaaaagatatatccaatttag	Protospacer
 ***.****************.*****

136. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NC_015915 (Borreliella bissettii DN127 plasmid lp17, complete sequence) position: , mismatch: 3, identity: 0.889

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttacaaaaagatatatccaatttag	Protospacer
 ***.****************.*****

137. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NZ_CP031406 (Borreliella burgdorferi strain MM1 plasmid plsm_cp32-9, complete sequence) position: , mismatch: 3, identity: 0.889

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttgcaaaaagacatatctagtttag	Protospacer
 ************.*****.*******

138. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NZ_CP031408 (Borreliella burgdorferi strain MM1 plasmid plsm_cp32-1, complete sequence) position: , mismatch: 3, identity: 0.889

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttgcaaaaagatatatctagtttgg	Protospacer
 ******************.*****.*

139. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NZ_CP031408 (Borreliella burgdorferi strain MM1 plasmid plsm_cp32-1, complete sequence) position: , mismatch: 3, identity: 0.889

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttgaaaaaagatatatctagtttag	Protospacer
 **** *************.*******

140. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NC_011722 (Borreliella burgdorferi ZS7 plasmid ZS7_cp32-9, complete sequence) position: , mismatch: 3, identity: 0.889

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttgcaaaaagacatatctagtttag	Protospacer
 ************.*****.*******

141. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NC_000948 (Borreliella burgdorferi B31 plasmid cp32-1, complete sequence) position: , mismatch: 3, identity: 0.889

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttgcaaaaagatatatctagtttgg	Protospacer
 ******************.*****.*

142. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NC_000948 (Borreliella burgdorferi B31 plasmid cp32-1, complete sequence) position: , mismatch: 3, identity: 0.889

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttgaaaaaagatatatctagtttag	Protospacer
 **** *************.*******

143. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NC_000953 (Borreliella burgdorferi B31 plasmid cp32-8, complete sequence) position: , mismatch: 3, identity: 0.889

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttacaaaaagatatatctagtttag	Protospacer
 ***.**************.*******

144. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NC_000954 (Borreliella burgdorferi B31 plasmid cp32-9, complete sequence) position: , mismatch: 3, identity: 0.889

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttgcaaaaagacatatctagtttag	Protospacer
 ************.*****.*******

145. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NC_000956 (Borreliella burgdorferi B31 plasmid lp56, complete sequence) position: , mismatch: 3, identity: 0.889

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttacaaaaagatatatccaatttag	Protospacer
 ***.****************.*****

146. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NZ_CP019846 (Borreliella burgdorferi plasmid cp32-1, complete sequence) position: , mismatch: 3, identity: 0.889

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttgcaaaaagatatatctagtttgg	Protospacer
 ******************.*****.*

147. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NZ_CP019846 (Borreliella burgdorferi plasmid cp32-1, complete sequence) position: , mismatch: 3, identity: 0.889

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttgaaaaaagatatatctagtttag	Protospacer
 **** *************.*******

148. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NZ_CP019850 (Borreliella burgdorferi plasmid cp32-9, complete sequence) position: , mismatch: 3, identity: 0.889

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttgcaaaaagacatatctagtttag	Protospacer
 ************.*****.*******

149. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NZ_CP019855 (Borreliella burgdorferi plasmid lp56, complete sequence) position: , mismatch: 3, identity: 0.889

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttacaaaaagatatatccaatttag	Protospacer
 ***.****************.*****

150. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NZ_CP019760 (Borreliella burgdorferi strain B31_NRZ isolate B31 plasmid p_cp32-9, complete sequence) position: , mismatch: 3, identity: 0.889

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttgcaaaaagacatatctagtttag	Protospacer
 ************.*****.*******

151. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NZ_CP019766 (Borreliella burgdorferi strain B31_NRZ isolate B31 plasmid p_lp56, complete sequence) position: , mismatch: 3, identity: 0.889

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttacaaaaagatatatccaatttag	Protospacer
 ***.****************.*****

152. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NC_011731 (Borreliella burgdorferi ZS7 plasmid ZS7_cp32-1, complete sequence) position: , mismatch: 3, identity: 0.889

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttgcaaaaagatatatctagtttgg	Protospacer
 ******************.*****.*

153. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NC_011731 (Borreliella burgdorferi ZS7 plasmid ZS7_cp32-1, complete sequence) position: , mismatch: 3, identity: 0.889

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttgaaaaaagatatatctagtttag	Protospacer
 **** *************.*******

154. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NZ_CP017203 (Borreliella burgdorferi strain B331 plasmid B331_cp32_1, complete sequence) position: , mismatch: 3, identity: 0.889

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttacaaaaagatatatctagtttag	Protospacer
 ***.**************.*******

155. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NZ_CP017205 (Borreliella burgdorferi strain B331 plasmid B331_cp32_11, complete sequence) position: , mismatch: 3, identity: 0.889

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttacaaaaagatatatccaatttag	Protospacer
 ***.****************.*****

156. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NZ_CP017206 (Borreliella burgdorferi strain B331 plasmid B331_cp32_4, complete sequence) position: , mismatch: 3, identity: 0.889

ctttgcaaaaagatatatccagtttag	CRISPR spacer
ctttgcaaaaagatatatctagtgtaa	Protospacer
*******************.*** **.

157. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NZ_CP017206 (Borreliella burgdorferi strain B331 plasmid B331_cp32_4, complete sequence) position: , mismatch: 3, identity: 0.889

ctttgcaaaaagatatatccagtttag	CRISPR spacer
ctttgcaaaaagatatatctagtgtaa	Protospacer
*******************.*** **.

158. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NC_017240 (Borreliella afzelii PKo plasmid lp32-10, complete sequence) position: , mismatch: 3, identity: 0.889

ctttgcaaaaagatatatccagtttag	CRISPR spacer
gtttgtaaaaagatatatctagtttag	Protospacer
 ****.*************.*******

159. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NZ_CP028875 (Borreliella bavariensis PBi plasmid lp28-4_cp32-1, complete sequence) position: , mismatch: 3, identity: 0.889

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttgcaaaaagatatatctaatttag	Protospacer
 ******************.*.*****

160. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NZ_CP017215 (Borreliella burgdorferi strain B331 plasmid B331_lp28_6, complete sequence) position: , mismatch: 3, identity: 0.889

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttacaaaaagatatatccaatttag	Protospacer
 ***.****************.*****

161. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NZ_CP017215 (Borreliella burgdorferi strain B331 plasmid B331_lp28_6, complete sequence) position: , mismatch: 3, identity: 0.889

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttacaaaaagatatatccaatttag	Protospacer
 ***.****************.*****

162. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NZ_CP017215 (Borreliella burgdorferi strain B331 plasmid B331_lp28_6, complete sequence) position: , mismatch: 3, identity: 0.889

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttacaaaaagatatatccaatttag	Protospacer
 ***.****************.*****

163. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NC_017225 (Borreliella afzelii PKo plasmid cp32-12, complete sequence) position: , mismatch: 4, identity: 0.852

gtttaaatgctaaaatagatagtttag	CRISPR spacer
atttaaatactaaaatagatagtgtaa	Protospacer
.*******.************** **.

164. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NZ_CP019926 (Borreliella burgdorferi strain PAbe plasmid p_lp56, complete sequence) position: , mismatch: 4, identity: 0.852

gtttaaatgctaaaatagatagtttag	CRISPR spacer
atttaaatgccaaaatagatagtgtgg	Protospacer
.*********.************ *.*

165. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NC_000953 (Borreliella burgdorferi B31 plasmid cp32-8, complete sequence) position: , mismatch: 4, identity: 0.852

gtttaaatgctaaaatagatagtttag	CRISPR spacer
atttaaatgccaaaatagatagtgttg	Protospacer
.*********.************ * *

166. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NC_000956 (Borreliella burgdorferi B31 plasmid lp56, complete sequence) position: , mismatch: 4, identity: 0.852

gtttaaatgctaaaatagatagtttag	CRISPR spacer
atttaaatgccaaaatagatagtgtgg	Protospacer
.*********.************ *.*

167. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NZ_CP019855 (Borreliella burgdorferi plasmid lp56, complete sequence) position: , mismatch: 4, identity: 0.852

gtttaaatgctaaaatagatagtttag	CRISPR spacer
atttaaatgccaaaatagatagtgtgg	Protospacer
.*********.************ *.*

168. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NZ_CP019766 (Borreliella burgdorferi strain B31_NRZ isolate B31 plasmid p_lp56, complete sequence) position: , mismatch: 4, identity: 0.852

gtttaaatgctaaaatagatagtttag	CRISPR spacer
atttaaatgccaaaatagatagtgtgg	Protospacer
.*********.************ *.*

169. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NZ_CP019918 (Borreliella burgdorferi strain PAbe plasmid p_cp32-5-1, complete sequence) position: , mismatch: 4, identity: 0.852

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttacaaaaagatatatctagtttaa	Protospacer
 ***.**************.******.

170. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NZ_CP019921 (Borreliella burgdorferi strain PAbe plasmid p_cp32-9-4, complete sequence) position: , mismatch: 4, identity: 0.852

ctttgcaaaaagatatatccagtttag	CRISPR spacer
ctttgcaaaaagatatatctagcttga	Protospacer
*******************.**.**..

171. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NC_018981 (Borrelia burgdorferi 297 plasmid 297_cp32-5, complete sequence) position: , mismatch: 4, identity: 0.852

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttacaaaaagatatatctagtttaa	Protospacer
 ***.**************.******.

172. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NC_017398 (Borreliella burgdorferi N40 plasmid N40_cp32-5, complete sequence) position: , mismatch: 4, identity: 0.852

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttacaaaaagatatatctagtttaa	Protospacer
 ***.**************.******.

173. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NZ_CP031410 (Borreliella burgdorferi strain MM1 plasmid plsm_cp32-4, complete sequence) position: , mismatch: 4, identity: 0.852

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttacaaaaagatatatctagtttaa	Protospacer
 ***.**************.******.

174. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NZ_CP031411 (Borreliella burgdorferi strain MM1 plasmid plsm_cp32-5, complete sequence) position: , mismatch: 4, identity: 0.852

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttacaaaaagatatatctagtttaa	Protospacer
 ***.**************.******.

175. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NZ_CP015799 (Borrelia mayonii strain MN14-1539 plasmid cp32-13, complete sequence) position: , mismatch: 4, identity: 0.852

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttacaaaaagatatatctagtttaa	Protospacer
 ***.**************.******.

176. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NZ_CP019849 (Borreliella burgdorferi plasmid cp32-5, complete sequence) position: , mismatch: 4, identity: 0.852

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttacaaaaagatatatctagtttaa	Protospacer
 ***.**************.******.

177. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NZ_CP019756 (Borreliella burgdorferi strain B31_NRZ isolate B31 plasmid p_cp32-1_1, complete sequence) position: , mismatch: 4, identity: 0.852

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttacaaaaagatatatctagtttaa	Protospacer
 ***.**************.******.

178. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NZ_CP017207 (Borreliella burgdorferi strain B331 plasmid B331_cp32_5, complete sequence) position: , mismatch: 4, identity: 0.852

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttacaaaaagatatatctagtttaa	Protospacer
 ***.**************.******.

179. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NC_019005 (Borrelia burgdorferi 297 plasmid 297_cp32-6, complete sequence) position: , mismatch: 4, identity: 0.852

ctttgcaaaaagatatatccagtttag	CRISPR spacer
ctttgcaaaaagatatatctagcttga	Protospacer
*******************.**.**..

180. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NC_017402 (Borreliella burgdorferi N40 plasmid N40_cp32-9, complete sequence) position: , mismatch: 4, identity: 0.852

ctttgcaaaaagatatatccagtttag	CRISPR spacer
ctttgcaaaaagatatatctagcttga	Protospacer
*******************.**.**..

181. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NC_017425 (Borreliella burgdorferi JD1 plasmid JD1 cp32-6, complete sequence) position: , mismatch: 4, identity: 0.852

ctttgcaaaaagatatatccagtttag	CRISPR spacer
ctttgcaaaaagatatatctagcttga	Protospacer
*******************.**.**..

182. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NC_017426 (Borreliella burgdorferi JD1 plasmid JD1 cp32-8, complete sequence) position: , mismatch: 4, identity: 0.852

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttacaaaaagatatatctagtttaa	Protospacer
 ***.**************.******.

183. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NC_017426 (Borreliella burgdorferi JD1 plasmid JD1 cp32-8, complete sequence) position: , mismatch: 4, identity: 0.852

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttacaaaaagatatatctagtttaa	Protospacer
 ***.**************.******.

184. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NC_017426 (Borreliella burgdorferi JD1 plasmid JD1 cp32-8, complete sequence) position: , mismatch: 4, identity: 0.852

ctttgcaaaaagatatatccagtttag	CRISPR spacer
gtttgcaaaaagatatatctaatttaa	Protospacer
 ******************.*.****.

185. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NZ_CP031406 (Borreliella burgdorferi strain MM1 plasmid plsm_cp32-9, complete sequence) position: , mismatch: 4, identity: 0.852

ctttgcaaaaagatatatccagtttag	CRISPR spacer
ctttgcaaaaagatatatctagcttga	Protospacer
*******************.**.**..

186. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NC_011722 (Borreliella burgdorferi ZS7 plasmid ZS7_cp32-9, complete sequence) position: , mismatch: 4, identity: 0.852

ctttgcaaaaagatatatccagtttag	CRISPR spacer
ctttgcaaaaagatatatctagcttga	Protospacer
*******************.**.**..

187. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NC_000953 (Borreliella burgdorferi B31 plasmid cp32-8, complete sequence) position: , mismatch: 4, identity: 0.852

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttacaaaaagatatatctagtttaa	Protospacer
 ***.**************.******.

188. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NC_000953 (Borreliella burgdorferi B31 plasmid cp32-8, complete sequence) position: , mismatch: 4, identity: 0.852

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttacaaaaagatatatctagtttaa	Protospacer
 ***.**************.******.

189. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NC_000953 (Borreliella burgdorferi B31 plasmid cp32-8, complete sequence) position: , mismatch: 4, identity: 0.852

ctttgcaaaaagatatatccagtttag	CRISPR spacer
gtttgcaaaaagatatatctaatttaa	Protospacer
 ******************.*.****.

190. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NC_000954 (Borreliella burgdorferi B31 plasmid cp32-9, complete sequence) position: , mismatch: 4, identity: 0.852

ctttgcaaaaagatatatccagtttag	CRISPR spacer
ctttgcaaaaagatatatctagcttga	Protospacer
*******************.**.**..

191. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NZ_CP019850 (Borreliella burgdorferi plasmid cp32-9, complete sequence) position: , mismatch: 4, identity: 0.852

ctttgcaaaaagatatatccagtttag	CRISPR spacer
ctttgcaaaaagatatatctagcttga	Protospacer
*******************.**.**..

192. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NZ_CP019760 (Borreliella burgdorferi strain B31_NRZ isolate B31 plasmid p_cp32-9, complete sequence) position: , mismatch: 4, identity: 0.852

ctttgcaaaaagatatatccagtttag	CRISPR spacer
ctttgcaaaaagatatatctagcttga	Protospacer
*******************.**.**..

193. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NZ_CP017203 (Borreliella burgdorferi strain B331 plasmid B331_cp32_1, complete sequence) position: , mismatch: 4, identity: 0.852

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttacaaaaagatatatctagtttaa	Protospacer
 ***.**************.******.

194. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NZ_CP017203 (Borreliella burgdorferi strain B331 plasmid B331_cp32_1, complete sequence) position: , mismatch: 4, identity: 0.852

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttacaaaaagatatatctagtttaa	Protospacer
 ***.**************.******.

195. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NZ_CP017203 (Borreliella burgdorferi strain B331 plasmid B331_cp32_1, complete sequence) position: , mismatch: 4, identity: 0.852

ctttgcaaaaagatatatccagtttag	CRISPR spacer
gtttgcaaaaagatatatctaatttaa	Protospacer
 ******************.*.****.

196. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NZ_CP017206 (Borreliella burgdorferi strain B331 plasmid B331_cp32_4, complete sequence) position: , mismatch: 4, identity: 0.852

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttacaaaaagatatatctagtttaa	Protospacer
 ***.**************.******.

197. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NC_015903 (Borreliella bissettii DN127 plasmid cp32-11, complete sequence) position: , mismatch: 4, identity: 0.852

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttacaaaaagatatatccaatttaa	Protospacer
 ***.****************.****.

198. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NZ_CP028864 (Borreliella garinii strain 20047 plasmid cp32-3, complete sequence) position: , mismatch: 4, identity: 0.852

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttgcaaaaagatatatctattttaa	Protospacer
 ******************.* ****.

199. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NC_000951 (Borreliella burgdorferi B31 plasmid cp32-6, complete sequence) position: , mismatch: 4, identity: 0.852

ctttgcaaaaagatatatccagtttag	CRISPR spacer
ctttgcaaaaagatatatctagcttga	Protospacer
*******************.**.**..

200. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NZ_CP017208 (Borreliella burgdorferi strain B331 plasmid B331_cp32_6, complete sequence) position: , mismatch: 4, identity: 0.852

ctttgcaaaaagatatatccagtttag	CRISPR spacer
ctttgcaaaaagatatatctagcttga	Protospacer
*******************.**.**..

201. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NZ_CP018747 (Borreliella garinii strain CIP 103362 isolate 20047 plasmid unnamed2) position: , mismatch: 4, identity: 0.852

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttgcaaaaagatatatctattttaa	Protospacer
 ******************.* ****.

202. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NZ_CP028874 (Borreliella bavariensis PBi plasmid lp25_cp32-3, complete sequence) position: , mismatch: 4, identity: 0.852

ctttgcaaaaagatatatccagtttag	CRISPR spacer
atttgcaaaaagatatatctattttaa	Protospacer
 ******************.* ****.

203. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NC_023559 (Oenococcus phage phi9805, complete genome) position: , mismatch: 4, identity: 0.852

ctttgcaaaaagatatatccagtttag	CRISPR spacer
ttatccaaagagatatatccagtttag	Protospacer
.* * ****.*****************

204. spacer 1.3|22295|39|NC_015909|CRISPRCasFinder matches to NC_015904 (Borreliella bissettii DN127 plasmid cp32-4, complete sequence) position: , mismatch: 4, identity: 0.897

aacttaattctaaaatagatagtgtaaaaaacgaactta-	CRISPR spacer
aacttaattctaaaatagataatgtagaaaa-gaatttac	Protospacer
*********************.****.**** ***.***

205. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NC_017425 (Borreliella burgdorferi JD1 plasmid JD1 cp32-6, complete sequence) position: , mismatch: 5, identity: 0.815

gtttaaatgctaaaatagatagtttag	CRISPR spacer
aacttaattctaaaatagatagtttag	Protospacer
. .* *** ******************

206. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NC_017426 (Borreliella burgdorferi JD1 plasmid JD1 cp32-8, complete sequence) position: , mismatch: 5, identity: 0.815

gtttaaatgctaaaatagatagtttag	CRISPR spacer
aacttaatgctaaaatagatagtgtag	Protospacer
. .* ****************** ***

207. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NC_017426 (Borreliella burgdorferi JD1 plasmid JD1 cp32-8, complete sequence) position: , mismatch: 5, identity: 0.815

gtttaaatgctaaaatagatagtttag	CRISPR spacer
aacttaatgctaaaatagatagtgtag	Protospacer
. .* ****************** ***

208. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NC_019005 (Borrelia burgdorferi 297 plasmid 297_cp32-6, complete sequence) position: , mismatch: 5, identity: 0.815

gtttaaatgctaaaatagatagtttag	CRISPR spacer
atttaaatgccaaaatagatagtgtta	Protospacer
.*********.************ * .

209. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NC_019005 (Borrelia burgdorferi 297 plasmid 297_cp32-6, complete sequence) position: , mismatch: 5, identity: 0.815

gtttaaatgctaaaatagatagtttag	CRISPR spacer
aacttaattctaaaatagatagtttag	Protospacer
. .* *** ******************

210. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NZ_CP009071 (Borreliella afzelii K78 plasmid cp32-5, complete sequence) position: , mismatch: 5, identity: 0.815

gtttaaatgctaaaatagatagtttag	CRISPR spacer
aatttaatgctaaaatagatggtttaa	Protospacer
. ** ***************.*****.

211. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NZ_CP031405 (Borreliella burgdorferi strain MM1 plasmid plsm_cp32-6, complete sequence) position: , mismatch: 5, identity: 0.815

gtttaaatgctaaaatagatagtttag	CRISPR spacer
aacttaattctaaaatagatagtttag	Protospacer
. .* *** ******************

212. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NC_000951 (Borreliella burgdorferi B31 plasmid cp32-6, complete sequence) position: , mismatch: 5, identity: 0.815

gtttaaatgctaaaatagatagtttag	CRISPR spacer
aacttaattctaaaatagatagtttag	Protospacer
. .* *** ******************

213. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NZ_CP015802 (Borrelia mayonii strain MN14-1539 plasmid cp32-6, complete sequence) position: , mismatch: 5, identity: 0.815

gtttaaatgctaaaatagatagtttag	CRISPR spacer
aacttaattctaaaatagatagtttag	Protospacer
. .* *** ******************

214. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NZ_CP017208 (Borreliella burgdorferi strain B331 plasmid B331_cp32_6, complete sequence) position: , mismatch: 5, identity: 0.815

gtttaaatgctaaaatagatagtttag	CRISPR spacer
aacttaattctaaaatagatagtttag	Protospacer
. .* *** ******************

215. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NC_017428 (Borreliella burgdorferi JD1 plasmid JD1 cp32-10, complete sequence) position: , mismatch: 5, identity: 0.815

gtttaaatgctaaaatagatagtttag	CRISPR spacer
atttaaatgccaaaatagatagtgtta	Protospacer
.*********.************ * .

216. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NZ_CP019921 (Borreliella burgdorferi strain PAbe plasmid p_cp32-9-4, complete sequence) position: , mismatch: 5, identity: 0.815

gtttaaatgctaaaatagatagtttag	CRISPR spacer
aacttaattctaaaatagatagtttag	Protospacer
. .* *** ******************

217. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NC_015905 (Borreliella bissettii DN127 plasmid cp32-6, complete sequence) position: , mismatch: 5, identity: 0.815

gtttaaatgctaaaatagatagtttag	CRISPR spacer
aacttaattctaaaatagatagtttag	Protospacer
. .* *** ******************

218. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NC_017227 (Borreliella afzelii PKo plasmid cp32-5, complete sequence) position: , mismatch: 5, identity: 0.815

gtttaaatgctaaaatagatagtttag	CRISPR spacer
gtttgaatactaaaatagatagtgtta	Protospacer
****.***.************** * .

219. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NZ_CP009063 (Borreliella afzelii K78 plasmid lp28-2, complete sequence) position: , mismatch: 5, identity: 0.815

gtttaaatgctaaaatagatagtttag	CRISPR spacer
aatttaatgctaaaatagatggtttaa	Protospacer
. ** ***************.*****.

220. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NZ_CP018746 (Borreliella garinii strain CIP 103362 isolate 20047 plasmid unnamed1) position: , mismatch: 5, identity: 0.815

gtttaaatgctaaaatagatagtttag	CRISPR spacer
aatttaatgccaaaatagatagtttaa	Protospacer
. ** *****.***************.

221. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NC_017402 (Borreliella burgdorferi N40 plasmid N40_cp32-9, complete sequence) position: , mismatch: 5, identity: 0.815

gtttaaatgctaaaatagatagtttag	CRISPR spacer
aacttaattctaaaatagatagtttag	Protospacer
. .* *** ******************

222. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NC_017397 (Borreliella burgdorferi JD1 plasmid JD1 cp32-9, complete sequence) position: , mismatch: 5, identity: 0.815

gtttaaatgctaaaatagatagtttag	CRISPR spacer
aacttaattctaaaatagatagtttag	Protospacer
. .* *** ******************

223. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NC_015903 (Borreliella bissettii DN127 plasmid cp32-11, complete sequence) position: , mismatch: 5, identity: 0.815

gtttaaatgctaaaatagatagtttag	CRISPR spacer
atttaaatgccaaaatagatagtgtta	Protospacer
.*********.************ * .

224. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NZ_CP031406 (Borreliella burgdorferi strain MM1 plasmid plsm_cp32-9, complete sequence) position: , mismatch: 5, identity: 0.815

gtttaaatgctaaaatagatagtttag	CRISPR spacer
aacttaattctaaaatagatagtttag	Protospacer
. .* *** ******************

225. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NZ_CP028865 (Borreliella garinii strain 20047 plasmid lp36, complete sequence) position: , mismatch: 5, identity: 0.815

gtttaaatgctaaaatagatagtttag	CRISPR spacer
aatttaatgccaaaatagatagtttaa	Protospacer
. ** *****.***************.

226. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NC_000953 (Borreliella burgdorferi B31 plasmid cp32-8, complete sequence) position: , mismatch: 5, identity: 0.815

gtttaaatgctaaaatagatagtttag	CRISPR spacer
aacttaatgctaaaatagatagtgtag	Protospacer
. .* ****************** ***

227. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NC_000954 (Borreliella burgdorferi B31 plasmid cp32-9, complete sequence) position: , mismatch: 5, identity: 0.815

gtttaaatgctaaaatagatagtttag	CRISPR spacer
aacttaattctaaaatagatagtttag	Protospacer
. .* *** ******************

228. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NZ_CP019850 (Borreliella burgdorferi plasmid cp32-9, complete sequence) position: , mismatch: 5, identity: 0.815

gtttaaatgctaaaatagatagtttag	CRISPR spacer
aacttaattctaaaatagatagtttag	Protospacer
. .* *** ******************

229. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NZ_CP019760 (Borreliella burgdorferi strain B31_NRZ isolate B31 plasmid p_cp32-9, complete sequence) position: , mismatch: 5, identity: 0.815

gtttaaatgctaaaatagatagtttag	CRISPR spacer
aacttaattctaaaatagatagtttag	Protospacer
. .* *** ******************

230. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NZ_CP015798 (Borrelia mayonii strain MN14-1539 plasmid cp32-1, complete sequence) position: , mismatch: 5, identity: 0.815

gtttaaatgctaaaatagatagtttag	CRISPR spacer
atttaaatgccaaaatagatagtgtta	Protospacer
.*********.************ * .

231. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NZ_CP017203 (Borreliella burgdorferi strain B331 plasmid B331_cp32_1, complete sequence) position: , mismatch: 5, identity: 0.815

gtttaaatgctaaaatagatagtttag	CRISPR spacer
atttaaatgccaaaatagatagtgtta	Protospacer
.*********.************ * .

232. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NZ_CP017203 (Borreliella burgdorferi strain B331 plasmid B331_cp32_1, complete sequence) position: , mismatch: 5, identity: 0.815

gtttaaatgctaaaatagatagtttag	CRISPR spacer
aacttaatgctaaaatagatagtgtag	Protospacer
. .* ****************** ***

233. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NC_017239 (Borreliella afzelii PKo plasmid lp28-2, complete sequence) position: , mismatch: 5, identity: 0.815

gtttaaatgctaaaatagatagtttag	CRISPR spacer
aatttaatgctaaaatagatggtttaa	Protospacer
. ** ***************.*****.

234. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to MN693532 (Marine virus AFVG_25M340, complete genome) position: , mismatch: 5, identity: 0.815

gtttaaatgctaaaatagatagtttag	CRISPR spacer
ctttaaatgctaaaaaagatacttttt	Protospacer
 ************** ***** ***

235. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NZ_CP026601 (Clostridiaceae bacterium 14S0207 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

gtttaaatgctaaaatagatagtttag	CRISPR spacer
ttccaaatgctaaattatatagtttag	Protospacer
 *..********** ** *********

236. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NC_048753 (Lactobacillus phage 3-521, complete genome) position: , mismatch: 5, identity: 0.815

gtttaa---atgctaaaatagatagtttag	CRISPR spacer
---taactgatgctaaaatagatagtttga	Protospacer
   ***   *******************..

237. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to KY883638 (Vibrio phage JSF13, complete genome) position: , mismatch: 5, identity: 0.815

gtttaaatgctaaaatagatagtttag	CRISPR spacer
gtttaaatactaaaatagatactctga	Protospacer
********.************ *.*..

238. spacer 1.2|22241|27|NC_015909|CRISPRCasFinder matches to NZ_CP031405 (Borreliella burgdorferi strain MM1 plasmid plsm_cp32-6, complete sequence) position: , mismatch: 5, identity: 0.815

ctttgcaaaaagatatatccagtttag	CRISPR spacer
ctttgcaaaaagatatatctggcttga	Protospacer
*******************..*.**..

239. spacer 1.3|22295|39|NC_015909|CRISPRCasFinder matches to NZ_CP028880 (Borreliella bavariensis PBi plasmid cp32-5, complete sequence) position: , mismatch: 5, identity: 0.872

aacttaattctaaaatagatagtgtaaaaaacgaactta	CRISPR spacer
atttaaatactaagatagatagtgtaaaaaacgaactta	Protospacer
* .* *** ****.*************************

240. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to NZ_CP020460 (Lactobacillus sakei strain FAM18311 plasmid pFAM18311_1) position: , mismatch: 6, identity: 0.778

gtttaaatgctaaaatagatagtttag	CRISPR spacer
acataaataataaaatagatagtttaa	Protospacer
.. *****. ****************.

241. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to MN694659 (Marine virus AFVG_250M322, complete genome) position: , mismatch: 6, identity: 0.778

gtttaaatgctaaaatagatagtttag	CRISPR spacer
tactaaatgataaaaaagatagtttat	Protospacer
  .****** ***** **********

242. spacer 1.1|22187|27|NC_015909|CRISPRCasFinder matches to MG209611 (Aphanizomenon phage vB_AphaS-CL131, complete genome) position: , mismatch: 6, identity: 0.778

gtttaaatgctaaaatagatagtttag	CRISPR spacer
ctttaaatgcaaaaatagaaagttctc	Protospacer
 ********* ******** ****.

243. spacer 1.3|22295|39|NC_015909|CRISPRCasFinder matches to NC_015909 (Borreliella bissettii DN127 plasmid cp32-5, complete sequence) position: , mismatch: 6, identity: 0.846

aacttaattctaaaatagatagtgtaaaaaacgaactta	CRISPR spacer
gtttagatactaaaatagatagtgtaaaaaacgaactta	Protospacer
. .* .** ******************************

244. spacer 1.3|22295|39|NC_015909|CRISPRCasFinder matches to NZ_CP019919 (Borreliella burgdorferi strain PAbe plasmid p_cp32-2, complete sequence) position: , mismatch: 6, identity: 0.846

aacttaattctaaaatagatagtgtaaaaaacgaactta	CRISPR spacer
gtttagatactaaaatagatagtgtaaaaaacgaactta	Protospacer
. .* .** ******************************

245. spacer 1.3|22295|39|NC_015909|CRISPRCasFinder matches to NZ_CP019919 (Borreliella burgdorferi strain PAbe plasmid p_cp32-2, complete sequence) position: , mismatch: 6, identity: 0.846

aacttaattctaaaatagatagtgtaaaaaacgaactta-	CRISPR spacer
aacttaattctaaaatagatagtatagaaaa-aaccttgc	Protospacer
***********************.**.**** .* ***.

246. spacer 1.3|22295|39|NC_015909|CRISPRCasFinder matches to NC_018980 (Borrelia burgdorferi 297 plasmid 297_cp32-7, complete sequence) position: , mismatch: 6, identity: 0.846

aacttaattctaaaatagatagtgtaaaaaacgaactta	CRISPR spacer
gtttagatactaaaatagatagtgtaaaaaacgaactta	Protospacer
. .* .** ******************************

247. spacer 1.3|22295|39|NC_015909|CRISPRCasFinder matches to NC_018980 (Borrelia burgdorferi 297 plasmid 297_cp32-7, complete sequence) position: , mismatch: 6, identity: 0.846

aacttaattctaaaatagatagtgtaaaaaacgaactta-	CRISPR spacer
aacttaattctaaaatagatagtatagaaaa-aaccttgc	Protospacer
***********************.**.**** .* ***.

248. spacer 1.3|22295|39|NC_015909|CRISPRCasFinder matches to NC_017422 (Borreliella burgdorferi N40 plasmid N40_cp32-7, complete sequence) position: , mismatch: 6, identity: 0.846

aacttaattctaaaatagatagtgtaaaaaacgaactta	CRISPR spacer
gtttagatactaaaatagatagtgtaaaaaacgaactta	Protospacer
. .* .** ******************************

249. spacer 1.3|22295|39|NC_015909|CRISPRCasFinder matches to NC_017422 (Borreliella burgdorferi N40 plasmid N40_cp32-7, complete sequence) position: , mismatch: 6, identity: 0.846

aacttaattctaaaatagatagtgtaaaaaacgaactta-	CRISPR spacer
aacttaattctaaaatagatagtatagaaaa-aaccttgc	Protospacer
***********************.**.**** .* ***.

250. spacer 1.3|22295|39|NC_015909|CRISPRCasFinder matches to NZ_CP031407 (Borreliella burgdorferi strain MM1 plasmid plsm_cp32-7, complete sequence) position: , mismatch: 6, identity: 0.846

aacttaattctaaaatagatagtgtaaaaaacgaactta	CRISPR spacer
gtttagatactaaaatagatagtgtaaaaaacgaactta	Protospacer
. .* .** ******************************

251. spacer 1.3|22295|39|NC_015909|CRISPRCasFinder matches to NZ_CP031407 (Borreliella burgdorferi strain MM1 plasmid plsm_cp32-7, complete sequence) position: , mismatch: 6, identity: 0.846

aacttaattctaaaatagatagtgtaaaaaacgaactta-	CRISPR spacer
aacttaattctaaaatagatagtatagaaaa-aaccttgc	Protospacer
***********************.**.**** .* ***.

252. spacer 1.3|22295|39|NC_015909|CRISPRCasFinder matches to NZ_CP028881 (Borreliella bavariensis PBi plasmid cp32-7, complete sequence) position: , mismatch: 6, identity: 0.846

aacttaattctaaaatagatagtgtaaaaaacgaactta	CRISPR spacer
gtttagatactaaaatagatagtgtaaaaaacgaactta	Protospacer
. .* .** ******************************

253. spacer 1.3|22295|39|NC_015909|CRISPRCasFinder matches to NZ_CP028881 (Borreliella bavariensis PBi plasmid cp32-7, complete sequence) position: , mismatch: 6, identity: 0.846

aacttaattctaaaatagatagtgtaaaaaacgaactta-	CRISPR spacer
aacttaattctaaaatagatagtatagaaaa-aaccttgc	Protospacer
***********************.**.**** .* ***.

254. spacer 1.3|22295|39|NC_015909|CRISPRCasFinder matches to NC_000952 (Borreliella burgdorferi B31 plasmid cp32-7, complete sequence) position: , mismatch: 6, identity: 0.846

aacttaattctaaaatagatagtgtaaaaaacgaactta	CRISPR spacer
gtttagatactaaaatagatagtgtaaaaaacgaactta	Protospacer
. .* .** ******************************

255. spacer 1.3|22295|39|NC_015909|CRISPRCasFinder matches to NC_000952 (Borreliella burgdorferi B31 plasmid cp32-7, complete sequence) position: , mismatch: 6, identity: 0.846

aacttaattctaaaatagatagtgtaaaaaacgaactta-	CRISPR spacer
aacttaattctaaaatagatagtatagaaaa-aaccttgc	Protospacer
***********************.**.**** .* ***.

256. spacer 1.3|22295|39|NC_015909|CRISPRCasFinder matches to NZ_CP019757 (Borreliella burgdorferi strain B31_NRZ isolate B31 plasmid p_cp32-2, complete sequence) position: , mismatch: 6, identity: 0.846

aacttaattctaaaatagatagtgtaaaaaacgaactta	CRISPR spacer
gtttagatactaaaatagatagtgtaaaaaacgaactta	Protospacer
. .* .** ******************************

257. spacer 1.3|22295|39|NC_015909|CRISPRCasFinder matches to NZ_CP019757 (Borreliella burgdorferi strain B31_NRZ isolate B31 plasmid p_cp32-2, complete sequence) position: , mismatch: 6, identity: 0.846

aacttaattctaaaatagatagtgtaaaaaacgaactta-	CRISPR spacer
aacttaattctaaaatagatagtatagaaaa-aaccttgc	Protospacer
***********************.**.**** .* ***.

258. spacer 1.3|22295|39|NC_015909|CRISPRCasFinder matches to NZ_CP017209 (Borreliella burgdorferi strain B331 plasmid B331_cp32_7, complete sequence) position: , mismatch: 6, identity: 0.846

aacttaattctaaaatagatagtgtaaaaaacgaactta	CRISPR spacer
gtttagatactaaaatagatagtgtaaaaaacgaactta	Protospacer
. .* .** ******************************

259. spacer 1.3|22295|39|NC_015909|CRISPRCasFinder matches to NZ_CP017209 (Borreliella burgdorferi strain B331 plasmid B331_cp32_7, complete sequence) position: , mismatch: 6, identity: 0.846

aacttaattctaaaatagatagtgtaaaaaacgaactta-	CRISPR spacer
aacttaattctaaaatagatagtatagaaaa-aaccttgc	Protospacer
***********************.**.**** .* ***.

260. spacer 1.3|22295|39|NC_015909|CRISPRCasFinder matches to NZ_CP019918 (Borreliella burgdorferi strain PAbe plasmid p_cp32-5-1, complete sequence) position: , mismatch: 7, identity: 0.821

aacttaattctaaaatagatagtgtaaaaaacgaactta	CRISPR spacer
gtttggatactaaaatagatagtgtaaaaaacgagctta	Protospacer
. .* .** *************************.****

261. spacer 1.3|22295|39|NC_015909|CRISPRCasFinder matches to NZ_CP009071 (Borreliella afzelii K78 plasmid cp32-5, complete sequence) position: , mismatch: 7, identity: 0.821

aacttaattctaaaatagatagtgtaaaaaacgaactta	CRISPR spacer
gcttagatgcgaaaatagatagtgtaaaaaacgaactta	Protospacer
. .* .** * ****************************

262. spacer 1.3|22295|39|NC_015909|CRISPRCasFinder matches to NC_018981 (Borrelia burgdorferi 297 plasmid 297_cp32-5, complete sequence) position: , mismatch: 7, identity: 0.821

aacttaattctaaaatagatagtgtaaaaaacgaactta	CRISPR spacer
gtttggatactaaaatagatagtgtaaaaaacgagctta	Protospacer
. .* .** *************************.****

263. spacer 1.3|22295|39|NC_015909|CRISPRCasFinder matches to NC_017398 (Borreliella burgdorferi N40 plasmid N40_cp32-5, complete sequence) position: , mismatch: 7, identity: 0.821

aacttaattctaaaatagatagtgtaaaaaacgaactta	CRISPR spacer
gtttggatactaaaatagatagtgtaaaaaacgagctta	Protospacer
. .* .** *************************.****

264. spacer 1.3|22295|39|NC_015909|CRISPRCasFinder matches to NC_017400 (Borreliella burgdorferi N40 plasmid N40_cp32-4, complete sequence) position: , mismatch: 7, identity: 0.821

aacttaattctaaaatagatagtgtaaaaaacgaactta	CRISPR spacer
gtttggatactaaaatagatagtgtaaaaaacgagctta	Protospacer
. .* .** *************************.****

265. spacer 1.3|22295|39|NC_015909|CRISPRCasFinder matches to NC_017394 (Borreliella burgdorferi JD1 plasmid JD1 cp32-1+5, complete sequence) position: , mismatch: 7, identity: 0.821

aacttaattctaaaatagatagtgtaaaaaacgaactta	CRISPR spacer
gtttggatactaaaatagatagtgtaaaaaacgagctta	Protospacer
. .* .** *************************.****

266. spacer 1.3|22295|39|NC_015909|CRISPRCasFinder matches to NZ_CP031411 (Borreliella burgdorferi strain MM1 plasmid plsm_cp32-5, complete sequence) position: , mismatch: 7, identity: 0.821

aacttaattctaaaatagatagtgtaaaaaacgaactta	CRISPR spacer
gtttggatactaaaatagatagtgtaaaaaacgagctta	Protospacer
. .* .** *************************.****

267. spacer 1.3|22295|39|NC_015909|CRISPRCasFinder matches to NZ_CP015799 (Borrelia mayonii strain MN14-1539 plasmid cp32-13, complete sequence) position: , mismatch: 7, identity: 0.821

aacttaattctaaaatagatagtgtaaaaaacgaactta	CRISPR spacer
gtttggatactaaaatagatagtgtaaaaaacgagctta	Protospacer
. .* .** *************************.****

268. spacer 1.3|22295|39|NC_015909|CRISPRCasFinder matches to NZ_CP019849 (Borreliella burgdorferi plasmid cp32-5, complete sequence) position: , mismatch: 7, identity: 0.821

aacttaattctaaaatagatagtgtaaaaaacgaactta	CRISPR spacer
gtttggatactaaaatagatagtgtaaaaaacgagctta	Protospacer
. .* .** *************************.****

269. spacer 1.3|22295|39|NC_015909|CRISPRCasFinder matches to NZ_CP019756 (Borreliella burgdorferi strain B31_NRZ isolate B31 plasmid p_cp32-1_1, complete sequence) position: , mismatch: 7, identity: 0.821

aacttaattctaaaatagatagtgtaaaaaacgaactta	CRISPR spacer
gtttggatactaaaatagatagtgtaaaaaacgagctta	Protospacer
. .* .** *************************.****

270. spacer 1.3|22295|39|NC_015909|CRISPRCasFinder matches to NC_017227 (Borreliella afzelii PKo plasmid cp32-5, complete sequence) position: , mismatch: 7, identity: 0.821

aacttaattctaaaatagatagtgtaaaaaacgaactta	CRISPR spacer
gcttagatgcgaaaatagatagtgtaaaaaacgaactta	Protospacer
. .* .** * ****************************

271. spacer 1.3|22295|39|NC_015909|CRISPRCasFinder matches to NC_015909 (Borreliella bissettii DN127 plasmid cp32-5, complete sequence) position: , mismatch: 8, identity: 0.795

aacttaattctaaaatagatagtgtaaaaaacgaactta	CRISPR spacer
atttaaatctaaaaatagatagtgttaaaaatgaactta	Protospacer
* .* ***.. ************** *****.*******

272. spacer 1.3|22295|39|NC_015909|CRISPRCasFinder matches to NC_015906 (Borreliella bissettii DN127 plasmid cp32-quad, complete sequence) position: , mismatch: 8, identity: 0.795

aacttaattctaaaatagatagtgtaaaaaacgaactta	CRISPR spacer
gtttagatattaaaatagataatgtaaaaaacgaactta	Protospacer
. .* .** .***********.*****************

273. spacer 1.3|22295|39|NC_015909|CRISPRCasFinder matches to NZ_CP019921 (Borreliella burgdorferi strain PAbe plasmid p_cp32-9-4, complete sequence) position: , mismatch: 8, identity: 0.795

aacttaattctaaaatagatagtgtaaaaaacgaactta	CRISPR spacer
atttaaatgtcaaaatagatagtgttaaaagcgaactta	Protospacer
* .* *** ..************** ****.********

274. spacer 1.3|22295|39|NC_015909|CRISPRCasFinder matches to NC_011722 (Borreliella burgdorferi ZS7 plasmid ZS7_cp32-9, complete sequence) position: , mismatch: 8, identity: 0.795

aacttaattctaaaatagatagtgtaaaaaacgaactta	CRISPR spacer
atttaaatgtcaaaatagatagtgttaaaagcgaactta	Protospacer
* .* *** ..************** ****.********

275. spacer 1.3|22295|39|NC_015909|CRISPRCasFinder matches to NC_000954 (Borreliella burgdorferi B31 plasmid cp32-9, complete sequence) position: , mismatch: 8, identity: 0.795

aacttaattctaaaatagatagtgtaaaaaacgaactta	CRISPR spacer
atttaaatgtcaaaatagatagtgttaaaagcgaactta	Protospacer
* .* *** ..************** ****.********

276. spacer 1.3|22295|39|NC_015909|CRISPRCasFinder matches to NZ_CP019850 (Borreliella burgdorferi plasmid cp32-9, complete sequence) position: , mismatch: 8, identity: 0.795

aacttaattctaaaatagatagtgtaaaaaacgaactta	CRISPR spacer
atttaaatgtcaaaatagatagtgttaaaagcgaactta	Protospacer
* .* *** ..************** ****.********

277. spacer 1.3|22295|39|NC_015909|CRISPRCasFinder matches to NZ_CP019760 (Borreliella burgdorferi strain B31_NRZ isolate B31 plasmid p_cp32-9, complete sequence) position: , mismatch: 8, identity: 0.795

aacttaattctaaaatagatagtgtaaaaaacgaactta	CRISPR spacer
atttaaatgtcaaaatagatagtgttaaaagcgaactta	Protospacer
* .* *** ..************** ****.********

278. spacer 1.3|22295|39|NC_015909|CRISPRCasFinder matches to NC_017226 (Borreliella afzelii PKo plasmid cp32-3, complete sequence) position: , mismatch: 8, identity: 0.795

aacttaattctaaaatagatagtgtaaaaaacgaactta	CRISPR spacer
gtttagagactaaaatagatagtgtaaaaaatgaactta	Protospacer
. .* .*  **********************.*******

279. spacer 1.3|22295|39|NC_015909|CRISPRCasFinder matches to NC_017230 (Borreliella afzelii PKo plasmid cp32-1, complete sequence) position: , mismatch: 8, identity: 0.795

aacttaattctaaaatagatagtgtaaaaaacgaactta	CRISPR spacer
gtttagagactaaaatagatagtgtaaaaaatgaactta	Protospacer
. .* .*  **********************.*******

280. spacer 1.3|22295|39|NC_015909|CRISPRCasFinder matches to NC_015908 (Borreliella bissettii DN127 plasmid cp32-3, complete sequence) position: , mismatch: 8, identity: 0.795

aacttaattctaaaatagatagtgtaaaaaacgaactta	CRISPR spacer
atttaaatataaaaatagatagtgttaaaaatgaactta	Protospacer
* .* *** . ************** *****.*******

281. spacer 1.3|22295|39|NC_015909|CRISPRCasFinder matches to NC_015906 (Borreliella bissettii DN127 plasmid cp32-quad, complete sequence) position: , mismatch: 9, identity: 0.769

aacttaattctaaaatagatagtgtaaaaaacgaactta	CRISPR spacer
gtttagatattaaaatagacaatgtaaaaaacgaactta	Protospacer
. .* .** .*********.*.*****************

282. spacer 1.3|22295|39|NC_015909|CRISPRCasFinder matches to NZ_CP009071 (Borreliella afzelii K78 plasmid cp32-5, complete sequence) position: , mismatch: 9, identity: 0.769

aacttaattctaaaatagatagtgtaaaaaacgaactta	CRISPR spacer
aacttaatgcaaaaatagatagtgtaaataccaagatag	Protospacer
******** * ***************** * *.*. * .

283. spacer 1.3|22295|39|NC_015909|CRISPRCasFinder matches to NC_015903 (Borreliella bissettii DN127 plasmid cp32-11, complete sequence) position: , mismatch: 9, identity: 0.769

aacttaattctaaaatagatagtgtaaaaaacgaactta	CRISPR spacer
atttagatataaaaatagatagtgttaaaaatgaactta	Protospacer
* .* .** . ************** *****.*******

284. spacer 1.3|22295|39|NC_015909|CRISPRCasFinder matches to NC_017226 (Borreliella afzelii PKo plasmid cp32-3, complete sequence) position: , mismatch: 9, identity: 0.769

aacttaattctaaaatagatagtgtaaaaaacgaactta	CRISPR spacer
gtttagatgtgaaaatagacagtgtaaaaaacgaactta	Protospacer
. .* .** . ********.*******************

285. spacer 1.3|22295|39|NC_015909|CRISPRCasFinder matches to NC_017226 (Borreliella afzelii PKo plasmid cp32-3, complete sequence) position: , mismatch: 9, identity: 0.769

aacttaattctaaaatagatagtgtaaaaaacgaactta	CRISPR spacer
aacttaatgcaaaaatagatagtgtaaataccaagatag	Protospacer
******** * ***************** * *.*. * .

286. spacer 1.3|22295|39|NC_015909|CRISPRCasFinder matches to NZ_CP009070 (Borreliella afzelii K78 plasmid cp32-3, complete sequence) position: , mismatch: 9, identity: 0.769

aacttaattctaaaatagatagtgtaaaaaacgaactta	CRISPR spacer
gtttagatgtgaaaatagacagtgtaaaaaacgaactta	Protospacer
. .* .** . ********.*******************

287. spacer 1.3|22295|39|NC_015909|CRISPRCasFinder matches to NZ_CP009070 (Borreliella afzelii K78 plasmid cp32-3, complete sequence) position: , mismatch: 9, identity: 0.769

aacttaattctaaaatagatagtgtaaaaaacgaactta	CRISPR spacer
aacttaatgcaaaaatagatagtgtaaataccaagatag	Protospacer
******** * ***************** * *.*. * .

288. spacer 1.3|22295|39|NC_015909|CRISPRCasFinder matches to NC_017227 (Borreliella afzelii PKo plasmid cp32-5, complete sequence) position: , mismatch: 10, identity: 0.744

aacttaattctaaaatagatagtgtaaaaaacgaactta	CRISPR spacer
aacttaatgcgaaaatagatagtgtaaatactaagatag	Protospacer
******** * ***************** * ..*. * .

289. spacer 1.3|22295|39|NC_015909|CRISPRCasFinder matches to NC_017227 (Borreliella afzelii PKo plasmid cp32-5, complete sequence) position: , mismatch: 10, identity: 0.744

aacttaattctaaaatagatagtgtaaaaaacgaactta	CRISPR spacer
aacttaatgcgaaaatagatagtgtaaatactaagatag	Protospacer
******** * ***************** * ..*. * .

290. spacer 1.3|22295|39|NC_015909|CRISPRCasFinder matches to NZ_CP009071 (Borreliella afzelii K78 plasmid cp32-5, complete sequence) position: , mismatch: 11, identity: 0.718

aacttaattctaaaatagatagtgtaaaaaacgaactta	CRISPR spacer
aacttaatgcgaaaatagatagtgtaaatgctaagatag	Protospacer
******** * ***************** . ..*. * .

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NC_015905

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

5. NC_015908

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

6. NC_015906

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage