CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NC_016047	Bacillus subtilis subsp. spizizenii TU-B-10, complete sequence	2 crisprs	csa3,cas3,DEDDh,WYL,DinG	0	1	9	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_016047_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_016047_1

1049473-1049585

Orphan

Consensus_repeat	Method
CAAGGTCAATTCGGCACTGAATTTGCTAG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_016047_1

>merge|NC_016047|1|1049473-1049585|CRISPRCasFinder
CAAGGTCAATTCGGCACTGAATTTGCTAGCGAAACAAACGCTCAGCAAGTCAGAAAACAAAACCAGCAATCAGCTGCTGGCCAACAAGGTCAATTCGGCACTGAATTCGCTAG

>NC_016047|1|1|1049473-1049585|CRISPRCasFinder
CAAGGTCAATTCGGCACTGAATTTGCTAG	CGAAACAAACGCTCAGCAAGTCAGAAAACAAAACCAGCAATCAGCTGCTGGCCAA
CAAGGTCAATTCGGCACTGAATTCGCTAG

Protein	Signature genes	Signature genes Name	Protein_function
NC_016047.1\|WP_014113111.1\|1043375_1045961_+\|YfhO-family-protein	unknown	unknown	gnl\|CDD\|226888
NC_016047.1\|WP_003223253.1\|1045953_1046937_-\|metal-dependent-hydrolase	unknown	unknown	gnl\|CDD\|224899
NC_016047.1\|WP_014113108.1\|1040302_1040821_+\|SH3-domain-containing-protein	unknown	unknown	gnl\|CDD\|214600
NC_016047.1\|WP_014113120.1\|1057029_1057914_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379641
NC_016047.1\|WP_014113121.1\|1064961_1065738_-\|sporulation-control-protein-Spo0M	unknown	unknown	gnl\|CDD\|226776
NC_016047.1\|WP_014113115.1\|1049828_1050089_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|372951
NC_016047.1\|WP_014113109.1\|1040906_1041239_+\|SdpI-family-protein	unknown	unknown	gnl\|CDD\|227945
NC_016047.1\|WP_014113119.1\|1056467_1056821_-\|YgzB-family-protein	unknown	unknown	gnl\|CDD\|371346
NC_016047.1\|WP_014113116.1\|1050849_1052592_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224055
NC_016047.1\|WP_041520895.1\|1047153_1048263_+\|A/G-specific-adenine-glycosylase	unknown	unknown	gnl\|CDD\|130156
NC_016047.1\|WP_003223250.1\|1042315_1043305_+\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|133030
NC_016047.1\|WP_014113113.1\|1048576_1049329_+\|enoyl-[acyl-carrier-protein]-reductase-FabL	unknown	unknown	gnl\|CDD\|236145
NC_016047.1\|WP_041520896.1\|1053946_1055236_-\|glutamate-1-semialdehyde-2,1-aminomutase	unknown	unknown	gnl\|CDD\|183493
NC_016047.1\|WP_003223285.1\|1055995_1056433_+\|peroxide-responsive-transcriptional-repressor-PerR	unknown	unknown	gnl\|CDD\|223806
NC_016047.1\|WP_003223280.1\|1055389_1055863_+\|thioredoxin-dependent-thiol-peroxidase	unknown	unknown	gnl\|CDD\|224146
NC_016047.1\|WP_014113117.1\|1052666_1053728_-\|aromatic-acid-exporter-family-protein	unknown	unknown	gnl\|CDD\|226614
NC_016047.1\|WP_014113110.1\|1041225_1042092_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223669
NC_016047.1\|WP_003223257.1\|1048270_1048495_-\|hypothetical-protein	unknown	unknown	unknown
NC_016047.1\|WP_014113107.1\|1039887_1040157_+\|YfhJ-family-protein	unknown	unknown	gnl\|CDD\|379438
NC_016047.1\|WP_003223272.1\|1050232_1050763_+\|DUF402-domain-containing-protein	unknown	unknown	gnl\|CDD\|184219

Protein	Function_ID	Function_description	E-value
NC_016047.1\|WP_014113111.1\|1043375_1045961_+\|YfhO-family-protein	gnl\|CDD\|226888	COG4485, COG4485, Predicted membrane protein [Function unknown].	0
NC_016047.1\|WP_003223253.1\|1045953_1046937_-\|metal-dependent-hydrolase	gnl\|CDD\|224899	COG1988, COG1988, Predicted membrane-bound metal-dependent hydrolases [General function prediction only].	3.54944e-44
NC_016047.1\|WP_014113108.1\|1040302_1040821_+\|SH3-domain-containing-protein	gnl\|CDD\|214600	smart00287, SH3b, Bacterial SH3 domain homologues.	8.34023e-13
NC_016047.1\|WP_014113120.1\|1057029_1057914_+\|hypothetical-protein	gnl\|CDD\|379641	pfam14540, NTF-like, Nucleotidyltransferase-like. Structural comparisons with Structure 1kny indicate that this N-terminal domain resembles a nucleotidyltransferase fold.	7.04238e-59
NC_016047.1\|WP_014113115.1\|1049828_1050089_+\|hypothetical-protein	gnl\|CDD\|372951	pfam14182, YgaB, YgaB-like protein. The YgaB-like protein family includes the B. subtilis YgaB protein, which is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 90 amino acids in length.	1.13473e-26
NC_016047.1\|WP_014113109.1\|1040906_1041239_+\|SdpI-family-protein	gnl\|CDD\|227945	COG5658, COG5658, Predicted integral membrane protein [Function unknown].	5.76643e-24
NC_016047.1\|WP_014113119.1\|1056467_1056821_-\|YgzB-family-protein	gnl\|CDD\|371346	pfam11023, DUF2614, Zinc-ribbon containing domain. This is a family of proteins conserved in the Bacillaceae family. Some members are annotated as being protein YgzB. The function is not known.	1.8925e-70
NC_016047.1\|WP_014113116.1\|1050849_1052592_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	0
NC_016047.1\|WP_041520895.1\|1047153_1048263_+\|A/G-specific-adenine-glycosylase	gnl\|CDD\|130156	TIGR01084, A/G-specific_adenine_glycosylase, A/G-specific adenine glycosylase. This equivalog model identifies mutY members of the pfam00730 superfamily (HhH-GPD: Helix-hairpin-helix and Gly/Pro rich loop followed by a conserved aspartate). The major members of the superfamily are nth and mutY. [DNA metabolism, DNA replication, recombination, and repair].	8.39152e-152
NC_016047.1\|WP_003223250.1\|1042315_1043305_+\|glycosyltransferase-family-2-protein	gnl\|CDD\|133030	cd04187, DPM1_like_bac, Bacterial DPM1_like enzymes are related to eukaryotic DPM1. A family of bacterial enzymes related to eukaryotic DPM1; Although the mechanism of eukaryotic enzyme is well studied, the mechanism of the bacterial enzymes is not well understood. The eukaryotic DPM1 is the catalytic subunit of eukaryotic Dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. The enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. This protein family belongs to Glycosyltransferase 2 superfamily.	9.15135e-85
NC_016047.1\|WP_014113113.1\|1048576_1049329_+\|enoyl-[acyl-carrier-protein]-reductase-FabL	gnl\|CDD\|236145	PRK08063, PRK08063, enoyl-[acyl-carrier-protein] reductase FabL.	5.72453e-171
NC_016047.1\|WP_041520896.1\|1053946_1055236_-\|glutamate-1-semialdehyde-2,1-aminomutase	gnl\|CDD\|183493	PRK12389, PRK12389, glutamate-1-semialdehyde aminotransferase; Provisional.	0
NC_016047.1\|WP_003223285.1\|1055995_1056433_+\|peroxide-responsive-transcriptional-repressor-PerR	gnl\|CDD\|223806	COG0735, Fur, Fe2+/Zn2+ uptake regulation proteins [Inorganic ion transport and metabolism].	2.19115e-56
NC_016047.1\|WP_014113121.1\|1064961_1065738_-\|sporulation-control-protein-Spo0M	gnl\|CDD\|226776	COG4326, Spo0M, Sporulation control protein [General function prediction only].	2.67683e-149
NC_016047.1\|WP_014113117.1\|1052666_1053728_-\|aromatic-acid-exporter-family-protein	gnl\|CDD\|226614	COG4129, COG4129, Predicted membrane protein [Function unknown].	2.06816e-90
NC_016047.1\|WP_014113110.1\|1041225_1042092_+\|alpha/beta-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	3.8479e-38
NC_016047.1\|WP_003223280.1\|1055389_1055863_+\|thioredoxin-dependent-thiol-peroxidase	gnl\|CDD\|224146	COG1225, Bcp, Peroxiredoxin [Posttranslational modification, protein turnover, chaperones].	3.41084e-86
NC_016047.1\|WP_014113107.1\|1039887_1040157_+\|YfhJ-family-protein	gnl\|CDD\|379438	pfam14043, WVELL, WVELL protein. This family includes the B. subtilis YfjH protein, which is functionally uncharacterized. This is not a homolog of E. coli YfjH, a synonym for IscX, which belongs to pfam04384. This family of proteins is found in bacteria. Proteins in this family are approximately 90 amino acids in length and contain a highly conserved WVELL motif.	7.76098e-41
NC_016047.1\|WP_003223272.1\|1050232_1050763_+\|DUF402-domain-containing-protein	gnl\|CDD\|184219	PRK13662, PRK13662, hypothetical protein; Provisional.	7.36814e-127

>NC_016047.1|WP_014113113.1|1048576_1049329_+|enoyl-[acyl-carrier-protein]-reductase-FabL
MEQNKCALVTGSSRGVGKAAAIRLAENGYNIVINYARSKKAALETAEEIEKLGVKVLVVKANVGQPAKIKEMFQQIDETFGRLDVFVNNAASGVLRPVMELEETHWDWTMNINAKALLFCAQEAAKLMEKNGGGHIVSISSLGSIRYLENYTTVGVSKAALEALTRYLAVELSSKQIIVNAVSGGAIDTDALKHFPNREDLLEDARQNTPAGRMVEIKDMVDTVEFLVSSKADMIRGQTIIVDGGRSLLV
>NC_016047.1|WP_003223257.1|1048270_1048495_-|hypothetical-protein
MYVGRDMSELNMVSKEDWKNSELAYFHHAFQQIMPYLNEEGQSKYRELTQEIEARGGMKRNEADYSHGTRVSYD
>NC_016047.1|WP_041520895.1|1047153_1048263_+|A/G-specific-adenine-glycosylase
MNVLEDKLKQKDIQRFRDDLISWFEREQRVLPWREDQDPYKVWVSEVMLQQTRVETVIPYFLRFVEQFPTVEALADADEEKVLKAWEGLGYYSRVRNLQSAVKEVKQEYGGIVPSEEKEFGGLKGVGPYTKGAVLSIAYNKPIPAVDGNVMRVMSRILSIWDDIAKPKARTIFEDAVRAFISKEKPSEFNQGLMELGALICTPKSPSCLLCPVQKHCSAFEEGTERELPVKSKKKKPGIKTMAAIVLTDEDGQVYIHKRPSKGLLANLWEFPNLETQKGIKTEREQLTAFLENECGIQADISDLQGVVEHVFTHLVWNISVFFGKVKQVSDTSELKKVTKEELEQFAFPVSHQKIWKMAVEAAAYSAAP
>NC_016047.1|WP_003223253.1|1045953_1046937_-|metal-dependent-hydrolase
MDTGTHVVMGIALGGIATLDPVVGSDPAMAHAVMIATLAGSQAPDIDTVLKLKNNAVYIRNHRGFTHSIPAVLFWSIIIPAILYLFYPQADFLHLWLWTLLAVVLHVFVDIFNAYGTQAIRPFSKKWVALGLINTFDPFIFISHLAAIAIWYAGGSPGITFLSLYIILAGYYLVRLIMQLRIKRKLHEMIHDEIESIIISPTMKFRQWRIAVTTAHAFYVGRSMEGHVVILDTFNRVPVPETEVMHAAKQDDNIAAFLSFSPVYRWEVDTFKDHYEVRFIDLRYRSKGHYPFVAIVHIGHDLTIRSSYTGWIFSEEKLQKKLKLGSI
>NC_016047.1|WP_014113111.1|1043375_1045961_+|YfhO-family-protein
MKRKYVMIYAASLLVSVLAHAFFVKEWTDGRYMTGPGDGLAQMIVFKKLLFDQYTHGNFFYNYSFGLGGGTFSQLGYYFSASFLFLVVSAAVWLLQAVQLIGEADTLFWAESAVFISIFKLSLIIFTAASVFHYLLKHRAASFTGAVLYGASIIYFRHEAYWEFFTDTMIWLPLLVLGAEKIIRERRPAWFIIACSLTLINNFYFAYINLIFIGIYVLFRWLIRLEKHEEKKWIQCRMFLISGLISFGICAAAFVPVVYGYLNNLRPPYSQKIEWLNFDDNILFSSRIIIVPAAFLLFLFIVSFYKNRVFRLFAGLSLLFILFHFSPYAASVFNGFSAPQNRFEYVLAFTIAGAAAAGLSQLSELKWKELLPAIAVALILYLYHIQRYKLDIWKPANESILLLLFLTIAALFAAAFAKKRAKVAVYVVIILSSLFVANTYQKYALSEGGGLDSVTKAYLTGEEYKGQESSELIRRLQKEDDDPLMRIDWMNGVRNNTPIIYGFNGFSAYSSILNKHLLTFYWNDLSIDMGRESVSRYASLGDRANLYSLLYGKYYMTEKTNEASVPYGFKKHLESEHYVVYENQYMLPFVKTADAIYSESELDKLPALAKEQAMMKGIVLADPSGKTEQAPKLANLIPKSDITAKHAQYENGLLTVTGENGGELIITPKQASSSPGDYYVSFYLKSKAKDKGFTLRVNDYVTTRKSNQSIYKTGVNDITVRVPKSDHISIKLPKGTYELKNIALYEENYQTLKSAVLQNKTDKDDNLKWDKNKLTFAYRLPKNQYIMLPIPYEKGWELKINGKTQTIEKADYAFIGFKAQKGDNHIELAYYPPYFKISALISLISLLLAVLYIRRKKPGSK
>NC_016047.1|WP_003223250.1|1042315_1043305_+|glycosyltransferase-family-2-protein
MKQGLISIIIPSYNEGYNVKLIHESLKKEFKTIHYDYEIFFINDGSVDDTLQQIKDLAAGCSRVKYISFSRNFGKEAAILAGFEHVQGEAVIVMDADLQHPTYLLKEFIKGYEEGYDQVIAQRNRKGDSPVRSLLSSLYYKFINKAVEVDLRDGVGDFRLLSRQAVNALLKLSEGNRFSKGLFCWIGFDQKIVFYENVERKNGTSKWSFSSLFNYGMDGVVSFNHKPLRICFYTGIFILLLSIIYIIATFVKILTNGISVPGYFTIISAVLFLGGVQLLSLGIIGEYIGRIYYETKKRPHYLIKEANIPNKDLPETNELKSMRRLTKMH
>NC_016047.1|WP_014113110.1|1041225_1042092_+|alpha/beta-hydrolase
MDGVKCQFVKTNGITLHVAAAGPEDGQLIVLLHGFPEFWYGWKNQIKPLADAGYRVIAPDQRGYNLSDKPDGIDSYRIDTLRDDIIGLISQFTDEKAIVIGHDWGGAVAWHLASTRPEYLEKLIAINIPHPHIMKTVTPIYPPQWLKSSYIAFFQLPDIPEASLKENDYETLDKAIGLSTRPELFTSEDVSKYKEAWKQPGALTAMLNWYRALRKGSLSEKTAYETAPYRMIWGMEDRFLSRKLAKETERHCPNGHLIFVDEASHWINHEKPAIVNQLILEYLYLKKQ
>NC_016047.1|WP_014113109.1|1040906_1041239_+|SdpI-family-protein
MAGLVGGGLMIIAGILIKLFPPESINSVYGYRTRRSMSDQRLWDEANRYSASLMILSGQVIAGMGLLLRSNLIILQLILLLAACVITFMLTEKRLKNMTYSQGGDRSGRS
>NC_016047.1|WP_014113108.1|1040302_1040821_+|SH3-domain-containing-protein
MKKKQVMLALTAAAGLSLTALYSAPAAQAAPLHDISVSMPSSDSYIIKAGKLNVRTEPNHKGKILGTLSSEQKVTVNGFANADWAQIQFKGKKAYISTHFLMKTASQAKTAKQTAFYAPTPENGKAKQLSSGTEVTLLGWGFSENGGFDFTWAFVDYAGVKGYIQSKDLQIR
>NC_016047.1|WP_014113107.1|1039887_1040157_+|YfhJ-family-protein
MDTYIEKLTNLLLEKNDMISYIQAKSWVELLWSDFEATYAKAGHAYQGEKMTEKIVTQWIENYGGQLHLFQSSRDDVNDYLNQSRGLLH
>NC_016047.1|WP_014113115.1|1049828_1050089_+|hypothetical-protein
MTEFEKLVSEQMKTMDKLLDLQSELDRCKQIEAELRHLERDARLRGIQDEIAVKRKHLADIQDMFQKQTEQVIRSYRSSEKPSSFV
>NC_016047.1|WP_003223272.1|1050232_1050763_+|DUF402-domain-containing-protein
MGYPKEGETIQIHSYKHNGLIHRIWNETTILKSTEMCVIGANDRTMVTESDGRTWITREPAICYFHARQWFNVIGMLREDGVHYYCNISSPFAYDGEAIKYIDYDLDVKVFPDMTYNILDEDEYDDHRKAMNYPKEIDSILRDYLNTLLHWIHQRQGPFAPEFVDMWYERYLRYTK
>NC_016047.1|WP_014113116.1|1050849_1052592_+|ABC-transporter-ATP-binding-protein
MGVMKRYMQFVKPYKKQIFVTVLIGIVKFSIPLALPLLLKYVVDDIIQGGGTASDKTTSLFTIMAIMFALFLILRPPVEYYRQYFAQWTASKVLYDIRAKLFDHIQKLSLRFYANTRTGEVISRVINDVEQTKDFVITGLMNIWLDMLTILIVISIMLTLDIKLTLISIVLFPLYGISVKYFYGRLRKLTRERSQALAQVQGHLHERIQGMPVIRSFAIEDHEQANFNEKNSHFLDKAISHTNWNAKTFAVVNTITDLAPLIVIACAGYFVINGPLTVGTMVAFVGYIDRMYNPVRRLINSSTTLTQSIASMDRVFEFIDEPYELTDKPNAIKADQIRGGVEFQNVSFQYEKEKENILHDVSLKVNRGETVALVGMSGGGKSTLVSLIPRFYDVTSGRLLIDGTDIRDYEARSLRNQVGMVLQDTFLFSETIRENIAIGKPDAPLEEIIEAAKAANAHEFIMSFSEGYETRVGERGVKLSGGQKQRISIARVFLKNPPLLILDEATSALDLESEHYIQEAMDKLAKDRTTFVVAHRLSTITHADKIVVMENGTIIEIGTHDELMDYDSQYKHLFTIQNLS
>NC_016047.1|WP_014113117.1|1052666_1053728_-|aromatic-acid-exporter-family-protein
MKLGARIFKTGIAITLALYLASWIGLPAPIFAGIAAIFAIQPSIYRSFLIIIDQVQANIIGAVIATVFGLIFGPSPIMIGLTAVIVITIMLKLKIEHTISIALVTVIAILESAGDDFLMFALIRTSTVILGVLSSFIVNLVFLPPKYETKLIHNTVENTEEIMKWIRLSMRQSTEHSILKEDIEKLKEKMIKLDQTYLLYKEERSYFKKTTYVKSRKLVLFRQAIITANRALDTLKKLHRLENEIYHMPEEFQETLTEELDYLLYWHELILMRFVGKIKPHDDADEEGIRYKQLLTKSFLKNQQNTDDELIDYNMLNIMASAVEYREQLEHLETLITSFQTYHPKDCEIETEE
>NC_016047.1|WP_041520896.1|1053946_1055236_-|glutamate-1-semialdehyde-2,1-aminomutase
MHTKSIELHNEALEHIVGGVNSPSRSYKAVGGGSPVAMEKANGAYFWDVDGNKYIDYLAAYGPIITGHAHPHITEAIKNAAENGVLYGTPTKHEVTFAKMLKEAIPAMDKVRFVNSGTEAVMTTIRVARAYTGRTKIIKFAGCYHGHSDLVLVAAGSGPSTLGTPDSAGVPKSIANEVITVPFNDIESYKAALDKWGSEIAAVLVEPIVGNFGIVEPKEGFLEKVNELTHDAGALVIYDEVITAFRFMYGGAQDLLQVKPDLTALGKIIGGGLPIGAYGGKKEIMEQVAPLGPAYQAGTMAGNPASILSGIACLEVLKEEGVYEKLDHLGAMLEEGILQHAETHGITITVNRLKGALTVYFSDEKVENYEQAERSDGKTFATFFKLMLERGINLAPSKYEAWFITTAHTEQDIKDTLAAVEDAFKHLKN
>NC_016047.1|WP_003223280.1|1055389_1055863_+|thioredoxin-dependent-thiol-peroxidase
MTIEIGQKAPDLELKGDHGETVTLSDYKGKYIVLYFYPKDMTPGCTTEACDFRDSHESFAELDAVIIGVSPDSQEKHGKFKEKHNLPFLLLVDDEHKLAEAFDVWKLKKNFGKEYMGIERSTFLIDKEGRLVKEWRKVKVKDHVAEALQTLKDMSEK
>NC_016047.1|WP_003223285.1|1055995_1056433_+|peroxide-responsive-transcriptional-repressor-PerR
MAAHELKEALETLKETGVRITPQRHAILEYLVNSMAHPTADDIYKALEGKFPNMSVATVYNNLRVFRESGLVKELTYGDASSRFDFVTSDHYHAICENCGKIVDFHYPGLDEVEQLAAHVTGFKVSHHRLEIYGVCQECSKKENH
>NC_016047.1|WP_014113119.1|1056467_1056821_-|YgzB-family-protein
MAKYSSKINKIRTFALSLVFVGFIIMYIGIFFKESVLLSSLFMILGLLSIGLSTVVYFWIGMLSTKAVRVICPGCEKETKVLGRVDMCMHCREPLTLDKGLEGKEFDESYNKKKMSK
>NC_016047.1|WP_014113120.1|1057029_1057914_+|hypothetical-protein
MDNLLRPIYQERASHPNTLAVIMIERRNKTSSLTDNFDAALLVIVKEADEPVFIKHYEFDQKTASLHVVTDSQIQEWILLGTNRRIIDWIVNGRVLFDRNEYIVELIDRLNTFPFAERKLKIGLEYGKLIRRYVEGKAFFEANQFLDAYNAVVHALHHLARIEVIDRGFHPETTVWSQVRQMEPQVYKLYSELIESHESLEKRLELLFLANDFLIHSKAEIGSAHLFEVMNEKDIWQFGEFLQHPDLKHFTQDLGVMLDYLTDKGLINVCQIETKGQAVYHRGYSFKKDIDSDS
>NC_016047.1|WP_014113121.1|1064961_1065738_-|sporulation-control-protein-Spo0M
MSFFKKLAASAGIGAAKVETILEKDAYYPGEEVRGTVHVKGGKIAQDIRYIDLQLNTRYVIVKDDEEHRKYATIHSFQVTGSFTIQPGEEYQFPFSFTLPLDTPITVGKVEVAVVTDLDIQGGIDKSDQDRIFVEAHPWIESVLEAIENLGFRLNEADCEQAPYFQRRLPFVQEFEFVPTSGYYRQMFDELELIFLLDEDGLEIIFEVDRRARGLRGWLEEMYNDGEQLVRVRFSQSELEDAEELKEVLEEIIDQYAE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_016047_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_016047_2

3111136-3111242

Orphan

Consensus_repeat	Method
TGATGGGAATCGAACCCACGACAT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_016047_2

>merge|NC_016047|2|3111136-3111242|CRISPRCasFinder
TGATGGGAATCGAACCCACGACATCAGCTTGGAAGGCTGAGGTTTTACCACTAAACTACACCCGCAATTTTATTTGGGGCGATTGATGGGAATCGAACCCACGAATG

>NC_016047|2|2|3111136-3111242|CRISPRCasFinder
TGATGGGAATCGAACCCACGACAT	CAGCTTGGAAGGCTGAGGTTTTACCACTAAACTACACCCGCAATTTTATTTGGGGCGAT
TGATGGGAATCGAACCCACGAATG

Protein	Signature genes	Signature genes Name	Protein_function
NC_016047.1\|WP_014114909.1\|3104991_3106446_-\|glycogen-synthase-GlgA	unknown	unknown	gnl\|CDD\|234809
NC_016047.1\|WP_003222741.1\|3126457_3127003_+\|biofilm-surface-layer-protein-BslA	unknown	unknown	gnl\|CDD\|379999
NC_016047.1\|WP_014114904.1\|3098555_3099611_-\|spore-coat-protein-CotS	unknown	unknown	gnl\|CDD\|131952
NC_016047.1\|WP_072181955.1\|3100948_3102022_+\|spore-coat-kinase-CotI	unknown	unknown	gnl\|CDD\|131952
NC_016047.1\|WP_014114914.1\|3118865_3119387_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NC_016047.1\|WP_014114908.1\|3102608_3105005_-\|glycogen/starch/alpha-glucan-phosphorylase	unknown	unknown	gnl\|CDD\|273967
NC_016047.1\|WP_014114919.1\|3122814_3124023_-\|choline-dehydrogenase	unknown	unknown	gnl\|CDD\|341481
NC_016047.1\|WP_041521049.1\|3120961_3121486_-\|NfeD-family-protein	unknown	unknown	gnl\|CDD\|376684
NC_016047.1\|WP_014114921.1\|3125709_3126252_+\|transcriptional-regulator-GbsR	unknown	unknown	gnl\|CDD\|224427
NC_016047.1\|WP_014114903.1\|3098131_3098554_-\|hypothetical-protein	unknown	unknown	unknown
NC_016047.1\|WP_014114911.1\|3107496_3108639_-\|glucose-1-phosphate-adenylyltransferase	unknown	unknown	gnl\|CDD\|179997
NC_016047.1\|WP_014114918.1\|3122148_3122730_-\|MOSC-domain-containing-protein	unknown	unknown	gnl\|CDD\|377051
NC_016047.1\|WP_014114910.1\|3106442_3107474_-\|glucose-1-phosphate-adenylyltransferase-subunit-GlgD	unknown	unknown	gnl\|CDD\|273966
NC_016047.1\|WP_014114920.1\|3124038_3125511_-\|betaine-aldehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|143437
NC_016047.1\|WP_041521050.1\|3121654_3122143_+\|DinB-family-protein	unknown	unknown	gnl\|CDD\|378981
NC_016047.1\|WP_014114915.1\|3119411_3120941_-\|flotillin-lipid-rafts-scaffold-protein-FloT	unknown	unknown	gnl\|CDD\|225177
NC_016047.1\|WP_014114912.1\|3108635_3110519_-\|1,4-alpha-glucan-branching-enzyme	unknown	unknown	gnl\|CDD\|273667
NC_016047.1\|WP_014114913.1\|3118245_3118824_+\|energy-coupled-thiamine-transporter-ThiT	unknown	unknown	gnl\|CDD\|226377
NC_016047.1\|WP_014114905.1\|3099625_3100759_-\|spore-coat-protein-CotSA	unknown	unknown	gnl\|CDD\|340831
NC_016047.1\|WP_014114907.1\|3102112_3102580_+\|TspO/MBR-family-protein	unknown	unknown	gnl\|CDD\|226007

Protein	Function_ID	Function_description	E-value
NC_016047.1\|WP_014114909.1\|3104991_3106446_-\|glycogen-synthase-GlgA	gnl\|CDD\|234809	PRK00654, glgA, glycogen synthase GlgA.	0
NC_016047.1\|WP_003222741.1\|3126457_3127003_+\|biofilm-surface-layer-protein-BslA	gnl\|CDD\|379999	pfam17735, BslA, Biofilm surface layer A. This family includes members such as BslA (previously called YuaB). Secreted BslA from Bacillus subtillis has been shown to form surface layers around the biofilm self-assembling at interfaces of B. subtilis biofilms, forming an elastic film. structural analysis revealed that BslA consists of an Ig-type fold with the addition of an unusual, extremely hydrophobic cap region. The hydrophobic cap exhibits physiochemical properties similar to the hydrophobic surface found in fungal hydrophobins; thus, BslA is defined as member of a class of bacterially produced hydrophobins.	1.54556e-46
NC_016047.1\|WP_014114904.1\|3098555_3099611_-\|spore-coat-protein-CotS	gnl\|CDD\|131952	TIGR02906, Spore_coat_protein_S, spore coat protein, CotS family. Members of this family include the spore coat proteins CotS and YtaA from Bacillus subtilis and, from other endospore-forming bacteria, homologs that are more closely related to these two than to the spore coat proteins YutH and YsxE. The CotS family is more broadly distributed than YutH or YsxE, but still is not universal among spore-formers. [Cellular processes, Sporulation and germination].	1.39228e-126
NC_016047.1\|WP_072181955.1\|3100948_3102022_+\|spore-coat-kinase-CotI	gnl\|CDD\|131952	TIGR02906, Spore_coat_protein_S, spore coat protein, CotS family. Members of this family include the spore coat proteins CotS and YtaA from Bacillus subtilis and, from other endospore-forming bacteria, homologs that are more closely related to these two than to the spore coat proteins YutH and YsxE. The CotS family is more broadly distributed than YutH or YsxE, but still is not universal among spore-formers. [Cellular processes, Sporulation and germination].	2.12488e-131
NC_016047.1\|WP_014114914.1\|3118865_3119387_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	1.02729e-09
NC_016047.1\|WP_014114908.1\|3102608_3105005_-\|glycogen/starch/alpha-glucan-phosphorylase	gnl\|CDD\|273967	TIGR02093, Glycogen_phosphorylase, glycogen/starch/alpha-glucan phosphorylases. This family consists of phosphorylases. Members use phosphate to break alpha 1,4 linkages between pairs of glucose residues at the end of long glucose polymers, releasing alpha-D-glucose 1-phosphate. The nomenclature convention is to preface the name according to the natural substrate, as in glycogen phosphorylase, starch phosphorylase, maltodextrin phosphorylase, etc. Name differences among these substrates reflect differences in patterns of branching with alpha 1,6 linkages. Members include allosterically regulated and unregulated forms. A related family, TIGR02094, contains examples known to act well on particularly small alpha 1,4 glucans, as may be found after import from exogenous sources. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0
NC_016047.1\|WP_014114919.1\|3122814_3124023_-\|choline-dehydrogenase	gnl\|CDD\|341481	cd08551, Fe-ADH, iron-containing alcohol dehydrogenases (Fe-ADH)-like. This family contains large metal-containing alcohol dehydrogenases (ADH), known as iron-containing alcohol dehydrogenases. They contain a dehydroquinate synthase-like protein structural fold and mostly contain iron. They are distinct from other alcohol dehydrogenases which contains different protein domains. There are several distinct families of alcohol dehydrogenases: Zinc-containing long-chain alcohol dehydrogenases, insect-type, or short-chain alcohol dehydrogenases, iron-containing alcohol dehydrogenases, among others. The iron-containing family has a Rossmann fold-like topology that resembles the fold of the zinc-dependent alcohol dehydrogenases, but lacks sequence homology, and differs in strand arrangement. ADH catalyzes the reversible oxidation of alcohol to acetaldehyde with the simultaneous reduction of NAD(P)+ to NAD(P)H.	3.30887e-175
NC_016047.1\|WP_041521049.1\|3120961_3121486_-\|NfeD-family-protein	gnl\|CDD\|376684	pfam01957, NfeD, NfeD-like C-terminal, partner-binding. NfeD-like proteins are widely distributed throughout prokaryotes and are frequently associated with genes encoding stomatin-like proteins (slipins). There appear to be three major groups: an ancestral group with only an N-terminal serine protease domain and this C-terminal beta sheet-rich domain which is structurally very similar to the OB-fold domain, associated with its neighboring slipin cluster; a second major group with an additional middle, membrane-spanning domain, associated in some species with eoslipin and in others with yqfA; a final 'artificial' group which unites truncated forms lacking the protease region and associated with their ancestral gene partner, either yqfA or eoslipin. This NefD, C-terminal, domain appears to be the major one for relating to the associated protein. NfeD homologs are clearly reliant on their conserved gene neighbor which is assumed to be necessary for function, either through direct physical interaction or by functioning in the same pathway, possibly involve with lipid-rafts.	0.000549951
NC_016047.1\|WP_014114921.1\|3125709_3126252_+\|transcriptional-regulator-GbsR	gnl\|CDD\|224427	COG1510, COG1510, Predicted transcriptional regulators [Transcription].	1.34399e-70
NC_016047.1\|WP_014114913.1\|3118245_3118824_+\|energy-coupled-thiamine-transporter-ThiT	gnl\|CDD\|226377	COG3859, COG3859, Predicted membrane protein [Function unknown].	6.04335e-73
NC_016047.1\|WP_014114911.1\|3107496_3108639_-\|glucose-1-phosphate-adenylyltransferase	gnl\|CDD\|179997	PRK05293, glgC, glucose-1-phosphate adenylyltransferase; Provisional.	0
NC_016047.1\|WP_014114918.1\|3122148_3122730_-\|MOSC-domain-containing-protein	gnl\|CDD\|377051	pfam03473, MOSC, MOSC domain. The MOSC (MOCO sulfurase C-terminal) domain is a superfamily of beta-strand-rich domains identified in the molybdenum cofactor sulfurase and several other proteins from both prokaryotes and eukaryotes. These MOSC domains contain an absolutely conserved cysteine and occur either as stand-alone forms or fused to other domains such as NifS-like catalytic domain in Molybdenum cofactor sulfurase. The MOSC domain is predicted to be a sulfur-carrier domain that receives sulfur abstracted by the pyridoxal phosphate-dependent NifS-like enzymes, on its conserved cysteine, and delivers it for the formation of diverse sulfur-metal clusters.	2.77056e-06
NC_016047.1\|WP_014114910.1\|3106442_3107474_-\|glucose-1-phosphate-adenylyltransferase-subunit-GlgD	gnl\|CDD\|273966	TIGR02092, Glycogen_biosynthesis_protein_GlgD, glucose-1-phosphate adenylyltransferase, GlgD subunit. This family is GlgD, an apparent regulatory protein that appears in an alpha2/beta2 heterotetramer with GlgC (glucose-1-phosphate adenylyltransferase, TIGR02091) in a subset of bacteria that use GlgC for glycogen biosynthesis. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0
NC_016047.1\|WP_014114920.1\|3124038_3125511_-\|betaine-aldehyde-dehydrogenase	gnl\|CDD\|143437	cd07119, ALDH_BADH-GbsA, Bacillus subtilis NAD+-dependent betaine aldehyde dehydrogenase-like. Included in this CD is the NAD+-dependent, betaine aldehyde dehydrogenase (BADH, GbsA, EC=1.2.1.8) of Bacillus subtilis involved in the synthesis of the osmoprotectant glycine betaine from choline or glycine betaine aldehyde.	0
NC_016047.1\|WP_041521050.1\|3121654_3122143_+\|DinB-family-protein	gnl\|CDD\|378981	pfam12867, DinB_2, DinB superfamily. The DinB family are an uncharacterized family of potential enzymes. The structure of these proteins is composed of a four helix bundle.	1.83152e-17
NC_016047.1\|WP_014114915.1\|3119411_3120941_-\|flotillin-lipid-rafts-scaffold-protein-FloT	gnl\|CDD\|225177	COG2268, COG2268, Uncharacterized protein conserved in bacteria [Function unknown].	9.12411e-122
NC_016047.1\|WP_014114912.1\|3108635_3110519_-\|1,4-alpha-glucan-branching-enzyme	gnl\|CDD\|273667	TIGR01515, branching_enzym, alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase. This model describes the glycogen branching enzymes which are responsible for the transfer of chains of approx. 7 alpha(1--4)-linked glucosyl residues to other similar chains (in new alpha(1--6) linkages) in the biosynthesis of glycogen. This enzyme is a member of the broader amylase family of starch hydrolases which fold as (beta/alpha)8 barrels, the so-called TIM-barrel structure. All of the sequences comprising the seed of this model have been experimentally characterized. This model encompasses both bacterial and eukaryotic species. No archaea have this enzyme, although Aquifex aolicus does. Two species, Bacillus thuringiensis and Clostridium perfringens have two sequences each which are annotated as amylases. These annotations are aparrently in error. GP\|18143720 from C. perfringens, for instance, contains the note "674 aa, similar to gp:A14658_1 amylase (1,4-alpha-glucan branching enzyme (EC 2.4.1.18) ) from Bacillus thuringiensis (648 aa); 51.1% identity in 632 aa overlap." A branching enzyme from Porphyromonas gingivales, OMNI\|PG1793, appears to be more closely related to the eukaryotic species (across a deep phylogenetic split) and may represent an instance of lateral transfer from this species' host. A sequence from Arabidopsis thaliana, GP\|9294564, scores just above trusted, but appears either to contain corrupt sequence or, more likely, to be a pseudogene as some of the conserved catalytic residues common to the alpha amylase family are not conserved here. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0
NC_016047.1\|WP_014114907.1\|3102112_3102580_+\|TspO/MBR-family-protein	gnl\|CDD\|226007	COG3476, COG3476, Tryptophan-rich sensory protein (mitochondrial benzodiazepine receptor homolog) [Signal transduction mechanisms].	2.08977e-39
NC_016047.1\|WP_014114905.1\|3099625_3100759_-\|spore-coat-protein-CotSA	gnl\|CDD\|340831	cd03801, GT4_PimA-like, phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.	2.92433e-72

>NC_016047.1|WP_014114912.1|3108635_3110519_-|1,4-alpha-glucan-branching-enzyme
MAAASPTAHDVYLFHEGSLFKSYQLFGSHYRELNGQRGYEFCVWAPHASEVRVAGDFNSWSGEQHVMHRANDGGIWTLFIPDLGEKERYKYEIVTKSGEIRLKADPYAIYSEIRPNTASLTYDFAGYNWKDQKWQKKQKANTLYEKPVFIYELHLGSWKKHSDGRHYSYKELSQSLIPYIKEHGFTHIELLPVHEHPYDRSWGYQGTGYYSPTSRFGTPHDLMKFVDECHQENIGVILDWVPGHFCKDAHGLYMFDGEPLYEYQEERDRENWLWGTANFDLGKPEVHSFLISNALYWAELYHIDGFRVDAVANLLYWPNQDERHTNPYAVEFLKKLNQTMREAYPHVMMIAEDSTEWPQVTGAVEEGGLGFHFKWNMGWMNDVLKYMETPPEERRYCHQLISFSLLYAFSEHFVLPFSHDEVVYGKKSLLNKMPGDYWQKFAQYRLLLGYMTAHPGKKLIFMGSEFAQFDEWKDTEQLDWFLDSFPMHQKASVFTQDLLRFYQKSKILYEHDHRAQSFEWIDVHNDEQSIFSFIRYGKRHGEALVIICNFTPAVYHQYDVGVPFLTQYIEVLNSDSEAYGGSGQINKKPLAAKKGALHHKPCYITMTIPPYGISILRAVKKRGEIKR
>NC_016047.1|WP_014114911.1|3107496_3108639_-|glucose-1-phosphate-adenylyltransferase
MKKQCVAMLLAGGKGSRLSGLTKNMAKPAVSFGGKYRIIDFTLSNCSNSGIDTVGILTQYQPLELNSYIGIGSAWDLDRYNGGVTVLPPYAESSEVKWYKGTASAIYENLNYLNQYDPEYVLILSGDHIYKMDYGKMLDFHIEKKADVTISVIEVGWEEASRFGIMKTDADGTITHFDEKPKFPKSNLASMGIYIFNWPLLKQYLEMDDRNPYSSHDFGKDIIPLLLEEKKNLSAYPFKGYWKDVGTVQSLWEANMDLLKEDSELKLFERKWKIYSVNPNQPPQFISSDAQVHDSLVNEGCVVYGNVSHSVLFQGVTVGKHATVKSSVIMPDVTIGEHVVIENAIVPKGLVLPDGAVIRSEKDIQEALLVSEEFVEKELI
>NC_016047.1|WP_014114910.1|3106442_3107474_-|glucose-1-phosphate-adenylyltransferase-subunit-GlgD
MFNNQMLGVIDETTYKHSLQDLTAQRSLGAIPFAGRYRLIDFMLSNMVNADIRSVAIFPKYRYRSLMDHLGAGKEWDLHRKKDGLFFFPSPHLHQEYDEFGSFRQFSDHLDYFHRSTQQYAVISNSHTVCNIQFQYVLKRHQEVGCDVTEVFQDGQSLQIYIMSTALLKDLIYGHSEKGYKTIQEAVEKESSSLTICPYEYSGYAAVIDSVEKYYTHSMELIQPRFWQQVFLPQQPIYTKVKDEPPTKYGKHSTVKNSLVANGCVLEGEVENCILFRAVHVGKGTKLKNCIIMQKTQIGENCQIEQVISDKDVKIGNATEAAGTAEQPLVLRKGLVQGELMNS
>NC_016047.1|WP_014114909.1|3104991_3106446_-|glycogen-synthase-GlgA
MKVLFAVSECTPFVKSGGLADVAGALPKALARLGNEVAVMLPKYSQIPERWKKRMEKTAECTVAVGWRQQYCGIEHIAEDDVNYYFIDNKYYFNRDSLYGHYDDGERFAFFSRAVLEAAEAVNIQADIVHTHDWHTAMVNYLLKEEYRKHPFYKQMRSVLTIHNLQFQGIFPPDVTHDLLGLEMDHFHYERLECNGFVNFMKAGIIAADHVTTVSPTYRNEILTPYYGEQLEQVLQYRENDITGILNGIDDTFYQPKCDPYIEAHYDSEHLACKEVNKTKLQRRMGLPERNDIPLISMVTRLTKQKGLDLVRRIMHELLEEQDIQLIVLGTGEREFEDYFRYAEFAFHEKCRAYIGFDEPLAHQIYAGSDMFLMPSKFEPCGLGQLIALQYGAIPIVRETGGLYDTVRSYQEEEGTGNGFTFSAFNAHDLKFTIERALSFYRQKDVWKSIMKTAMNADYSWEQSAKEYQRIFEHVTRSGRDVLE
>NC_016047.1|WP_014114908.1|3102608_3105005_-|glycogen/starch/alpha-glucan-phosphorylase
MFSSKERFAALFLKRLEMTCGKSFKDSAKLDQYKTLGNMVREYISADWIQTNEKSRSNSGKQTYYLSIEFLLGQLLEQNLMNLGVRDVVEAGLKEIGINLEEILQMESDAGLGNGGLGRLAACFLDSLASLNLPGHGMGIRYKHGLFEQKIVNGHQVELPEQWLKNGNVWEVRNADQAVDVPFWGEVHMTEKNGRLHFRHEQATIVTAVPYDIPIIGYETGTVNTLRLWNAEPYAHYHGGNILSYKRETEAVSEFLYPDDTHDEGKILRLKQQYFLVCASLKSIVNNYRKTNKSLSGLHKKVSIHINDTHPALAVPELMRILLDEENMSWEEAWHITVHTISYTNHTTLSEALEKWPIHLFKPLLPRMYMIIEEINERFCRAVWEKYPGDWKRIEDMAITAHGVVKMAHLAIVGSYSVNGVAKIHSDILKEREMRDFHLLFPNRFNNKTNGIAHRRWLLKANPGLSAIITEAIGNEWVKQPESLIRLEPYASDPAFIEQFQNNKSRKKQELTDLIFCTAGVVVNPDSIFDVQVKRLHAYKRQLLNVLHIMYLYNRLKEDSGFSIYPQTFIFGAKASPSYYYAKKIIKLIHSVAEKVNYDPAVKQLLKIVFLENYRVSMAERIFPASDVSEQISTASKEASGTGNMKFMMNGALTIGTHDGANIEILERVGPDCIYTFGLKADEVLSYQENGGYRSREYYQHDRRIRQVADQLINGFFEGEADEFESIYDSLLPHNDEYFVLKDFSSYADAQGRIQADYLDRRKWSERSIVNIAHSGYFSSDRTIREYAKNIWGIQPMM
>NC_016047.1|WP_014114907.1|3102112_3102580_+|TspO/MBR-family-protein
MKKMVGAIAVFVITYALFSAADYLFPIDQEWYNSLKKPDWTPPGSAIGIIWAILFALISLSAAIVYAAFSFKDAKSFWLTLLINYVLNQAFSYFQFTQKNLLAASIDSLLVAITAIVLMIIAKKYSRTASYLLLPYFLWSAFATFLSFTIYSMNL
>NC_016047.1|WP_072181955.1|3100948_3102022_+|spore-coat-kinase-CotI
MCPLMAENQEVIEEGNSSELPLSAEDERKLTELAENVLQGWDVQTEKIDVIQGNQMALVWKVHTGSGAVCLKRIHRPEKKALFSIFAQDYLAKKGMNVPGIIPNKKGSLYSKHGSFLFVVYDWIEGRPFELTVKQDLEFIMKGLADFHTASVGYQPPNGVPVFTKLGRWPNHYTKRCKQMETWKLMAQMEKEDPFSQLYLQEIDSFIEDGLRIKDRLLQSSYVPWTEQLKKSPNLCHQDYGTGNTLLGENEQIWVIDLDTVSFDLPIRDLRKMIIPLLDTTGVWDEETFHVMLNAYESSAPLTDEQKQVMFIDMLFPYELYDVIREKYVRKSALPKEELESAFEYERIKANALKQLI
>NC_016047.1|WP_014114905.1|3099625_3100759_-|spore-coat-protein-CotSA
MKIALIATEKLPVPSVRGGAIQIYLEAVAPLIAKKHEVTVFSIKDPNLADRETADGVHYVHLDEDRYEDAVGEELKKSRFDLVHVCNRPSWVSKLKKQAPDAVFILSVHNEMFAYDKISQAEGEICIDSVAQIVTVSDYIGQTITSRFPSARSKTKTVYSGVDLKAYHPRWTKEGQRAREDMRSELELHGKKIVLFVGRLSKVKGPHILLQALPDIIEEHPDVMMVFIGSKWFGDNELNNYVKHLHTLGAMQKDHVTFIQFVKPKDIPRLYTMSDVFVCSSQWQEPLARVHYEAMAAGLPIITSNRGGNPEVIEEGKNGYIIHDFENPKQYAGYINDLLSSSEKRERLGKYSRREAESQFGWQRVAENLLSVYEKNR
>NC_016047.1|WP_014114904.1|3098555_3099611_-|spore-coat-protein-CotS
MYQKEHEEQIVSDILSYYPFHVEHVALKSNKSGRKIWEIQTDQGLKLLKEAQMKPERMLFITQAHAHLQEKGLPVAPIHQTKNGGSCLGTDRVSYSLYDKVTGKEMIYYDAEQMKKVMSFAGHFHHASKGYVCRDESKKRSRLGKWHKLYRWKLQELEGNMQIAASYPDDLFSQTFLKHADKMLARGKEALQALDESEYENWTKETLEHGGFCFQDFTLARLTEIDGEPFLKELHSITYDLPSRDLRILLNKVMVKLSVWDTDFMVALLAAYDAVYPLTEKQYEVLWIDLAFPHLFCAIGHKYYLKQKKTWSDEKYNWALQNMISVEESKDAFLDKMPELYKKIKAYREAN
>NC_016047.1|WP_014114903.1|3098131_3098554_-|hypothetical-protein
MRSSRQKASISKLDLDQFVFTPPGSMGWQAHDTSSAEKEEEEKHLAVGSIRELPNINAPKEFQEETKEKETDHKVMDDEETKFETIREPEEEHDSKRSEPPIEEEDEEPELVEEARVEIIVLPSESAPAPWFSQTVKRKA
>NC_016047.1|WP_014114913.1|3118245_3118824_+|energy-coupled-thiamine-transporter-ThiT
MNQSKQLVRLIEIAIMTAAAVILDIVSGMFLRMPQGGSVSIMMIPIFLISFRWGVKAGLTTGLLTGLVQIAIGNLFAQHPIQLLLDYIVAFAAIGISGCFAYSVRKAAASKTKGKLIVSVVSAVFIGSFLRYATHVISGAVFFGSYAPKGTPVWIYSLTYNATYMVPSFIICAIVLCLLFMTAPRLLKSDKA
>NC_016047.1|WP_014114914.1|3118865_3119387_-|GNAT-family-N-acetyltransferase
MATVREAKLEDIKDIAKVHVDSWRTTYQGIVPAEYLNSLNYKEFEDKWKSRSLKGVFVVHDEKGSIFGFASFGPIRSEQEGYDGELYAIYLLEERQRQGAGRALLAKGAEFLLQHGFSSMFAWVIQKNPSITFYQAYTPERVAEDSFEIAGERLKEVGFGWPDLSALKTLLNT
>NC_016047.1|WP_014114915.1|3119411_3120941_-|flotillin-lipid-rafts-scaffold-protein-FloT
MTMPIIIVIGVVFFLLIALIAVFITKYRTAGPDEALIVTGSYLGNKNVHVDEGGNRLKIVRGGGTFVLPVFQQAEPLSLLSSKLDVSTPEVYTEQGVPVMADGTAIIKIGGSIGEIATAAEQFLGKSKDDREQEAREVLEGHLRSILGSMTVEEIYKNREKFSQEVQRVASQDLAKMGLVIVSFTIKDVRDKNGYLESLGKPRIAQVKRDADIATAEADKETRIKRAEADKDAKKSELERATEIAEAEKINQLKMAEYRREQDTAKANADQAYDLETAKARQHVTEQEMQVKIIERQKQIELEEKEILRRERQYDSEVKKKADADRYSVEQSAAAEKAKQLAEADAKKYSIEAMAKAEAEKVRIDGLAKAEAEKAKGETEAEVIRLKGLAEAEAKEKIAAAFEQYGQAAIFDMIVKMLPEYAKQAAAPLSNIDKITVVDTGGSGESSGANKVTSYATNLMSSLQESLKASSGIDVKEMIENFSGKGNVKQSITELTNEIKEAKTVQKPE
>NC_016047.1|WP_041521049.1|3120961_3121486_-|NfeD-family-protein
MELFGVPIQTIYLYTLIIAGSLTLLFLFFGDVFAGLSEGIPFLNPTLVLAFFTCFSAGGYIGELILPMSSLLIALLSCILSIMLVVLLHIFVLVPLSSAEESLAYKEDDLRGRVGKVITAVPVDGYGEVVIEGIGGTISKSAVSFDNQQISYGTAVLIVDVNNGVLSVTPHEPI
>NC_016047.1|WP_041521050.1|3121654_3122143_+|DinB-family-protein
MSIFNEARLETWNEVKGLSDEKLNQKPSAEEWSIREVLDHLKKIDMAAQKMLKERVKEAPVKEVEEKPLEVAQDRNNKRKAPSHLEPEHDFISGSQMKRELDVVREQLTAAIASLKEEDFERVLPHPVFQELTVRQWIDFIGHHEKRHLSQIKEIKEKIERA
>NC_016047.1|WP_014114918.1|3122148_3122730_-|MOSC-domain-containing-protein
MWKRITAKTEGVYIADTESFVTKQMDKLDFDYGGIPGDLHFGLTKKAGAREPMFSRGTEIFNRRQISIVSIEECDEIALKMGVPSILPEWLGANVAVSGIPDLTSLKEGSRLIFPSGAALLCEGENDPCIQPGEVIQSYYPDKSKLAPAFVRHALGIRGIVCIVERPGAVYAGDEIEVHSYQRKVKPRKAERV
>NC_016047.1|WP_014114919.1|3122814_3124023_-|choline-dehydrogenase
MTLNMKIESMHKFHTFEIPTVIKHGIGAVKNTGEEVAALGVSKALLVTDPGIYKAGVVDPVIESLKEAGIEVVLFNKVEPNPPVRLVNEGSELYKKENCNGLVAVGGGSSMDTAKAIGVEATHEGSVLDYEAADGKKPLENRIPPLTTIPTTAGTGSEVTQWAVITDEDREFKFNTGGPLIAAHLTIIDPELHVSMPPHVTAMTGIDALAHAIECYTMKFAQPITDAVALMAIEYAAHYIKRAFADGEDLEARYGMAQAAMLAGLSYGSESAGAAHAMSQTLGGIIPVAHGQCVAAMMGPVMEYNWKGYPEKFARIAKAFGIDTSNMTTEEAAKASVNWMYDLVEDLEVPTLEEQGVSPDMIERLSKEAMKDPQTFGNPRDLNEKAYNWIYKRCFNLTPKTV
>NC_016047.1|WP_014114920.1|3124038_3125511_-|betaine-aldehyde-dehydrogenase
MSQTLYIDGEWISAEKEQIRSIINPFNQEEIATVSEGGREDAIKAIAAARRAFDKGEWSSLSGLERGKIVLKIAELIRRDLDELAELESLDTGKTLEESKADMDDIANVFQYYAGLADKDGGEIISSPIPDSESKIIREPIGVCGQITPWNYPLLQASWKIAPALAAGNTIVMKPSEITPLTTIKVFKLMEEAGVPKGVANLVLGPGATVGDELAVNKDVDLISFTGGIETGKKIMRAASGNVKKIALELGGKNPNIVFKDADLEVAVDQALNAVFFHAGQVCSAGSRLLVEDAIHDQFLAELVKRTKRIKLGNGFHAETESGPLISAEHRAKVEKYVEIGIEEGAKLETGGKRPEDPALQKGFFYEPTIFSNCKSDMRIVQEEVFGPVLTVETFSSEEEVIALANDTIYGLAGAVWSKDIEKCERVAARLRMGTVWINDFHPYFAQAPWGGYKQSGFGRELGKIGLEEYTEVKHVYRNTKPAAVNWFNS
>NC_016047.1|WP_014114921.1|3125709_3126252_+|transcriptional-regulator-GbsR
MDENPEFAAIEQARDLVIDSIAETMDLYGITRSVGILYGTMYMRDEMTLDEMREELQMSKPSMSTGVKKLQDLNVVKKTFHRGIRKHTFVAEKDFFKFFTNFFPPKWEREVQVNVAAIEEAQADLQEVLNKDSLSEDIKNEALQLYEQLESSKAYYDWLKRLAESVQSGEIFKFIPIETK
>NC_016047.1|WP_003222741.1|3126457_3127003_+|biofilm-surface-layer-protein-BslA
MKRKLLSSLAISALSLGLLVSAPSASFAAESKSTSAHTESTMKTQSTASLFATITGASKTEWSFSDIELTYRPNTLLSLGVMEFTLPSGFTANTKDTMNGRALRETQILNNGKTVRIPLALDLLGAGEFKLKLNNKTLPAAGTYTFRAENKSLSIGNKFYAEASIDVAKRSTPPTQPCGCN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_016047_2	2.1\|3111160\|59\|NC_016047\|CRISPRCasFinder	3111160-3111218	59	NZ_CP015439	Anoxybacillus amylolyticus strain DSM 15939 plasmid pDSM15939_1, complete sequence	255887-255945	7	0.881
NC_016047_2	2.1\|3111160\|59\|NC_016047\|CRISPRCasFinder	3111160-3111218	59	NZ_CP010587	Bacillus megaterium Q3 plasmid p1, complete sequence	838-896	8	0.864
NC_016047_2	2.1\|3111160\|59\|NC_016047\|CRISPRCasFinder	3111160-3111218	59	NZ_CP023319	Bacillus megaterium strain A plasmid p2, complete sequence	75825-75883	8	0.864
NC_016047_2	2.1\|3111160\|59\|NC_016047\|CRISPRCasFinder	3111160-3111218	59	NZ_CP024037	Bacillus aryabhattai strain K13 plasmid unnamed2	10418-10476	8	0.864
NC_016047_2	2.1\|3111160\|59\|NC_016047\|CRISPRCasFinder	3111160-3111218	59	NZ_CP026740	Bacillus megaterium strain YC4-R4 plasmid unnamed4	70765-70823	8	0.864
NC_016047_2	2.1\|3111160\|59\|NC_016047\|CRISPRCasFinder	3111160-3111218	59	NC_017139	Bacillus megaterium WSH-002 plasmid WSH-002_p1, complete sequence	1319-1377	8	0.864
NC_016047_2	2.1\|3111160\|59\|NC_016047\|CRISPRCasFinder	3111160-3111218	59	NC_020451	Vibrio coralliilyticus strain ATCC BAA-450 plasmid, complete sequence	1961-2019	9	0.847
NC_016047_2	2.1\|3111160\|59\|NC_016047\|CRISPRCasFinder	3111160-3111218	59	NZ_CP015440	Anoxybacillus amylolyticus strain DSM 15939 plasmid pDSM15939_2, complete sequence	64774-64832	11	0.814
NC_016047_2	2.1\|3111160\|59\|NC_016047\|CRISPRCasFinder	3111160-3111218	59	NZ_CP033045	Bacillus foraminis strain Bac44 plasmid unnamed, complete sequence	483791-483849	13	0.78
NC_016047_2	2.1\|3111160\|59\|NC_016047\|CRISPRCasFinder	3111160-3111218	59	NZ_LR134399	Listeria monocytogenes strain NCTC7974 plasmid 2, complete sequence	57361-57419	14	0.763

1. spacer 2.1|3111160|59|NC_016047|CRISPRCasFinder matches to NZ_CP015439 (Anoxybacillus amylolyticus strain DSM 15939 plasmid pDSM15939_1, complete sequence) position: , mismatch: 7, identity: 0.881

cagcttggaaggctgaggttttaccactaaactacacccgcaattttatttggggcgat-	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgc-atattatatacgacggtt	Protospacer
***************************************** ** **** *. *.**.*

2. spacer 2.1|3111160|59|NC_016047|CRISPRCasFinder matches to NZ_CP010587 (Bacillus megaterium Q3 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.864

cagcttggaaggctgaggttttaccactaaactacacccgcaattttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatattttaaagtggcggt	Protospacer
******************************************  ***    * ****.*

3. spacer 2.1|3111160|59|NC_016047|CRISPRCasFinder matches to NZ_CP023319 (Bacillus megaterium strain A plasmid p2, complete sequence) position: , mismatch: 8, identity: 0.864

cagcttggaaggctgaggttttaccactaaactacacccgcaattttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatattttaaagtggcggt	Protospacer
******************************************  ***    * ****.*

4. spacer 2.1|3111160|59|NC_016047|CRISPRCasFinder matches to NZ_CP024037 (Bacillus aryabhattai strain K13 plasmid unnamed2) position: , mismatch: 8, identity: 0.864

cagcttggaaggctgaggttttaccactaaactacacccgcaattttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatattttaaagtggcggt	Protospacer
******************************************  ***    * ****.*

5. spacer 2.1|3111160|59|NC_016047|CRISPRCasFinder matches to NZ_CP026740 (Bacillus megaterium strain YC4-R4 plasmid unnamed4) position: , mismatch: 8, identity: 0.864

cagcttggaaggctgaggttttaccactaaactacacccgcaattttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatattttaaagtggcggt	Protospacer
******************************************  ***    * ****.*

6. spacer 2.1|3111160|59|NC_016047|CRISPRCasFinder matches to NC_017139 (Bacillus megaterium WSH-002 plasmid WSH-002_p1, complete sequence) position: , mismatch: 8, identity: 0.864

cagcttggaaggctgaggttttaccactaaactacacccgcaattttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatattttaaagtggcggt	Protospacer
******************************************  ***    * ****.*

7. spacer 2.1|3111160|59|NC_016047|CRISPRCasFinder matches to NC_020451 (Vibrio coralliilyticus strain ATCC BAA-450 plasmid, complete sequence) position: , mismatch: 9, identity: 0.847

cagcttggaaggctgaggttttaccactaaactacacccgcaattttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcattttagttatggcccgg	Protospacer
****************************************** *** .**  ** * .

8. spacer 2.1|3111160|59|NC_016047|CRISPRCasFinder matches to NZ_CP015440 (Anoxybacillus amylolyticus strain DSM 15939 plasmid pDSM15939_2, complete sequence) position: , mismatch: 11, identity: 0.814

cagcttggaaggctgaggttttaccactaaactacacccgcaattttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcataataatatataccatt	Protospacer
******************************************   * ** *. . *. *

9. spacer 2.1|3111160|59|NC_016047|CRISPRCasFinder matches to NZ_CP033045 (Bacillus foraminis strain Bac44 plasmid unnamed, complete sequence) position: , mismatch: 13, identity: 0.78

cagcttggaaggctgaggttttaccactaaactacacccgc---------aattttattt	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatggttaaaagttttgcc-	Protospacer
*****************************************         *.****...

10. spacer 2.1|3111160|59|NC_016047|CRISPRCasFinder matches to NZ_LR134399 (Listeria monocytogenes strain NCTC7974 plasmid 2, complete sequence) position: , mismatch: 14, identity: 0.763

cagcttggaaggctgaggttttaccactaaactacacccgc------aattttatttggg	CRISPR spacer
cagcttggaaggctgtagttttaccactaaactacacccgcatagtaagtagttcttag-	Protospacer
*************** .************************      *.*  * .**.*

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

153020 : 240810

103

Bacillus_phage(46.0%)

head,portal,terminase,holin,tail,capsid,plate,tRNA,integrase

attL 167306:167365|attR 227783:233857

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014112352.1\|153020_153764_+\|tRNA	tRNA pseudouridine(38-40) synthase TruA	NA	NA	NA	NA
WP_003241966.1\|153925_154363_+	50S ribosomal protein L13	NA	NA	NA	NA
WP_004399691.1\|154383_154776_+	30S ribosomal protein S9	NA	NA	NA	NA
WP_014112354.1\|155251_156019_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_014112355.1\|156214_156658_+	YbaK family protein	NA	NA	NA	NA
WP_014112356.1\|156717_157431_+	N-acetylmuramoyl-L-alanine amidase CwlD	A0A0N6W8I1	Bacillus_phage	3.1e-14	29.5
WP_014112357.1\|157525_158584_+	iron-sulfur carrier protein/transcriptional regulator SalA	NA	NA	NA	NA
WP_014112358.1\|158621_159179_-	spore germination protein GerD	NA	NA	NA	NA
WP_014112359.1\|159288_159885_+	KinB-signaling pathway activation protein	NA	NA	NA	NA
WP_014112360.1\|159885_160650_-	polysaccharide deacetylase family sporulation protein PdaB	NA	NA	NA	NA
WP_014112362.1\|166120_167305_-\|integrase	tyrosine-type recombinase/integrase	A0A0K2CZ62	Paenibacillus_phage	5.3e-75	40.7
WP_014112363.1\|167291_167825_-	ImmA/IrrE family metallo-endopeptidase	A0A2H4JA43	uncultured_Caudovirales_phage	5.2e-38	50.6
167306:167365	attL	NA	NA	NA	NA
WP_014112364.1\|167911_168577_-	hypothetical protein	NA	NA	NA	NA
WP_017696738.1\|168822_169152_-	helix-turn-helix transcriptional regulator	O64078	Bacillus_phage	2.0e-16	45.7
WP_014112366.1\|169312_169546_+	helix-turn-helix transcriptional regulator	A8ATX6	Listeria_phage	6.6e-14	52.8
WP_017696740.1\|169558_169750_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_014112367.1\|169814_170348_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_014112368.1\|170337_170598_+	hypothetical protein	NA	NA	NA	NA
WP_014112369.1\|170598_170763_+	hypothetical protein	NA	NA	NA	NA
WP_041520831.1\|171182_171368_+	hypothetical protein	NA	NA	NA	NA
WP_014112370.1\|171364_173338_+	AAA family ATPase	A0A1L2K2K3	Aeribacillus_phage	2.7e-140	45.4
WP_014112371.1\|173380_174139_+	phage recombination protein Bet	A8ATK8	Listeria_phage	1.8e-68	54.1
WP_041520832.1\|174135_174837_+	MBL fold metallo-hydrolase	A0A1L2JY21	Aeribacillus_phage	4.2e-96	70.0
WP_014112373.1\|175035_175791_+	hypothetical protein	U5Q085	Bacillus_phage	9.1e-12	32.7
WP_014112374.1\|175808_176090_+	hypothetical protein	NA	NA	NA	NA
WP_014112375.1\|176064_177366_+	replicative DNA helicase	Q38152	Bacillus_phage	7.1e-97	45.7
WP_014112376.1\|177679_178135_+	RusA family crossover junction endodeoxyribonuclease	S6B1L9	Thermus_phage	2.0e-51	69.1
WP_041520834.1\|178342_178522_+	hypothetical protein	NA	NA	NA	NA
WP_014112378.1\|178591_178795_+	hypothetical protein	NA	NA	NA	NA
WP_014112379.1\|178836_179124_+	hypothetical protein	NA	NA	NA	NA
WP_014112381.1\|179418_179874_+	hypothetical protein	NA	NA	NA	NA
WP_014112382.1\|179946_180333_+	ArpU family transcriptional regulator	Q9ZXB9	Bacillus_phage	2.9e-30	58.9
WP_014112383.1\|180572_181619_+	NADH:flavin oxidoreductase/NADH oxidase	NA	NA	NA	NA
WP_014112384.1\|181696_182230_-	VOC family protein	NA	NA	NA	NA
WP_080010044.1\|182261_182657_-	DoxX family protein	NA	NA	NA	NA
WP_044059163.1\|182970_183384_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_014112388.1\|183991_184159_+	hypothetical protein	NA	NA	NA	NA
WP_014112389.1\|184253_184598_+	hypothetical protein	M4ZRM2	Bacillus_phage	1.7e-29	57.9
WP_014112390.1\|184665_185124_+	hypothetical protein	NA	NA	NA	NA
WP_014112391.1\|185179_185701_+	ParB N-terminal domain-containing protein	A0A1B1P7B5	Bacillus_phage	1.5e-53	58.5
WP_014112392.1\|185711_186731_+	DNA (cytosine-5-)-methyltransferase	A0A1B1P7C6	Bacillus_phage	1.5e-126	63.8
WP_041520836.1\|186781_187549_+	DUF4145 domain-containing protein	NA	NA	NA	NA
WP_019712754.1\|187703_187952_+	hypothetical protein	A8ATN7	Listeria_phage	2.4e-06	40.5
WP_014112394.1\|187999_188878_+	hypothetical protein	A0A1B1P7C9	Bacillus_phage	4.9e-25	40.3
WP_014112395.1\|188874_190200_+\|terminase	PBSX family phage terminase large subunit	A0A2P1JTW5	Anoxybacillus_phage	8.9e-156	63.4
WP_014112396.1\|190192_191725_+\|portal	phage portal protein	A0A1B1P7C8	Bacillus_phage	1.1e-154	54.6
WP_014112397.1\|191721_192639_+\|head	phage head morphogenesis protein	A0A1B1P7D7	Bacillus_phage	4.7e-55	40.4
WP_014112398.1\|192682_193327_+	hypothetical protein	NA	NA	NA	NA
WP_014112399.1\|193355_194537_+\|terminase	terminase	A0A1B1P7E4	Bacillus_phage	4.8e-84	51.1
WP_014112400.1\|194568_195504_+\|capsid	phage major capsid protein	A0A1B1P7E3	Bacillus_phage	8.4e-108	65.9
WP_010330132.1\|195514_195832_+	hypothetical protein	NA	NA	NA	NA
WP_010330131.1\|195837_196230_+	DUF3199 family protein	A0A1B1P7D6	Bacillus_phage	4.2e-13	36.2
WP_014112401.1\|196226_196589_+	YqbH/XkdH family protein	NA	NA	NA	NA
WP_014112402.1\|196585_197089_+	HK97 gp10 family phage protein	A0A249XXA4	Clostridium_phage	1.2e-36	46.2
WP_014112403.1\|197101_197539_+	hypothetical protein	NA	NA	NA	NA
WP_080010045.1\|197535_197727_+	hypothetical protein	NA	NA	NA	NA
WP_014112405.1\|197727_199128_+\|tail	phage tail sheath family protein	S5MNC1	Brevibacillus_phage	2.2e-75	39.3
WP_014112406.1\|199129_199573_+\|tail	phage tail tube protein	A0A0A7RVP1	Clostridium_phage	4.5e-27	46.5
WP_014112407.1\|200195_200645_+\|portal	phage portal protein	A0A0A7RTY8	Clostridium_phage	7.8e-11	37.4
WP_014112408.1\|200686_200824_+	hypothetical protein	NA	NA	NA	NA
WP_014112409.1\|200826_206169_+	transglycosylase SLT domain-containing protein	A0A1L2JY60	Aeribacillus_phage	1.4e-42	45.9
WP_014112410.1\|206161_206821_+	LysM peptidoglycan-binding domain-containing protein	A0A090DBR9	Clostridium_phage	3.0e-27	36.3
WP_014112411.1\|206833_207814_+	hypothetical protein	H7BV96	unidentified_phage	1.0e-39	31.4
WP_014112412.1\|207810_208077_+	DUF2577 family protein	NA	NA	NA	NA
WP_014112413.1\|208089_208515_+	DUF2634 domain-containing protein	A0A0A8WJV8	Clostridium_phage	1.9e-11	34.1
WP_014112414.1\|208507_209554_+\|plate	baseplate J/gp47 family protein	S6AVU3	Thermus_phage	6.3e-72	43.5
WP_014112415.1\|209537_210116_+	YmfQ family protein	A0A2H4J717	uncultured_Caudovirales_phage	9.7e-14	33.1
WP_014112416.1\|210112_210385_+	hypothetical protein	NA	NA	NA	NA
WP_014112417.1\|210388_212143_+	hypothetical protein	A0A1P8CWR7	Bacillus_phage	2.4e-23	39.6
WP_014112418.1\|212154_212484_+	XkdW family protein	NA	NA	NA	NA
WP_010330111.1\|212480_212645_+	XkdX family protein	A0A2H4JAA1	uncultured_Caudovirales_phage	1.9e-15	69.8
WP_014112419.1\|212736_213630_+	hypothetical protein	NA	NA	NA	NA
WP_041520837.1\|213675_214098_+\|holin	phage holin family protein	D6R405	Bacillus_phage	3.5e-53	80.5
WP_014112421.1\|214142_215117_+	N-acetylmuramoyl-L-alanine amidase	A0A218KC88	Bacillus_phage	8.2e-66	69.6
WP_014112422.1\|215155_215440_-	hypothetical protein	NA	NA	NA	NA
WP_014112423.1\|215445_217158_-	ribonuclease YeeF family protein	A0A1P8CWI7	Bacillus_phage	3.2e-81	64.5
WP_014112424.1\|217367_218501_+	tetratricopeptide repeat protein	A0A1P8CWN8	Bacillus_phage	6.2e-89	48.8
WP_014112425.1\|218490_218649_+	hypothetical protein	NA	NA	NA	NA
WP_014112426.1\|218680_218854_-	YolD-like family protein	NA	NA	NA	NA
WP_014112427.1\|219075_220131_-	hypothetical protein	NA	NA	NA	NA
WP_080010046.1\|220404_220596_+	hypothetical protein	NA	NA	NA	NA
WP_014112362.1\|226597_227782_-\|integrase	tyrosine-type recombinase/integrase	A0A0K2CZ62	Paenibacillus_phage	5.3e-75	40.7
WP_014112363.1\|227768_228302_-	ImmA/IrrE family metallo-endopeptidase	A0A2H4JA43	uncultured_Caudovirales_phage	5.2e-38	50.6
WP_014112364.1\|228388_229054_-	hypothetical protein	NA	NA	NA	NA
WP_017696738.1\|229299_229629_-	helix-turn-helix transcriptional regulator	O64078	Bacillus_phage	2.0e-16	45.7
WP_014112366.1\|229789_230023_+	helix-turn-helix transcriptional regulator	A8ATX6	Listeria_phage	6.6e-14	52.8
WP_017696740.1\|230035_230227_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_014112367.1\|230291_230825_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_014112368.1\|230814_231075_+	hypothetical protein	NA	NA	NA	NA
WP_014112369.1\|231075_231240_+	hypothetical protein	NA	NA	NA	NA
WP_041520831.1\|231659_231845_+	hypothetical protein	NA	NA	NA	NA
WP_014112370.1\|231841_233815_+	AAA family ATPase	A0A1L2K2K3	Aeribacillus_phage	2.7e-140	45.4
WP_014112371.1\|233857_234616_+	phage recombination protein Bet	A8ATK8	Listeria_phage	1.8e-68	54.1
227783:233857	attR	NA	NA	NA	NA
WP_041520832.1\|234612_235314_+	MBL fold metallo-hydrolase	A0A1L2JY21	Aeribacillus_phage	4.2e-96	70.0
WP_014112373.1\|235512_236268_+	hypothetical protein	U5Q085	Bacillus_phage	9.1e-12	32.7
WP_014112374.1\|236285_236567_+	hypothetical protein	NA	NA	NA	NA
WP_014112375.1\|236541_237843_+	replicative DNA helicase	Q38152	Bacillus_phage	7.1e-97	45.7
WP_014112376.1\|238156_238612_+	RusA family crossover junction endodeoxyribonuclease	S6B1L9	Thermus_phage	2.0e-51	69.1
WP_041520834.1\|238819_238999_+	hypothetical protein	NA	NA	NA	NA
WP_014112378.1\|239068_239272_+	hypothetical protein	NA	NA	NA	NA
WP_014112379.1\|239313_239601_+	hypothetical protein	NA	NA	NA	NA
WP_014112381.1\|239895_240351_+	hypothetical protein	NA	NA	NA	NA
WP_014112382.1\|240423_240810_+	ArpU family transcriptional regulator	Q9ZXB9	Bacillus_phage	2.9e-30	58.9

DBSCAN-SWA_2

244730 : 278978

Bacillus_phage(51.85%)

head,portal,terminase,holin,tail,capsid,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014112389.1\|244730_245075_+	hypothetical protein	M4ZRM2	Bacillus_phage	1.7e-29	57.9
WP_014112390.1\|245142_245601_+	hypothetical protein	NA	NA	NA	NA
WP_014112391.1\|245656_246178_+	ParB N-terminal domain-containing protein	A0A1B1P7B5	Bacillus_phage	1.5e-53	58.5
WP_014112392.1\|246188_247208_+	DNA (cytosine-5-)-methyltransferase	A0A1B1P7C6	Bacillus_phage	1.5e-126	63.8
WP_041520836.1\|247258_248026_+	DUF4145 domain-containing protein	NA	NA	NA	NA
WP_019712754.1\|248180_248429_+	hypothetical protein	A8ATN7	Listeria_phage	2.4e-06	40.5
WP_014112394.1\|248476_249355_+	hypothetical protein	A0A1B1P7C9	Bacillus_phage	4.9e-25	40.3
WP_014112395.1\|249351_250677_+\|terminase	PBSX family phage terminase large subunit	A0A2P1JTW5	Anoxybacillus_phage	8.9e-156	63.4
WP_014112396.1\|250669_252202_+\|portal	phage portal protein	A0A1B1P7C8	Bacillus_phage	1.1e-154	54.6
WP_014112397.1\|252198_253116_+\|head	phage head morphogenesis protein	A0A1B1P7D7	Bacillus_phage	4.7e-55	40.4
WP_014112398.1\|253159_253804_+	hypothetical protein	NA	NA	NA	NA
WP_014112399.1\|253832_255014_+\|terminase	terminase	A0A1B1P7E4	Bacillus_phage	4.8e-84	51.1
WP_014112400.1\|255045_255981_+\|capsid	phage major capsid protein	A0A1B1P7E3	Bacillus_phage	8.4e-108	65.9
WP_010330132.1\|255991_256309_+	hypothetical protein	NA	NA	NA	NA
WP_010330131.1\|256314_256707_+	DUF3199 family protein	A0A1B1P7D6	Bacillus_phage	4.2e-13	36.2
WP_014112401.1\|256703_257066_+	YqbH/XkdH family protein	NA	NA	NA	NA
WP_014112402.1\|257062_257566_+	HK97 gp10 family phage protein	A0A249XXA4	Clostridium_phage	1.2e-36	46.2
WP_014112403.1\|257578_258016_+	hypothetical protein	NA	NA	NA	NA
WP_080010045.1\|258012_258204_+	hypothetical protein	NA	NA	NA	NA
WP_014112405.1\|258204_259605_+\|tail	phage tail sheath family protein	S5MNC1	Brevibacillus_phage	2.2e-75	39.3
WP_014112406.1\|259606_260050_+\|tail	phage tail tube protein	A0A0A7RVP1	Clostridium_phage	4.5e-27	46.5
WP_014112407.1\|260672_261122_+\|portal	phage portal protein	A0A0A7RTY8	Clostridium_phage	7.8e-11	37.4
WP_014112408.1\|261163_261301_+	hypothetical protein	NA	NA	NA	NA
WP_014112409.1\|261303_266646_+	transglycosylase SLT domain-containing protein	A0A1L2JY60	Aeribacillus_phage	1.4e-42	45.9
WP_014112410.1\|266638_267298_+	LysM peptidoglycan-binding domain-containing protein	A0A090DBR9	Clostridium_phage	3.0e-27	36.3
WP_014112411.1\|267310_268291_+	hypothetical protein	H7BV96	unidentified_phage	1.0e-39	31.4
WP_014112412.1\|268287_268554_+	DUF2577 family protein	NA	NA	NA	NA
WP_014112413.1\|268566_268992_+	DUF2634 domain-containing protein	A0A0A8WJV8	Clostridium_phage	1.9e-11	34.1
WP_014112414.1\|268984_270031_+\|plate	baseplate J/gp47 family protein	S6AVU3	Thermus_phage	6.3e-72	43.5
WP_014112415.1\|270014_270593_+	YmfQ family protein	A0A2H4J717	uncultured_Caudovirales_phage	9.7e-14	33.1
WP_014112416.1\|270589_270862_+	hypothetical protein	NA	NA	NA	NA
WP_014112417.1\|270865_272620_+	hypothetical protein	A0A1P8CWR7	Bacillus_phage	2.4e-23	39.6
WP_014112418.1\|272631_272961_+	XkdW family protein	NA	NA	NA	NA
WP_010330111.1\|272957_273122_+	XkdX family protein	A0A2H4JAA1	uncultured_Caudovirales_phage	1.9e-15	69.8
WP_014112419.1\|273213_274107_+	hypothetical protein	NA	NA	NA	NA
WP_041520837.1\|274152_274575_+\|holin	phage holin family protein	D6R405	Bacillus_phage	3.5e-53	80.5
WP_014112421.1\|274619_275594_+	N-acetylmuramoyl-L-alanine amidase	A0A218KC88	Bacillus_phage	8.2e-66	69.6
WP_014112422.1\|275632_275917_-	hypothetical protein	NA	NA	NA	NA
WP_014112423.1\|275922_277635_-	ribonuclease YeeF family protein	A0A1P8CWI7	Bacillus_phage	3.2e-81	64.5
WP_014112424.1\|277844_278978_+	tetratricopeptide repeat protein	A0A1P8CWN8	Bacillus_phage	6.2e-89	48.8

DBSCAN-SWA_3

818970 : 827336

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014112914.1\|818970_820266_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	2.2e-18	25.4
WP_014112915.1\|820340_821066_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0E3G7P8	Synechococcus_phage	1.2e-45	44.1
WP_014112916.1\|821058_821313_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_014112917.1\|821309_821993_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_014112918.1\|821976_824205_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	3.8e-159	40.1
WP_014112919.1\|824180_825611_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.5e-52	32.5
WP_014112920.1\|825711_826752_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	1.7e-64	41.4
WP_014112921.1\|826748_827336_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.2e-27	40.4

DBSCAN-SWA_4

1328025 : 1362149

Planktothrix_phage(20.0%)

tRNA,coat,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014113366.1\|1328025_1329018_-\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_014113367.1\|1329761_1331399_+	oligopeptide ABC transporter substrate-binding protein OppA	NA	NA	NA	NA
WP_014113368.1\|1331506_1332442_+	oligopeptide ABC transporter permease OppB	NA	NA	NA	NA
WP_014113369.1\|1332445_1333363_+	oligopeptide ABC transporter permease OppC	NA	NA	NA	NA
WP_072182805.1\|1333367_1334444_+	oligopeptide ABC transporter ATP-binding protein OppD	G9BWD6	Planktothrix_phage	2.1e-17	30.8
WP_014113371.1\|1334445_1335363_+	oligopeptide ABC transporter ATP-binding protein OppF	M1HP82	Acanthocystis_turfacea_Chlorella_virus	1.5e-05	24.6
WP_014113372.1\|1335556_1336681_+	MFS transporter	NA	NA	NA	NA
WP_003224597.1\|1336858_1337437_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_003239281.1\|1337617_1338013_+	transcriptional regulator Spx	NA	NA	NA	NA
WP_014113373.1\|1338267_1338924_-	TerC family protein	A0A2R2YAT9	Pseudomonas_phage	1.7e-30	38.4
WP_120698858.1\|1339107_1339233_+	hypothetical protein	NA	NA	NA	NA
WP_014113374.1\|1339199_1339856_+	adaptor protein MecA	NA	NA	NA	NA
WP_014113375.1\|1340015_1341167_+	competence protein CoiA	NA	NA	NA	NA
WP_166854689.1\|1341396_1343226_+	oligoendopeptidase F	NA	NA	NA	NA
WP_041520918.1\|1343263_1343431_-	hypothetical protein	NA	NA	NA	NA
WP_014113378.1\|1343744_1344644_-\|protease	protease adaptor protein SpxH	NA	NA	NA	NA
WP_003224612.1\|1344640_1345039_-	group 2 truncated hemoglobin YjbI	NA	NA	NA	NA
WP_080010123.1\|1345292_1345838_-	lytic transglycosylase domain-containing protein	A0A1P8CWQ1	Bacillus_phage	1.6e-39	72.9
WP_014113380.1\|1346044_1346617_-	CYTH domain-containing protein	NA	NA	NA	NA
WP_014113381.1\|1346740_1347106_+	hypothetical protein	NA	NA	NA	NA
WP_019713982.1\|1347134_1347770_+	GTP diphosphokinase	NA	NA	NA	NA
WP_003224622.1\|1347788_1348589_+	NAD kinase	NA	NA	NA	NA
WP_014113383.1\|1348603_1349503_+	RluA family pseudouridine synthase	NA	NA	NA	NA
WP_014113384.1\|1349515_1350250_-	bis(5'-nucleosyl)-tetraphosphatase PrpE	A0A1V0SJW2	Klosneuvirus	1.1e-11	27.0
WP_014113385.1\|1350483_1352328_+	monovalent cation:proton antiporter family protein	NA	NA	NA	NA
WP_014113386.1\|1352579_1353287_+	thiaminase II	NA	NA	NA	NA
WP_014113387.1\|1353264_1353882_+	thiazole tautomerase TenI	NA	NA	NA	NA
WP_014113388.1\|1353865_1354975_+	glycine oxidase ThiO	NA	NA	NA	NA
WP_072182824.1\|1354974_1355175_+	sulfur carrier protein ThiS	NA	NA	NA	NA
WP_080010067.1\|1355171_1355942_+	thiazole synthase	NA	NA	NA	NA
WP_014113390.1\|1355938_1356949_+	thiazole biosynthesis adenylyltransferase ThiF	NA	NA	NA	NA
WP_014113391.1\|1356966_1357782_+	bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase	NA	NA	NA	NA
WP_014113392.1\|1357918_1358695_+	enoyl-ACP reductase FabI	NA	NA	NA	NA
WP_080010068.1\|1358795_1359479_+\|coat	spore coat protein	NA	NA	NA	NA
WP_014113394.1\|1359570_1360020_-\|coat	spore coat protein	NA	NA	NA	NA
WP_014113395.1\|1360147_1360636_-\|coat	spore coat protein CotY	NA	NA	NA	NA
WP_014113396.1\|1360787_1361306_-\|coat	spore coat protein CotX	NA	NA	NA	NA
WP_014113397.1\|1361400_1361721_-	hypothetical protein	NA	NA	NA	NA
WP_014113398.1\|1361762_1362149_-\|coat	spore coat protein CotV	NA	NA	NA	NA

DBSCAN-SWA_5

1419524 : 1465957

Bacillus_phage(25.71%)

portal,terminase,holin,tail,capsid,plate,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014113457.1\|1419524_1420796_+	ATPase YjoB	A0A1V0SEI6	Indivirus	8.6e-15	37.1
WP_079288553.1\|1420940_1422077_+	response regulator aspartate phosphatase RapA	A0A1P8CWN8	Bacillus_phage	3.7e-94	47.4
WP_014113458.1\|1422066_1422201_+	phosphatase RapA inhibitor PhrA	NA	NA	NA	NA
WP_014113461.1\|1422607_1423561_+	N-acetylmuramoyl-L-alanine amidase	A0A218KC88	Bacillus_phage	2.1e-66	73.5
WP_014113462.1\|1423597_1423975_-	PH domain-containing protein	A5GYQ0	Lactococcus_phage	2.3e-16	42.3
WP_014113463.1\|1424081_1424684_+	poly-gamma-glutamate hydrolase family protein	A0A0Y0AJU6	Bacillus_phage	3.5e-43	47.3
WP_014113464.1\|1424758_1425595_+	manganese catalase family protein	NA	NA	NA	NA
WP_014113465.1\|1425639_1426236_-	ImmA/IrrE family metallo-endopeptidase	A0A2H4JA43	uncultured_Caudovirales_phage	5.6e-41	53.0
WP_003220555.1\|1426397_1426739_-	helix-turn-helix transcriptional regulator	A0A2H4J6F9	uncultured_Caudovirales_phage	5.9e-19	45.8
WP_003220557.1\|1426917_1427097_+	hypothetical protein	NA	NA	NA	NA
WP_014113466.1\|1427083_1427920_+	hypothetical protein	S6BFM4	Thermus_phage	9.7e-23	50.5
WP_072182446.1\|1427819_1428620_+	ATP-binding protein	A6XMI1	Bacillus_virus	7.0e-63	53.5
WP_014113468.1\|1428619_1428787_+	hypothetical protein	NA	NA	NA	NA
WP_014113469.1\|1428871_1429231_+	hypothetical protein	NA	NA	NA	NA
WP_014113470.1\|1429217_1429424_+	phage-like element PBSX protein XtrA	A0A2H4J4M6	uncultured_Caudovirales_phage	1.9e-12	50.0
WP_014113471.1\|1429538_1430048_+	sigma-70 family RNA polymerase sigma factor	A0A1L2JY33	Aeribacillus_phage	4.2e-21	38.0
WP_014113472.1\|1430165_1430963_+\|terminase	phage terminase small subunit	A0A0S2MVB6	Bacillus_phage	5.5e-60	50.6
WP_014113473.1\|1430959_1432261_+\|terminase	PBSX family phage terminase large subunit	A0A2P1JTW5	Anoxybacillus_phage	2.8e-154	60.5
WP_072182470.1\|1432264_1433752_+\|portal	phage portal protein	A0A1B1P7C8	Bacillus_phage	1.3e-139	55.7
WP_014113475.1\|1433771_1434599_+\|portal	phage portal protein	A0A1B1P7E4	Bacillus_phage	3.6e-54	58.7
WP_003220578.1\|1434623_1435559_+\|capsid	phage major capsid protein	A0A1B1P7E3	Bacillus_phage	8.6e-105	63.8
WP_014113476.1\|1435580_1435964_+	DUF3199 family protein	A0A1B1P7D6	Bacillus_phage	2.7e-12	38.7
WP_014113477.1\|1435960_1436317_+	YqbH/XkdH family protein	NA	NA	NA	NA
WP_014113478.1\|1436313_1436799_+	HK97 gp10 family phage protein	A0A249XXA4	Clostridium_phage	4.7e-38	46.2
WP_014113479.1\|1436811_1437252_+	hypothetical protein	NA	NA	NA	NA
WP_014113480.1\|1437255_1437474_+	hypothetical protein	NA	NA	NA	NA
WP_003220591.1\|1437470_1438871_+\|tail	phage tail sheath family protein	A0A0A7RTT5	Clostridium_phage	2.2e-80	40.0
WP_003220592.1\|1438872_1439316_+\|tail	phage tail tube protein	A0A0K2CNG3	Brevibacillus_phage	1.1e-25	45.2
WP_014113481.1\|1439408_1439855_+\|portal	phage portal protein	A0A0A7RTY8	Clostridium_phage	2.2e-10	35.8
WP_080010069.1\|1439896_1440037_+	hypothetical protein	NA	NA	NA	NA
WP_014113483.1\|1440037_1445218_+	transglycosylase SLT domain-containing protein	A0A1L2JY60	Aeribacillus_phage	4.4e-41	42.0
WP_014113484.1\|1445210_1445870_+	LysM peptidoglycan-binding domain-containing protein	A0A0A8WJR4	Clostridium_phage	6.2e-25	33.7
WP_014113485.1\|1445885_1446863_+\|portal	phage portal protein	H7BV96	unidentified_phage	3.0e-39	32.6
WP_014113486.1\|1446862_1447129_+	DUF2577 family protein	S6C459	Thermus_phage	4.9e-05	36.4
WP_014113487.1\|1447185_1447611_+	DUF2634 domain-containing protein	A0A0A7RTU4	Clostridium_phage	9.3e-14	37.5
WP_014113488.1\|1447603_1448650_+\|plate	baseplate J/gp47 family protein	S6AVU3	Thermus_phage	3.7e-72	43.5
WP_014113489.1\|1448633_1449212_+	YmfQ family protein	A0A2H4J717	uncultured_Caudovirales_phage	6.7e-15	33.8
WP_014113490.1\|1449208_1449481_+	hypothetical protein	NA	NA	NA	NA
WP_014113491.1\|1449483_1451925_+	hypothetical protein	A0A2H4J4R1	uncultured_Caudovirales_phage	1.8e-21	35.9
WP_014113492.1\|1451942_1452269_+	XkdW family protein	NA	NA	NA	NA
WP_014113493.1\|1452265_1452430_+	XkdX family protein	A0A2H4JAA1	uncultured_Caudovirales_phage	1.4e-15	67.9
WP_014113494.1\|1452474_1453314_+	hypothetical protein	NA	NA	NA	NA
WP_014113495.1\|1453366_1453636_+	hemolysin XhlA family protein	A0A2H4JD40	uncultured_Caudovirales_phage	1.9e-25	65.9
WP_014113496.1\|1453648_1453912_+\|holin	phage holin	A0A2H4J6M0	uncultured_Caudovirales_phage	1.6e-24	65.5
WP_014113497.1\|1453924_1454818_+	N-acetylmuramoyl-L-alanine amidase	Q9ZXD7	Bacillus_phage	2.2e-81	67.4
WP_136654612.1\|1454855_1454993_-	hypothetical protein	NA	NA	NA	NA
WP_003239095.1\|1455078_1455249_-	type II toxin-antitoxin system SpoIISB family antitoxin	NA	NA	NA	NA
WP_014113499.1\|1455248_1455995_-	toxin-antitoxin-antitoxin system toxin SpoIISA	NA	NA	NA	NA
WP_014113500.1\|1456104_1457106_-	inorganic phosphate transporter	NA	NA	NA	NA
WP_014113501.1\|1457118_1457736_-	DUF47 domain-containing protein	NA	NA	NA	NA
WP_014113502.1\|1458012_1459329_-	serine/threonine exchanger	NA	NA	NA	NA
WP_014113503.1\|1459713_1460664_+	ring-cleaving dioxygenase	NA	NA	NA	NA
WP_120698821.1\|1460764_1460911_+	hypothetical protein	NA	NA	NA	NA
WP_014113505.1\|1460917_1463107_+	glycosyltransferase family 39 protein	NA	NA	NA	NA
WP_014113506.1\|1463118_1464090_+	glycosyltransferase family 2 protein	A0A2H5BFL1	Salmonella_phage	7.2e-62	40.6
WP_041520925.1\|1464263_1464440_-	hypothetical protein	NA	NA	NA	NA
WP_041520926.1\|1464598_1465957_-\|protease	serine protease HtrA	A0A1B1IT49	uncultured_Mediterranean_phage	1.4e-23	33.0

DBSCAN-SWA_6

1972531 : 1979280

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014113877.1\|1972531_1972924_+	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	G3MBF1	Bacillus_virus	8.5e-30	59.1
WP_014113878.1\|1972883_1974986_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	U5PY35	Bacillus_phage	0.0e+00	86.5
WP_014113879.1\|1975003_1975993_+	class 1b ribonucleoside-diphosphate reductase subunit beta	F8WQ21	Bacillus_phage	1.1e-155	84.1
WP_014113880.1\|1976042_1976663_+	hypothetical protein	A0A127AYS1	Bacillus_phage	7.1e-47	48.4
WP_014113881.1\|1976726_1977494_-	sporulation-specific N-acetylmuramoyl-L-alanine amidase	E5DV68	Deep-sea_thermophilic_phage	1.7e-50	48.7
WP_014113883.1\|1978311_1979280_+	stage V sporulation protein K	G3MAX6	Bacillus_virus	2.3e-52	41.8

DBSCAN-SWA_7

2391842 : 2397935

Staphylococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003223904.1\|2391842_2392436_-	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	2.0e-14	35.4
WP_041521175.1\|2392425_2393181_-	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	5.5e-09	28.3
WP_014114253.1\|2393459_2393984_+	DUF309 domain-containing protein	NA	NA	NA	NA
WP_003223910.1\|2393997_2394372_-	GNAT family N-acetyltransferase RibT	NA	NA	NA	NA
WP_003223915.1\|2394483_2394948_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	5.5e-44	60.0
WP_014114254.1\|2394980_2396177_-	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	5.9e-114	54.4
WP_014114255.1\|2396191_2396839_-	riboflavin synthase subunit alpha	A0A2H4PQS5	Staphylococcus_phage	5.0e-43	45.9
WP_014114256.1\|2396849_2397935_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	6.6e-56	36.1

DBSCAN-SWA_8

3422868 : 3450569

Organic_Lake_phycodnavirus(25.0%)

holin,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014115187.1\|3422868_3423522_-\|holin	choline ABC transporter permease OpuBB	NA	NA	NA	NA
WP_014115188.1\|3423536_3424682_-\|holin	betaine/proline/choline family ABC transporter ATP-binding protein	F2Y2R6	Organic_Lake_phycodnavirus	2.7e-15	32.7
WP_014115190.1\|3424966_3425500_+	GbsR/MarR family transcriptional regulator	NA	NA	NA	NA
WP_014115191.1\|3425533_3426202_-\|holin	glycine betaine/carnitine/choline/choline sulfate ABC transporter permease OpuCD	NA	NA	NA	NA
WP_014115192.1\|3426219_3427137_-	osmoprotectant ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003219978.1\|3427150_3427804_-\|holin	glycine betaine/carnitine/choline/choline sulfate ABC transporter permease OpuCB	NA	NA	NA	NA
WP_014115193.1\|3427826_3428966_-\|holin	betaine/proline/choline family ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	6.1e-12	29.3
WP_014115194.1\|3429229_3429787_+	opuC operon transcriptional regulator OpcR	NA	NA	NA	NA
WP_014115196.1\|3430314_3431013_+	zinc ribbon domain-containing protein	NA	NA	NA	NA
WP_014115197.1\|3431048_3432863_-	zinc ribbon domain-containing protein	NA	NA	NA	NA
WP_014115199.1\|3432995_3433457_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_007409956.1\|3433499_3434792_-	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	1.9e-174	71.0
WP_014115200.1\|3434820_3436356_-	2,3-bisphosphoglycerate-independent phosphoglycerate mutase	NA	NA	NA	NA
WP_010328643.1\|3436348_3437110_-	triose-phosphate isomerase	NA	NA	NA	NA
WP_003219959.1\|3437140_3438325_-	phosphoglycerate kinase	NA	NA	NA	NA
WP_003219957.1\|3438641_3439649_-	type I glyceraldehyde-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_014115202.1\|3439695_3440718_-	gapA transcriptional regulator CggR	NA	NA	NA	NA
WP_014115204.1\|3441018_3442413_-	arabinose-proton symporter AraE	NA	NA	NA	NA
WP_041521074.1\|3442616_3443705_+	arabinose utilization transcriptional regulator AraR	NA	NA	NA	NA
WP_014115206.1\|3443755_3444766_-	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_014115208.1\|3444923_3445802_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_014115209.1\|3445899_3446817_+	DMT family transporter	NA	NA	NA	NA
WP_014115210.1\|3446857_3448201_-	amino acid permease	NA	NA	NA	NA
WP_087941766.1\|3449418_3450569_-\|transposase	IS3 family transposase	A0A0N9SIX5	Staphylococcus_phage	3.5e-39	61.9

DBSCAN-SWA_9

3820965 : 3930510

111

Bacillus_phage(27.78%)

holin,lysis,bacteriocin,protease,tRNA,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014115544.1\|3820965_3822636_-\|tRNA	arginine--tRNA ligase	NA	NA	NA	NA
WP_014115545.1\|3822632_3823061_-	DUF1934 domain-containing protein	NA	NA	NA	NA
WP_003222002.1\|3823373_3823505_+\|bacteriocin	subtilosin A family bacteriocin	NA	NA	NA	NA
WP_014115546.1\|3823636_3824983_+	subtilosin maturase AlbA	NA	NA	NA	NA
WP_014115547.1\|3824995_3825157_+\|bacteriocin	antilisterial bacteriocin subtilosin biosynthesis protein AlbB	NA	NA	NA	NA
WP_014115548.1\|3825153_3825873_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.5e-19	27.6
WP_014115549.1\|3825865_3827176_+\|bacteriocin	antilisterial bacteriocin subtilosin biosynthesis protein AlbD	NA	NA	NA	NA
WP_079287694.1\|3827165_3828326_+	insulinase family protein	NA	NA	NA	NA
WP_014115551.1\|3828330_3829614_+	insulinase family protein	NA	NA	NA	NA
WP_014115552.1\|3829610_3830312_+\|bacteriocin	bacteriocin biosynthesis protein AlbG	NA	NA	NA	NA
WP_014115553.1\|3830449_3831805_-	YncE family protein	NA	NA	NA	NA
WP_014115555.1\|3832031_3833177_+	response regulator aspartate phosphatase RapF	A0A1P8CWN8	Bacillus_phage	1.9e-77	43.5
WP_009968329.1\|3833160_3833280_+	phosphatase RapF inhibitor PhrF	NA	NA	NA	NA
WP_041521094.1\|3833520_3834000_+	hypothetical protein	NA	NA	NA	NA
WP_014115557.1\|3834149_3834938_+	membrane protein	NA	NA	NA	NA
WP_014115558.1\|3834924_3835599_+	hypothetical protein	NA	NA	NA	NA
WP_014115559.1\|3835599_3836406_+	hypothetical protein	NA	NA	NA	NA
WP_014115560.1\|3836408_3837056_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	7.7e-28	40.0
WP_014115561.1\|3837048_3837609_+	hypothetical protein	NA	NA	NA	NA
WP_014115562.1\|3837655_3838528_-	agmatinase	NA	NA	NA	NA
WP_003222027.1\|3838588_3839419_-	spermidine synthase	NA	NA	NA	NA
WP_014115563.1\|3839620_3841696_+	penicillin-binding protein	NA	NA	NA	NA
WP_014115565.1\|3842017_3842536_-	YwhD family protein	NA	NA	NA	NA
WP_014115566.1\|3842548_3843208_-\|protease	site-2 protease family protein	NA	NA	NA	NA
WP_003222038.1\|3843316_3843505_+	4-oxalocrotonate tautomerase	NA	NA	NA	NA
WP_014115567.1\|3843547_3843967_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_014115568.1\|3844086_3846003_-\|tRNA	threonine--tRNA ligase	A0A2K9L297	Tupanvirus	1.2e-140	42.5
WP_014115569.1\|3846610_3846766_-	hypothetical protein	NA	NA	NA	NA
WP_003222046.1\|3846901_3847402_-	YwgA family protein	NA	NA	NA	NA
WP_014115571.1\|3847437_3848739_-	HD domain-containing protein	E3T4P8	Cafeteria_roenbergensis_virus	4.2e-25	29.3
WP_003222050.1\|3848899_3849124_-	DUF1450 domain-containing protein	NA	NA	NA	NA
WP_014115572.1\|3849338_3850118_+	prespore-specific transcription regulator RsfA	A0A1D6X8E5	Bacillus_phage	7.7e-06	50.0
WP_041521207.1\|3850261_3851152_-	DMT family transporter	NA	NA	NA	NA
WP_014115574.1\|3851321_3852167_-	octanoyl-[GcvH]:protein N-octanoyltransferase	NA	NA	NA	NA
WP_014115575.1\|3852214_3853114_-	cysJI operon transcriptional regulator CysL	A0A2H4J8I9	uncultured_Caudovirales_phage	3.6e-07	42.5
WP_014115576.1\|3853260_3854232_-	phosphate acetyltransferase	NA	NA	NA	NA
WP_014115577.1\|3854501_3855266_+	heme-dependent peroxidase	NA	NA	NA	NA
WP_014115578.1\|3855397_3856177_+	NADPH-dependent reductase BacG	NA	NA	NA	NA
WP_014115579.1\|3856191_3857391_-	transaminase BacF	NA	NA	NA	NA
WP_041521096.1\|3857391_3858576_-	bacilysin exporter BacE	NA	NA	NA	NA
WP_014115581.1\|3858572_3859991_-	alanine--anticapsin ligase	NA	NA	NA	NA
WP_014115582.1\|3860009_3860771_-	dihydroanticapsin 7-dehydrogenase	Q06VL0	Trichoplusia_ni_ascovirus	5.7e-22	31.7
WP_003222084.1\|3860773_3861481_-	3-((4R)-4-hydroxycyclohexa-1, 5-dien-1-yl)-2-oxopropanoate isomerase	NA	NA	NA	NA
WP_014115583.1\|3861470_3862085_-	prephenate decarboxylase	NA	NA	NA	NA
WP_014115584.1\|3862235_3863474_-	MFS transporter	NA	NA	NA	NA
WP_014115585.1\|3863687_3865100_-	amino acid permease	NA	NA	NA	NA
WP_014115586.1\|3865099_3866800_-	M20/M25/M40 family metallo-hydrolase	NA	NA	NA	NA
WP_014115587.1\|3866872_3868420_-	L-glutamate gamma-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_014115588.1\|3868659_3869934_-	glutamate dehydrogenase	NA	NA	NA	NA
WP_003222098.1\|3870112_3870577_-	biofilm-surface layer protein BslB	NA	NA	NA	NA
WP_003222100.1\|3870900_3871356_-	dTDP-4-dehydrorhamnose 3,5-epimerase family protein	NA	NA	NA	NA
WP_041521097.1\|3871348_3872200_-	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	6.8e-40	39.3
WP_014115589.1\|3872213_3873161_-	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	8.8e-73	44.4
WP_014115590.1\|3873160_3873901_-	NTP transferase domain-containing protein	I7I009	Enterobacteria_phage	2.2e-47	41.5
WP_041521098.1\|3873925_3874945_-\|coat	spore coat protein	NA	NA	NA	NA
WP_014115591.1\|3874947_3875670_-\|coat	spore coat protein	NA	NA	NA	NA
WP_014115592.1\|3875662_3876784_-	N-acetylneuraminate synthase family protein	NA	NA	NA	NA
WP_014115593.1\|3876783_3877653_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_014115594.1\|3877654_3878824_-	DegT/DnrJ/EryC1/StrS aminotransferase family protein	E5ES46	Bathycoccus_sp._RCC1105_virus	4.7e-15	28.1
WP_014115595.1\|3878845_3880270_-	CDP-glycerol glycerophosphotransferase family protein	NA	NA	NA	NA
WP_014115596.1\|3880274_3881045_-\|coat	spore coat dTDP-glycosyltransferase SpsA	A0A0F7L2F7	uncultured_marine_virus	3.4e-06	28.6
WP_014115597.1\|3881364_3881901_+\|coat	spore coat protein GerQ	NA	NA	NA	NA
WP_003222123.1\|3881944_3882316_-	DUF423 domain-containing protein	NA	NA	NA	NA
WP_014115598.1\|3882377_3883700_-	solute carrier family 23 protein	NA	NA	NA	NA
WP_014115599.1\|3883718_3884036_-	YwdI family protein	NA	NA	NA	NA
WP_041521099.1\|3884203_3885574_+	aldehyde dehydrogenase	NA	NA	NA	NA
WP_014115602.1\|3885601_3886279_-	uracil-DNA glycosylase	A0A172DS90	Canid_alphaherpesvirus	3.2e-48	47.0
WP_014115603.1\|3886293_3887100_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_041521100.1\|3887189_3887723_-	hypothetical protein	NA	NA	NA	NA
WP_014115605.1\|3887770_3888406_-	hypothetical protein	NA	NA	NA	NA
WP_014115606.1\|3888398_3888737_-	PadR family transcriptional regulator	NA	NA	NA	NA
WP_041521101.1\|3888880_3889696_+	bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase	NA	NA	NA	NA
WP_014115608.1\|3889785_3890034_-	hypothetical protein	NA	NA	NA	NA
WP_014115609.1\|3890127_3891567_-	sucrose-6-phosphate hydrolase	F8WPR5	Bacillus_phage	6.3e-22	27.5
WP_014115610.1\|3891563_3892949_-	PTS system sucrose transporter subunit IIBC	NA	NA	NA	NA
WP_014115611.1\|3893250_3894021_+	formate/nitrite transporter family protein	NA	NA	NA	NA
WP_014115612.1\|3894059_3894890_-	sac operon transcriptional antiterminator SacT	NA	NA	NA	NA
WP_003222155.1\|3894929_3895232_-	hypothetical protein	NA	NA	NA	NA
WP_014115613.1\|3895760_3898181_+\|protease	serine protease Vpr	A0A217EQY2	Bacillus_phage	5.3e-21	38.6
WP_014115614.1\|3898218_3899220_-	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_014115615.1\|3899395_3900145_-	oxygen-insensitive NADPH nitroreductase	NA	NA	NA	NA
WP_014115617.1\|3900250_3901432_-	cell shape-determining peptidoglycan glycosyltransferase RodA	NA	NA	NA	NA
WP_014115618.1\|3901642_3902788_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_003227411.1\|3903016_3903280_+	spore morphogenesis/germination protein YwcE	NA	NA	NA	NA
WP_003222169.1\|3903321_3903696_-	cytochrome aa3 quinol oxidase subunit IV	NA	NA	NA	NA
WP_003236031.1\|3903697_3904312_-	cytochrome aa3 quinol oxidase subunit III	NA	NA	NA	NA
WP_014115619.1\|3904325_3906275_-	cytochrome aa3 quinol oxidase subunit I	NA	NA	NA	NA
WP_079287695.1\|3906302_3907268_-	cytochrome aa3 quinol oxidase subunit II	NA	NA	NA	NA
WP_003222176.1\|3907781_3908027_+	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
WP_014115621.1\|3908096_3909638_-	UDP-glucose--hexose-1-phosphate uridylyltransferase	NA	NA	NA	NA
WP_014115622.1\|3909641_3910814_-	galactokinase	NA	NA	NA	NA
WP_014115623.1\|3910898_3911282_-	GtrA family protein	NA	NA	NA	NA
WP_014115624.1\|3911299_3911971_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_014115625.1\|3912323_3912482_+	anti-repressor SinI family protein	NA	NA	NA	NA
WP_003222190.1\|3912924_3913233_+	DUF485 domain-containing protein	NA	NA	NA	NA
WP_014115626.1\|3913229_3914771_+	cation acetate symporter	NA	NA	NA	NA
WP_014115627.1\|3914812_3915415_-	DsbA family protein	NA	NA	NA	NA
WP_014115628.1\|3915503_3916754_-	deferrochelatase/peroxidase EfeB	NA	NA	NA	NA
WP_014115629.1\|3916772_3917930_-	iron uptake system lipoprotein EfeM	NA	NA	NA	NA
WP_014115630.1\|3917926_3919372_-	ferrous ion permease EfeU	NA	NA	NA	NA
WP_014115632.1\|3919527_3920196_-	thiamine phosphate synthase	NA	NA	NA	NA
WP_014115633.1\|3920192_3921011_-	hydroxyethylthiazole kinase	NA	NA	NA	NA
WP_014115634.1\|3921018_3921924_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_003222205.1\|3922029_3922416_+\|holin	CidA/LrgA family holin-like protein	NA	NA	NA	NA
WP_014115635.1\|3922397_3923075_+\|lysis	CidB/LrgB family autolysis modulator	NA	NA	NA	NA
WP_003222222.1\|3924310_3924508_+	YwbE family protein	NA	NA	NA	NA
WP_014115636.1\|3924536_3925724_-	class I SAM-dependent rRNA methyltransferase	W6LLI2	Streptococcus_phage	1.4e-75	43.2
WP_003236077.1\|3925846_3926227_+	glyoxalase GlxA	NA	NA	NA	NA
WP_014115637.1\|3926264_3926942_-	DUF2711 family protein	NA	NA	NA	NA
WP_014115638.1\|3927022_3928345_-	PTS cellobiose transporter subunit IIC	NA	NA	NA	NA
WP_014115640.1\|3928572_3930510_+\|protease	minor protease Epr	A0A1B0T6A2	Bacillus_phage	1.0e-46	36.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_016047

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection