CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NC_017622	Streptococcus suis A7, complete sequence	3 crisprs	PrimPol,DinG,csa3,cas3,DEDDh	0	0	5	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_017622_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_017622_1

1176447-1176536

Orphan

Consensus_repeat	Method
TGACGAGTGGCTTCATACCAACGTA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_017622_1

>merge|NC_017622|1|1176447-1176536|CRISPRCasFinder
TGACGAGTGGCTTCATACCAACGTAAATCATCCGTCTGTGACCAAGTGGGTAAAATAACACTTGATGACGAGTAGCTTCATACCAACGTA

>NC_017622|1|1|1176447-1176536|CRISPRCasFinder
TGACGAGTGGCTTCATACCAACGTA	AATCATCCGTCTGTGACCAAGTGGGTAAAATAACACTTGA
TGACGAGTAGCTTCATACCAACGTA

Protein	Signature genes	Signature genes Name	Protein_function
NC_017622.1\|WP_012027251.1\|1184239_1185034_-\|Nif3-like-dinuclear-metal-center-hexameric-protein	unknown	unknown	gnl\|CDD\|376614
NC_017622.1\|WP_012027253.1\|1185708_1186383_-\|DnaD-domain-containing-protein	unknown	unknown	gnl\|CDD\|226445
NC_017622.1\|WP_002937118.1\|1181194_1181680_-\|hypothetical-protein	unknown	unknown	unknown
NC_017622.1\|WP_002937100.1\|1167957_1169172_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224057
NC_017622.1\|WP_012775202.1\|1183239_1184064_-\|ZIP-family-metal-transporter	unknown	unknown	gnl\|CDD\|223505
NC_017622.1\|WP_012027249.1\|1182272_1183142_-\|glucose-1-phosphate-thymidylyltransferase-RfbA	unknown	unknown	gnl\|CDD\|130274
NC_017622.1\|WP_012775199.1\|1163616_1164924_-\|DUF2142-domain-containing-protein	unknown	unknown	gnl\|CDD\|370749
NC_017622.1\|WP_012027234.1\|1164920_1166180_-\|lipopolysaccharide-biosynthesis-protein	unknown	unknown	gnl\|CDD\|240533
NC_017622.1\|WP_012027238.1\|1169980_1170910_-\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|133039
NC_017622.1\|WP_041179340.1\|1166212_1167937_-\|rhamnan-synthesis-protein-F	unknown	unknown	gnl\|CDD\|377447
NC_017622.1\|WP_014636419.1\|1172268_1174818_+\|alkaline-phosphatase-family-protein	unknown	unknown	gnl\|CDD\|293739
NC_017622.1\|WP_012775203.1\|1185023_1185707_-\|tRNA-(adenine-N(1))-methyltransferase	unknown	unknown	gnl\|CDD\|225258
NC_017622.1\|WP_074390297.1\|1174877_1175306_-\|glucosaminidase	unknown	unknown	gnl\|CDD\|224619
NC_017622.1\|WP_012775201.1\|1177993_1179037_-\|LPXTG-cell-wall-anchor-domain-containing-protein	unknown	unknown	unknown
NC_017622.1\|WP_012775198.1\|1162604_1163594_-\|glycosyltransferase-family-8-protein	unknown	unknown	gnl\|CDD\|133037
NC_017622.1\|WP_012027245.1\|1179053_1179905_-\|dTDP-4-dehydrorhamnose-reductase	unknown	unknown	gnl\|CDD\|367904
NC_017622.1\|WP_012028306.1\|1170906_1172055_-\|DUF1972-domain-containing-protein	unknown	unknown	gnl\|CDD\|340858
NC_017622.1\|WP_012027237.1\|1169171_1169978_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224596
NC_017622.1\|WP_012027248.1\|1181679_1182273_-\|dTDP-4-dehydrorhamnose-3,5-epimerase	unknown	unknown	gnl\|CDD\|380337
NC_017622.1\|WP_002937117.1\|1179959_1181006_-\|dTDP-glucose-4,6-dehydratase	unknown	unknown	gnl\|CDD\|224013

Protein	Function_ID	Function_description	E-value
NC_017622.1\|WP_012027251.1\|1184239_1185034_-\|Nif3-like-dinuclear-metal-center-hexameric-protein	gnl\|CDD\|376614	pfam01784, NIF3, NIF3 (NGG1p interacting factor 3). This family contains several NIF3 (NGG1p interacting factor 3) protein homologs. NIF3 interacts with the yeast transcriptional coactivator NGG1p which is part of the ADA complex, the exact function of this interaction is unknown.	5.04263e-82
NC_017622.1\|WP_012027253.1\|1185708_1186383_-\|DnaD-domain-containing-protein	gnl\|CDD\|226445	COG3935, DnaD, Putative primosome component and related proteins [DNA replication, recombination, and repair].	1.16527e-67
NC_017622.1\|WP_002937100.1\|1167957_1169172_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224057	COG1134, TagH, ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane].	3.88202e-117
NC_017622.1\|WP_012775202.1\|1183239_1184064_-\|ZIP-family-metal-transporter	gnl\|CDD\|223505	COG0428, COG0428, Predicted divalent heavy-metal cations transporter [Inorganic ion transport and metabolism].	1.03609e-62
NC_017622.1\|WP_012775199.1\|1163616_1164924_-\|DUF2142-domain-containing-protein	gnl\|CDD\|370749	pfam09913, DUF2142, Predicted membrane protein (DUF2142). This domain, found in various hypothetical prokaryotic proteins, has no known function.	3.17333e-75
NC_017622.1\|WP_012027234.1\|1164920_1166180_-\|lipopolysaccharide-biosynthesis-protein	gnl\|CDD\|240533	cd13128, MATE_Wzx_like, Wzx, a subfamily of the multidrug and toxic compound extrusion (MATE)-like proteins. Escherichia coli Wzx and related proteins from other gram-negative bacteria are thought to act as flippases, assisting in the membrane translocation of lipopolysaccharides including those containing O-antigens. Proteins from the MATE family are involved in exporting metabolites across the cell membrane and are often responsible for multidrug resistance (MDR).	2.13925e-18
NC_017622.1\|WP_012027238.1\|1169980_1170910_-\|glycosyltransferase-family-2-protein	gnl\|CDD\|133039	cd04196, GT_2_like_d, Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.	1.53639e-86
NC_017622.1\|WP_041179340.1\|1166212_1167937_-\|rhamnan-synthesis-protein-F	gnl\|CDD\|377447	pfam05045, RgpF, Rhamnan synthesis protein F. This family consists of a group of proteins which are related to the Streptococcus rhamnose-glucose polysaccharide assembly protein (RgpF). Rhamnan backbones are found in several O polysaccharides of phytopathogenic bacteria and are regarded as pathogenic factors.	1.11245e-70
NC_017622.1\|WP_014636419.1\|1172268_1174818_+\|alkaline-phosphatase-family-protein	gnl\|CDD\|293739	cd16015, LTA_synthase, Lipoteichoic acid synthase like. Lipoteichoic acid (LTA) is an important cell wall polymer found in Gram-positive bacteria. It may contain long chains of ribitol or glycerol phosphate. LTA synthase catalyzes the reaction to extend the polymer by the repeated addition of glycerolphosphate (GroP) subunits to the end of the growing chain.	9.6557e-67
NC_017622.1\|WP_012775203.1\|1185023_1185707_-\|tRNA-(adenine-N(1))-methyltransferase	gnl\|CDD\|225258	COG2384, COG2384, Predicted SAM-dependent methyltransferase [General function prediction only].	1.15625e-92
NC_017622.1\|WP_074390297.1\|1174877_1175306_-\|glucosaminidase	gnl\|CDD\|224619	COG1705, FlgJ, Muramidase (flagellum-specific) [Cell motility and secretion / Intracellular trafficking and secretion].	3.56435e-42
NC_017622.1\|WP_012027249.1\|1182272_1183142_-\|glucose-1-phosphate-thymidylyltransferase-RfbA	gnl\|CDD\|130274	TIGR01207, Glucose-1-phosphate_thymidylyltransferase_1, glucose-1-phosphate thymidylyltransferase, short form. Alternate name: dTDP-D-glucose synthase homotetramer This model describes a tightly conserved but broadly distributed subfamily (here designated as short form) of known and putative bacterial glucose-1-phosphate thymidylyltransferases. It is well characterized in several species as the first of four enzymes involved in the biosynthesis of dTDP-L-rhamnose, a cell wall constituent and a feedback inhibitor of the enzyme. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides].	0
NC_017622.1\|WP_012775198.1\|1162604_1163594_-\|glycosyltransferase-family-8-protein	gnl\|CDD\|133037	cd04194, GT8_A4GalT_like, A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.	1.00214e-72
NC_017622.1\|WP_012027245.1\|1179053_1179905_-\|dTDP-4-dehydrorhamnose-reductase	gnl\|CDD\|367904	pfam04321, RmlD_sub_bind, RmlD substrate binding domain. L-rhamnose is a saccharide required for the virulence of some bacteria. Its precursor, dTDP-L-rhamnose, is synthesized by four different enzymes the final one of which is RmlD. The RmlD substrate binding domain is responsible for binding a sugar nucleotide.	3.3376e-128
NC_017622.1\|WP_012028306.1\|1170906_1172055_-\|DUF1972-domain-containing-protein	gnl\|CDD\|340858	cd04955, GT4-like, glycosyltransferase family 4 proteins. This family is most closely related to the GT4 family of glycosyltransferases. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found in certain bacteria and Archaea.	0
NC_017622.1\|WP_012027237.1\|1169171_1169978_-\|ABC-transporter-permease	gnl\|CDD\|224596	COG1682, TagG, ABC-type polysaccharide/polyol phosphate export systems, permease component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane].	1.41516e-49
NC_017622.1\|WP_012027248.1\|1181679_1182273_-\|dTDP-4-dehydrorhamnose-3,5-epimerase	gnl\|CDD\|380337	cd00438, cupin_RmlC, RmlC carbohydrate epimerase, involved in dTDP-L-rhamnose production. RmlC (deoxythymidine diphosphate (dTDP)-4-keto-6-deoxy-D-hexulose 3, 5-epimerase or dTDP-6-deoxy-D-xylo-4-hexulose 3,5-epimerase; also known as RfbC) is a carbohydrate epimerase involved in the production of dTDP-L-rhamnose, a precursor of the bacterial cell wall constituent, L-rhamnose. L-Rhamnose (6-deoxy-l-mannose) plays an important role in the cell-wall structure of many bacterial species. It has been found to contribute to the virulence of several species, including the Gram-negative Salmonella enterica and Vibrio cholerae, where it is present as a part of the O-antigen, and is essential for the growth of Gram-positive bacteria such as Streptococcus pyogenes. RmlC converts dTDP-6-deoxy-D-xylo-4-hexulose to dTDP-6-deoxy-L-xylo-hexulose by catalyzing the epimerization of the 5-methyl and 3-hydroxyl groups of hexulose, the third of four steps in the dTDP-L-rhamnose biosynthetic pathway. RmlC belongs to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold capable of homodimerization.	2.18994e-53
NC_017622.1\|WP_002937117.1\|1179959_1181006_-\|dTDP-glucose-4,6-dehydratase	gnl\|CDD\|224013	COG1088, RfbB, dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane].	0

>NC_017622.1|WP_074390297.1|1174877_1175306_-|glucosaminidase
MEQSSKANSILSSVMLSQAILESAWGTSYLATHGNNLFGIKADAAWTGATIEIITNEYRDGEKKQEKHLFRKYNSWNESVADYAKFFTSTPWRIKNYQSFREATDYQQAILALRQSGYATDPKYGEKLRSIIENYKLYLLDN
>NC_017622.1|WP_014636419.1|1172268_1174818_+|alkaline-phosphatase-family-protein
MKLIKQLIHILISIGLIGSFFLYAHLIQNELGSTKNDGTIEIIAEQPNQVIDSIQINGRYIHSSEIIENQWGINDADLIPNFSSLGEENSLVIKSSSSVRTLSFEYFVSENPTIVKIKVGGQLVESIDTSTGDKYKNLAFIELPYTLRITKDNQFWYLHLIVLALGLTCFILNGATWRIKRRDIRILTILLIVQYIFTTFTFPRLYRNELVLFNSNFNKMETQQLLVALTYLIFFSLLGYKQLRGHISKAFKTISLSVIYLLVPIFSLFIIENSYSQFSTLSSNSLWNNLIIIGVLYLILVFTTNLRFASLLILSASVFIGISNQLLIDSRGAPLLFYNLFQITDGLNVASSVAININNRMLQSMVFSYILLTFFFFIPKLYLPKLLPSRTFYSSYDFKWPKRFSRILLGYITLITIVPMINKTVVSNANISLNYWRMYVTYGQFGLPLSLASFYEDSKITKPEGYSVPKLNEVLEKYPPETEKQTIRPNIIFIQNESQSDFSNLQGLNMEPNPLSNQHALTDNTIHGTLNVSVFGGGTANTEYEVLTSNPISLLSSNLFPYQQIITQDRPSFATYLKNKNYDTVALHPQSGNNYNRNAVYPLLGFNKSYFLDSEPAISSLAPLTIDRGWPSDQFLFNGIKELYTQKGDQPLFSFVVTMQGHGGYPSTEEIYPREVSINGSTSEYLAETEFLTSMKRTDEAFADLITFFSTYKEPTVIVMYGDHQPSLTQEFYAQFMDENNPAAKYSTPLVIWSNFDIRERESTTISPNYLVPYLMDILSESDYALPRSPYQQFLSDMQIEAPIITSWGNIDNNGQQIEDLSTLPLYQTYLQLEYNSAIDKQPLTDLYE
>NC_017622.1|WP_012028306.1|1170906_1172055_-|DUF1972-domain-containing-protein
MKHVFIIGSRGLPAKYGGFETFVQQLVSHQQSEKICYHVACLSDTSHHQHSTYLGADCFTINPPKLGPARVIAYDMMAITYALKIIKEQQIERPIFYILGNTIGGFIVPFAKQIHSVGGTLFVNPDGLEWKRAKWAKPVQRYLKFSEKMMVKYADLIIADNEGIEDYIQSEYSATNTRFIAYGTDLSPTKLTKESEQVRQYFTNWNIKEKEFYLIIGRFVPENNYVTAIREFMASNTRRDLVIVANHEGSAYFQKLKDETGFISDKRIKFVGTVYDQELLKYLRQECRAYIHGHEVGGTNPSLLEALAQTNENLVLGVDFNRKVALEGARYWSKESGSLSQLINQIDENAEAMELGEIAKKHMKDEYTWEKIVQEYEELFLQ
>NC_017622.1|WP_012027238.1|1169980_1170910_-|glycosyltransferase-family-2-protein
MKVNILMSTYNGQQFLAEQIRSIQEQSYIDWTLFIRDDGSSDRTREIIKDFVEQDQRIHFIDVETDENLGVIKSFHRLVHYDTADFYFFSDQDDVWLPNKLEVSLKKAQAYPTNLPLMVYMDLKVVNQNLEVMAESMVKSQSHHANTELVQELTENTVTGGVAMINHHLAEMWQVTEDILMHDWYLALLASALGKLVFIDKPGELYRQHSDNVLGARTLSKRFKKWIRPHILFAVYWDLIKNSQKQARHLLQMPLSQSNRELIEAFVTIMDKPMLERFRILRKYGLRKNKTFHTLVFTTLIVTKFAYKE
>NC_017622.1|WP_012027237.1|1169171_1169978_-|ABC-transporter-permease
MNLLNKENQILLREMIKTDFKLRYQGSLIGHLWSILKPMLLFTIMYLVFVRFLRFDDGTPHYAVGLLLGMVTWNFFTEATNMGMMSIVSRGDLLRKLNFSKEIIVFSSVAGAAINYAINLMVVFVFAAINGVPFTWSVLVIIPLFFELALLATGIAFILSSLFVRFRDIGPIWEVFLQAGLYATPIIYSLTFILQRGQVTFAKLMMLNPVAQIIQDLRHFIVYSGNTTVSELIENPVIVAIPYILPVVVYLLGITVFRKNAKKFAEIL
>NC_017622.1|WP_002937100.1|1167957_1169172_-|ABC-transporter-ATP-binding-protein
MVKNNNIAVKVEHVSKSFKLPTESSQSLRTTLVNLFKGIKGYVEYNVLQDISFEVEKGDFFGIVGRNGSGKSTLLKILSQIYVPERGTVAVDGKLVSFIELGVGFNPELTGKENVYLNGAMLGFTAEEIDAMYDDIVEFAELSEFMNQKLKNYSSGMQVRLAFSVAIKAQGDILILDEVLAVGDEAFQRKCNDYFLERKKSGKTTILVTHDMGAVKKYCNKALLIEKGYVKALGEPDDVANQYSFDNVLASISEVTENEEPLHQSDIVKDLQINLVSKNQIEPDESIEIEFRYTVLEDIETHVAFTFLDLERHFDVYNDNSMDLKTFGKGEKFFRVKCKLPSINQAKLKMAVSVRNSNKQPLLFAKTSDTPAIFISRKFSTDNIAEEDAATGFIQRNSQWELLD
>NC_017622.1|WP_041179340.1|1166212_1167937_-|rhamnan-synthesis-protein-F
MSRLLVYVHYNKYNVVSEYIYFQLKSIRSIYSDIVFVSNSHVSKDIVQYLQSERLIDFFIQRDNIGYDFAAWKEGLNQVTFYQYDSVTLMNDTCFGPLWDLEDYYSQFDSDVDVDFWGMTNHLETKIDSVVVPEHLQSYFMVFKKRILQSQAFVGFWSSVSELTDIQDVIKLYESQLTKILLSEGYSYKCALDTSICCKTLENSNITLEYPEVILKNNVPFIKIKSFTEYPDRIYSLLHLIRMKTKYPVELIERHLRQIIIPGTSFIPQIRVSQTTETVRSSTSVLLHVHIESVSIFEEYIEELCKIADRCQLLITLPEDDFSNKCSIVERCLFTYQLRAQIAKLTDELHFFEIVNNYMGDAKYLAHVTVKQTKEIKYSVEDIIDRHQLRKMFFTSFDAVISNFESQSNLAVVIPDLTTNQRYDRQSLREGNPELIRQLNILYESLVRTKKVDFYKVPYIIGEEVSWYWIKTEHYKKIEEKFRNIDFSKEDRLLLVPILFIYSAWDLSNDYAVVENTENVSPILEKISFSSERELRLIIEEKEFLQIGLRRTLKIISVGIVSVFKMIKKSLLKN
>NC_017622.1|WP_012027234.1|1164920_1166180_-|lipopolysaccharide-biosynthesis-protein
MKSRIVSPKIIFIWNLLGSVSSAAISIFLLLLVTRLLTELEADIFSFAYAVANLFVIIASFQVRDYQATDVSKKFSFSQYLATRLITITIMLLLALSYIFLSQYEFQKSACIFLICLYRGSDALSDVFQGLFQQNARLDIAGKSLFLRNSIVILTFGFGLFITNNLLLSLIYLVISSYLFVFFFDVTNLFQFTRIIKEEINLKAIKNILLECLPLFINAFLLVTIYNQPKYALNTFFERGVIGTGVQRDFNILFMPVFSMNILLILFRPMITQLAIYRRAGDYNQFKQYQKRIVKMVVGLAVLVLVGGIVLGIPALNILYGTNLNKYWLSFIITMLGGIASTFATICDNMLTVLRKQKYLVISFAISCLLSILISNPLVEYYGILGAAIAFVSSMWTWFLISLVIYLKLQKHLNWEVQE
>NC_017622.1|WP_012775199.1|1163616_1164924_-|DUF2142-domain-containing-protein
MKIEKLFLRLAIPFLLISIFVMPVTKVPDEATHAFMSWNILFDSPTSRDTEAMNELRAADFTYSEPEIHAVDSTEYSSLFTKIRDFSKDKLSIDFSLKSLMSTPQLIGLVVGKLLYPSYGMMVTIGRLFNTIVYIIGIYYLIKKIKYGKMTLFFVSLLPMMIQQAGSLSYDVVNYLAVVAFFVFYVNLLVDKVLTTRKFINLILLSLLLYLTKANNILLLALLFFVDFEFEGVLSKFNSILKWIQKRRLPILILGFGLVLLVSYLFLHNRGGVVHFVKVMINSLFINNRNDHLNGILTVGIFGYFGWFVTQLPLWLIFIDIFIFTLLLFNDGNLKISKTEGLASLFVLPVQVAIIVAGMYFAWTPTAIGPNAMISQGAQGRYFTPFLVYLFPACLMLKEQVSVSVKQKYLIRLLTGTVVINFIMYLFLIVDYYWV
>NC_017622.1|WP_012775198.1|1162604_1163594_-|glycosyltransferase-family-8-protein
MNILFTLNDAFVPQVAACMGSIMRTLDEDDTCHFYLFSDGISQQNKENLHQFVTDGGNKLTIVELENLESYFDFEVDTNGWASVVLARLLVDKLLPEEVDRIIYLDGDTLVLENIRELWEVDLEGKVLGMCPEPTASSERREGLNLGTYTYHNAGVLLIDLKRWRSKSIGTIIFDYYKEKNGELFANDQDALNGALKEEIKTLSITYNYFNIFDVYPYRTLEKLSRPSTFISKEEFVKIRKQPRIVHFLGEERPWRIGNKHRFREDYVSALNQTPWRGTQFESGWQFYFFCFNLFNMVMKPFPMLRYKIITVLIPVFMKYRKIRLQKGV
>NC_017622.1|WP_012775201.1|1177993_1179037_-|LPXTG-cell-wall-anchor-domain-containing-protein
MKKKAIVKPLLMSGIFLALLGGATLPSGAVPVVAAETSQSTTYHLTDDEKVAVREYIQAKMTIDMQEYRLAFLEGMMEEMASGSAEAAWDEEIADLKANLTAEQVVVLDELEANLIGSIAQHYHYLFETLTVAGKSGREEAAAIVSKYESEDDASTPEAELAALKYAREVIVELLNKESAAIDNYIAYAEATGQELAGLLESGNSNLESITSATIGYGQALATASQPKFPYDFSEMDRQIAELTASLQSKVEDKSTAKTENTGVQTSQSATNGSNDLQTVPDQGGGQISDVATGKGNISEAGQKKVIPNDNAKVLPKTSGKSSLPLTVLGLITIFAGWLLTNKQEEK
>NC_017622.1|WP_012027245.1|1179053_1179905_-|dTDP-4-dehydrorhamnose-reductase
MILITGANGQLGTELRYLLDERGVDYVAADVAEMDITDADKVDAFFAEVKPSVVYHCAAYTAVDMAEDEGKELNYKINVTGSENVAKATAKYCATLVYISTDYVFNGDLPVGKEWQVDDQPDPQSEYGRTKRKGEEAVEKFADKFYTVRTAWVFGNYGKNFVFTMQNLAETRDTLTVVNDQHGRPTWTRTLAEFMVHLVDTKQAFGYYHLSNDAAEDTTWFDFATEVLKDTNTKVLPVDSSQFPAKAKRPFNSTMSLDKAKATGFVIPTWQEALEAFYKQEKK
>NC_017622.1|WP_002937117.1|1179959_1181006_-|dTDP-glucose-4,6-dehydratase
MSQFKNIIVTGGAGFIGSNFVHYVYNNHPDVHVTVLDKLTYAGNKANLEAILGDRVELVVGDIADAELVDKLAAKADAIVHYAAESHNDNSLNDPSPFIHTNFIGTYTLLEAARKYDIRFHHVSTDEVYGDLPLREDLPGHGEGPGEKFTAETNYNPSSPYSSTKAASDLIVKAWVRSFGVKATISNCSNNYGPYQHIEKFIPRQITNILAGIKPKLYGEGKNVRDWIHTNDHSTGVWAILTKGRMGETYLIGADGEKNNKEVLELILEKMGQPKDAYDHVTDRAGHDLRYAIDASKLRDELGWTPQFTDFSQGLEETIQWYTDNQDWWKAEKEAVEANYAKTQEVIK
>NC_017622.1|WP_002937118.1|1181194_1181680_-|hypothetical-protein
MFQAFLEIAEQLNKLGITPLLMGSVGLERRTGRDWQARDLDIHVPSDPRGWEAPDEERIYRADELIVLMNQLGYVLVDRHEHEFHKDGLSVEFGGLHSLPEFAGVELEDLEELETVGVRYYLPTLEQYLKIYQASSKDSYRAENNNQKDFAKIAYLKEILR
>NC_017622.1|WP_012027248.1|1181679_1182273_-|dTDP-4-dehydrorhamnose-3,5-epimerase
MTENFFGKTLAARPVEAIPGMLEFDIPVHGDNRGWFKENFQKEKMLPLGFPESFFAEGKLQNNVSFSRKNVLRGLHAEPWDKYISVADGGKVLGTWVDLREGETFGNTYQTVIDASKSIFVPRGVANGFQVLSDFVAYSYLVNDYWALELKPKYAFVNYADPSLDIKWENLEEAEVSEADENHPFLKDVKPLRKEDL
>NC_017622.1|WP_012027249.1|1182272_1183142_-|glucose-1-phosphate-thymidylyltransferase-RfbA
MKGIILAGGSGTRLYPLTRAASKQLMPIYDKPMIYYPLSTLMLAGIKDILIISTPQDLPRFKDMLGDGSELGISLSYAEQPSPDGLAQAFIIGEEFIGDDNVALILGDNIYHGNGLTKMLQRAASKEKGATVFGYQVKDPERFGVVEFDADMNAISIEEKPEEPKSNFAVTGLYFYDNDVVEIAKNIKPSPRGELEITDVNKAYLERGDLSVELMGRGFAWLDTGTHESLLEAAQYIETVQRLQNVQVANLEEIAYRMGYITKEQVYKLAQPLKKNEYGQYLLRLIGEA
>NC_017622.1|WP_012775202.1|1183239_1184064_-|ZIP-family-metal-transporter
MTWVTNQSVVLQALLGGLFTWFCTIVGSAVVFFFKTVSRRLLDTMLGFAAGVMIAASFWSLLAPSIEYAESSYGNLAWIPAAVGFAAGGIFLRLVDAWVPHLHLGNDKDKAEGGGEKDRKNLSKTALLFLAITIHNIPEGLAVGVIFGALASNYSPAAFIGAIGLAIGIGIQNIPEGAALAIPIRTDGASRWKAFYWGSMSAIVEPIAAVIGAFAVTFMTPILPYALSFAAGAMIFVVVEELIPESQTNGNTDIATLGLMAGFIIMMILDVALG
>NC_017622.1|WP_012027251.1|1184239_1185034_-|Nif3-like-dinuclear-metal-center-hexameric-protein
MLASQVIERYQAFCPHSLAMEGDVKGLQIGTLNKEIQRVMVALDIRETTVAEAIDKKVDLIIVKHAPIFRPINDLVADNPQTKMYLDLIKHDIAVYVSHTDIDVVEGGLNDWFCELLEIQDTTYLIETAEGQGLGRVGTIAEQTLEELALKVKSVFDLDAVRLVTYGHQAKQYVSRVAICGGSGGSYYHEALAKGADVYITGDIYYHTGQDMLTQGLLAIDPGHHIEVLFIKKIAELLEIWKAKEGWDVEILPSTVSTNPFRHL
>NC_017622.1|WP_012775203.1|1185023_1185707_-|tRNA-(adenine-N(1))-methyltransferase
METKLSKRLETVASFVPQGARLVDVGSDHAYLPLFLVEQGRIDFAIAGEVVQGPYQSALQNVEQAGQTEKILVRLANGLGAFEKSDQMTAVTIAGMGGRLIAEILEAGKEKLATIERLILQPNNREDDVRRWLEKNGFRLVAEKILEENGKLYEVLVAESGQMRLSEVERRFGPYLLEETSPVFVKKWRRELEKLSFALEQVPSERQGDRFAISQKIQQIQEVVHVS
>NC_017622.1|WP_012027253.1|1185708_1186383_-|DnaD-domain-containing-protein
MNYSQQFRQGHLVLPAAILFHYQELFPSADDFLIWQFFLYQNSSAIESLAPSEIAQATGKTVAQVNQAIENLQDAGLLEFKTISIAGEIEMIFDALPAFEKLDVLLTPKQAVEIVQPENDLKTLVGDFERELGRFLSPFEIEDLQKTIEDDKTSIDLVRAALKEAVFNNKTNWKYIQAILRNWRREGITTVVQVEAKNAEREIQTPKNVTVSSDFLDAMDLWKD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_017622_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_017622_2

1672821-1672965

Orphan

Consensus_repeat	Method
GTCCACTCTCGCCGTTGCGCCTTTCCAGTTTCTTGGGCGCAAG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_017622_2

>merge|NC_017622|2|1672821-1672965|CRISPRCasFinder
GTCCACTCTCGCCGTTGCGCCTTTCCAGTTTCTTGGGCGCAAGCTAAAAAGACCCGTCGGGGTCTCAATTCGCTTTCTTATTTTCATGCTCATGAAAAAACAGTCCATTCTCGCCGTTGCGCCTTTCCAGTTTCTTGGGCGCAAG

>NC_017622|2|2|1672821-1672965|CRISPRCasFinder
GTCCACTCTCGCCGTTGCGCCTTTCCAGTTTCTTGGGCGCAAG	CTAAAAAGACCCGTCGGGGTCTCAATTCGCTTTCTTATTTTCATGCTCATGAAAAAACA
GTCCATTCTCGCCGTTGCGCCTTTCCAGTTTCTTGGGCGCAAG

Protein	Signature genes	Signature genes Name	Protein_function
NC_017622.1\|WP_012775322.1\|1662566_1664021_+\|sucrose-6-phosphate-hydrolase	unknown	unknown	gnl\|CDD\|273554
NC_017622.1\|WP_012027735.1\|1671945_1672602_+\|DUF1129-domain-containing-protein	unknown	unknown	gnl\|CDD\|368981
NC_017622.1\|WP_002939248.1\|1670985_1671930_+\|magnesium-transporter-CorA-family-protein	unknown	unknown	gnl\|CDD\|213361
NC_017622.1\|WP_012775324.1\|1666496_1667558_-\|aminopeptidase-P-family-protein	unknown	unknown	gnl\|CDD\|223085
NC_017622.1\|WP_012027738.1\|1676903_1678094_+\|hypothetical-protein	unknown	unknown	unknown
NC_017622.1\|WP_012027724.1\|1664001_1664967_+\|LacI-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380514
NC_017622.1\|WP_002942403.1\|1673769_1674060_-\|30S-ribosomal-protein-S6	unknown	unknown	gnl\|CDD\|179034
NC_017622.1\|WP_002938276.1\|1665046_1665466_-\|transcription-antitermination-factor-NusB	unknown	unknown	gnl\|CDD\|234686
NC_017622.1\|WP_012775326.1\|1684391_1685051_+\|trimeric-intracellular-cation-channel-family-protein	unknown	unknown	gnl\|CDD\|225415
NC_017622.1\|WP_012775323.1\|1665875_1666433_-\|elongation-factor-P	unknown	unknown	gnl\|CDD\|234788
NC_017622.1\|WP_002942393.1\|1681908_1682904_-\|alpha-ketoacid-dehydrogenase-subunit-beta	unknown	unknown	gnl\|CDD\|223101
NC_017622.1\|WP_012027737.1\|1675784_1676774_-\|lipoate--protein-ligase	unknown	unknown	gnl\|CDD\|161920
NC_017622.1\|WP_002942446.1\|1665455_1665848_-\|Asp23/Gls24-family-envelope-stress-response-protein	unknown	unknown	gnl\|CDD\|377129
NC_017622.1\|WP_002942409.1\|1673263_1673758_-\|single-stranded-DNA-binding-protein	unknown	unknown	gnl\|CDD\|180915
NC_017622.1\|WP_002937767.1\|1680179_1681568_-\|dihydrolipoamide-acetyltransferase	unknown	unknown	gnl\|CDD\|237001
NC_017622.1\|WP_012027732.1\|1667656_1670482_-\|excinuclease-ABC-subunit-UvrA	unknown	unknown	gnl\|CDD\|234734
NC_017622.1\|WP_012027739.1\|1678145_1679906_-\|dihydrolipoyl-dehydrogenase	unknown	unknown	gnl\|CDD\|273568
NC_017622.1\|WP_012775325.1\|1683190_1684159_-\|thiamine-pyrophosphate-dependent-dehydrogenase-E1-component-subunit-alpha	unknown	unknown	gnl\|CDD\|238958
NC_017622.1\|WP_002939250.1\|1672991_1673231_-\|30S-ribosomal-protein-S18	unknown	unknown	gnl\|CDD\|178997
NC_017622.1\|WP_012027722.1\|1660483_1662361_-\|PTS-sugar-transporter-subunit-IIBCA	unknown	unknown	gnl\|CDD\|131051

Protein	Function_ID	Function_description	E-value
NC_017622.1\|WP_012775322.1\|1662566_1664021_+\|sucrose-6-phosphate-hydrolase	gnl\|CDD\|273554	TIGR01322, Sucrose-6-phosphate_hydrolase, sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0
NC_017622.1\|WP_012027735.1\|1671945_1672602_+\|DUF1129-domain-containing-protein	gnl\|CDD\|368981	pfam06570, DUF1129, Protein of unknown function (DUF1129). This family consists of several hypothetical bacterial proteins of unknown function.	2.99466e-85
NC_017622.1\|WP_002939248.1\|1670985_1671930_+\|magnesium-transporter-CorA-family-protein	gnl\|CDD\|213361	cd12827, EcCorA_ZntB-like_u2, uncharacterized bacterial subfamily of the Escherichia coli CorA-Salmonella typhimurium ZntB family. A uncharacterized subfamily of the Escherichia coli CorA-Salmonella typhimurium ZntB (EcCorA-ZntB_like) family of the MIT superfamily of essential membrane proteins involved in transporting divalent cations (uptake or efflux) across membranes.The EcCorA-ZntB-like family includes the Mg2+ transporters Escherichia coli and Salmonella typhimurium CorAs, which can also transport Co2+, and Ni2+. Structures of the intracellular domain of EcCorA-ZntB-like family members, Vibrio parahaemolyticus and Salmonella typhimurium ZntB, form funnel-shaped homopentamers, the tip of the funnel is formed from two C-terminal transmembrane (TM) helices from each monomer, and the large opening of the funnel from the N-terminal cytoplasmic domains. The GMN signature motif of the MIT superfamily occurs just after TM1, mutation within this motif is known to abolish Mg2+ transport through Salmonella typhimurium CorA. Natural variants such as GVN and GIN, such as occur in some ZntB family proteins, may be associated with the transport of different divalent cations, such as zinc and cadmium. The functional diversity of MIT transporters may also be due to minor structural differences regulating gating, substrate selection, and transport.	1.46201e-115
NC_017622.1\|WP_012775324.1\|1666496_1667558_-\|aminopeptidase-P-family-protein	gnl\|CDD\|223085	COG0006, PepP, Xaa-Pro aminopeptidase [Amino acid transport and metabolism].	5.90797e-112
NC_017622.1\|WP_012027724.1\|1664001_1664967_+\|LacI-family-transcriptional-regulator	gnl\|CDD\|380514	cd06291, PBP1_Qymf-like, ligand binding domain of the lacI-like transcription regulator from a novel metal-reducing bacterium Alkaliphilus Metalliredigens (strain Qymf) and its close homologs. This group includes the ligand binding domain of the lacI-like transcription regulator from a novel metal-reducing bacterium Alkaliphilus metalliredigens (strain Qymf) and its close homologs. Qymf is a strict anaerobe that could be grown in the presence of borax and its cells are straight rods that produce endospores. This group is a member of the LacI-GalR family repressors that are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type 1 periplasmic binding protein-like fold. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA binding affinity of the repressor.	1.99878e-103
NC_017622.1\|WP_002942403.1\|1673769_1674060_-\|30S-ribosomal-protein-S6	gnl\|CDD\|179034	PRK00453, rpsF, 30S ribosomal protein S6; Reviewed.	1.41522e-37
NC_017622.1\|WP_002938276.1\|1665046_1665466_-\|transcription-antitermination-factor-NusB	gnl\|CDD\|234686	PRK00202, nusB, transcription antitermination factor NusB.	6.30967e-49
NC_017622.1\|WP_012775326.1\|1684391_1685051_+\|trimeric-intracellular-cation-channel-family-protein	gnl\|CDD\|225415	COG2860, COG2860, Predicted membrane protein [Function unknown].	6.67558e-43
NC_017622.1\|WP_012775323.1\|1665875_1666433_-\|elongation-factor-P	gnl\|CDD\|234788	PRK00529, PRK00529, elongation factor P; Validated.	1.37279e-91
NC_017622.1\|WP_002942393.1\|1681908_1682904_-\|alpha-ketoacid-dehydrogenase-subunit-beta	gnl\|CDD\|223101	COG0022, AcoB, Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, beta subunit [Energy production and conversion].	1.50604e-179
NC_017622.1\|WP_012027737.1\|1675784_1676774_-\|lipoate--protein-ligase	gnl\|CDD\|161920	TIGR00545, Probable_lipoate-protein_ligase_A, lipoyltransferase and lipoate-protein ligase. One member of this group of proteins is bovine lipoyltransferase, which transfers the lipoyl group from lipoyl-AMP to the specific Lys of lipoate-dependent enzymes. However, it does not first activate lipoic acid with ATP to create lipoyl-AMP and pyrophosphate. Another member of this group, lipoate-protein ligase A from E. coli, catalyzes both the activation and the transfer of lipoate. Homology between the two is full-length, except for the bovine mitochondrial targeting signal, but is strongest toward the N-terminus. [Protein fate, Protein modification and repair].	1.69881e-103
NC_017622.1\|WP_002942446.1\|1665455_1665848_-\|Asp23/Gls24-family-envelope-stress-response-protein	gnl\|CDD\|377129	pfam03780, Asp23, Asp23 family, cell envelope-related function. The alkaline shock protein Asp23 was identified as an alkaline shock protein that was expressed in a sigmaB-dependent manner in Staphylococcus aureus. Following an alkaline shock Asp23 accumulates in the soluble protein fraction of the S. aureus cell. Asp23 is one of the most abundant proteins in the cytosolic protein fraction of stationary S. aureus cells, with a copy-number of >25000 per cell. A second Asp23-family protein, AmaP, which is encoded within the asp23-operon, is required to localize Asp23 to the cell membrane. The overall function for the family is thus a cell envelope-related one in Gram-positive bacteria.	1.25433e-34
NC_017622.1\|WP_002942409.1\|1673263_1673758_-\|single-stranded-DNA-binding-protein	gnl\|CDD\|180915	PRK07275, PRK07275, single-stranded DNA-binding protein; Provisional.	1.03536e-102
NC_017622.1\|WP_002937767.1\|1680179_1681568_-\|dihydrolipoamide-acetyltransferase	gnl\|CDD\|237001	PRK11856, PRK11856, branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed.	5.84394e-162
NC_017622.1\|WP_012027732.1\|1667656_1670482_-\|excinuclease-ABC-subunit-UvrA	gnl\|CDD\|234734	PRK00349, uvrA, excinuclease ABC subunit UvrA.	0
NC_017622.1\|WP_012027739.1\|1678145_1679906_-\|dihydrolipoyl-dehydrogenase	gnl\|CDD\|273568	TIGR01350, Dihydrolipoyl_dehydrogenase, dihydrolipoamide dehydrogenase. This model describes dihydrolipoamide dehydrogenase, a flavoprotein that acts in a number of ways. It is the E3 component of dehydrogenase complexes for pyruvate, 2-oxoglutarate, 2-oxoisovalerate, and acetoin. It can also serve as the L protein of the glycine cleavage system. This family includes a few members known to have distinct functions (ferric leghemoglobin reductase and NADH:ferredoxin oxidoreductase) but that may be predicted by homology to act as dihydrolipoamide dehydrogenase as well. The motif GGXCXXXGCXP near the N-terminus contains a redox-active disulfide.	0
NC_017622.1\|WP_012775325.1\|1683190_1684159_-\|thiamine-pyrophosphate-dependent-dehydrogenase-E1-component-subunit-alpha	gnl\|CDD\|238958	cd02000, TPP_E1_PDC_ADC_BCADC, Thiamine pyrophosphate (TPP) family, E1 of PDC_ADC_BCADC subfamily, TPP-binding module; composed of proteins similar to the E1 components of the human pyruvate dehydrogenase complex (PDC), the acetoin dehydrogenase complex (ADC) and the branched chain alpha-keto acid dehydrogenase/2-oxoisovalerate dehydrogenase complex (BCADC). PDC catalyzes the irreversible oxidative decarboxylation of pyruvate to produce acetyl-CoA in the bridging step between glycolysis and the citric acid cycle. ADC participates in the breakdown of acetoin while BCADC participates in the breakdown of branched chain amino acids. BCADC catalyzes the oxidative decarboxylation of 4-methyl-2-oxopentanoate, 3-methyl-2-oxopentanoate and 3-methyl-2-oxobutanoate (branched chain 2-oxo acids derived from the transamination of leucine, valine and isoleucine).	7.20442e-147
NC_017622.1\|WP_002939250.1\|1672991_1673231_-\|30S-ribosomal-protein-S18	gnl\|CDD\|178997	PRK00391, rpsR, 30S ribosomal protein S18; Reviewed.	6.68341e-38
NC_017622.1\|WP_012027722.1\|1660483_1662361_-\|PTS-sugar-transporter-subunit-IIBCA	gnl\|CDD\|131051	TIGR01996, Includes:_Phosphotransferase_enzyme_IIB_component, PTS system, sucrose-specific IIBC component. This model represents the fused enzyme II B and C components of the sucrose-specific PTS sugar transporter system. Sucrose is converted to sucrose-6-phosphate in the process of translocation into the cell. Some of these transporters lack their own IIA domains and instead use the glucose IIA protein (IIAglc or Crr). The exceptions to this rule are Staphylococci, Streptococci, Lactococci, Lactobacilli, etc. which contain their own A domain as a C-terminal fusion. This family is closely related to the trehalose transporting PTS IIBC enzymes and the B and C domains of each are described by subfamily-domain level TIGRFAMs models (TIGR00826 and TIGR00852, respectively).	0

>NC_017622.1|WP_012027735.1|1671945_1672602_+|DUF1129-domain-containing-protein
MSFTEINGLTKKNQEFIHIATNQLIKDGKSDSEIKELLEEILPTIIEKQKTGVTARNLYGAPSEWAASKTISEQEKKDQVEYNENPWLMWLDSSLFMLAIIAGINGLMNLFGQGAQYGLLTLFVIGFGVGAGMYLMYHFVYREQIKTGQRPKLLKAIAFLGLATLAWSVVFILAALIPAAFNPVLPPLVTILIGAAAFGARYLLKKKYNIRNAMSPVQ
>NC_017622.1|WP_002939248.1|1670985_1671930_+|magnesium-transporter-CorA-family-protein
MKQIFLSTMTDLEEIQTFEPGAWINLVNPSQSESMEVAEHYKIDIADLRAPLDAEESSRITVEDDYTLILVDVPILEERNNKTYYITIPLGIILTDDAIITTCLEPLPLFEQFIHRRLRNFFTFMKSRFVFQILYRNAQLYLSALRTIDRKSEEIEKQLHEATRNEELIVLMELEKTIVYFKASLKTNERLVKKLASSSRLLRKYEEDEDLLEDTLVETQQAIEMADIYGSILNSMTHAFASIISNNQNTIMKTLALVTIVLSIPTMVFSAYGMNFKDNIIPFNDIPYAFWWIILFAFAISLSLTFYFIRKRWF
>NC_017622.1|WP_012027732.1|1667656_1670482_-|excinuclease-ABC-subunit-UvrA
MQENIVIHGARAHNLKNIDVTIPREKLVVVTGLSGSGKSSLAFDTLYAEGQRRYVESLSAYARQFLGNMDKPDVDSIEGLSPAISIDQKTTSRNPRSTVGTATEINDYLRLLYARVGVPYCINGHGAIAASSVEQIVDEVLELPERQRLQILAPIVRKKKGQHKTIFEKIQKDGYVRVRVNGGVYDVSEVPELSKSKAHNIEVVVDRIVIKDGIRSRLFDSIEAALRIADGYVIIDTMDEKEMLFSEYYACPVCGFTVPELEPRLFSFNAPFGSCSDCDGLGMKLEVDTDLIVPDASKTLREGALAPWNPISSNYYPQMLEQAMNHFGVDMDKPFEELTEEEKNLIFNGSDGKEFHFHYENEFGGVRDIDIPFEGLITNINRRYRETNSDYTRTVMKTYMNELTCGTCHGYRLNDQALSVKVGGEQGLHIGQLSDLSVADHLQVIEHLTLSENEATIATPIVKEIKDRLSFLNNVGLNYLTLSRAAGTLSGGESQRIRLATQIGSNLSGVLYILDEPSIGLHQRDNDRLIASLKKMRDLGNTLIVVEHDEDTMREADWLIDIGPGAGVFGGEIVASGTPAQVAKNKKSITGQYLSGKREIPVPLERRVGNGRFLEVTGAKENNLQDVTVRFPLGKFVAVTGVSGSGKSTLVNSILKKAIAQKLNRNSDKPGKFKSISGIEHLDRLIDIDQSPIGRTPRSNPATYTGVFDDIRDLFAQTNEAKIRGYKKGRFSFNVKGGRCEACSGDGIIKIEMHFLPDVFVPCEVCHGHRYNSETLEVHYKEKNIAQVLDMTVNDAVEFFKHIPKIERKLRTIQDVGLGYVTLGQPATTLSGGEAQRMKLASELHKRSTGKSLYILDEPTTGLHTEDIAQLLKVLARFVDDGNTVLVIEHNLDVIKTADHIIDMGPEGGVGGGTVVATGTPEEVAENPASFTGQYLKMKLK
>NC_017622.1|WP_012775324.1|1666496_1667558_-|aminopeptidase-P-family-protein
MQKRLEKFEAKLAQSTVDGILVTGQNNIYYLTGFWGTEATVFISGKRRLFVTDSRYTLIAKASVKGFDIIESRFALEEIAKVIKEDGLEKIGFDSEVTYGFYQSLTSIFEGYQLVAMSNFIEDLRMIKDEKEIATIRRACQISDQAFIDVLDFIKPGQTTEMDVNHFLDHRMRQLGAEGASFEFIVASGYRSAMPHGRASEKVIQSGETLTLDFGCYYQHYVSDMTRTIHIGHVTDQEREIYDVVLRANKALIEQAKEGVTYREFDAIPREIISAAGYGANFTHGIGHGIGLDIHEYPYFGKSDETIKAGMVLTDEPGIYLDDKYGVRIEDDLLITENGCEVLTLAPKELIVI
>NC_017622.1|WP_012775323.1|1665875_1666433_-|elongation-factor-P
MIEASKLRAGMTFEAEGKLIKVLDASHHKPGKGNTIMRMKLRDVRTGSTFDTTYRPDEKFEQAIIETVPAQYLYQMDDTAYFMNTETYDQYEIPVATIKEELLYILENSEVKIQFYGTEVIGVTVPTTVELVVAETQPSIKGATVTGSGKPATMETGLVVNVPDFIEAGQKLVINTAEGTYVSRA
>NC_017622.1|WP_002942446.1|1665455_1665848_-|Asp23/Gls24-family-envelope-stress-response-protein
MTTEYQGEIVIAPRVLEVITGIAAAKVDGVHSLQNKRVADSWSKTSLNKGVYLETDEEGRVTADIYVYLEYGVNVPAVSMDIQRAVKTAVYNYAEVQVAAVNIHVSGIVPDKTPKPALKDLFGEDFLDEE
>NC_017622.1|WP_002938276.1|1665046_1665466_-|transcription-antitermination-factor-NusB
MKNNRHALRKCALQAIVSLEFGQEPVQAAQFSYLYDREEEQEGVEIPLFLLNLVNGVADYRDDLDKELSSRLKAGWTLDRLTLIDKNIMRLGLFEILHFEETPDRVAVNEAIELAKEFSDESSAKFVNGVLSQFIKEEA
>NC_017622.1|WP_012027724.1|1664001_1664967_+|LacI-family-transcriptional-regulator
MVAKLTDVAQLAGVSPTTVSRVINKKGYLSEKTIRNVEEAMRELGYKPNNLARSLQGKSAKLVGLIFPTINNIFYSELISHLEKELFDRGYKTIICNSQHESDKEREYLEMLAANQVDGIISGSHNLGIQDYDRVVAPIIAFDRNLSPSIPIVSSDNFAGGVLAAQTLQKAGCHNPLMITGNDDSNSPTGLRQVGFTSILNKAEVFHISSDFSPVRKEMEIRAILEKQKPNGIFVSGDATAMLVWNVIRSMKLSIPEDIKLIGYDGTSFIENYYPQLTTIKQPLTEIARLLVELLVDKIEGKKLTKTDYILPISLLAGASI
>NC_017622.1|WP_012775322.1|1662566_1664021_+|sucrose-6-phosphate-hydrolase
MAFTTGERYRAYADWTPEYIEKIKKNTESSPWRTNFHIETPHGLLNDPNGFSYFNGKWTLFYQYFPFGAAHGLKSWVHTESTDLVHFEETGTVMYPDTPLDSHGAYSGSAMEFGDKLFLFYTGNVRDENWVRHPYQIGALMDKDGKIEKIDKVLIEQPEDTTDHFRDPQIFNYKGQYYAIVGGQNLDKKGIVKLYKAENNDYLNWSYVGDLDFANDMTAYMMECPNIAFVGEQPILLYCPQGLDKEVLDYGNIYPNMYKIGQSFVPETASIVEPSELINLDYGFECYATQAFNAPDGRTLSVSWLALPDVEYPTDAYDYQGCLSLVKELTIKDGKLYQYPVDAITSLRKEAQPFSAQKETNNVYELELDFSASTKHEIVLFANEAEKGLVLSVDTEQGQITLDRGNCGQPFALDFGTSRSCEISPGALTANIFIDKSVFEIFINKGEKVFSGRVFPDADQSGIVITTGNPTGTYYHLDYGRKTN
>NC_017622.1|WP_012027722.1|1660483_1662361_-|PTS-sugar-transporter-subunit-IIBCA
MNNTEIAKKVIDALGGRENVRSVAHCATRLRVMVVDEGKIDKDTVEDIEKVQGAFFNSGQYQIIFGTGTVNKIYDEVVALGLPTATTGEQKAEAAKQGNAFQRAIRTFGDVFVPIIPAIVATGLFMGLRGLLGALGYTLPEDLNVYSQILTDTAFIVLPALVVWSTFRVFGGNQTIGIVLGMMLIAGQLPNAWVVASGGDVKPTIFFGFIPVVGLQGSVLPAFIIGLVGAKFEKAVRKVVPEVLDLLVTPFVTLFVMSILGLFVIGPVFHVVENYILAGTQAILNLPMGLGGLLIGGVHQVIVVSGVHHIFNFLEAQLVANTGANPFNAIITAAMTAQGAATVAVGVKTKNPKLKALAFPAALSAFLGITEPAIFGVNLRFRKPFLLSLIAGAIGGAVASLLGLAGKGMGVTIIPGATLYVGNGQLFQYILMVAVSFALGFALTYLFGFEDEVEAAPKAAAAPVATPATPAVELNEETLVSPLSGDVVALENVNDPVFSSGAMGKGLAVKPSEGVVYAPADAEVTIAFETGHAYGLKTASGAELLIHIGIDTVSMNGNGFEKLVAAGDKVKAGTPLAKFDAAKIAEAGLDDTTMIIVTNTADFAEVSPLAEGTIAHGVEFLKVAK
>NC_017622.1|WP_002939250.1|1672991_1673231_-|30S-ribosomal-protein-S18
MAQQRRGGFKRRKKVDYIAANKIEYVDYKDTELLSRFISERGKILPRRVTGTSAKNQRKVTTAIKRARVMALLPFVNED
>NC_017622.1|WP_002942409.1|1673263_1673758_-|single-stranded-DNA-binding-protein
MINNVVLVGRMTRDAELRYTPSNQAVATFTLAVNRNFKNQNGEREADFINVVIWRQQAENLANWAKKGALIGVTGRIQTRSYDNQQGQRVYVTEVVAESFQLLESRTAREGQGGGYSAGNSFAGGNDYNSPYQAPAQSTPNFAREESPFGASNPMDISDDDLPF
>NC_017622.1|WP_002942403.1|1673769_1674060_-|30S-ribosomal-protein-S6
MAKYEILYIIRPNIEEEAKNALVARFDSILTDNGATIVESKAWEKRRLAYEIKDFREGLYHIVNVEANNDEALKEFDRLSKINGDILRHMIVKLDA
>NC_017622.1|WP_012027737.1|1675784_1676774_-|lipoate--protein-ligase
MKYIVNNSNDPAYNIALEAYAFKELTDIDEIFILWINEPAIIIGKHQNAIEEINKEFTDEKGIHVVRRLSGGGAVYHDLNNLNYTIISNKADEGAFDFKTFSKPVIDTLATLGVEANFTGRNDLEIDGKKICGNAQAYAKGRMMHHGCLLFDVDMSVLASALKVSKDKIESKGVKSVRARVTNINNELPDKMTVLEFKDAILNQMKQEYPEMDEYVLTEDDLARIQEIRDSQFATWDWTYGQTPEYTVERSVRYPAGKITTYIKAEKSVIESIKIYGDFFGIGDVADVEDLLVGTRYEYADVLAKLQEIDTTHYFSRMTTEEVAKAIVA
>NC_017622.1|WP_012027738.1|1676903_1678094_+|hypothetical-protein
MSKHLKSFLIFYLAASIFLPFMWFINAPLICFVLPLYLTWKNIRHFWDLLKKQLKEYSFWINDGLIFFLGTGLSWLALEMAQVVYVDWPETLVNNQIHSPMQTEAWSGQFFLLLLGVLAYLVLNIFQTKLLPPLLTVLLISCLYPSFVFAVLWTIQLSSLIETDFFTYCYLCLVPFNICLIYSRTILQTIQLWQAELAKQSNPRFPRLSALLQKSLSLPIWLLFFSLPYLAVLGSYLILFGQKPDQLLQMWTETSDWALSEKISPPNAFYDEHYLCTVGAAGHRKLVKPIRMGERHGHRVVVNRQLQIANAFEQILEERCPRLHRCVRSNYDRYGYPISKHIRKAWQADLIYLIMKPAEWLFLIVIYLHDRQPENRIAVQYLPLSKNLLPQENTSN
>NC_017622.1|WP_012027739.1|1678145_1679906_-|dihydrolipoyl-dehydrogenase
MAIEIIMPKLGVDMQEGEIIEWKKQEGDFVNEGDVILEMMSDKTSMELEAEESGVLLKIVHGNGATVPVTEVIAYLGAEGESVEVGAALAPAEVAQATADLKAAGLEVPATPAAAPQAPKAELAADEYDMVVVGGGPAGYYAAIRGAQLGGKIAIVEKSEFGGTCLNKGCIPTKTYLKNAEILDGLKIAAERGINLASTNYTVDMDKTVDFKNKVVKTLTGGVQGLLKANKVTIFNGLGQVNPDKTVVIGDKVIKGRSIILATGSKVSRINIPGIDSKLVLTSDDILDLREIPKSLTVMGGGVVGVELGLVYASYGTEVTVVEMADRIIPGMDREVSVELQKVLSKKGMKFLTSVGVSEIVEANNQLTIKLNDGSEIVSEKALLSIGRVPQLAGLENLNLELDRGRIKVNEYQETSIPGIYAPGDVNGTKMLAHAAYRMGEVAAENAIHGNHHKAKLDFTPAAVYTHPEIAMVGLTEDQAIEKYGKENILIGRNSFTGNGRAIASNEAHGFVKVIADKKYHEILGVHIIGPVAAEMINEAATIMESELTVDDVAASIHGHPTFSEVMYEAFLDVLGVAIHNPPKRK
>NC_017622.1|WP_002937767.1|1680179_1681568_-|dihydrolipoamide-acetyltransferase
MAIEIIMPKLGVDMQEGEIIEWKKQEGDFVNEGDVILEMMSDKTSMELEAEESGVLLKIVHGNGATVPVTEVIAYIGAEGETVEAGASSAPAVEPAAAIEEVPAGRTPVIVAPATAAKPQGSGKVRATPAARKLARELGIDLGLVPGTGANGRVHKVDVEDFKGAAPKATPLAARIAADQGVDLSTLTGSGVNGKIVKNDVLAVLAPVAVETAAPVPKAEEKPAKELPEGVEIIKMSPMRKAISKGMVNSYLTAPTFTLNYDIDMTNLMALRKQVLEPIMNKTGLKVTFTDLIGLAVVRTLMKEEHRYMNASLINDAQEIELHKFVNLGIAVGLDDGLVVPVVHGADKMSLSDFVVASKDVIKKAQSGKLKGAEMSGSTFSITNLGMFGTKTFNPIINQPNSAILGVASTVQTPVVIDGEIKIRPIMALCLTIDHRIIDGMNGAKFMVDLKNLLENPLELLI
>NC_017622.1|WP_002942393.1|1681908_1682904_-|alpha-ketoacid-dehydrogenase-subunit-beta
MAETKVMALREAINLAQSEEMRKDEKVFLMGEDVGIYGGDFGTSVGMLDEFGPKRVRDTPISEAAIAGSAVGAAQTGLRPIVDLTFMDFITIALDAIVNQAAKTNYMFGGGLKTPVTFRVASGSGIGSAAQHSQSLEAWLTHIPGIKVVAPGTANDAKGLLKSSILDNNPVIFLEPKALYGKKEEVNLDPDFYIPLGKGEIKREGTDVTIISYGRMLERALKAAEEVAAEGISVEVVDPRTLIPLDKELIIESVKKTGKVILVNDAYKTGGFIGEIASIITESEAFDYLDAPIIRIASDDVPVPYANILENAVLPNVEKIKAAIYKQVNKG
>NC_017622.1|WP_012775325.1|1683190_1684159_-|thiamine-pyrophosphate-dependent-dehydrogenase-E1-component-subunit-alpha
MVSITKEQHLDMFLKMQQIRDVDMKLNKLVRRGFVQGMTHFSVGEEAAAVGPIAGLTDEDIIFSHHRGHGHVIAKGIDINGMMAELAGKATGTSKGRGGSMHLANVEKGNFGSNGIVGGGYALAVGAALTQQYLGTDNIVIAFSGDSATNEGSFHESMNLAAVWNLPVIFFITNNRYGISTDISYSTKIPHLYQRAAAYGIPGHYVEDGNDVIAVYEKMQEVIEYVRAGKGPAMVEVESYRWFGHSTADAGVYRTKEEVNEWKAKDPLKKYRKYLTENKIATDEELDAIEAQVAEQVEASVKFAQESPDPDISVAYEDVFVD
>NC_017622.1|WP_012775326.1|1684391_1685051_+|trimeric-intracellular-cation-channel-family-protein
MEFDLFLMICNYIGTIAFAVSGAVKGFKKKLDIFGISLLGIITAVGGGIIRDTMANRIPAALTDPTAIYLSLGVAISMYLIVINLKQDKPLDKKMIHFLSQTNLIFDAIGLAIFALIGASTGISLQLNALTSGILAALTGVGGGITRDLLVNETPIVLKEDVYAVLAFFSGVLYHLCVVNWKLPQIPTFITIFTISLIIRLLVIKYKINLPNMESKRKV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_017622_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_017622_3

1717339-1717462

Orphan

Consensus_repeat	Method
CCAATCAACCACTACTGCGCTAAGATGTTGAC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_017622_3

>merge|NC_017622|3|1717339-1717462|CRISPRCasFinder
CCAATCAACCACTACTGCGCTAAGATGTTGACACTAACGTTGAGAAGCGGTACAGGGCTTGAGCCCAGCTTCACTCCACTGGACTGTTAAACCCAATCAACCACTACTGCGCTGAGATGTTGAC

>NC_017622|3|3|1717339-1717462|CRISPRCasFinder
CCAATCAACCACTACTGCGCTAAGATGTTGAC	ACTAACGTTGAGAAGCGGTACAGGGCTTGAGCCCAGCTTCACTCCACTGGACTGTTAAAC
CCAATCAACCACTACTGCGCTGAGATGTTGAC

Protein	Signature genes	Signature genes Name	Protein_function
NC_017622.1\|WP_012775336.1\|1727420_1729124_-\|acetolactate-synthase-large-subunit	unknown	unknown	gnl\|CDD\|180919
NC_017622.1\|WP_012775335.1\|1722179_1722923_+\|amino-acid-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224051
NC_017622.1\|WP_012027765.1\|1713376_1713817_-\|SUF-system-NifU-family-Fe-S-cluster-assembly-protein	unknown	unknown	gnl\|CDD\|273918
NC_017622.1\|WP_012027769.1\|1717635_1718808_-\|undecaprenyl/decaprenyl-phosphate-alpha-N-acetylglucosaminyl-1-phosphate-transferase	unknown	unknown	gnl\|CDD\|133463
NC_017622.1\|WP_002942324.1\|1706739_1707738_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|223521
NC_017622.1\|WP_012775333.1\|1715030_1716293_-\|Fe-S-cluster-assembly-protein-SufD	unknown	unknown	gnl\|CDD\|223791
NC_017622.1\|WP_012027759.1\|1705795_1706737_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224048
NC_017622.1\|WP_002938143.1\|1704837_1705794_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223674
NC_017622.1\|WP_002938165.1\|1716309_1717083_-\|Fe-S-cluster-assembly-ATPase-SufC	unknown	unknown	gnl\|CDD\|223473
NC_017622.1\|WP_002938151.1\|1711611_1713027_-\|Fe-S-cluster-assembly-protein-SufB	unknown	unknown	gnl\|CDD\|131035
NC_017622.1\|WP_012775332.1\|1710117_1711359_+\|D-alanyl-D-alanine-carboxypeptidase	unknown	unknown	gnl\|CDD\|224600
NC_017622.1\|WP_012775331.1\|1708114_1709905_-\|oligopeptide-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173875
NC_017622.1\|WP_009910805.1\|1726951_1727428_-\|acetolactate-synthase-small-subunit	unknown	unknown	gnl\|CDD\|183365
NC_017622.1\|WP_002937416.1\|1724255_1725506_-\|threonine-ammonia-lyase-IlvA	unknown	unknown	gnl\|CDD\|236318
NC_017622.1\|WP_012027774.1\|1723343_1724246_-\|SPFH-domain-containing-protein	unknown	unknown	gnl\|CDD\|259805
NC_017622.1\|WP_012775334.1\|1718804_1719527_-\|adaptor-protein-MecA	unknown	unknown	gnl\|CDD\|235030
NC_017622.1\|WP_009910803.1\|1725788_1726811_-\|ketol-acid-reductoisomerase	unknown	unknown	gnl\|CDD\|235491
NC_017622.1\|WP_012028491.1\|1720621_1722187_+\|ABC-transporter-substrate-binding-protein/permease	unknown	unknown	gnl\|CDD\|270345
NC_017622.1\|WP_012027766.1\|1713803_1715027_-\|cysteine-desulfurase	unknown	unknown	gnl\|CDD\|131034
NC_017622.1\|WP_009910800.1\|1723048_1723258_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NC_017622.1\|WP_012775336.1\|1727420_1729124_-\|acetolactate-synthase-large-subunit	gnl\|CDD\|180919	PRK07282, PRK07282, acetolactate synthase large subunit.	0
NC_017622.1\|WP_012775335.1\|1722179_1722923_+\|amino-acid-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224051	COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism].	7.30548e-147
NC_017622.1\|WP_012027765.1\|1713376_1713817_-\|SUF-system-NifU-family-Fe-S-cluster-assembly-protein	gnl\|CDD\|273918	TIGR01994, Iron-sulfur_cluster_assembly_scaffold_protein_IscU, SUF system FeS assembly protein, NifU family. Three iron-sulfur cluster assembly systems are known so far. ISC is broadly distributed while NIF tends to be associated with nitrogenase in nitrogen-fixing bacteria. The most recently described is SUF, believed to be important to maintain the function during aerobic stress of enzymes with labile Fe-S clusters. It is fairly widely distributed. This family represents one of two different proteins proposed to act as a scaffold on which the Fe-S cluster is built and from which it is transferred. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other].	8.16406e-68
NC_017622.1\|WP_012027769.1\|1717635_1718808_-\|undecaprenyl/decaprenyl-phosphate-alpha-N-acetylglucosaminyl-1-phosphate-transferase	gnl\|CDD\|133463	cd06853, GT_WecA_like, This subfamily contains Escherichia coli WecA, Bacillus subtilis TagO and related proteins. WecA is an UDP-N-acetylglucosamine (GlcNAc):undecaprenyl-phosphate (Und-P) GlcNAc-1-phosphate transferase that catalyzes the formation of a phosphodiester bond between a membrane-associated undecaprenyl-phosphate molecule and N-acetylglucosamine 1-phosphate, which is usually donated by a soluble UDP-N-acetylglucosamine precursor. WecA participates in the biosynthesis of O antigen LPS in many enteric bacteria and is also involved in the biosynthesis of enterobacterial common antigen. A conserved short sequence motif and a conserved arginine at a cytosolic loop of this integral membrane protein were shown to be critical in recognition of substrate UDP-N-acetylglucosamine.	9.66017e-81
NC_017622.1\|WP_002942324.1\|1706739_1707738_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|223521	COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	1.71068e-159
NC_017622.1\|WP_012775333.1\|1715030_1716293_-\|Fe-S-cluster-assembly-protein-SufD	gnl\|CDD\|223791	COG0719, SufB, Cysteine desulfurase activator SufB [Posttranslational modification, protein turnover, chaperones].	4.97321e-124
NC_017622.1\|WP_012027759.1\|1705795_1706737_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224048	COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only].	2.10004e-119
NC_017622.1\|WP_002938143.1\|1704837_1705794_-\|ABC-transporter-permease	gnl\|CDD\|223674	COG0601, DppB, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	1.06681e-112
NC_017622.1\|WP_002938165.1\|1716309_1717083_-\|Fe-S-cluster-assembly-ATPase-SufC	gnl\|CDD\|223473	COG0396, sufC, Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones].	2.74827e-148
NC_017622.1\|WP_002938151.1\|1711611_1713027_-\|Fe-S-cluster-assembly-protein-SufB	gnl\|CDD\|131035	TIGR01980, UPF0051_protein_slr0074, FeS assembly protein SufB. This protein, SufB, forms a cytosolic complex SufBCD. This complex enhances the cysteine desulfurase of SufSE. The system, together with SufA, is believed to act in iron-sulfur cluster formation during oxidative stress. Note that SufC belongs to the family of ABC transporter ATP binding proteins, so this protein, encoded by an adjacent gene, has often been annotated as a transporter component. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other].	0
NC_017622.1\|WP_012775332.1\|1710117_1711359_+\|D-alanyl-D-alanine-carboxypeptidase	gnl\|CDD\|224600	COG1686, DacC, D-alanyl-D-alanine carboxypeptidase [Cell envelope biogenesis, outer membrane].	5.36323e-91
NC_017622.1\|WP_012775331.1\|1708114_1709905_-\|oligopeptide-ABC-transporter-substrate-binding-protein	gnl\|CDD\|173875	cd08510, PBP2_Lactococcal_OppA_like, The substrate binding component of an ABC-type lactococcal OppA-like transport system contains. This family represents the substrate binding domain of an ATP-binding cassette (ABC)-type oligopeptide import system from Lactococcus lactis and other gram-positive bacteria, as well as its closet homologs from gram-negative bacteria. Oligopeptide-binding protein (OppA) from Lactococcus lactis can bind peptides of length from 4 to at least 35 residues without sequence preference. The oligopeptide import system OppABCDEF is consisting of five subunits: two homologous integral membrane proteins OppB and OppF that form the translocation pore; two homologous nucleotide-binding domains OppD and OppF that drive the transport process through binding and hydrolysis of ATP; and the substrate-binding protein or receptor OppA that determines the substrate specificity of the transport system. The dipeptide (DppA) and oligopeptide (OppA) binding proteins differ in several ways. The DppA binds dipeptides and some tripeptides and also is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	0
NC_017622.1\|WP_009910805.1\|1726951_1727428_-\|acetolactate-synthase-small-subunit	gnl\|CDD\|183365	PRK11895, ilvH, acetolactate synthase 3 regulatory subunit; Reviewed.	1.6123e-73
NC_017622.1\|WP_002937416.1\|1724255_1725506_-\|threonine-ammonia-lyase-IlvA	gnl\|CDD\|236318	PRK08639, PRK08639, threonine dehydratase; Validated.	0
NC_017622.1\|WP_012027774.1\|1723343_1724246_-\|SPFH-domain-containing-protein	gnl\|CDD\|259805	cd03407, SPFH_like_u4, Uncharacterized family; SPFH (stomatin, prohibitin, flotillin, and HflK/C) superfamily. This model summarizes an uncharacterized family of proteins similar to stomatin, prohibitin, flotillin, HflK/C (SPFH) and podocin. The conserved domain common to the SPFH superfamily has also been referred to as the Band 7 domain. Many superfamily members are associated with lipid rafts. Individual proteins of the SPFH superfamily may cluster to form membrane microdomains which may in turn recruit multiprotein complexes. Microdomains formed from flotillin proteins may in addition be dynamic units with their own regulatory functions. Flotillins have been implicated in signal transduction, vesicle trafficking, cytoskeleton rearrangement and are known to interact with a variety of proteins. Stomatin interacts with and regulates members of the degenerin/epithelia Na+ channel family in mechanosensory cells of Caenorhabditis elegans and vertebrate neurons and participates in trafficking of Glut1 glucose transporters. Prohibitin may act as a chaperone for the stabilization of mitochondrial proteins. Prokaryotic HflK/C plays a role in the decision between lysogenic and lytic cycle growth during lambda phage infection. Flotillins have been implicated in the progression of prion disease, in the pathogenesis of neurodegenerative diseases such as Parkinson's and Alzheimer's disease and, in cancer invasion and metastasis. Mutations in the podocin gene give rise to autosomal recessive steroid resistant nephritic syndrome.	3.71678e-128
NC_017622.1\|WP_012775334.1\|1718804_1719527_-\|adaptor-protein-MecA	gnl\|CDD\|235030	PRK02315, PRK02315, adaptor protein MecA.	2.58092e-83
NC_017622.1\|WP_009910803.1\|1725788_1726811_-\|ketol-acid-reductoisomerase	gnl\|CDD\|235491	PRK05479, PRK05479, ketol-acid reductoisomerase; Provisional.	0
NC_017622.1\|WP_012028491.1\|1720621_1722187_+\|ABC-transporter-substrate-binding-protein/permease	gnl\|CDD\|270345	cd13627, PBP2_AA_binding_like_2, Substrate-binding domain of putative amino acid-binding protein; the type 2 periplasmic-binding protein fold. This putative amino acid-binding protein belongs to the type 2 periplasmic-binding fold protein (PBP2) superfamily, whose members are involved in chemotaxis and uptake of nutrients and other small molecules from the extracellular space as a primary receptor. PBP2 typically comprises of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two receptor cytoplasmically-located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.18368e-91
NC_017622.1\|WP_012027766.1\|1713803_1715027_-\|cysteine-desulfurase	gnl\|CDD\|131034	TIGR01979, Probable_cysteine_desulfurase, cysteine desulfurases, SufSfamily. This model represents a subfamily of NifS-related cysteine desulfurases involved in FeS cluster formation needed for nitrogen fixation among other vital functions. Many cysteine desulfurases are also active as selenocysteine lyase and/or cysteine sulfinate desulfinase. This subfamily is associated with the six-gene SUF system described in E. coli and Erwinia as an FeS cluster formation system during oxidative stress. The active site Cys is this subfamily resembles GHHC with one or both His conserved. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other].	0

>NC_017622.1|WP_002938165.1|1716309_1717083_-|Fe-S-cluster-assembly-ATPase-SufC
MSVLEIKDLHVEIEGKEILKGVNLTLKTGEIAAIMGPNGTGKSTLSAAIMGNPSYEVTQGEILFDGVNILELEVDERARMGLFLAMQYPSEIPGITNAEFLRAAMNAGKEDEDKISVRDFITKLDEKMELLNMKEEMAERYLNEGFSGGEKKRNEILQLLMLEPTFALLDEIDSGLDIDALKVVSKGINAMRGEGFGAMIITHYQRLLNYITPDVVHVMMEGRVVLSGGPELAQRLEKEGYVQVAAELGIDYKEDDI
>NC_017622.1|WP_012775333.1|1715030_1716293_-|Fe-S-cluster-assembly-protein-SufD
MTKEKIQEFSALQAEPTWLTDLRLKAFDKIAELDLPVIERVKFHRWNLGDGSLATNDEIGAVPDFTAIGDNPMLVQVGSQTILEQLPVALVEKGVVFTDFASAMDVIPDVLEKYLGAAVAYDEHKLAAYNTAYFNATAVLYVPDNVEIDQPVEALFYQDSTSPVAFNKRVLIIAGKNAKLNYLERFESLGDGAATTSANIVVEVIALAGSQIKFAAIDRLGKHLDTYLNRRGYLGNDATIDWAIGLLNEGNVVADLDSELKGNGSHANLKVVGLSSGRQVQGVDTRVTNYGHNSVGHILQHGVILESGTLTFNGIGHIVRGAKGADAQQESRVLMLSDKARSDANPILLIDENEVTAGHAASIGQVDPEDMYYLMSRGLDRATAERLVVRGFLGSVITEIPVKEVRDQLIAVIEEKLTKR
>NC_017622.1|WP_012027766.1|1713803_1715027_-|cysteine-desulfurase
MDLERIRKEFSILDQVVNDEPLVYLDNAATTQKPQQVLDVLADYYQKDNANVHRGVHTLSERATTRYEAARQKVADFIQAKSSKEILFTRGTTTSLNWVAQFAKEILQPDQEVIISVQEHHSNIIPWQQACQQTGAKLRYVTLKDGELDMDHLRSLLSSKTKFVSLAHVSNVLGGVVPIGEIAELVHQVGAYLVVDGAQSVPHMGVNVQELDVDFYAFSGHKMLGPTGIGILYGKEELLNLMSPVEFGGEMIDFVYEQSATWKELPWKFEAGTPNIAGAIGLGAAIDYLTEIGMDAIQAHEAELVDYVFPKLQAIPGLTIYGSQDLSKRTGVIAFNLDDLHPHDVATALDYEGVAVRAGHHCAQPLLRYLQVPATVRASFYIYNTKADCDKLVEAIIKTKEFFNGPI
>NC_017622.1|WP_012027765.1|1713376_1713817_-|SUF-system-NifU-family-Fe-S-cluster-assembly-protein
MALSRLDSLYMAVVSEHSKSPRHRGSLDGVEKLELHNPTCGDVIELSVKIEKDVITDIAFDGVGCTISTASASMMTEAVLGKEISQIQELAEIFSQMVRGQEDPRQKELGDASLLAGVAKFPQRIKCATLPWNALKKALSLRSSAE
>NC_017622.1|WP_002938151.1|1711611_1713027_-|Fe-S-cluster-assembly-protein-SufB
MSEERIEPTPIDLGEYKFGFHDENVELVASTGKGLNEEVIREMSRIKGEPEWMLEFRLKSYETFKKMPMQTWGADLSELDFDDIVYYQKPSDKPARSWDDVPDKIKETFERIGIPEAERAYLAGASAQYESEVVYHNMKEEYDKHGIIFTDTDTALKEHPELFKKYFGKLVPPSDNKLAALNSAVWSGGTFIYVPKGVKLDIPLQTYFRINNEGTGQFERTLIIVDEGASVHYVEGCTAPTYSTASLHAAIVEIIAHEGAYMRYTTIQNWSDNVYNLVTKRARAEKNATVEWIDGNLGAKTTMKYPAVYLEGEGARGTMLSIAFANKGQVQDTGAKMIHNAPRTSSSIVSKSIARGGGEVNYRGQVTFAKNSAKSISHIECDTIIMDDISKSDTIPFNEIHNSQVALEHEAKVSKISEEQLYYLMSRGLSESEATEMIVMGFVEPFTKELPMEYAVELNRLIAYEMEGSVG
>NC_017622.1|WP_012775332.1|1710117_1711359_+|D-alanyl-D-alanine-carboxypeptidase
MRKLLLTLTTILAVFLTSTPILAEDFSVAAKHAIAVEVSSGKILYEQDAETKASIASISKTLSIYLVYEALAKGEITLDTMVDISDYPYSLTSNTELSNVNLDERSYSVRDLLNASLITSSNSAIIALAEKIAGSEAAFVDRMKAKVQEWGITDTKIVNVSGLDNTDLGENIYPGSSPEDVNMFSALDVAIIARRLILDYPQVLDITSLNAYDFGGYTYYSTNQMLSDGTHARGGVDGLKTGTSNSAGSSFLATTQQAGMRIITVVLNANDGLTSPENRFVATNDLMNYVYSNFSLVTLVKKSEAFGDSKIKVFNGEKETSPVVAAADLTVVQRNQTDNVPTATFTTDIKEIDAPLKAGTLVSKLQLKDQDLIGKGYISEQTGVDMIIPSDMKEASWPFSWWNQFVRYVNEKL
>NC_017622.1|WP_012775331.1|1708114_1709905_-|oligopeptide-ABC-transporter-substrate-binding-protein
MKKTTKLFALAGVTLLSASVLAACGSKQSGAAKQELSFPAEVKQDGTAVADAQLKYAWVSPTTSSGLLIDELTENTTDSTFGGMVDISMFGYDGERKLDDSGLAKAEFDVKGKKITVSLTGKDYKWSDGESFTINDYIFTIKSMASKDYTGIRFDDKFLNIEGMQEFVDGKASDISGIKKVDDYTVELTVKEMSPSMMYAGGDVPAYIQPEHIYKDIPVADWEKSEYSRTAKLVGMGPWKIKEIVNGESITYVPNEYFFKGTKPKTSSLKIDIVSPDTIVSEMKAGNYDIAEMPVDQLDSYKDASNLNIVGQLESSYEYISFNFGKYDEAAGKNVMDENAKMNDVKLRQAIAYAIDTKTAGKSLYNGLYHPAKSLIISFFGDIHDSELEGYSYNPEKAKKLLDEAGYKDVDGDGIREGKDGKAFKITFAARKRTEANEALVQQYIAWWKEVGLNVELYTGRTVEGKSFYNSVQANDAAIDMYAGGWSTGYDPNPSGLWGPIAAFNMSRFVSDENTKLLEAISSAESFDDKKNVENYKAWQKYAHEQAFAIPTFESEKITAVNKRVKSYDTKYGSASGTGLAYEGIELTADKGVVAE
>NC_017622.1|WP_002942324.1|1706739_1707738_-|ABC-transporter-ATP-binding-protein
MATEKPLLDIKDLHVGFRIGDDYFDAVDGVDISLQKNEILAIVGESGCGKSTLATTIMGLHNPLNTKITGSIQYNDMELIGMDEAKYNTVRGNDIGMIFQDPLASLNPLMTIGAQIDEALFYHTDLDANARTERVLELLAQVGIPNPKRTFKQYPHELSGGMRQRIIIAMALSCKPPIIIADEPTTALDVTIQAQILDLLNDIQAETGSGIILITHDLGVVAETADRVAVMYGGQFVEVAPVEELFTNPKHPYTRSLLKSNPQSGSEGGDLHVIEGIVPPITKMVRKGCRFAPRIPWIGAEAHEENPSMHEVGPNHFVRCTCHETFYFEGEA
>NC_017622.1|WP_012027759.1|1705795_1706737_-|ABC-transporter-ATP-binding-protein
MGFIEVKDLKVHYPIRSGFFNRVTDHVYAVDGVNIEFEEGKTYGLVGESGSGKSTIGKAIIGLERATSGQIIYEGQDVTNKSRGKKGNFNRDVQMIFQDSLSSFNPKKRILDIIAEPIRNFDRLSPDEEKKKVLQLLDTIGLNEEALIKYPHEFSGGQRQRIGVARALASNPRLIIADEPVSALDLSVQAQVLNYMKRIQDEFKLSYLFISHDLGVVQHMCDELFIMYRGRFVETGNKNDIYNNPQHIYTKRLLSAIPTIDPLNRLKNKEKRLAAEKEYQEMQGQYYDENGRVYDLRSFSETHQVALPEGGQN
>NC_017622.1|WP_002938143.1|1704837_1705794_-|ABC-transporter-permease
MWKTVLRRLLMMIPQIIILSVIAFFVAKMMPGDPFTGLIDPNIDPAIIEQKRIAAGYYDPIPVQYFRWVGNLLQGDFGQSVIFKQPVVDVIMQRLNNTIGLSLLTMVLTYLIALPLGMIAGRYQNSLADKIIGVYNFLTFSTPTFVFAILMLWMFGFSLGWFPTRGSISGGVEGFAATLSRLHHMILPAITMAILSTTVTIQYLRTGIIDAKSQDYVRTARAKGVPERVVYNRHIFRNSILPIASFLGYELTGLIGGSIFIENIFTYPGIGQLFFNSISSRDYSVILALLLVFGMGTLLGTLISDIIMSIVDPRIRVK
>NC_017622.1|WP_012027769.1|1717635_1718808_-|undecaprenyl/decaprenyl-phosphate-alpha-N-acetylglucosaminyl-1-phosphate-transferase
MIPFALKYIMVIITTMVISAIATPLVRFMSLRVGAVDNPNARRINKVPMPSAGGLAIFVAFTISVLWFLPGIVTRVNYHGTYLHYIWPLVLASSIIVLTGFIDDVKELKPAPKMFGILAAATIIWIFTEFRFDSFKIPFGGPFLQFPVWLSFLLTVLWIVSITNAVNLIDGLDGLVSGVSIISLTTMGIVSYFFLHDSNIFLTLTIFVLVAAIVGFLPYNYNPAIIYLGDTGALFIGFMIGVLSLQGLKNSTAVAVVTPMIILGVPITDTVVAIIRRKLSGQKIYEADKMHLHHRLLSLGLTHRGTVLVIYAISFLFSLTSLLLNVSSRIGGILLLVTMGLGIEILCELIGIFGINRTPLLNLLRFIGNSSYRQEKIAKYKKCCEEKKRK
>NC_017622.1|WP_012775334.1|1718804_1719527_-|adaptor-protein-MecA
MKVKQISDSTLKITIKLDDLEERGMELSDFLIPQEKTEEFFYTVLDELDLPMTFRESGMLSFRVTPKPDRVDIFVTKSDLDQNLNFDEFTDLSELGDVASMTPDEFFKSLEQTVREKSAPDATAVRHLEEVEQEEEADEEEQERYIYYILEFPTIEDLFTFVGTVDYPVEESELYKMDGHYYLTVLINVENRSKQYPGYILSRMLEFTNDTKLTRPALQEHGTLMLPLAAIEELRKVPTV
>NC_017622.1|WP_012028491.1|1720621_1722187_+|ABC-transporter-substrate-binding-protein/permease
MKRKLSIFLLTLIAVFSVTTGVRADEYLRVGMEAAYAPFNWTQEDDSNSAVPIEGTNQFANGYDVQVAKKIAASMDKELLVVKTKWEGLVPALTSGKIDMIIAGMSPTEERKKEIAFSDSYYTSIPTLVVRSDSQYANATSLEDFAGAKITAQQGVYLYDLIDQIEGANKQTAMGDFSQIRQALESGIIDAYVSERPEGRTAEAANKAFKMVELADSFETNAEDVTIAVGMRKDDERIAQVNEVLATISEEEQIALMDDMIENQPVEEASEGETPSFFAQVWNIVVNNWQQLLRGTGMTLLISILGTIIGTAIGLLIGVFRTAPKAANKALAIGQKVLGWIINIYIEIFRGTPMIVQSMVIYYGTAQAFGLNLDRTLAAIFIVSINTGAYMSEIVRGGIFAVDKGQFEAATALGFTHNQTMRKIVLPQVIRNILPATGNEFVINIKDTSVLNVISVVELYFSGNTVATQTYQYFQTFTVIAIIYFILTFTVTRILRAVEKYFDTDTYTTGANQMQVEVPHD
>NC_017622.1|WP_012775335.1|1722179_1722923_+|amino-acid-ABC-transporter-ATP-binding-protein
MTKNVILEIKNLKKSYGQNQVLKDISISVEKGEVISIIGSSGSGKSTFLRSINLLETPTEGQILYHGQDVLAKGYDLTTYREKLGMVFQSFNLFNNLNVLENAIVAQTTVLKRDRAEAEKIAKENLNKVGMTEQYWQAKPSQLSGGQKQRVAIARALSVDPEVILFDEPTSALDPEMVGEVLKTMQDLAKSGLTMLIVTHEMEFARDVSDRVIFMDKGVIAEEGSPQQIFENPQEERTREFLQRFLG
>NC_017622.1|WP_009910800.1|1723048_1723258_-|hypothetical-protein
MTSYEKVAAVVGWVREKKITGYRISKETNAREMSVIALAQGRAKIDNISFATALGLIDFYDKNHKKFEN
>NC_017622.1|WP_012027774.1|1723343_1724246_-|SPFH-domain-containing-protein
MVFGPIVFIGSFLFFVLIALILIASGLYVVKQQTVAIIERFGKYQKTSTSGINFKIPFGVDVIAARIQLRMLQSEIVVETKTQDNVFVTMNVATQYRVNENNVTDAYYKLMHPEAQIKSYIEDALRSSVPKLTLDELFEKKDEIALEVQKQVAEEMSTYGYVIVKTLITKVEPDAEVKQSMNEINAAQRKRVAAQELAEADKIKIVTAAEAEAEKDRLHGVGIAQQRKAIVDGLADSIRELKESNVSLSEEQIMSILLTNQYLDTLNNFAQGGNQTIFLPGNPEGVEDIRTQILSSLRAK
>NC_017622.1|WP_002937416.1|1724255_1725506_-|threonine-ammonia-lyase-IlvA
MITAKNVEQAYSVLKRVVVRTPLDYSRYLSEKYGATIYLKRENEQRVRSFKIRGAYYAISQLTDDEKSRGVVCASAGNHAQGVAYTCQEMQIPATIFMPITTPQQKIGQVKFFGGDYVEIRLVGDTFDESAKAAQDYTQESGKTFIDPFDDENVQAGQGTVAYEILEEAEEQTISFDQILVPIGGGGLVAGVSAYLKEHAPEIKIVGVEASGARSMKAAFDKGRPVKLDQIDKFADGIAVQKVGKSTYEVARKYVDRLIGVDEGWISGTILDLYSKLGIVAEPAGAATIAALEVVKDQIKGQTICCIISGGNNDINRMPEMEERALIYEGIKHYFVVNFPQRPGALREFVNDILGPNDDITRFEYIKRANKGTGPVLIGIALGDKTDYTQFISRLEEFDPQYINLHENDSLYKMLV
>NC_017622.1|WP_009910803.1|1725788_1726811_-|ketol-acid-reductoisomerase
MTVTMQYEKDVTVAALDGKRIAVIGYGSQGHAHAQNLRDTGHDVIIGVRAGKSFDKAKEDGFETFEVAEAAKQADVIMILAPDEIQADLYNEEIAPNLEAGNALGFAHGFNVHFEFIKVPADVDVFMCAPKGPGHLVRRTFEEGFGVPALYAVYQDATGNAKHIAMDWAKGVGSARVGLLETTFKEETEEDLFGEQAVLCGGLTALMQAGFEVLTEAGYAPELAYFEVLHEMKLIVDLVYEGGFKKMRQSISNTAEFGDYVSGPRVITDQVKENMKAVLADIQSGKFANDFVNDYKAGRPRMEAYRKEAENLEIEKVGAELRKAMPFVGRNDDDAFKIYN
>NC_017622.1|WP_009910805.1|1726951_1727428_-|acetolactate-synthase-small-subunit
MRRMLTAKLRNSSGVLNRFTGVLSRRQINIESISVGPTEVDGISRVTVIVDVVSHDEVEQIIKQLNRLIDVVRVRDLTDIPHLEREVILVKISAPPTKRAEILAIIQPFRANVVDVAPHSITIQMTGDGDKIDALLRVIQPYGIKNIARTGATGFSRD
>NC_017622.1|WP_012775336.1|1727420_1729124_-|acetolactate-synthase-large-subunit
MQEIQLDQPRSGSYLILDTLHQLGVDLVFGYPGGAVLPLYDAIYQYEGIQHILARHEQGAVHEAEGYAKSSGKVGVAIVTSGPGATNAITGIADAMGDSVPLLVFTGQVATRGIGKDAFQEADVLGMTMPITKYNYQIRDTADIPRVITEALHIATTGRPGPVVIDVPKDIQERVVDFYHDPTLHLPSYQPTIEPNGLQVKKILKQLSQAQKPVILAGGGVNYADANKELVAFAERYRIPVVSTLLGLGAMPIEHELSLAMGGMHGSYAANMAMDQADYIINIGARFDDRLTGNPTTYAPNATVAHIDIDPAEIGKVVKTAIPVVGDAKATLKALLALETVETGYADWTAQVLENKRRAPFWYDEDEKVIKPQAAIELIGQLTQGDAIVVTDVGQHQMWAAQFYPYRHARQLVTSGGMGTMGFGIPAAIGAKLANPDKEVIIFVGDGGFQMTNQELAILNGYGVPIKVVLINNHSLGMVRQWQESFYEKRRSQSVFDDEPNFQLLAEAYGISHYSFDNPATLSEDMKVILEDKPMLIEVHISNREHVQPMVPAGKSNAEMLGVKFNA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

544004 : 558667

Streptococcus_phage(92.31%)

transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011922101.1\|544004_544643_-	MBL fold metallo-hydrolase	A0A1X9I5D3	Streptococcus_phage	1.0e-125	99.5
WP_011922102.1\|544705_547219_+	bifunctional DnaQ family exonuclease/ATP-dependent helicase	A0A1X9I5C8	Streptococcus_phage	0.0e+00	98.5
WP_011922103.1\|547378_548455_+	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	1.5e-193	99.2
WP_011922104.1\|548519_549758_+	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	1.0e-217	96.8
WP_011922105.1\|549767_550553_+	pyrroline-5-carboxylate reductase	A0A1X9I6T5	Streptococcus_phage	1.0e-130	95.4
WP_011922106.1\|550575_550980_-	TetR/AcrR family transcriptional regulator	A0A1X9I6A2	Streptococcus_phage	3.2e-64	99.3
WP_002938910.1\|551106_551958_+	DegV family protein	A0A1X9I5J4	Streptococcus_phage	1.3e-152	98.6
WP_011922108.1\|552056_553316_-	PLP-dependent aminotransferase family protein	A0A1X9I5H2	Streptococcus_phage	1.2e-239	98.8
WP_012775019.1\|553438_554173_+	peroxide stress protein YaaA	A0A1X9I5I0	Streptococcus_phage	1.5e-120	99.5
WP_014638896.1\|554458_555622_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	1.4e-11	24.4
WP_012775020.1\|555827_557273_+	LCP family protein	A0A1X9I5X1	Streptococcus_phage	2.4e-226	99.5
WP_014638897.1\|557290_557980_+	capsular polysaccharide biosynthesis protein CpsC	A0A1X9I5E1	Streptococcus_phage	2.6e-114	98.7
WP_012775429.1\|557989_558667_+	tyrosine-protein kinase	A0A1X9I5D6	Streptococcus_phage	8.1e-121	99.1

DBSCAN-SWA_2

639586 : 655095

Streptococcus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012775040.1\|639586_641824_+	DNA internalization-related competence protein ComEC/Rec2	M1PSD2	Streptococcus_phage	1.2e-99	96.7
WP_002935351.1\|641825_641969_+\|transposase	transposase	NA	NA	NA	NA
WP_011922763.1\|642148_642805_+	CBS domain-containing protein	M1NSC5	Streptococcus_phage	2.7e-113	98.6
WP_011922194.1\|642898_643726_+	hypothetical protein	M1PFV6	Streptococcus_phage	1.0e-133	98.5
WP_011922195.1\|643731_645003_+	hypothetical protein	M1PLC8	Streptococcus_phage	1.3e-207	98.1
WP_002935357.1\|645039_645906_-	YitT family protein	M1Q1P6	Streptococcus_phage	4.6e-153	99.7
WP_011922767.1\|646720_647605_+	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	5.6e-154	98.6
WP_002935361.1\|647624_647942_+	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	3.1e-54	100.0
WP_002935362.1\|647943_648807_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	2.1e-158	99.7
WP_011922200.1\|649435_650527_+	3-phosphoserine/phosphohydroxythreonine transaminase	M1Q1P2	Streptococcus_phage	2.4e-207	100.0
WP_011922201.1\|650526_651084_+	GNAT family acetyltransferase	M1PSC3	Streptococcus_phage	5.9e-93	94.6
WP_011922202.1\|651137_652319_+	phosphoglycerate dehydrogenase	M1NSB9	Streptococcus_phage	7.8e-220	99.7
WP_011922203.1\|652321_652828_+	methylated-DNA--[protein]-cysteine S-methyltransferase	M1PFU9	Streptococcus_phage	7.0e-93	97.0
WP_002935368.1\|652811_653165_+	arsenate reductase family protein	M1PLC0	Streptococcus_phage	1.9e-60	100.0
WP_011922204.1\|653181_654081_-	cation transporter	M1Q1N9	Streptococcus_phage	5.1e-163	99.7
WP_012775042.1\|654267_655095_-	exodeoxyribonuclease III	M1PSC0	Streptococcus_phage	2.9e-152	100.0

DBSCAN-SWA_3

816658 : 823850

Bacillus_phage(33.33%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002934970.1\|816658_817498_+	thymidylate synthase	U5J9N5	Bacillus_phage	3.0e-88	55.7
WP_014638913.1\|817648_818161_+	dihydrofolate reductase	A0A076GDN3	Bacillus_phage	2.7e-20	36.6
WP_002943186.1\|818358_819585_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	1.2e-133	59.2
WP_014638915.1\|819639_820227_+	YihA family ribosome biogenesis GTP-binding protein	NA	NA	NA	NA
WP_014638916.1\|820249_820663_+	nucleoside-diphosphate kinase	D2E8E1	Anguillid_herpesvirus	1.8e-22	41.0
WP_014638917.1\|820758_822591_+	elongation factor 4	A0A2K9L2P9	Tupanvirus	2.2e-19	38.8
WP_002934978.1\|822640_822823_-	4-oxalocrotonate tautomerase	NA	NA	NA	NA
WP_014638919.1\|823268_823850_+	thymidine kinase	A0A249XZX5	Enterococcus_phage	7.1e-49	54.0

DBSCAN-SWA_4

1238673 : 1244458

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012027298.1\|1238673_1239423_-	ABC-F family ATP-binding cassette domain-containing protein	A0A1B0RXA0	Streptococcus_phage	3.4e-27	32.9
WP_012027299.1\|1239585_1240128_-	ATP-binding cassette domain-containing protein	A0A2I4R674	Erysipelothrix_phage	5.9e-21	35.1
WP_012027300.1\|1240646_1241450_-	MBL fold metallo-hydrolase	A0A0C5AJ83	Bacteriophage	2.8e-35	35.6
WP_012027301.1\|1241456_1242806_-	cell wall metabolism sensor histidine kinase VicK	W8CYF6	Bacillus_phage	2.1e-35	34.5
WP_004298854.1\|1242798_1243503_-	response regulator transcription factor	W8CYM9	Bacillus_phage	1.1e-38	39.8
WP_012027304.1\|1243696_1244458_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.0e-34	38.4

DBSCAN-SWA_5

1394766 : 1404808

Streptococcus_phage(90.0%)

integrase

attL 1386128:1386142|attR 1412218:1412232

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1386128:1386142	attL	NA	NA	NA	NA
WP_012775260.1\|1394766_1395309_-\|integrase	site-specific integrase	A0A1S5SCL7	Streptococcus_phage	1.1e-80	78.9
WP_014636468.1\|1395295_1395481_-	hypothetical protein	NA	NA	NA	NA
WP_012027449.1\|1395778_1397311_-	primase	A0A1X9I717	Streptococcus_phage	4.9e-105	42.3
WP_012027450.1\|1397325_1397898_-	hypothetical protein	NA	NA	NA	NA
WP_012027451.1\|1397890_1398091_-	hypothetical protein	NA	NA	NA	NA
WP_012775262.1\|1398102_1398306_-	membrane protein	A0A1X9I5T6	Streptococcus_phage	2.4e-20	73.1
WP_012027452.1\|1398326_1398644_-	hypothetical protein	A0A1X9I5Z6	Streptococcus_phage	1.3e-09	41.0
WP_012027454.1\|1398997_1399261_-	hypothetical protein	A0A1S5S7M1	Streptococcus_phage	1.0e-07	43.8
WP_012775263.1\|1399391_1399799_-	hypothetical protein	A0A1X9I5V7	Streptococcus_phage	1.8e-35	52.2
WP_012027456.1\|1399810_1400128_-	hypothetical protein	NA	NA	NA	NA
WP_012027457.1\|1400114_1400336_-	hypothetical protein	NA	NA	NA	NA
WP_012027458.1\|1400332_1400575_-	hypothetical protein	NA	NA	NA	NA
WP_012027459.1\|1400571_1400772_-	hypothetical protein	NA	NA	NA	NA
WP_014636470.1\|1400761_1401052_-	hypothetical protein	A0A1X9I5U4	Streptococcus_phage	1.8e-08	40.7
WP_012027461.1\|1401369_1401558_-	helix-turn-helix transcriptional regulator	R9QNG3	Lactococcus_phage	2.0e-05	42.4
WP_012027462.1\|1401709_1402231_+	helix-turn-helix transcriptional regulator	A0A1X9I723	Streptococcus_phage	8.7e-14	65.1
WP_012028388.1\|1402286_1402979_+	DUF3800 domain-containing protein	NA	NA	NA	NA
WP_012775264.1\|1403665_1404808_+\|integrase	site-specific integrase	A0A1S5S7K9	Streptococcus_phage	2.5e-69	39.7
1412218:1412232	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_017622

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection