CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
NC_016821	Leuconostoc mesenteroides subsp. mesenteroides J18 plasmid pKLE03, complete sequence	0 crisprs	NA	0
NC_016820	Leuconostoc mesenteroides subsp. mesenteroides J18 plasmid pKLE02, complete sequence	0 crisprs	NA	4
NC_016827	Leuconostoc mesenteroides subsp. mesenteroides J18 plasmid pKLE01, complete sequence	0 crisprs	NA	0
NC_016828	Leuconostoc mesenteroides subsp. mesenteroides J18 plasmid pKLE04, complete sequence	0 crisprs	csa3	1
NC_016805	Leuconostoc mesenteroides subsp. mesenteroides J18, complete sequence	1 crisprs	csa3,cas3,DEDDh	5

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_016805_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_016805_1

362155-362257

Unclear

Consensus_repeat	Method
CCGACTTAGCTCAGTTGGTAGAGCAC	CRISPRCasFinder

1 spacers

cas3

The CRISPR arrays of NC_016805_1

>merge|NC_016805|1|362155-362257|CRISPRCasFinder
CCGACTTAGCTCAGTTGGTAGAGCACCTGACTGTTAATCAGGTTGTCGCCGGTTCGAGCCCGGCAGTCGGAGTTTCGCCGACGTAGCTCAGTTGGTAGAGCAC

>NC_016805|1|1|362155-362257|CRISPRCasFinder
CCGACTTAGCTCAGTTGGTAGAGCAC	CTGACTGTTAATCAGGTTGTCGCCGGTTCGAGCCCGGCAGTCGGAGTTTCG
CCGACGTAGCTCAGTTGGTAGAGCAC

Protein	Signature genes	Signature genes Name	Protein_function
NC_016805.3\|WP_014324306.1\|367078_367879_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224054
NC_016805.3\|WP_014324298.1\|351025_354565_+\|transcription-repair-coupling-factor	cas3	cd09639_cas3_CAS-I	gnl\|CDD\|224118
NC_016805.3\|WP_014324307.1\|367875_368604_+\|membrane-protein	unknown	unknown	unknown
NC_016805.3\|WP_014324302.1\|360424_361912_+\|lysine--tRNA-ligase	unknown	unknown	gnl\|CDD\|234778
NC_016805.3\|WP_011679262.1\|357232_359335_+\|ATP-dependent-zinc-metalloprotease-FtsH	unknown	unknown	gnl\|CDD\|273520
NC_016805.3\|WP_014324310.1\|369579_371670_+\|DNA-topoisomerase-III	unknown	unknown	gnl\|CDD\|376463
NC_016805.3\|WP_014324301.1\|359443_360337_+\|Hsp33-family-molecular-chaperone-HslO	unknown	unknown	gnl\|CDD\|234643
NC_016805.3\|WP_014324300.1\|355372_356665_+\|tRNA-lysidine(34)-synthetase-TilS	unknown	unknown	gnl\|CDD\|238950
NC_016805.3\|WP_014324304.1\|363750_364698_-\|ferrochelatase	unknown	unknown	gnl\|CDD\|366291
NC_016805.3\|WP_014324303.1\|362985_363702_+\|YebC/PmpR-family-DNA-binding-transcriptional-regulator	unknown	unknown	gnl\|CDD\|237084
NC_016805.3\|WP_014324313.1\|374410_375532_+\|alanine-racemase	unknown	unknown	gnl\|CDD\|143481
NC_016805.3\|WP_014324299.1\|354580_354862_+\|RNA-binding-S4-domain-containing-protein	unknown	unknown	gnl\|CDD\|224109
NC_016805.3\|WP_010277907.1\|356665_357205_+\|hypoxanthine-phosphoribosyltransferase	unknown	unknown	gnl\|CDD\|223707
NC_016805.3\|WP_011679258.1\|349688_350333_-\|CBS-domain-containing-protein	unknown	unknown	gnl\|CDD\|341358
NC_016805.3\|WP_014324305.1\|365510_366959_+\|NCS2-family-permease	unknown	unknown	gnl\|CDD\|225161
NC_016805.3\|WP_014324309.1\|369035_369446_+\|DUF3021-family-protein	unknown	unknown	gnl\|CDD\|378668
NC_016805.3\|WP_014324308.1\|368581_369049_+\|LytTR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197918
NC_016805.3\|WP_010291225.1\|350458_351025_+\|aminoacyl-tRNA-hydrolase	unknown	unknown	gnl\|CDD\|235457
NC_016805.3\|WP_011679265.1\|362381_362915_+\|rRNA-large-subunit-pseudouridine-synthase-E	unknown	unknown	gnl\|CDD\|211334
NC_016805.3\|WP_011679260.1\|354943_355342_+\|septum-formation-initiator-family-protein	unknown	unknown	gnl\|CDD\|368217

Protein	Function_ID	Function_description	E-value
NC_016805.3\|WP_014324306.1\|367078_367879_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224054	COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms].	6.30651e-50
NC_016805.3\|WP_014324298.1\|351025_354565_+\|transcription-repair-coupling-factor	gnl\|CDD\|224118	COG1197, Mfd, Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription].	0
NC_016805.3\|WP_014324313.1\|374410_375532_+\|alanine-racemase	gnl\|CDD\|143481	cd00430, PLPDE_III_AR, Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Alanine Racemase. This family includes predominantly bacterial alanine racemases (AR), some serine racemases (SerRac), and putative bifunctional enzymes containing N-terminal UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D-alanine ligase (murF) and C-terminal AR domains. These proteins are fold type III PLP-dependent enzymes that play essential roles in peptidoglycan biosynthesis. AR catalyzes the interconversion between L- and D-alanine, which is an essential component of the peptidoglycan layer of bacterial cell walls. SerRac converts L-serine into its D-enantiomer (D-serine) for peptidoglycan synthesis. murF catalyzes the addition of D-Ala-D-Ala to UDPMurNAc-tripeptide, the final step in the synthesis of the cytoplasmic precursor of bacterial cell wall peptidoglycan. Members of this family contain an N-terminal PLP-binding TIM-barrel domain and a C-terminal beta-sandwich domain. They exist as homodimers with active sites that lie at the interface between the TIM barrel domain of one subunit and the beta-sandwich domain of the other subunit. AR and other members of this family require dimer formation and the presence of the PLP cofactor for catalytic activity. Fungal ARs and eukaryotic serine racemases, which are fold types I and II PLP-dependent enzymes respectively, are excluded from this family.	1.27798e-116
NC_016805.3\|WP_014324302.1\|360424_361912_+\|lysine--tRNA-ligase	gnl\|CDD\|234778	PRK00484, lysS, lysyl-tRNA synthetase; Reviewed.	0
NC_016805.3\|WP_011679262.1\|357232_359335_+\|ATP-dependent-zinc-metalloprotease-FtsH	gnl\|CDD\|273520	TIGR01241, ATP-dependent_zinc_metalloprotease_FtsH, ATP-dependent metalloprotease FtsH. HflB(FtsH) is a pleiotropic protein required for correct cell division in bacteria. It has ATP-dependent zinc metalloprotease activity. It was formerly designated cell division protein FtsH. [Cellular processes, Cell division, Protein fate, Degradation of proteins, peptides, and glycopeptides].	0
NC_016805.3\|WP_014324310.1\|369579_371670_+\|DNA-topoisomerase-III	gnl\|CDD\|376463	pfam01131, Topoisom_bac, DNA topoisomerase. This subfamily of topoisomerase is divided on the basis that these enzymes preferentially relax negatively supercoiled DNA, from a 5' phospho- tyrosine linkage in the enzyme-DNA covalent intermediate and has high affinity for single stranded DNA.	1.94228e-69
NC_016805.3\|WP_014324301.1\|359443_360337_+\|Hsp33-family-molecular-chaperone-HslO	gnl\|CDD\|234643	PRK00114, hslO, Hsp33 family molecular chaperone HslO.	2.40897e-101
NC_016805.3\|WP_014324300.1\|355372_356665_+\|tRNA-lysidine(34)-synthetase-TilS	gnl\|CDD\|238950	cd01992, PP-ATPase, N-terminal domain of predicted ATPase of the PP-loop faimly implicated in cell cycle control [Cell division and chromosome partitioning]. This is a subfamily of Adenine nucleotide alpha hydrolases superfamily.Adeninosine nucleotide alpha hydrolases superfamily includes N type ATP PPases and ATP sulphurylases. It forms a apha/beta/apha fold which binds to Adenosine group. This domain has a strongly conserved motif SGGXD at the N terminus.	7.24732e-74
NC_016805.3\|WP_014324304.1\|363750_364698_-\|ferrochelatase	gnl\|CDD\|366291	pfam00762, Ferrochelatase, Ferrochelatase.	2.50858e-128
NC_016805.3\|WP_014324303.1\|362985_363702_+\|YebC/PmpR-family-DNA-binding-transcriptional-regulator	gnl\|CDD\|237084	PRK12378, PRK12378, YebC/PmpR family DNA-binding transcriptional regulator.	1.34299e-129
NC_016805.3\|WP_014324299.1\|354580_354862_+\|RNA-binding-S4-domain-containing-protein	gnl\|CDD\|224109	COG1188, COG1188, Ribosome-associated heat shock protein implicated in the recycling of the 50S subunit (S4 paralog) [Translation, ribosomal structure and biogenesis].	9.50943e-29
NC_016805.3\|WP_010277907.1\|356665_357205_+\|hypoxanthine-phosphoribosyltransferase	gnl\|CDD\|223707	COG0634, Hpt, Hypoxanthine-guanine phosphoribosyltransferase [Nucleotide transport and metabolism].	3.80407e-78
NC_016805.3\|WP_011679258.1\|349688_350333_-\|CBS-domain-containing-protein	gnl\|CDD\|341358	cd02205, CBS_pair_SF, Two tandem repeats of the cystathionine beta-synthase (CBS pair) domains superfamily. The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase).	1.94521e-07
NC_016805.3\|WP_014324305.1\|365510_366959_+\|NCS2-family-permease	gnl\|CDD\|225161	COG2252, COG2252, Xanthine/uracil/vitamin C permease [Nucleotide transport and metabolism].	2.65842e-119
NC_016805.3\|WP_014324309.1\|369035_369446_+\|DUF3021-family-protein	gnl\|CDD\|378668	pfam11457, DUF3021, Protein of unknown function (DUF3021). This is a bacterial family of uncharacterized proteins.	1.60212e-08
NC_016805.3\|WP_014324308.1\|368581_369049_+\|LytTR-family-transcriptional-regulator	gnl\|CDD\|197918	smart00850, LytTR, LytTr DNA-binding domain. This domain is found in a variety of bacterial transcriptional regulators. The domain binds to a specific DNA sequence pattern.	1.41805e-17
NC_016805.3\|WP_010291225.1\|350458_351025_+\|aminoacyl-tRNA-hydrolase	gnl\|CDD\|235457	PRK05426, PRK05426, peptidyl-tRNA hydrolase; Provisional.	2.28277e-94
NC_016805.3\|WP_011679265.1\|362381_362915_+\|rRNA-large-subunit-pseudouridine-synthase-E	gnl\|CDD\|211334	cd02566, PseudoU_synth_RluE, Pseudouridine synthase, Escherichia coli RluE. This group is comprised of bacterial proteins similar to E. coli RluE. Pseudouridine synthases catalyze the isomerization of specific uridines in an RNA molecule to pseudouridines (5-ribosyluracil, psi). No cofactors are required. Escherichia coli RluE makes psi2457 in 23S RNA. psi2457 is not universally conserved.	1.68309e-102
NC_016805.3\|WP_011679260.1\|354943_355342_+\|septum-formation-initiator-family-protein	gnl\|CDD\|368217	pfam04977, DivIC, Septum formation initiator. DivIC from B. subtilis is necessary for both vegetative and sporulation septum formation. These proteins are mainly composed of an amino terminal coiled-coil.	1.77007e-05

>NC_016805.3|WP_014324302.1|360424_361912_+|lysine--tRNA-ligase
MAEEKALNDQMLARRQKLATIVSDLHLDPFGKRFERTAKAQELHNLYDASSLEELENAKHEVVIAGRMVAKRGAGKVIFADFRDVSGKIQVYARRDDLADNYPIIKRADLGDFLGIKGIMMKTEAGELTVLATELTHLSKALRPMPDKFHGISDVETRYRKRYLDLIANEDSFKKFQERSHIISAIRAYMDRNDFLEVETPILQTEAGGAAARPFITHHNALNIDMYMRIATELYLKRLVVGGMERVYEIGRIFRNEGMDPKHNPEFTTMESYAAYMDFTDVMDETEGIFKAAASVVSDDLKITYQGTEIDLGTKFARKHLVDLIKEQTGIDFWQEMSVEAAQKLADDNHVKYEKYWGVGHIINAFFEEFVEDTLVQPTFVYGHPVEVSPLAKKNTDDPRFTDRFELFIMGSEYANAFTELNDPIDQRARFEAQAAERENGNDEAEGIDEDFIEALEYGMPPTGGLGVGIDRLVMLLTDSDTIRDVVLFPTMRPE
>NC_016805.3|WP_014324301.1|359443_360337_+|Hsp33-family-molecular-chaperone-HslO
MADQFIKAITKNKYFRTFAVNGTNLVHQAAQIHETSRIAAVVLGRGLLATTLTAQAVLKGEETLSTKINGRGPIGNVVVESDAKGSVRGYVTNPNLETLINEAGQLDVAKAVGKNGFLQVTKFAPYSDPYIGQSQLVSGEIGDDFTYYLAQSEQTPSVIGVSVYMNSDDTVAGAGGFLVQALPDATDEAIDQLEVALKNMKPLSEMIQERYTPLEVLEEIFGKGEVEILQTAGIGLAAEPSKDAYAKMLLTLPASEIQAMIKEDHGAEIVGKFSGKRYFFTEEQLSEILKQIEKNNE
>NC_016805.3|WP_011679262.1|357232_359335_+|ATP-dependent-zinc-metalloprotease-FtsH
MNNNKGGFLRSSVFYIFIFLAVVGMVYGLFGNDKTTTKTITSSEFIKALNDKELKSVTVQPGNSIYNVTGTYKKAQTATKDKGLSLFQPTQKVTKFTSTLLPNDASLKSVTDAATKTKTELVTKQAENSGFWLNLLVSLVPVLLIVAVFYLMMNQAGGGKGGQGGMMSFGKSKAKPSDPKDNKVRFADVAGAEEEKQELVEVVEFLKAPKKFVNLGARIPKGVLLEGPPGTGKTLLAKAVAGEASVPFFSMSGSDFVEMFVGVGASRVRDLFENAKKSAPAIIFIDEIDAVGRRRGTGMGGGNDEREQTLNQILIEMDGFEGSEGVIILASTNRSDVLDPALLRSGRFDRKILVGAPDVKGREAILNVHAKNKPLADNVDLKAIAQQTPGYVGADLENLLNEAALLAARRNKSKVDAADIDEAEDRIFQGPAKTNHNMSESERRTTAYHEAGHALVGLVRSEASVVRKVTIVPRGRIGGYALMTPKNDRYNLKYSEAKEQLAGLMGGRASEIFMFNEASSGASNDFQQATGLARQMVTAFGMSDKLGMVQLEGNASVGYADQAGNRAYSEETARLIDEEVRRLAREAFDDAIAILRDNKDKLTAIAEALLEVETLDEKQIKDIYLTGTFTRKDIQDDTELAKAKSFEEAKAAADAKDSQAEQRFEKQDEEKSSDDHSESKNEDTDSTDKSETDDNNTENK
>NC_016805.3|WP_010277907.1|356665_357205_+|hypoxanthine-phosphoribosyltransferase
MDNDIQEVLYDQESIQKAAERLGKQITQDYAGSTPLFLSVLKGAYLWTADLLREVDLYAELEFIKISSYHGGVSSSDEITLVTDVRSDVRGRDVIILEDIVDTGQSLLFLKELLAKRGAKSIKVATLLDKIEGRKVEVDADYAGFNVRNEFVVGYGLDYEEHYRNLPYVGILKKEVYTK
>NC_016805.3|WP_014324300.1|355372_356665_+|tRNA-lysidine(34)-synthetase-TilS
MTEKILQTIQQYNWPETVIVAVSGGVDSVVLVHALSKTKANLVIAHVNYRLREESDDDADFVRQLATQTGAIFEEQVWQHIPDHAVEKAARQFRYDFFEELAQKYHTNTIAVAHHADDQAETVLLKMIRGGRLQQMGGMQTKNHKVIRPFLSITKQELITYAQDNQLGWHQDKTNFDVDYTPRNLLRNDVLPKLTTINQRAVRHINNMAAQILQQQRLIDNQAKIYANDIQDWQKIPTLWQLPTLKYWLQKNKLFNIKENQLQQMIQLLSNTHKPNGKIALADNFEFIKNYQKISIQKQQNMAQVLTPVMLKLNQWHSFAKTTFMWTDNVPMNGQSFIKFQLTRSLPYLSLRPAKASDKIALINGHKNLRRLAIDEKLTPQERTMMWVLATADDEVIAVHLRSNQWRVNADFAVKENTQPYWLVCQIEET
>NC_016805.3|WP_011679260.1|354943_355342_+|septum-formation-initiator-family-protein
MAGNFKRRQSNITPLNPAIAREIKKSERANSEAAKHYRKAHARREKKILLFGGLIAIIFVVQLLIGQVKLHAANQELTNTQDRLEKVQKTNTDLTADTKRLKDATYLQQLLRDKYGYSKQGELVYNLPSDNN
>NC_016805.3|WP_014324299.1|354580_354862_+|RNA-binding-S4-domain-containing-protein
MRLDKYLKISRLIKRRTVAKEIADQGRISINGKVAKSSSDVSTNDELEVRFGNKTLTVKVLKIVETTKKEESADMYEVVSEKFQQDFRKIGDE
>NC_016805.3|WP_014324298.1|351025_354565_+|transcription-repair-coupling-factor
MTLIDFLSDTVTIKKLNEQATVGSAQLLLGVNGTARAASIAALYRKNPRPMLIISDTQVHADQFFDDLSSLLEDLVYNFPAEESIATEMAISSSELRLQRVQTLLALKTEKPIIVVTSLAGAERLVPKKQSLEQAYLHVKVGDAYNLNVIKNTLMMMGYTPTKLVQTPGEFAHRGSIVDVYPITFDDPIRLDFFDDELDQLKSFDVATQKSTTSFDEINIDPATDFIVSEHQYDQAKLAIESAFSDYRTNLSGVDKKHATDGFAPTQYMLNERERGSVLVPYAPFFFDGQTTLLDYFPTDSLIIIDEYTRLMETRLQQMTRDQEWIEQQIEAYQLLPKQTWRTEITDLLASNQHATIYLANFQRGLNRIKFTNVEEVTTRPANQYYGQIPALKNDLIYAQESGITMVLLIPDAKRRANFSRSLSELEVPVTETRDIVKNQVQIMPGELSAGFEWPKLHLTVLTTHELFTQAKHSAPRTRKIANSERLKSYNELNVGDYVVHINHGIGRYEGLQTIEADGGKQDYLTIAYQQNAKIFIPVTQLNLIQKYVGASDVAKKPKLNKLGGSEWAKTKRQVAAKIEDIADDLLELYAKREAQQGYVFPPDDHAQIKFDDSFGYPETPDQIRSIEEIKVDMQKLRPMDRLLVGDVGFGKTEVALRAVFKAAHSGKQVAFLAPTTILVQQHYETMLARFSDFPEIKIGVLSRFQTPTQNKMIIEQLQNHEIDVVVGTHRLLSKDVDFSDLGLLIIDEEQRFGVKHKERLKQLRTSVDVLTLTATPIPRTLNMAMVGARDLSVIETPPANRYPIQTYVLAMDWKIVRDAIEKEIARNGQVFYLHNRVADLDRIVSQIEELIPSARVAAIHGQMSETQLESILYDFLNGQYDVLVTTTIIETGVDIPNANTLIVENADHMGLAQLYQLRGRVGRSTRLAYAYFTYPFTRTPSEEAEKRLEAIRDFTELGSGFRIAMRDLSIRGAGDLLGKQQHGFIDSVGYDMYTQMLKDTVAQKQGKQVTTSQPETDAELILGVLAYLPDEYVSDNAQKIELYSRIRQARTDAEFEDIESDMLDRFGEMPDEVARLLLVGQIKQLADQSQITNIRRQRKQLIMTFNETATKNLAGEAIFETMVDVPLKAAVRTEEGNLQVIFTVNDVAESSIWLNILRNFLLVIINKLSAKTLNELHH
>NC_016805.3|WP_010291225.1|350458_351025_+|aminoacyl-tRNA-hydrolase
MKFIFGLGNIGAEYDQTRHNIGFMAVDAFATANHMSFSPSKQFALVAKTIIGGESVMLVKPTTYMNDSGKAVRAILDYYDGDVDDVLVLVDDMDLPFGKMRFRAKGSAGGHNGLKSIMTHTGSQTFLRLKFGLGHPVHEQNVVVNYVLGKFTAAEKPDIDAMLDRSTQAIADWIQGATAPELSNRYNG
>NC_016805.3|WP_011679258.1|349688_350333_-|CBS-domain-containing-protein
MFQKSLVIPKSELTTVTENATIQEVYDIFNDPENAHTRTMPILDESGKLFRGNVYKQHVFEHVAKNGNMNLPATAIMRNSTKFIYTNSKFYEVFFAIRDLPFIAVLDENHQFYGIFTHDALMDLLSQSWSVRSGGVAIAISTHNTQGDLSKISKIITRYSNIESLLTIQSELKPLTVLFTLPLQEDSEQLEKLIKRLEKKGYHVSSVENLNRFR
>NC_016805.3|WP_011679265.1|362381_362915_+|rRNA-large-subunit-pseudouridine-synthase-E
MIVLFNKPYNVLTKFTDAEGRPTLADYIDIPRVYAAGRLDMDSEGLLLLTDSGKLNHELTDPDNKAYKTYVVQVEGVPTKSQLKQLEQGVALKDGLTLPAKVKRIPYPKWLWEREKPIRIRKNQPTSFIQLKIKEGRNRQVRRMTAAVGIPTLRLIRTHIGEYHIADLKPGQYRIVK
>NC_016805.3|WP_014324303.1|362985_363702_+|YebC/PmpR-family-DNA-binding-transcriptional-regulator
MGRKWENIKMKKAQTDGAAAKVNSKYGIEIYAAAKQGGSPDPEANSTLKFVIERAKQAQVPKHVIERAIEKAKGSGDETFIEGRYEGFGPNGSLIIVDTLTSNVNRTATNVRTAFNKNGGTYGAAGSVSYLFDETGVIVFEGEDADATLETLLDAEVDVRDAEQQDDHIVVYTEPTALHQAIAALRESGVSDFSTTEISMLPQSEMTLAGKDLEIFEKLIDVLESDDDVQKVYHNVEL
>NC_016805.3|WP_014324304.1|363750_364698_-|ferrochelatase
MNKKGLLLVNLGTPDSPHPDDVKAYLKEFLSDTNVIQMPRLLWQPILRGKILPKRSFKSAELYQKIWRKDGSPLMVYAKKQVEQVQQLQPNWIVRYAMTYRKPNIAETLKEMRLAGADDIVVLPLFPQYSVTSTQSVIDQVRKADKNINIVKSFYNDEAYLDLLARDIREAWAKNDYDRLIISYHGVPESYVRRGDPYVDHCTATTQGVLESVGPLTPDNTHQVFQSRFGPTEWVKPYLSDTLMSLPSQGIKRVLVATPAFVADCLETIEEIHVENHDIFKQAGGEVFDVVQPFNEHIDFSKYIASLANRHFAQN
>NC_016805.3|WP_014324305.1|365510_366959_+|NCS2-family-permease
MEKLFQLKENKTTVRREIIAGITTFVSMAYIFFLNPQILGQAGVPTQAVFLAAILVAVFGTLFMGLFANVPFALAPGIGMQAYFTYTIVFGFGFTWQQALAIVFLVGVVDIVITLTHGRRAIVKGIPTELKAAIGGGIGLFVTYIGLKNAGFINFIVDPSNIMTLNGKPFTGEVHGAVNSILANGGVTPELTKFNNASTLLALIGFIILVVLVMRKVPGAFLISLIVTTLIGIPMGVTNTHIGAGTSVSHAFGELGQVFGQSLGAQGLGSLFNNWHHASLALVTIFAMGLTGLFDAIGTLIGIGNQTGIFSKEDQKSFESSNGFNSKMDRALVVDTFTTAFAGIVGTSNTTTFIESASGVAAGARTGLANVVTAAGFALMILFAPLVGVVPTAATSPLLILVGIMMMGEFKKISWESLEVALPAFFTSVFMAFSYSISYGIAAGFIFFIIVKFALGKFKEVSPVLLIVSAFFLLNFAVLAFM
>NC_016805.3|WP_014324306.1|367078_367879_+|ABC-transporter-ATP-binding-protein
MLNIKNLSVSYGRKVALTVPKLSINKGEIIGVMGKSGSGKSTLVNSCLGLIPFKGQVRIDTDDVGILMQEQHYVDTMTNQKMIEGMLNTRIKRDKKLTELINFFDFSDQLSLHFKNLSGGQKQRMSLIMVLYQEPELLFLDEMTTGLDFESRQALISQLKIYFKQHQTTVLMVTHYAQEIEALADKLLVIHDGQVKAFDEPKNLFKQYIGYSAFIVDNHTEKSIKVQQPEDEYKVACRLIDDGDDFRRTQSDIELVYTEVMKGQRA
>NC_016805.3|WP_014324307.1|367875_368604_+|membrane-protein
MIKKRKLVLEFQNLLGNIITLFFGFAFAPMMALVFGNSYANVPQALNQLYLGFFCTIPLSMVFVGFSSLFSQEVEQGFTLRAELFGYSRVSQALHKFMALTVFVLLSSIIYSWIFLSHFNLPLPNAVIIGQMAIFQILNTAVYFIIVFILTTILKKFSRVYGISMISYFAIMIISGIMGNMDVGKLGDYLPIKLFVTNYTNHLNDTDYISGKIGLYLLILLGILGVILKVIVRNKNGNKHQY
>NC_016805.3|WP_014324308.1|368581_369049_+|LytTR-family-transcriptional-regulator
MEININIDDKLKDVQVVISGSDIEQLADIAQYLKSRNTPSRQLAIKTADNIRVVDKEDIILVESYGNDLTFTLKNNHKITTRKTLKRFLEENQKSDFVQISKSEVMNLSYLSKMESAFSGNYYAFLTNQARVTVSRRFIKGILKRLEGSAEDEAF
>NC_016805.3|WP_014324309.1|369035_369446_+|DUF3021-family-protein
MKHFKEAIVYLLVGIGVGSFISLLSFTLNHATPSMKQFGLLMTMSAIMGLLSLIFEYDKITFITQLISHFILEMLTYGFFIWLTFGSAVITFTNIPTFVITYVIIFIYFRKQGRDNARRINEQLQKNKPKKSDSTN
>NC_016805.3|WP_014324310.1|369579_371670_+|DNA-topoisomerase-III
MPNYLILTEKPSAAANFVKALGGKTGVFGDFTYKITNLRGHVMTLKDPEEMVAEDLKKQYKSWLVKHLPWNLEDFSWARTYIRQRNIRTGKIESTKKLIDELKKESKSGYDAIVIATDTDPSGEGELLAWEALDAIGWRGQVLRANFMDESVSGIQKAMHQLRNVSDKMADGEYVKGESRNRWDFASMQLTRIATTAAKKEGFKVVAREGRLKSVIVWRIYQQLAAIKNYIKTPYFEVKFKDPAGHIFGRVTPQGEVIPWRFATKEQAKVDFNNYHETEVINEKHQTRTQAPGKLLDLAGLASILAPRGFSSKEVLSTYQKMYEAQIVSYPRTEDKTVTPEQFNELLPLIDQIAGVVGVDKNLLTHRSPRKTHVKSQGAHGANRPGENVPQTTQSLAKFGSSGPAIYEVLAKNYLAMLAEDYVYDHVTANLKDYPEFKTAFNIPIKLNFKLVYDSQKAIKVEEGEEEESISGQLGPQARPYLHEGANPKPQVPTTKWIMAFLEKHNVGTGATRVSTLSEMSRGTKAMLTEKRGKLGLTETGNVSAIMVKDTWIASPKITKRLFEMMDQVGRFEMTMVQVLDSATKVVEHDMPIMLDNAQTLETLLGKPKPSIKKPRKTSEKMTGIWQGQEITFAREWSGHVFTDEELQKLLTGSEVSFPAKSKRGKLYTAIGKMAKQTFKGNTFYGFKLNPKTKKA
>NC_016805.3|WP_014324313.1|374410_375532_+|alanine-racemase
MNYNAPHRHAVIELSQSAVVHNLKVIKENTHAKEIMAVLKANAFSHGLPEMASLSITAGATRFGMAMLDEALTLRDLGYIQPIDVLGLTDPRYARLAAERNITLAFSTKESIKAAAEQLAGTGLTLKVSLPVDTGLNRIGFKSREDLVAAIQEVSAQDTLIFQSMWTHFATADTPNVDYVDFQISEWQRLTHDLPVEPNEKHFANTGIATWYPEKINTDIVRLGIGLFGINGSVPIMSMPFELIPALSLKAKVVNSKPLKKGDAVGYGPEYHAPNDGYLITIPIGHSDGYPFNGSGMRALVADGQIGHIVGGVAMDQSMIFVTNPVAVGTTVTLIGRVGDQSITMQDLAEHTQSSIVALMNDFAPRLQRIIVS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

58334 : 75032

Bacillus_virus(33.33%)

protease,bacteriocin

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014324148.1\|58334_58544_+\|bacteriocin	Blp family class II bacteriocin	NA	NA	NA	NA
WP_014324149.1\|58584_58791_+	hypothetical protein	NA	NA	NA	NA
WP_049639999.1\|59505_59886_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_011679055.1\|60063_61620_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	5.3e-14	24.9
WP_011679056.1\|61619_62741_+	ABC transporter permease	NA	NA	NA	NA
WP_011679057.1\|62742_63699_+	ABC transporter permease	NA	NA	NA	NA
WP_014324151.1\|63738_64653_-	L-2-hydroxyisocaproate dehydrogenase	NA	NA	NA	NA
WP_014324152.1\|64768_65524_-	ATP-binding cassette domain-containing protein	W6JKT0	Anomala_cuprea_entomopoxvirus	2.4e-12	29.8
WP_014324153.1\|65516_66416_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_011679060.1\|66412_67417_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_014324154.1\|67883_68471_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002815471.1\|68528_69266_+	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_011679061.1\|69381_69507_+	putative metal homeostasis protein	NA	NA	NA	NA
WP_014324155.1\|70322_71672_-\|bacteriocin	bacteriocin secretion accessory protein	NA	NA	NA	NA
WP_014324156.1\|71689_73837_-	peptide cleavage/export ABC transporter	F2Y352	Organic_Lake_phycodnavirus	3.8e-23	30.6
WP_010287032.1\|74067_74244_+\|bacteriocin	class IIb bacteriocin, lactobin A/cerein 7B family	NA	NA	NA	NA
WP_010287029.1\|74274_74436_+\|bacteriocin	class IIb bacteriocin, lactobin A/cerein 7B family	NA	NA	NA	NA
WP_014324157.1\|74894_75032_+\|bacteriocin	class IIb bacteriocin, lactobin A/cerein 7B family	NA	NA	NA	NA

DBSCAN-SWA_2

545458 : 558623

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011679402.1\|545458_546724_+	insulinase family protein	A0A1X9I714	Streptococcus_phage	3.8e-47	30.8
WP_014324423.1\|546725_547997_+	insulinase family protein	A0A167R9K4	Powai_lake_megavirus	1.9e-17	31.8
WP_014324424.1\|548011_548887_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_010285285.1\|548897_549479_+	CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase	NA	NA	NA	NA
WP_011679405.1\|549618_550776_+	recombinase RecA	A0A0S2MVG1	Bacillus_phage	1.1e-117	65.1
WP_011679406.1\|550858_551551_+	response regulator transcription factor	W8CYM9	Bacillus_phage	4.8e-36	34.5
WP_014324425.1\|551790_552699_+	phosphate ABC transporter substrate-binding protein	M1U9L0	Synechococcus_phage	1.2e-10	27.7
WP_041775151.1\|552782_554123_+	two-component sensor histidine kinase	W8CYF6	Bacillus_phage	1.0e-29	35.2
WP_014324427.1\|554264_555146_+	phosphate ABC transporter substrate-binding protein PstS family protein	H6WG65	Cyanophage	7.6e-10	28.4
WP_011679411.1\|555198_556122_+	phosphate ABC transporter permease subunit PstC	NA	NA	NA	NA
WP_010291776.1\|556121_557006_+	phosphate ABC transporter permease PstA	NA	NA	NA	NA
WP_011679412.1\|557013_557856_+	phosphate ABC transporter ATP-binding protein	A0A1V0SE00	Indivirus	1.0e-11	28.4
WP_014324428.1\|557852_558623_+	phosphate ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.6e-16	29.3

DBSCAN-SWA_3

800717 : 809376

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014324572.1\|800717_801623_+	cation transporter	M1Q1N9	Streptococcus_phage	2.4e-43	35.6
WP_014324573.1\|801642_802602_+	arginine deiminase	NA	NA	NA	NA
WP_014324574.1\|802984_804019_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A1V0SE20	Indivirus	1.1e-36	33.3
WP_011679597.1\|804018_804609_+	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	1.4e-23	34.9
WP_014324575.1\|804611_805805_+	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	4.5e-90	44.9
WP_011679599.1\|805829_806300_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	1.4e-31	43.9
WP_014324576.1\|806736_809376_+	cation-translocating P-type ATPase	M1HX51	Paramecium_bursaria_Chlorella_virus	3.9e-78	28.5

DBSCAN-SWA_4

1408726 : 1421778

Staphylococcus_phage(37.5%)

protease,integrase

attL 1399899:1399913|attR 1418675:1418689

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1399899:1399913	attL	NA	NA	NA	NA
WP_002815228.1\|1408726_1409869_-	nicotinamide-nucleotide adenylyltransferase	A0A2K9VDE3	Lactobacillus_phage	2.2e-110	56.4
WP_011680189.1\|1409914_1410682_-	nicotinamide mononucleotide transporter	U5J9C5	Bacillus_phage	4.7e-24	31.5
WP_010281611.1\|1410784_1411228_-	peptide-methionine (R)-S-oxide reductase MsrB	NA	NA	NA	NA
WP_002815235.1\|1411331_1411916_-	YihA family ribosome biogenesis GTP-binding protein	NA	NA	NA	NA
WP_011680190.1\|1411916_1413167_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	1.3e-132	57.9
WP_193391377.1\|1413396_1414488_+	restriction endonuclease subunit S	A0A2H4PQP5	Staphylococcus_phage	1.9e-34	40.3
WP_014324994.1\|1414550_1415468_-\|integrase	site-specific integrase	A8ATD6	Listeria_phage	4.9e-68	43.2
WP_060499447.1\|1415539_1416793_-	restriction endonuclease subunit S	A0A2H4PQP5	Staphylococcus_phage	3.3e-19	24.6
WP_060499448.1\|1416785_1417001_-	SAM-dependent DNA methyltransferase	A0A2H4PQP4	Staphylococcus_phage	1.0e-08	68.3
WP_060499450.1\|1416940_1417354_-	hypothetical protein	NA	NA	NA	NA
WP_014324996.1\|1418916_1421778_-	type I restriction endonuclease subunit R	A0A220A398	Liberibacter_phage	4.5e-27	24.5
1418675:1418689	attR	NA	NA	NA	NA

DBSCAN-SWA_5

1635025 : 1645796

Pandoravirus(14.29%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014325118.1\|1635025_1636135_-	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	A0A0B5JD48	Pandoravirus	1.9e-13	28.5
WP_014325119.1\|1636131_1637049_-	homoserine O-succinyltransferase	NA	NA	NA	NA
WP_002815833.1\|1637557_1637884_+	thioredoxin family protein	NA	NA	NA	NA
WP_010280582.1\|1637977_1638835_-	trypsin-like peptidase domain-containing protein	W5SAB9	Pithovirus	6.7e-11	29.8
WP_010280580.1\|1638926_1640225_-	HAMP domain-containing histidine kinase	A0A1V0SGX0	Hokovirus	7.5e-14	26.5
WP_011680398.1\|1640205_1640907_-	response regulator transcription factor	W8CYM9	Bacillus_phage	4.0e-30	35.4
WP_002815839.1\|1640987_1641353_-	type II toxin-antitoxin system PemK/MazF family toxin	A0A2P0ZKX3	Lactobacillus_phage	9.4e-07	36.8
WP_014325120.1\|1641391_1642513_-	alanine racemase	A0A0P0YM39	Yellowstone_lake_mimivirus	3.8e-30	29.5
WP_002815841.1\|1642509_1642920_-	holo-ACP synthase	NA	NA	NA	NA
WP_014325121.1\|1642990_1644277_-	D-alanyl-lipoteichoic acid biosynthesis protein DltD	NA	NA	NA	NA
WP_010292689.1\|1644281_1644518_-	D-alanine--poly(phosphoribitol) ligase subunit DltC	NA	NA	NA	NA
WP_014325122.1\|1644587_1645796_-	D-alanyl-lipoteichoic acid biosynthesis protein DltB	A0A125RNP0	Pseudomonas_phage	1.9e-19	26.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NC_016828

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 14729

Streptomyces_phage(16.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014335296.1\|802_1447_+	ArsR family transcriptional regulator	NA	NA	NA	NA
WP_014335295.1\|1572_1854_+	thioredoxin family protein	NA	NA	NA	NA
WP_006844824.1\|1867_2182_+	thioredoxin	A0A1J0GW78	Streptomyces_phage	1.4e-14	43.0
WP_014335294.1\|2202_2526_+	thioredoxin family protein	NA	NA	NA	NA
WP_006844822.1\|2744_3689_+	thioredoxin-disulfide reductase	G3MA85	Bacillus_virus	7.7e-77	47.9
WP_014335309.1\|3707_4355_+	DsbA family oxidoreductase	NA	NA	NA	NA
WP_014335307.1\|4516_5848_+	NAD(P)/FAD-dependent oxidoreductase	A0A2K5B2C5	Erysipelothrix_phage	1.4e-20	24.7
WP_014335306.1\|6279_6618_+\|transposase	transposase	A0A1S5SBP9	Streptococcus_phage	1.5e-06	31.6
WP_014335305.1\|6968_7946_+	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_014335304.1\|8062_9295_+	MFS transporter	NA	NA	NA	NA
WP_014335303.1\|9305_10733_+	glycoside hydrolase family 32 protein	S6ATV4	Bacillus_phage	3.1e-29	28.8
WP_078126288.1\|10891_11197_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_014335300.1\|11841_13077_+	plasmid recombination protein	NA	NA	NA	NA
WP_014335299.1\|13574_14729_+	RepB family plasmid replication initiator protein	A0A1V0E006	Clostridioides_phage	5.6e-05	25.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NC_016820

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 9468

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013102144.1\|34_382_+	CrcB family protein	NA	NA	NA	NA
WP_014333923.1\|556_2089_+	ClC family H(+)/Cl(-) exchange transporter	NA	NA	NA	NA
WP_010277818.1\|2654_3617_+	cation:proton antiporter	NA	NA	NA	NA
WP_014333924.1\|3697_4378_-	VIT family protein	NA	NA	NA	NA
WP_049640002.1\|4379_5054_-	VIT family protein	NA	NA	NA	NA
WP_014333928.1\|7031_7436_+	arsenate reductase (thioredoxin)	A0A2H4PQT9	Staphylococcus_phage	9.7e-29	47.4
WP_014333931.1\|8254_8632_-	hypothetical protein	NA	NA	NA	NA
WP_014333932.1\|8634_9468_-	AAA family ATPase	F0PIG8	Enterococcus_phage	4.6e-49	42.7

DBSCAN-SWA_2

13998 : 21974

Lactobacillus_phage(25.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014333936.1\|13998_14241_+\|transposase	transposase	Q6J1X3	Lactobacillus_phage	3.1e-06	36.1
WP_014333937.1\|14286_15090_+\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	1.3e-29	36.0
WP_014333938.1\|15086_15413_-	plasmid recombination protein	NA	NA	NA	NA
WP_014333939.1\|16109_17444_+	FAD-dependent oxidoreductase	A0A2K5B2C5	Erysipelothrix_phage	4.9e-101	44.9
WP_013102133.1\|17955_18324_+	large conductance mechanosensitive channel protein MscL	NA	NA	NA	NA
WP_049640003.1\|20123_21974_+	heavy metal translocating P-type ATPase	E4ZFI9	Streptococcus_phage	1.4e-98	34.5

DBSCAN-SWA_3

25577 : 27745

Bacillus_phage(50.0%)

integrase

attL 24841:24855|attR 28816:28830

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
24841:24855	attL	NA	NA	NA	NA
WP_006844813.1\|25577_26165_-\|integrase	site-specific integrase	D2XR58	Bacillus_phage	2.8e-21	33.1
WP_010276774.1\|26342_27098_-	iron export ABC transporter permease subunit FetB	NA	NA	NA	NA
WP_010383508.1\|27094_27745_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	3.7e-22	31.5
28816:28830	attR	NA	NA	NA	NA

DBSCAN-SWA_4

32057 : 33935

Bacillus_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014333947.1\|32057_32495_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	6.0e-24	43.6
WP_146017152.1\|32536_32863_-	hypothetical protein	NA	NA	NA	NA
WP_013102142.1\|32908_33163_-\|transposase	transposase	NA	NA	NA	NA
WP_010277799.1\|33371_33935_-	recombinase family protein	A0A0A8WIK3	Clostridium_phage	5.5e-30	42.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_016805

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NC_016828

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NC_016820

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection