CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NC_017017	Pediococcus claussenii ATCC BAA-344 plasmid pPECL-6, complete sequence	1 crisprs	NA	1	0
NC_017018	Pediococcus claussenii ATCC BAA-344 plasmid pPECL-7, complete sequence	0 crisprs	NA	0	1
NC_017019	Pediococcus claussenii ATCC BAA-344 plasmid pPECL-8, complete sequence	0 crisprs	NA	0	0
NC_016607	Pediococcus claussenii ATCC BAA-344 plasmid pPECL-4, complete sequence	0 crisprs	NA	0	0
NC_016608	Pediococcus claussenii ATCC BAA-344 plasmid pPECL-5, complete sequence	0 crisprs	csa3	0	0
NC_016605	Pediococcus claussenii ATCC BAA-344, complete sequence	0 crisprs	csa3,DEDDh,cas3,DinG	0	4
NC_016635	Pediococcus claussenii ATCC BAA-344 plasmid pPECL-1, complete sequence	0 crisprs	NA	0	0
NC_016636	Pediococcus claussenii ATCC BAA-344 plasmid pPECL-3, complete sequence	0 crisprs	NA	0	0
NC_016606	Pediococcus claussenii ATCC BAA-344 plasmid pPECL-2, complete sequence	0 crisprs	NA	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_017017_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_017017_1

5351-5452

Orphan

Consensus_repeat	Method
GTCCGATTTTCGGATTTTCGCTCGTAGCAAGGGTTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_017017_1

>merge|NC_017017|1|5351-5452|CRISPRCasFinder
GTCCGATTTTCGGATTTTCGCTCGTAGCAAGGGTTTGCGGGGTGTCGTCAACGAACTTTCGCGAACGTCCGATTTTCGGATTTTCGCTCGTAGCAAGGGTTT

>NC_017017|1|1|5351-5452|CRISPRCasFinder
GTCCGATTTTCGGATTTTCGCTCGTAGCAAGGGTTT	GCGGGGTGTCGTCAACGAACTTTCGCGAAC
GTCCGATTTTCGGATTTTCGCTCGTAGCAAGGGTTT

Protein	Signature genes	Signature genes Name	Protein_function
NC_017017.1\|WP_014386875.1\|7176_7944_-\|ParA-family-protein	unknown	unknown	gnl\|CDD\|224113
NC_017017.1\|WP_014386873.1\|6431_6812_-\|hypothetical-protein	unknown	unknown	unknown
NC_017017.1\|WP_010620892.1\|4100_4286_-\|hypothetical-protein	unknown	unknown	unknown
NC_017017.1\|WP_014386870.1\|3423_4104_-\|zeta-toxin-family-protein	unknown	unknown	gnl\|CDD\|226648
NC_017017.1\|WP_014386869.1\|3155_3434_+\|hypothetical-protein	unknown	unknown	unknown
NC_017017.1\|WP_014386871.1\|4332_4614_-\|type-II-toxin-antitoxin-system-RelB/DinJ-family-antitoxin	unknown	unknown	gnl\|CDD\|274102
NC_017017.1\|WP_014386881.1\|15484_16222_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|378937
NC_017017.1\|WP_014386876.1\|8025_8586_-\|recombinase-family-protein	unknown	unknown	gnl\|CDD\|239737
NC_017017.1\|WP_014386880.1\|14547_15492_+\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|213235
NC_017017.1\|WP_014386882.1\|16224_16962_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|378937
NC_017017.1\|WP_014386878.1\|9241_12334_+\|type-2-lantipeptide-synthetase-LanM	unknown	unknown	gnl\|CDD\|274840
NC_017017.1\|WP_003555660.1\|2905_3133_+\|hypothetical-protein	unknown	unknown	unknown
NC_017017.1\|WP_014386879.1\|12388_14548_+\|peptidase-domain-containing-ABC-transporter	unknown	unknown	gnl\|CDD\|225183
NC_017017.1\|WP_014386868.1\|592_2653_-\|MobA/MobL-family-protein	unknown	unknown	gnl\|CDD\|367473
NC_017017.1\|WP_014386874.1\|6875_7175_-\|hypothetical-protein	unknown	unknown	unknown
NC_017017.1\|WP_014386877.1\|8985_9162_+\|plantaricin-C-family-lantibiotic	unknown	unknown	gnl\|CDD\|333722

Protein	Function_ID	Function_description	E-value
NC_017017.1\|WP_014386875.1\|7176_7944_-\|ParA-family-protein	gnl\|CDD\|224113	COG1192, Soj, ATPases involved in chromosome partitioning [Cell division and chromosome partitioning].	6.01546e-43
NC_017017.1\|WP_014386880.1\|14547_15492_+\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|213235	cd03268, ABC_BcrA_bacitracin_resist, ATP-binding cassette domain of the bacitracin-resistance transporter. The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance. Bacitracin is a dodecapeptide antibiotic produced by B. licheniformis and B. subtilis. The synthesis of bacitracin is non-ribosomally catalyzed by a multi-enzyme complex BcrABC. Bacitracin has potent antibiotic activity against gram-positive bacteria. The inhibition of peptidoglycan biosynthesis is the best characterized bacterial effect of bacitracin. The bacitracin resistance of B. licheniformis is mediated by the ABC transporter Bcr which is composed of two identical BcrA ATP-binding subunits and one each of the integral membrane proteins, BcrB and BcrC. B. subtilis cells carrying bcr genes on high-copy number plasmids develop collateral detergent sensitivity, a similar phenomenon in human cells with overexpressed multi-drug resistance P-glycoprotein.	3.28348e-87
NC_017017.1\|WP_014386871.1\|4332_4614_-\|type-II-toxin-antitoxin-system-RelB/DinJ-family-antitoxin	gnl\|CDD\|274102	TIGR02384, Putative_antitoxin_RelB, addiction module antitoxin, RelB/DinJ family. Plasmids may be maintained stably in bacterial populations through the action of addiction modules, in which a toxin and antidote are encoded in a cassette on the plasmid. In any daughter cell that lacks the plasmid, the toxin persists and is lethal after the antidote protein is depleted. Toxin/antitoxin pairs are also found on main chromosomes, and likely represent selfish DNA. Sequences in the seed for this alignment all were found adjacent to toxin genes. The resulting model appears to describe a narrower set of proteins than pfam04221, although many in the scope of this model are not obviously paired with toxin proteins. Several toxin/antitoxin pairs may occur in a single species. [Cellular processes, Toxin production and resistance, Mobile and extrachromosomal element functions, Other].	1.00264e-10
NC_017017.1\|WP_014386870.1\|3423_4104_-\|zeta-toxin-family-protein	gnl\|CDD\|226648	COG4185, COG4185, Uncharacterized protein conserved in bacteria [Function unknown].	1.04185e-38
NC_017017.1\|WP_014386878.1\|9241_12334_+\|type-2-lantipeptide-synthetase-LanM	gnl\|CDD\|274840	TIGR03897, Lantibiotic_mersacidin_modifying_enzyme, type 2 lantibiotic biosynthesis protein LanM. Members of this family are known generally as LanM, a multifunctional enzyme of lantibiotic biosynthesis. This catalysis by LanM distinguishes the type 2 lantibiotics, such as mersacidin, cinnamycin, and lichenicidin, from LanBC-produced type 1 lantibiotics such as nisin and subtilin. The N-terminal domain contains regions associated with Ser and Thr dehydration. The C-terminal region contains a pfam05147 domain, which catalyzes the formation of the lanthionine bridge. [Cellular processes, Toxin production and resistance].	0
NC_017017.1\|WP_014386882.1\|16224_16962_+\|ABC-transporter-permease	gnl\|CDD\|378937	pfam12730, ABC2_membrane_4, ABC-2 family transporter protein. This family is related to the ABC-2 membrane transporter family pfam01061.	2.45452e-18
NC_017017.1\|WP_014386879.1\|12388_14548_+\|peptidase-domain-containing-ABC-transporter	gnl\|CDD\|225183	COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms].	1.0349e-143
NC_017017.1\|WP_014386868.1\|592_2653_-\|MobA/MobL-family-protein	gnl\|CDD\|367473	pfam03389, MobA_MobL, MobA/MobL family. This family includes of the MobA protein from the E. coli plasmid RSF1010, and the MobL protein from the Thiobacillus ferrooxidans plasmid PTF1. These sequences are mobilisation proteins, which are essential for specific plasmid transfer.	5.10353e-101
NC_017017.1\|WP_014386881.1\|15484_16222_+\|ABC-transporter-permease	gnl\|CDD\|378937	pfam12730, ABC2_membrane_4, ABC-2 family transporter protein. This family is related to the ABC-2 membrane transporter family pfam01061.	1.1415e-29
NC_017017.1\|WP_014386877.1\|8985_9162_+\|plantaricin-C-family-lantibiotic	gnl\|CDD\|333722	NF000539, plantaricin, plantaricin C family lantibiotic. This family describes plantaricin C-like lantibiotic precursors. The seed alignment straddles the cleavage motif (typically GG), and includes both an extended leader peptide region and a Cys-rich core peptide region. Because of the mosaic structure of lantibiotic precursors, this family can be expected to overlap other lantibiotic precursor families in the same clan.	8.8934e-07
NC_017017.1\|WP_014386876.1\|8025_8586_-\|recombinase-family-protein	gnl\|CDD\|239737	cd03768, SR_ResInv, Serine Recombinase (SR) family, Resolvase and Invertase subfamily, catalytic domain; members contain a C-terminal DNA binding domain. Serine recombinases catalyze site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and the enzyme. They are functionally versatile and include resolvases, invertases, integrases, and transposases. Resolvases and invertases affect resolution or inversion and comprise a major phylogenic group. Resolvases (e.g. Tn3, gamma-delta, and Tn5044) normally recombine two sites in direct repeat causing deletion of the DNA between the sites. Invertases (e.g. Gin and Hin) recombine sites in inverted repeat to invert the DNA between the sites. Cointegrate resolution with gamma-delta resolvase requires the formation of a synaptosome of three resolvase dimers bound to each of two res sites on the DNA. Also included in this subfamily are some putative integrases including a sequence from bacteriophage phi-FC1.	4.35091e-54

>NC_017017.1|WP_014386871.1|4332_4614_-|type-II-toxin-antitoxin-system-RelB/DinJ-family-antitoxin
MAVKEKKRVQVQIDKELADNTEAVLSQLGLNPTTAINMFYKRIVADAALPFKPALSEAERANLSLLKVTKETPVTEFKDAKEVADWLNDPDED
>NC_017017.1|WP_010620892.1|4100_4286_-|hypothetical-protein
MKDTITINDFFEIAKETDLKDLLDKSLHEPDPEKRKVYDALYTYFLDKRQDEVIKRKDFVR
>NC_017017.1|WP_014386870.1|3423_4104_-|zeta-toxin-family-protein
MIDKPQYIIVAGINGAGKSTLYDTFPILFDKTKRINADELLRQMGGDWHKDSDNLKAMKEEIKQLHYALDHQQSIHVETTLAGRGKAQLNLIDKAHKNGFEVTLLYVALRDENLAIQRVNERVQKGGHGVPVATIKKRYQQSKHNLPLVAFKSDKVMIYDNSEKFTSVYAREKGQVFKNDLRHFPWINQNITYPEKVQKQLQNFADQNPEIKPKNDPENKNDRPSY
>NC_017017.1|WP_014386869.1|3155_3434_+|hypothetical-protein
MSNQYEKLVEQQARLKQKIEREDFKLRQSKYYENRQSRKARSRRLIQKGALLEKYFQANNLSVEQTEELLKTFANYVNAHKPNKFKDDQPNN
>NC_017017.1|WP_003555660.1|2905_3133_+|hypothetical-protein
MIGGIVMSQSNLEKQEAKLKALNQKIKDEKNKIEQRLGKQIISQANLDYANLSNDQIKLLAKQFSEFLKVKSVDH
>NC_017017.1|WP_014386868.1|592_2653_-|MobA/MobL-family-protein
MAIFHMSFSNISAGKGRSAIAGASYRSGEKLFDQKEGRSYFYARSVMPESFILTPKNAPEWASDREKLWNEVERKDRRANSRYAKEFNVALPVELSEDEQKELLTKYVQENFVNAGMVADVAIHRDHPDNPHAHVMLTNRPFNSDGTWGIKSKKQYILDDNGNKTYTGTSKYPKSRKILMVDWDKKEKITEWRHNWATAVNQVLEAKNLPDRISEKSYEEQGIDEVATQHEGINSQKEKRQEFNQNVKQQRQAKAEAKNTNEKIHNERRMQTLQRHYSFDEKRLVAQLSNRLKTFVSLENLDEKQRMLFNWKNSTMIKQAIGQDMTKQLITINQQENSLAEANQLLDKVVNRTVRKLYPDIDFERVTMAEKRELIKETDSEQKVFAGNELKDRLAMIRTNIINQQILTFTKRPFVSWLMLEKQEQRVKENTSDILAKKGYRFKDIKLTKGALLNGFEENEQNVLKRSIKELSAINEVKKVVDTQYNSVLTKSFPDIDLNKVKMTEKERLYTAVIYYNPELQPLEKQDITRLKNKPPEKFTTQEHVQGLAYLSGQVKPDEIKNANLLRVLNNRGTQQLFIGEAGQDKNISAKQIEQAKQAVKQHNLRSDDFRKENIEGYRAVNYNENTPIKYMSTLLSDALMSVLYSNTQDYELNKQRKAQEELEYELDKKKRQHHKHGRRGGTIHR
>NC_017017.1|WP_014386873.1|6431_6812_-|hypothetical-protein
MKTQLMDYWLYLYLGCIYLVPLFRIIKLNNNDTRFMLRKLLFPLEYLIQVKAEQAFNNSRSATRLIHILIFPMSVLGLVGASMPLVSLNEPMMKHTAILVFITYYCMLAPITFWFQPKAGKIYKTK
>NC_017017.1|WP_014386874.1|6875_7175_-|hypothetical-protein
MTKREFKKAVDTNKLSGLSQPKKFMESDTDNKQWNDYLEAIKQEQENYEQVLYSVAVEPSLKEAIKIAGKNRGRVKGGAKSIVRDAMTSYFDKHPELFE
>NC_017017.1|WP_014386875.1|7176_7944_-|ParA-family-protein
MAKIIAFYNNKGGVAKTTTATNVAGVLSLQHKRVLLIDGDPQGHTSLTFGVDADDLQTTLGAYLSSGWDAKQASDYFINVNDYLDVVPSNQSLSDFIIAVSGEDPKFRNKHLKNFIDPIRDEYDYIIFDMAPAVDIILENIVEIVDDLTVVAVPETYAVKNAETTLKITDDKQVIVRHIVPTKTQLNTNTHKFMLENLREVAEAHNIKMTDTFIPNLIAFAEAVSIYELPLALVKDNHYKSAQKYYQNLVKELGY
>NC_017017.1|WP_014386876.1|8025_8586_-|recombinase-family-protein
MKYGYARVSTTDQKLENQIDSLKNSGAEIIYQEKFTGTTTERPEFNKLLNELKTDDTLIVTKLDRFARNTREALDIIQDLFKRDIKVNILNMGIIDNTPTGQLIFTIFSAFAQFERDMIVTRTQEGKIYAKTHDPYFHEGRPQTYTDEQIRLAYELRQQGMTYRMIARKTGISERTQQRRFKKLNK
>NC_017017.1|WP_014386877.1|8985_9162_+|plantaricin-C-family-lantibiotic
MKKNLMKSAEESSGNVLEELNNAQLGMISGGKKIKKSSSGDICTLTSECDHLATWVCC
>NC_017017.1|WP_014386878.1|9241_12334_+|type-2-lantipeptide-synthetase-LanM
MVKKTDSVQGQIEKAIGTDVLQLAMDNLSKFKQPVEDIVYLNRLEEDSLLLVRNDYDSKKLYFLNHKKVIFSSFYDRLFFIAQNLLKKEYPECIKILSPHAQKMFLNSVGEKLDLICTRTLIYEMHIQNHLGNLNGVTPEDQYLSFNKEILGTNDEFIRILNTYSVMKTAIFSLIGGALKNLDFMIKHFLQDKELIMSQFGVKENIKKINDLSVNLSDSHSNGKIVYKLTLDDNKEIIYKPRSVNTEIIYQKILSHFIKVTPSSKKSLYYPIIDKKEYGWSVFVDHKNCKTEQEVSSYYYNFGIISFVNMLLNTDDLHFENLISSDEYPVLVDVETIMSNDINRIDFSNAGSIISHLLNSTVLRSGLLPTFVSFGGDNEGFDYSAINGEKDVELPYKVPRIENMYRSDMRIHYVHPHMHNENNQVRLKQTVVNPHRYVKEIVKGFCNAYKKAISLKETLISDLEFFNGIQSRILLKNTQQYSMVLRTSYHPIFLQNAQERIKFLHSIGKNTDTSSEQGKFILYSEVQDLLNNDIPYFYSKPKSKKLYNSMGDCINFFGDTAYSVIKKRIKNLNIEDMNFQRFIISLKISSPTPEMRVKEKRQTTLNFNKETANLVYSHDIFDTAAKKILDNLYNRAFISKKNNDVNWIQAVLSTEADNSWEISKMGMYLYDGIAGIAIFVNAFLAQNQNFLDKKYLQLKIALDNTLFKYVDQCLFDKNFFDDKSLGAFYGESSIAYTFQILFRITQNKLYFEYARKICDHLPNQVENDDICDYLLGSAGAINVFVNMFELTGNKKYLNISMSLLDHIEKSARVAFPDNSIAWKSDMASDPLAGLSHGASGFILSFSRLYKATKDKRILDLISNTLNFEDKLYDHNLHNWRDNRIIQGQRNYKNNINPVAWCHGSSGILLARLAVKRNCANVNNDLVERDIRLAIDSIKRMGNRDQNCLCHGSFGNVLCLLEAQDELTIQDQKDLEIIKLKMAKKVLEGHWSCGLPPQYENTSFMLGISGIGYALLKMNNSKLPNVLSLEI
>NC_017017.1|WP_014386879.1|12388_14548_+|peptidase-domain-containing-ABC-transporter
MRKHRIRLINQFSSSDCGLACILMIFKSYGYNKNLYNLIATVRPSRDGLTVAQLKTISKDNQFDLKAFKFKSRKSLIQNLPAILPTKDGHYVVISSVKKNVFTVLDPAEGVQKQSFQDLQQNCLPVLCIITPLPSFSKQTKFHGFIPSNKGILGSFNFKKSDVFITIFCTVILEAIVLIIPDIIKRIVNASVKTDINIQQVLIVLCLIIISFFVLNLLFTWIRQWVVLRMQTSVFKQVIDKLLEKLFSIDLTFYETHSTGDILNRFNNISMINNFLSTFLIKMFIDILTGIVCFIVMLTISPLLTTSIILIGAFEGILIYSLNSKLHSKTQEYITTQTQAQDNMADVFNNIIQIMCMGSQDKLEKDLENKYFKSIDSFREKGSLNNNLQSWLDSISVITNLLIYTLGFFLIQKGQINIGTLIQFVSLSSFAITPINSTIGAIPQIKVIQEITNRLNEIMFYKSVSRNGGTEISAINDIEVSHVSFSYSQTTNLDLRDISIKIPKGKRIAIVGNSGGGKTTLTKLIMNVFDDYSGSMYVNGVNYRKLNSASLYDKISVVTQTPLAINGTIKDNLDFGNKLSDSQLEDCLKNAEILDFVKQLPLGINTVMGDNGQNLSGGQKQRIAIARAISKNPELIIFDEGTNSLDQLTEQKIYHNLQSLNITQLIISHRLAAIQDADYIYVLSHGEIIEEGIHDELIAKKGLYYRNFLDNKQIEGRES
>NC_017017.1|WP_014386880.1|14547_15492_+|ATP-binding-cassette-domain-containing-protein
MDLNNDYVLRTDHLTKIYGPQISVKNLSIHVQKGKIYGLLGKNGAGKSTTMKMILGLIKPSSGTYSLFGKDMSKITNSELKSIFSKVGNTIESPGFYPNLTGTENLRIFAKLRKLPEKTIESSLTKLGLPYKDKKLFSEYSLGMKQRLAIANATMNSPELLILDEPINGLDPEGIVDIRKLLIDLSQNQGTTILISSHILSEMQLIADDIGIIANGALLVESKLQDLIEQNSNSFVFKVSNSANAAKILEQQFKIKDIVITNQQKLSISHAITDSAAIIKAFIMNGIDVQAAYLKEGTLENYFESITNGGASHE
>NC_017017.1|WP_014386881.1|15484_16222_+|ABC-transporter-permease
MSSLLVCEFKKLKRNSILKYTVLAAFLFPIPLSLLALHANMSFDKLKMFVFVFGFYLLMPIFLGLILATLVFEERDNNTLKNILTIPISKRSLLLAKIIATLIIGVIFAVVSLILPIILGVVRGNIDLGQFFTTLGIGLIIGVMVTVADLPLLIVVLKMKKNYLMSFVVSLSYTILSFVTSLQYNRFPLPLSVVFKWSLPHISSGTMSASITRLFFSTPSCIGILCIVGFLSYYVAVKLFESEEE
>NC_017017.1|WP_014386882.1|16224_16962_+|ABC-transporter-permease
MGTLIINEFRKLKRCDVLLVFFISLVFTDLLSIFQLYSGNEHSLYNYTDFMNIVIWDSFSLVLPAMIVIFSNYLINVEHISGALKNNITCAVSVNKLYVSKLVALCLINVVFAALNAFLTYLIFLFLPHKSEPIYHSLISMIQLIGISLGVFIAVLPILILFIRQASSYLNVVIAFVYGFVGVFVAGQNLQDYYPITAFLKIVNYNNGSLTYHGNTSYITVFIVLLFSLIAWIFMAQKLKKADYA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_017017_1	1.1\|5387\|30\|NC_017017\|CRISPRCasFinder	5387-5416	30	NC_017017	Pediococcus claussenii ATCC BAA-344 plasmid pPECL-6, complete sequence	5387-5416	0	1.0
NC_017017_1	1.1\|5387\|30\|NC_017017\|CRISPRCasFinder	5387-5416	30	NZ_CP014928	Lactobacillus paracollinoides strain TMW 1.1995 plasmid pL11995-4, complete sequence	6824-6853	0	1.0
NC_017017_1	1.1\|5387\|30\|NC_017017\|CRISPRCasFinder	5387-5416	30	NZ_CP047125	Lactobacillus hilgardii strain FLUB plasmid unnamed4	5237-5266	0	1.0
NC_017017_1	1.1\|5387\|30\|NC_017017\|CRISPRCasFinder	5387-5416	30	NZ_CP014920	Lactobacillus paracollinoides strain TMW 1.1994 plasmid pL11994-5, complete sequence	12632-12661	1	0.967
NC_017017_1	1.1\|5387\|30\|NC_017017\|CRISPRCasFinder	5387-5416	30	NC_017468	Lactobacillus helveticus H10 plasmid pH10, complete sequence	15844-15873	1	0.967
NC_017017_1	1.1\|5387\|30\|NC_017017\|CRISPRCasFinder	5387-5416	30	NZ_CP033891	Lactobacillus plantarum strain LMT1-48 plasmid p_3, complete sequence	3330-3359	1	0.967
NC_017017_1	1.1\|5387\|30\|NC_017017\|CRISPRCasFinder	5387-5416	30	NZ_CP031200	Lactobacillus brevis strain UCCLBBS449 plasmid pUCCLBBS449_B, complete sequence	39624-39653	1	0.967
NC_017017_1	1.1\|5387\|30\|NC_017017\|CRISPRCasFinder	5387-5416	30	NC_008498	Lactobacillus brevis ATCC 367 plasmid 1, complete sequence	8762-8791	1	0.967
NC_017017_1	1.1\|5387\|30\|NC_017017\|CRISPRCasFinder	5387-5416	30	NZ_CP014874	Lactobacillus backii strain TMW 1.1989 plasmid pL11989-1, complete sequence	6854-6883	2	0.933
NC_017017_1	1.1\|5387\|30\|NC_017017\|CRISPRCasFinder	5387-5416	30	NZ_CP027191	Lactobacillus sp. CBA3605 plasmid pCBA3605-1, complete sequence	29359-29388	2	0.933
NC_017017_1	1.1\|5387\|30\|NC_017017\|CRISPRCasFinder	5387-5416	30	NZ_CP027195	Lactobacillus sp. CBA3606 plasmid pCBA3606-1, complete sequence	30409-30438	2	0.933
NC_017017_1	1.1\|5387\|30\|NC_017017\|CRISPRCasFinder	5387-5416	30	NC_006529	Lactobacillus salivarius UCC118 plasmid pSF118-20, complete sequence	4742-4771	2	0.933
NC_017017_1	1.1\|5387\|30\|NC_017017\|CRISPRCasFinder	5387-5416	30	NC_015421	Lactobacillus buchneri NRRL B-30929 plasmid pLBUC03, complete sequence	1005-1034	2	0.933
NC_017017_1	1.1\|5387\|30\|NC_017017\|CRISPRCasFinder	5387-5416	30	NZ_CP014900	Lactobacillus backii strain TMW 1.2002 plasmid pL12002-1, complete sequence	28835-28864	2	0.933
NC_017017_1	1.1\|5387\|30\|NC_017017\|CRISPRCasFinder	5387-5416	30	NZ_CP014913	Lactobacillus paracollinoides strain TMW 1.1979 plasmid pL11979-1, complete sequence	22508-22537	3	0.9
NC_017017_1	1.1\|5387\|30\|NC_017017\|CRISPRCasFinder	5387-5416	30	NZ_CP019033	Lactobacillus fermentum strain SNUV175 plasmid pSNU175-4, complete sequence	21083-21112	3	0.9
NC_017017_1	1.1\|5387\|30\|NC_017017\|CRISPRCasFinder	5387-5416	30	NZ_CP017358	Lactobacillus plantarum strain TMW 1.25 plasmid pL125-4, complete sequence	4830-4859	3	0.9
NC_017017_1	1.1\|5387\|30\|NC_017017\|CRISPRCasFinder	5387-5416	30	NZ_CP017368	Lactobacillus plantarum strain TMW 1.277 plasmid pL1277-5, complete sequence	5770-5799	3	0.9
NC_017017_1	1.1\|5387\|30\|NC_017017\|CRISPRCasFinder	5387-5416	30	NZ_CP017265	Lactobacillus paracasei strain FAM18149 plasmid pFAM18149.24, complete sequence	26504-26533	3	0.9
NC_017017_1	1.1\|5387\|30\|NC_017017\|CRISPRCasFinder	5387-5416	30	NZ_CP019982	Pediococcus inopinatus strain DSM 20285 plasmid pLDW-12, complete sequence	10405-10434	3	0.9
NC_017017_1	1.1\|5387\|30\|NC_017017\|CRISPRCasFinder	5387-5416	30	NZ_CP019982	Pediococcus inopinatus strain DSM 20285 plasmid pLDW-12, complete sequence	86924-86953	3	0.9
NC_017017_1	1.1\|5387\|30\|NC_017017\|CRISPRCasFinder	5387-5416	30	NZ_CP017960	Lactobacillus plantarum strain C410L1 plasmid unnamed6, complete sequence	6891-6920	3	0.9
NC_017017_1	1.1\|5387\|30\|NC_017017\|CRISPRCasFinder	5387-5416	30	NZ_CP017960	Lactobacillus plantarum strain C410L1 plasmid unnamed6, complete sequence	20910-20939	3	0.9
NC_017017_1	1.1\|5387\|30\|NC_017017\|CRISPRCasFinder	5387-5416	30	NZ_CP014934	Pediococcus claussenii strain TMW 2.53 plasmid pL253-1, complete sequence	5933-5962	3	0.9
NC_017017_1	1.1\|5387\|30\|NC_017017\|CRISPRCasFinder	5387-5416	30	NZ_CP014937	Pediococcus claussenii strain TMW 2.54 plasmid pL254-1, complete sequence	5934-5963	3	0.9
NC_017017_1	1.1\|5387\|30\|NC_017017\|CRISPRCasFinder	5387-5416	30	MK994179	Lactobacillus plantarum strain PC518 plasmid plp75TA, complete sequence	4885-4914	3	0.9
NC_017017_1	1.1\|5387\|30\|NC_017017\|CRISPRCasFinder	5387-5416	30	NZ_CP011537	Lactobacillus fermentum 3872 plasmid pLF3872, complete sequence	7181-7210	3	0.9
NC_017017_1	1.1\|5387\|30\|NC_017017\|CRISPRCasFinder	5387-5416	30	NZ_AP014682	Lactobacillus hokkaidonensis JCM 18461 strain LOOC260 plasmid pLOOC260-2, complete sequence	515-544	5	0.833
NC_017017_1	1.1\|5387\|30\|NC_017017\|CRISPRCasFinder	5387-5416	30	MN034684	Leviviridae sp. isolate H1_Rhizo_27_scaffold_801 RNA-dependent RNA polymerase (H1Rhizo27801_000001), hypothetical protein (H1Rhizo27801_000002), and hypothetical protein (H1Rhizo27801_000003) genes, complete cds	2054-2083	8	0.733

1. spacer 1.1|5387|30|NC_017017|CRISPRCasFinder matches to NC_017017 (Pediococcus claussenii ATCC BAA-344 plasmid pPECL-6, complete sequence) position: , mismatch: 0, identity: 1.0

gcggggtgtcgtcaacgaactttcgcgaac	CRISPR spacer
gcggggtgtcgtcaacgaactttcgcgaac	Protospacer
******************************

2. spacer 1.1|5387|30|NC_017017|CRISPRCasFinder matches to NZ_CP014928 (Lactobacillus paracollinoides strain TMW 1.1995 plasmid pL11995-4, complete sequence) position: , mismatch: 0, identity: 1.0

gcggggtgtcgtcaacgaactttcgcgaac	CRISPR spacer
gcggggtgtcgtcaacgaactttcgcgaac	Protospacer
******************************

3. spacer 1.1|5387|30|NC_017017|CRISPRCasFinder matches to NZ_CP047125 (Lactobacillus hilgardii strain FLUB plasmid unnamed4) position: , mismatch: 0, identity: 1.0

gcggggtgtcgtcaacgaactttcgcgaac	CRISPR spacer
gcggggtgtcgtcaacgaactttcgcgaac	Protospacer
******************************

4. spacer 1.1|5387|30|NC_017017|CRISPRCasFinder matches to NZ_CP014920 (Lactobacillus paracollinoides strain TMW 1.1994 plasmid pL11994-5, complete sequence) position: , mismatch: 1, identity: 0.967

gcggggtgtcgtcaacgaactttcgcgaac	CRISPR spacer
gcggggtgtcgtcaacgaactttcgcgaat	Protospacer
*****************************.

5. spacer 1.1|5387|30|NC_017017|CRISPRCasFinder matches to NC_017468 (Lactobacillus helveticus H10 plasmid pH10, complete sequence) position: , mismatch: 1, identity: 0.967

gcggggtgtcgtcaacgaactttcgcgaac	CRISPR spacer
gcggggtgtcgtcaacgaactttcgcgaag	Protospacer
*****************************

6. spacer 1.1|5387|30|NC_017017|CRISPRCasFinder matches to NZ_CP033891 (Lactobacillus plantarum strain LMT1-48 plasmid p_3, complete sequence) position: , mismatch: 1, identity: 0.967

gcggggtgtcgtcaacgaactttcgcgaac	CRISPR spacer
gcggggtgtcgtcaacgaactttcgcgaag	Protospacer
*****************************

7. spacer 1.1|5387|30|NC_017017|CRISPRCasFinder matches to NZ_CP031200 (Lactobacillus brevis strain UCCLBBS449 plasmid pUCCLBBS449_B, complete sequence) position: , mismatch: 1, identity: 0.967

gcggggtgtcgtcaacgaactttcgcgaac	CRISPR spacer
gcggggtgtcgtcaacgaactttcgcgaat	Protospacer
*****************************.

8. spacer 1.1|5387|30|NC_017017|CRISPRCasFinder matches to NC_008498 (Lactobacillus brevis ATCC 367 plasmid 1, complete sequence) position: , mismatch: 1, identity: 0.967

gcggggtgtcgtcaacgaactttcgcgaac	CRISPR spacer
gtggggtgtcgtcaacgaactttcgcgaac	Protospacer
*.****************************

9. spacer 1.1|5387|30|NC_017017|CRISPRCasFinder matches to NZ_CP014874 (Lactobacillus backii strain TMW 1.1989 plasmid pL11989-1, complete sequence) position: , mismatch: 2, identity: 0.933

gcggggtgtcgtcaacgaactttcgcgaac	CRISPR spacer
gcggggtgttgtcaacgaactttcgcgaat	Protospacer
*********.*******************.

10. spacer 1.1|5387|30|NC_017017|CRISPRCasFinder matches to NZ_CP027191 (Lactobacillus sp. CBA3605 plasmid pCBA3605-1, complete sequence) position: , mismatch: 2, identity: 0.933

gcggggtgtcgtcaacgaactttcgcgaac	CRISPR spacer
gcggggtgttgtcaacgaactttcgcgaat	Protospacer
*********.*******************.

11. spacer 1.1|5387|30|NC_017017|CRISPRCasFinder matches to NZ_CP027195 (Lactobacillus sp. CBA3606 plasmid pCBA3606-1, complete sequence) position: , mismatch: 2, identity: 0.933

gcggggtgtcgtcaacgaactttcgcgaac	CRISPR spacer
gcggggtgttgtcaacgaactttcgcgaat	Protospacer
*********.*******************.

12. spacer 1.1|5387|30|NC_017017|CRISPRCasFinder matches to NC_006529 (Lactobacillus salivarius UCC118 plasmid pSF118-20, complete sequence) position: , mismatch: 2, identity: 0.933

gcggggtgtcgtcaacgaactttcgcgaac	CRISPR spacer
gcggggtgtcgtcaacggactttcgcgaag	Protospacer
*****************.***********

13. spacer 1.1|5387|30|NC_017017|CRISPRCasFinder matches to NC_015421 (Lactobacillus buchneri NRRL B-30929 plasmid pLBUC03, complete sequence) position: , mismatch: 2, identity: 0.933

gcggggtgtcgtcaacgaactttcgcgaac	CRISPR spacer
gcgggttgtcgtcaacgaactttcgcgaat	Protospacer
***** ***********************.

14. spacer 1.1|5387|30|NC_017017|CRISPRCasFinder matches to NZ_CP014900 (Lactobacillus backii strain TMW 1.2002 plasmid pL12002-1, complete sequence) position: , mismatch: 2, identity: 0.933

gcggggtgtcgtcaacgaactttcgcgaac	CRISPR spacer
gcggggtgttgtcaacgaactttcgcgaat	Protospacer
*********.*******************.

15. spacer 1.1|5387|30|NC_017017|CRISPRCasFinder matches to NZ_CP014913 (Lactobacillus paracollinoides strain TMW 1.1979 plasmid pL11979-1, complete sequence) position: , mismatch: 3, identity: 0.9

gcggggtgtcgtcaacgaactttcgcgaac	CRISPR spacer
gcggggtgtcatcaacggactttcgcgaag	Protospacer
**********.******.***********

16. spacer 1.1|5387|30|NC_017017|CRISPRCasFinder matches to NZ_CP019033 (Lactobacillus fermentum strain SNUV175 plasmid pSNU175-4, complete sequence) position: , mismatch: 3, identity: 0.9

gcggggtgtcgtcaacgaactttcgcgaac	CRISPR spacer
gcggagtgtcgtcaacggactttcgcgaag	Protospacer
****.************.***********

17. spacer 1.1|5387|30|NC_017017|CRISPRCasFinder matches to NZ_CP017358 (Lactobacillus plantarum strain TMW 1.25 plasmid pL125-4, complete sequence) position: , mismatch: 3, identity: 0.9

gcggggtgtcgtcaacgaactttcgcgaac	CRISPR spacer
gcggggtgtcatcaacggactttcgcgaag	Protospacer
**********.******.***********

18. spacer 1.1|5387|30|NC_017017|CRISPRCasFinder matches to NZ_CP017368 (Lactobacillus plantarum strain TMW 1.277 plasmid pL1277-5, complete sequence) position: , mismatch: 3, identity: 0.9

gcggggtgtcgtcaacgaactttcgcgaac	CRISPR spacer
gcggggtgtcatcaacggactttcgcgaag	Protospacer
**********.******.***********

19. spacer 1.1|5387|30|NC_017017|CRISPRCasFinder matches to NZ_CP017265 (Lactobacillus paracasei strain FAM18149 plasmid pFAM18149.24, complete sequence) position: , mismatch: 3, identity: 0.9

gcggggtgtcgtcaacgaactttcgcgaac	CRISPR spacer
gcggggtgtcatcaacggactttcgcgaag	Protospacer
**********.******.***********

20. spacer 1.1|5387|30|NC_017017|CRISPRCasFinder matches to NZ_CP019982 (Pediococcus inopinatus strain DSM 20285 plasmid pLDW-12, complete sequence) position: , mismatch: 3, identity: 0.9

gcggggtgtcgtcaacgaactttcgcgaac	CRISPR spacer
gcggagtgttgtcaacgaactttcgcgaat	Protospacer
****.****.*******************.

21. spacer 1.1|5387|30|NC_017017|CRISPRCasFinder matches to NZ_CP019982 (Pediococcus inopinatus strain DSM 20285 plasmid pLDW-12, complete sequence) position: , mismatch: 3, identity: 0.9

gcggggtgtcgtcaacgaactttcgcgaac	CRISPR spacer
gcggagtgttgtcaacgaactttcgcgaat	Protospacer
****.****.*******************.

22. spacer 1.1|5387|30|NC_017017|CRISPRCasFinder matches to NZ_CP017960 (Lactobacillus plantarum strain C410L1 plasmid unnamed6, complete sequence) position: , mismatch: 3, identity: 0.9

gcggggtgtcgtcaacgaactttcgcgaac	CRISPR spacer
gcggggtgtcatcaacggactttcgcgaag	Protospacer
**********.******.***********

23. spacer 1.1|5387|30|NC_017017|CRISPRCasFinder matches to NZ_CP017960 (Lactobacillus plantarum strain C410L1 plasmid unnamed6, complete sequence) position: , mismatch: 3, identity: 0.9

gcggggtgtcgtcaacgaactttcgcgaac	CRISPR spacer
gcggggtgtcatcaacggactttcgcgaag	Protospacer
**********.******.***********

24. spacer 1.1|5387|30|NC_017017|CRISPRCasFinder matches to NZ_CP014934 (Pediococcus claussenii strain TMW 2.53 plasmid pL253-1, complete sequence) position: , mismatch: 3, identity: 0.9

gcggggtgtcgtcaacgaactttcgcgaac	CRISPR spacer
gcggggtgtcatcaacggactttcgcgaag	Protospacer
**********.******.***********

25. spacer 1.1|5387|30|NC_017017|CRISPRCasFinder matches to NZ_CP014937 (Pediococcus claussenii strain TMW 2.54 plasmid pL254-1, complete sequence) position: , mismatch: 3, identity: 0.9

gcggggtgtcgtcaacgaactttcgcgaac	CRISPR spacer
gcggggtgtcatcaacggactttcgcgaag	Protospacer
**********.******.***********

26. spacer 1.1|5387|30|NC_017017|CRISPRCasFinder matches to MK994179 (Lactobacillus plantarum strain PC518 plasmid plp75TA, complete sequence) position: , mismatch: 3, identity: 0.9

gcggggtgtcgtcaacgaactttcgcgaac	CRISPR spacer
gcggggtgtcatcaacggactttcgcgaag	Protospacer
**********.******.***********

27. spacer 1.1|5387|30|NC_017017|CRISPRCasFinder matches to NZ_CP011537 (Lactobacillus fermentum 3872 plasmid pLF3872, complete sequence) position: , mismatch: 3, identity: 0.9

gcggggtgtcgtcaacgaactttcgcgaac	CRISPR spacer
gcggagtgtcgtcaacggactttcgcgaag	Protospacer
****.************.***********

28. spacer 1.1|5387|30|NC_017017|CRISPRCasFinder matches to NZ_AP014682 (Lactobacillus hokkaidonensis JCM 18461 strain LOOC260 plasmid pLOOC260-2, complete sequence) position: , mismatch: 5, identity: 0.833

gcggggtgtcgtcaacgaactttcgcgaac	CRISPR spacer
gaggggtgtcgtcaacgaacttatgcggaa	Protospacer
* ******************** .***.*

29. spacer 1.1|5387|30|NC_017017|CRISPRCasFinder matches to MN034684 (Leviviridae sp. isolate H1_Rhizo_27_scaffold_801 RNA-dependent RNA polymerase (H1Rhizo27801_000001), hypothetical protein (H1Rhizo27801_000002), and hypothetical protein (H1Rhizo27801_000003) genes, complete cds) position: , mismatch: 8, identity: 0.733

gcggggtgtcgtcaacgaactttcgcgaac	CRISPR spacer
cgctggtgtcgtcaacgaacattcgctact	Protospacer
    **************** ***** * .

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NC_017018

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 7611

Lactococcus_phage(33.33%)

transposase,integrase

attL 876:887|attR 3703:3714

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014386884.1\|0_574_-\|transposase	IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	6.0e-24	31.4
WP_014386885.1\|647_1385_-	ATP-binding protein	A0A059NT77	Lactococcus_phage	2.1e-58	50.0
876:887	attL	NA	NA	NA	NA
WP_003555353.1\|1394_2618_-\|transposase	IS21 family transposase	A0A059NT83	Lactococcus_phage	1.9e-107	51.7
WP_014386886.1\|2697_3273_-\|integrase	site-specific integrase	D2XR58	Bacillus_phage	7.3e-22	34.3
WP_003586674.1\|3349_3628_+	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_002834562.1\|3627_3984_+	type II toxin-antitoxin system YafQ family toxin	NA	NA	NA	NA
3703:3714	attR	NA	NA	NA	NA
WP_014386887.1\|4087_5341_+	MFS transporter	A0A1B0RXG2	Streptococcus_phage	1.2e-56	33.5
WP_014386888.1\|5415_7611_-	copper-translocating P-type ATPase	A0A218MNH6	uncultured_virus	1.5e-59	30.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NC_016605

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

524840 : 532540

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_081478597.1\|524840_525923_+	peptide chain release factor 2	B5LLF2	Mycobacterium_phage	8.2e-06	43.2
WP_014215020.1\|525934_526633_+	response regulator transcription factor	W8CYM9	Bacillus_phage	2.1e-39	38.8
WP_014215021.1\|526613_527996_+	two-component sensor histidine kinase	W8CYF6	Bacillus_phage	2.1e-22	29.8
WP_014215022.1\|528263_529142_+	phosphate ABC transporter substrate-binding protein PstS family protein	H6WG65	Cyanophage	4.9e-09	30.4
WP_014215023.1\|529148_530069_+	phosphate ABC transporter permease subunit PstC	NA	NA	NA	NA
WP_014215024.1\|530065_530953_+	phosphate ABC transporter permease PstA	NA	NA	NA	NA
WP_014215025.1\|530966_531767_+	phosphate ABC transporter ATP-binding protein	M1IC18	Acanthocystis_turfacea_Chlorella_virus	2.4e-07	31.8
WP_014215026.1\|531784_532540_+	phosphate ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.6e-16	29.1

DBSCAN-SWA_2

572639 : 603409

Lactobacillus_phage(17.65%)

portal,terminase,capsid,head,tRNA,integrase

attL 590596:590616|attR 604401:604421

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014215062.1\|572639_573110_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE	NA	NA	NA	NA
WP_014215063.1\|573102_573594_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_014215064.1\|573586_574123_-	exonuclease	M1PFD8	Streptococcus_phage	3.9e-25	43.3
WP_014215065.1\|574200_575112_+	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_014215066.1\|575144_576044_+	UDP-N-acetylmuramate dehydrogenase	NA	NA	NA	NA
WP_014215067.1\|576288_577140_+	TIGR00159 family protein	NA	NA	NA	NA
WP_014215068.1\|577136_577934_+	hypothetical protein	NA	NA	NA	NA
WP_014215069.1\|577962_579324_+	phosphoglucosamine mutase	A0A127AWJ1	Bacillus_phage	8.1e-19	27.4
WP_014215070.1\|579532_581347_+	glutamine--fructose-6-phosphate transaminase (isomerizing)	A7IW18	Paramecium_bursaria_Chlorella_virus	1.2e-94	36.8
WP_014215071.1\|581606_581921_+	hypothetical protein	NA	NA	NA	NA
WP_014215072.1\|581998_582379_+	hypothetical protein	NA	NA	NA	NA
WP_148265539.1\|582561_582906_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_014215074.1\|582917_584594_+	oleate hydratase	NA	NA	NA	NA
WP_050899559.1\|584725_585559_-	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_041534573.1\|585887_587084_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	2.8e-15	33.3
WP_014215077.1\|587067_587832_+	EAL domain-containing protein	NA	NA	NA	NA
WP_041534574.1\|587898_588849_+	2-hydroxyacid dehydrogenase	M1H9J0	Paramecium_bursaria_Chlorella_virus	3.8e-31	33.1
WP_014215079.1\|589004_589817_-	LicD family protein	A0A1V0SD50	Indivirus	1.5e-07	39.2
WP_014215080.1\|589946_590096_+	hypothetical protein	NA	NA	NA	NA
590596:590616	attL	NA	NA	NA	NA
WP_014215081.1\|590633_591785_-\|integrase	site-specific integrase	A0A097PAS9	Streptococcus_pyogenes_phage	1.3e-54	36.9
WP_014215082.1\|591984_592803_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_014215083.1\|593145_593415_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_041534576.1\|593654_593891_+	hypothetical protein	NA	NA	NA	NA
WP_041534577.1\|593880_594723_+	bifunctional DNA primase/polymerase	A0A1P8BMS4	Lactococcus_phage	2.8e-09	26.3
WP_050899561.1\|594679_596242_+	hypothetical protein	V5US55	Enterococcus_phage	6.9e-30	30.5
WP_014215086.1\|596755_597118_+	phage transcriptional regulator, ArpU family protein	D6PSV8	Lactobacillus_phage	7.6e-09	34.6
WP_014215087.1\|597133_597343_+	hypothetical protein	D7RWL9	Brochothrix_phage	6.6e-05	43.1
WP_041534578.1\|597332_597545_+	hypothetical protein	NA	NA	NA	NA
WP_041534579.1\|597544_597889_+\|head	phage head closure protein	A0A2P0ZLF0	Lactobacillus_phage	3.1e-07	29.4
WP_014215090.1\|597888_598266_+	HNH endonuclease	A0A1J0MFT4	Staphylococcus_phage	4.4e-15	38.5
WP_014215091.1\|598491_598926_+\|terminase	phage terminase small subunit P27 family	A0A2H4JH50	uncultured_Caudovirales_phage	9.5e-06	28.3
WP_014215092.1\|598922_600632_+\|terminase	terminase large subunit	E9LUI0	Lactobacillus_phage	4.7e-117	41.1
WP_014215094.1\|600786_601923_+\|portal	phage portal protein	A0A2H4J8V4	uncultured_Caudovirales_phage	2.8e-49	35.9
WP_014215095.1\|601897_603409_+\|capsid	phage major capsid protein	A0A060AI54	Enterococcus_phage	9.6e-37	35.2
604401:604421	attR	NA	NA	NA	NA

DBSCAN-SWA_3

910171 : 922216

Staphylococcus_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014215377.1\|910171_910648_+	nucleoside 2-deoxyribosyltransferase	A0A1G5S9Z4	Enterococcus_phage	2.9e-16	38.2
WP_014215378.1\|910728_911607_-	YitT family protein	M1Q1P6	Streptococcus_phage	3.3e-58	41.4
WP_041534608.1\|911718_912921_+\|tRNA	CCA tRNA nucleotidyltransferase	H7BUW3	unidentified_phage	8.1e-47	34.6
WP_014215380.1\|912922_914797_+	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	5.3e-53	30.4
WP_014215381.1\|914809_915760_+	thymidylate synthase	A0A0N9SH48	Staphylococcus_phage	3.2e-115	60.8
WP_014215382.1\|915772_916255_+	dihydrofolate reductase	A0A0N9S8H6	Staphylococcus_phage	2.5e-23	38.8
WP_014215383.1\|916327_917173_+	DegV family protein	A0A0N9SI50	Staphylococcus_phage	9.8e-15	32.8
WP_014215384.1\|917241_917463_+	YozE family protein	NA	NA	NA	NA
WP_014215385.1\|917468_918881_+	S41 family peptidase	A0A0R6PIZ1	Moraxella_phage	9.0e-21	30.3
WP_014215386.1\|919051_919954_+	lipase/acylhydrolase	NA	NA	NA	NA
WP_014215387.1\|919956_920568_+	YpmS family protein	NA	NA	NA	NA
WP_014215388.1\|920610_921477_+	ribosome biogenesis GTPase YlqF	NA	NA	NA	NA
WP_014215389.1\|921457_922216_+	ribonuclease HII	V5LS49	Emiliania_huxleyi_virus	9.4e-25	39.2

DBSCAN-SWA_4

1579607 : 1587708

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014216054.1\|1579607_1580939_+	NAD(P)/FAD-dependent oxidoreductase	A0A2K5B2C5	Erysipelothrix_phage	1.3e-26	25.4
WP_014216055.1\|1580995_1581328_-	AzlD domain-containing protein	NA	NA	NA	NA
WP_014216056.1\|1581347_1582133_-	AzlC family ABC transporter permease	NA	NA	NA	NA
WP_014216057.1\|1582252_1583554_-	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	7.8e-11	27.8
WP_014216058.1\|1583700_1584825_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	8.4e-30	29.7
WP_014216059.1\|1585072_1585762_-	response regulator transcription factor	W8CYM9	Bacillus_phage	8.2e-36	36.9
WP_014216060.1\|1585847_1586345_-	methylated-DNA--[protein]-cysteine S-methyltransferase	H2EF51	Moumouvirus	1.2e-15	34.0
WP_014216061.1\|1586565_1587708_-	IMP dehydrogenase	A0A1V0SHK8	Klosneuvirus	3.1e-64	34.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_017017

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NC_017018

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NC_016605

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection