CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number
NC_016779	Bacillus cereus F837/76, complete sequence	7 crisprs	cas3,csa3,WYL,cas14k,DinG,cas14j,DEDDh,RT,c2c9_V-U4	36	29	5
NC_016794	Bacillus cereus F837/76 plasmid pF837_55, complete sequence	0 crisprs	NA	0	0	2
NC_016780	Bacillus cereus F837/76 plasmid pF837_10, complete sequence	0 crisprs	NA	0	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_016779_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_016779_1

1153903-1154011

Orphan

Consensus_repeat	Method
TGTATGATTACCTTCCGCATGAGAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_016779_1

>merge|NC_016779|1|1153903-1154011|CRISPRCasFinder
TGTATGATTACCTTCCGCATGAGAAGAGAATCCGTTAGCGATAGTCGCGGTTCCTTCTGCATGTGCTGCTTCGCCTAAAGCGATTGTATGTTTACCTTCCGCATGAGAA

>NC_016779|1|1|1153903-1154011|CRISPRCasFinder
TGTATGATTACCTTCCGCATGAGAA	GAGAATCCGTTAGCGATAGTCGCGGTTCCTTCTGCATGTGCTGCTTCGCCTAAAGCGAT
TGTATGTTTACCTTCCGCATGAGAA

Protein	Signature genes	Signature genes Name	Protein_function
NC_016779.1\|WP_001180009.1\|1150440_1150812_+\|hypothetical-protein	unknown	unknown	unknown
NC_016779.1\|WP_000612274.1\|1144599_1145844_+\|competence-protein	unknown	unknown	gnl\|CDD\|226875
NC_016779.1\|WP_000191105.1\|1149715_1150294_-\|CYTH-domain-containing-protein	unknown	unknown	gnl\|CDD\|143627
NC_016779.1\|WP_000673194.1\|1151499_1152297_+\|NAD-kinase	unknown	unknown	gnl\|CDD\|235317
NC_016779.1\|WP_000651527.1\|1163511_1164192_+\|streptomycin-biosynthesis-protein-StrF	unknown	unknown	gnl\|CDD\|379345
NC_016779.1\|WP_001292832.1\|1157818_1158571_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|379312
NC_016779.1\|WP_001994556.1\|1156878_1157805_-\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|366154
NC_016779.1\|WP_000069734.1\|1159753_1160650_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|375999
NC_016779.1\|WP_001079116.1\|1152312_1153206_+\|RluA-family-pseudouridine-synthase	unknown	unknown	gnl\|CDD\|223638
NC_016779.1\|WP_000003393.1\|1145894_1147721_+\|oligoendopeptidase-F	unknown	unknown	gnl\|CDD\|341071
NC_016779.1\|WP_000043381.1\|1149136_1149535_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|381281
NC_016779.1\|WP_001078427.1\|1162124_1162814_+\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|369778
NC_016779.1\|WP_001081482.1\|1150842_1151481_+\|GTP-pyrophosphokinase-family-protein	unknown	unknown	gnl\|CDD\|225232
NC_016779.1\|WP_000654717.1\|1155599_1156760_-\|rod-shape-determining-protein-RodA	unknown	unknown	gnl\|CDD\|274033
NC_016779.1\|WP_000872717.1\|1154784_1155525_-\|bis(5'-nucleosyl)-tetraphosphatase-PrpE	unknown	unknown	gnl\|CDD\|184187
NC_016779.1\|WP_000444380.1\|1158785_1159631_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|377550
NC_016779.1\|WP_002051510.1\|1147840_1148014_-\|hypothetical-protein	unknown	unknown	unknown
NC_016779.1\|WP_000932918.1\|1160815_1161913_+\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|133005
NC_016779.1\|WP_000360638.1\|1148243_1149137_-\|DsbA-family-protein	unknown	unknown	gnl\|CDD\|372699
NC_016779.1\|WP_001271183.1\|1162810_1163497_+\|streptomycin-biosynthesis-protein-StrF	unknown	unknown	gnl\|CDD\|379345

Protein	Function_ID	Function_description	E-value
NC_016779.1\|WP_000612274.1\|1144599_1145844_+\|competence-protein	gnl\|CDD\|226875	COG4469, CoiA, Competence protein CoiA-like family, contains a predicted nuclease domain [General function prediction only].	2.34429e-57
NC_016779.1\|WP_000191105.1\|1149715_1150294_-\|CYTH-domain-containing-protein	gnl\|CDD\|143627	cd07762, CYTH-like_Pase_1, Uncharacterized subgroup 1 of the CYTH-like superfamily. Enzymes belonging to the CYTH-like (also known as triphosphate tunnel metalloenzyme (TTM)-like) superfamily hydrolyze triphosphate-containing substrates, require metal cations as cofactors, and have a unique active site located at the center of an eight-stranded antiparallel beta barrel tunnel (the triphosphate tunnel). The name CYTH originated from the gene designation for bacterial class IV adenylyl cyclases (CyaB) and from thiamine triphosphatase. Class IV adenylate cyclases catalyze the conversion of ATP to 3',5'-cyclic AMP (cAMP) and PPi. Thiamine triphosphatase is a soluble cytosolic enzyme which converts thiamine triphosphate to thiamine diphosphate. This domain superfamily also contains RNA triphosphatases, membrane-associated polyphosphate polymerases, tripolyphosphatases, nucleoside triphosphatases, nucleoside tetraphosphatases and other proteins with unknown functions. Proteins of this subgroup are of bacterial origin and have not been characterized.	1.94434e-83
NC_016779.1\|WP_000673194.1\|1151499_1152297_+\|NAD-kinase	gnl\|CDD\|235317	PRK04885, ppnK, inorganic polyphosphate/ATP-NAD kinase; Provisional.	0
NC_016779.1\|WP_000651527.1\|1163511_1164192_+\|streptomycin-biosynthesis-protein-StrF	gnl\|CDD\|379345	pfam13712, Glyco_tranf_2_5, Glycosyltransferase like family. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.	7.1131e-109
NC_016779.1\|WP_001292832.1\|1157818_1158571_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	7.79414e-19
NC_016779.1\|WP_001994556.1\|1156878_1157805_-\|glycosyltransferase-family-2-protein	gnl\|CDD\|366154	pfam00535, Glycos_transf_2, Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.	1.2498e-25
NC_016779.1\|WP_000069734.1\|1159753_1160650_-\|hypothetical-protein	gnl\|CDD\|375999	pfam18573, BclA_C, BclA C-terminal domain. This is the C-terminal domain of BclA (Bacillus collagen-like protein of anthracis) which is expressed on spores of Bacillus species. Trimers of the C-terminal domain (CTD) form the tips of the spore's hair-like nap and are the immunodominant target of vertebrate antibodies and drive trimerization. Structure analysis indicate the C-terminal region of the peptide folding into an all-beta structure with a jelly-fold topology, similar to the first human complement C1q, a member of the tumor necrosis factor (TNF)-like family. The C-terminal globular domain has been shown to be located on the exterior of the exosporium, and therefore is critical in determining the immunogenicity of the spore in a mammalian host.	2.71524e-18
NC_016779.1\|WP_000654717.1\|1155599_1156760_-\|rod-shape-determining-protein-RodA	gnl\|CDD\|274033	TIGR02210, Rod_shape-determining_protein_RodA, rod shape-determining protein RodA. This protein is a member of the FtsW/RodA/SpoVE family (pfam01098). It is found only in species with rod (or spiral) shapes. In many species, mutation of rodA has been shown to correlate with loss of the normal rod shape. Note that RodA homologs are found, scoring below the cutoffs for this model, in a number of both rod-shaped and coccoid bacteria, including four proteins in Bacillus anthracis, for example. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan, Cellular processes, Cell division].	1.52178e-99
NC_016779.1\|WP_000003393.1\|1145894_1147721_+\|oligoendopeptidase-F	gnl\|CDD\|341071	cd09608, M3B_PepF, Peptidase family M3B, oligopeptidase F (PepF). Peptidase family M3B oligopeptidase F (PepF; Pz-peptidase B; EC 3.4.24.-) is mostly bacterial and includes oligoendopeptidase F from Lactococcus lactis. This enzyme hydrolyzes peptides containing between 7 and 17 amino acids with fairly broad specificity. The PepF gene is duplicated in L. lactis on the plasmid that bears it, while a shortened second copy is found in Bacillus subtilis. Most bacterial PepFs are cytoplasmic endopeptidases; however, the Bacillus amyloliquefaciens PepF oligopeptidase is a secreted protein and may facilitate the process of sporulation. Specifically, the yjbG gene encoding the homolog of the PepF1 and PepF2 oligoendopeptidases of Lactococcus lactis has been identified in Bacillus subtilis as an inhibitor of sporulation initiation when over-expressed from a multicopy plasmid. This PepF family includes Streptococcus agalactiae PepB, a group B streptococcal oligopeptidase which has been shown to degrade a variety of bioactive peptides as well as the synthetic collagen-like substrate N-(3-[2-furyl]acryloyl)-Leu-Gly- Pro-Ala in vitro.	0
NC_016779.1\|WP_000043381.1\|1149136_1149535_-\|hypothetical-protein	gnl\|CDD\|381281	cd14772, TrHb2_Bs-trHb-like_O, Truncated hemoglobins, group 2 (O); Bacillus subtilis TrHb like. The M- and S families exhibit the canonical secondary structure of hemoglobins, a 3-over-3 alpha-helical sandwich structure (3/3 Mb-fold), built by eight alpha-helical segments. Truncated hemoglobins (TrHbs, 2/2Hb, or 2/2 globins) or the T family globins adopt a 2-on-2 alpha-helical sandwich structure, resulting from extensive and complex modifications of the canonical 3-on-3 alpha-helical sandwich that are distributed throughout the whole protein molecule. TrHbs are classified into three main groups based on their structural properties and named after Mycobacterium sp. genes glbN, glbO, and glbP: TrHb1s (N), TrHb2s (O) and TrHb3s (P). TrHb2's belonging to this group include monomeric Bacillus subtilis trHb (Bs-trHb), which exhibits an extremely high oxygen affinity, and a dimeric TrHb2 from the thermophilic aerobic spore forming bacterium Geobacillus stearothermophilus(Gs-trHb).	1.17037e-69
NC_016779.1\|WP_001078427.1\|1162124_1162814_+\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|369778	pfam08242, Methyltransf_12, Methyltransferase domain. Members of this family are SAM dependent methyltransferases.	3.57676e-18
NC_016779.1\|WP_001081482.1\|1150842_1151481_+\|GTP-pyrophosphokinase-family-protein	gnl\|CDD\|225232	COG2357, COG2357, PpGpp synthetase catalytic domain [General function prediction only].	1.66713e-95
NC_016779.1\|WP_001079116.1\|1152312_1153206_+\|RluA-family-pseudouridine-synthase	gnl\|CDD\|223638	COG0564, RluA, Pseudouridylate synthases, 23S RNA-specific [Translation, ribosomal structure and biogenesis].	3.88119e-102
NC_016779.1\|WP_000872717.1\|1154784_1155525_-\|bis(5'-nucleosyl)-tetraphosphatase-PrpE	gnl\|CDD\|184187	PRK13625, PRK13625, bis(5'-nucleosyl)-tetraphosphatase PrpE; Provisional.	0
NC_016779.1\|WP_000444380.1\|1158785_1159631_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|377550	pfam05711, TylF, Macrocin-O-methyltransferase (TylF). This family consists of bacterial macrocin O-methyltransferase (TylF) proteins. TylF is responsible for the methylation of macrocin to produce tylosin. Tylosin is a macrolide antibiotic used in veterinary medicine to treat infections caused by Gram-positive bacteria and as an animal growth promoter in the swine industry. It is produced by several Streptomyces species. As with other macrolides, the antibiotic activity of tylosin is due to the inhibition of protein biosynthesis by a mechanism that involves the binding of tylosin to the ribosome, preventing the formation of the mRNA-aminoacyl-tRNA-ribosome complex. The structure of one representative sequence from this family, NovP, shows it to be an S-adenosyl-l-methionine-dependent O-methyltransferase that catalyzes the penultimate step in the biosynthesis of the aminocoumarin antibiotic novobiocin. Specifically, it methylates at 4-OH of the noviose moiety, and the resultant methoxy group is important for the potency of the mature antibiotic. It is likely that the key structural features of NovP are common to the rest of the family and include: a helical 'lid' region that gates access to the co-substrate binding pocket and an active centre that contains a 3-Asp putative metal binding site. A further conserved Asp probably acts as the general base that initiates the reaction by de-protonating the 4-OH group of the noviose unit.	1.59865e-154
NC_016779.1\|WP_000932918.1\|1160815_1161913_+\|glycosyltransferase-family-2-protein	gnl\|CDD\|133005	cd02511, Beta4Glucosyltransferase, UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.	9.60011e-55
NC_016779.1\|WP_000360638.1\|1148243_1149137_-\|DsbA-family-protein	gnl\|CDD\|372699	pfam13743, Thioredoxin_5, Thioredoxin.	5.36453e-93
NC_016779.1\|WP_001271183.1\|1162810_1163497_+\|streptomycin-biosynthesis-protein-StrF	gnl\|CDD\|379345	pfam13712, Glyco_tranf_2_5, Glycosyltransferase like family. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.	4.25249e-108

>NC_016779.1|WP_001079116.1|1152312_1153206_+|RluA-family-pseudouridine-synthase
MNRFTLKWDIESAEEGTLVREFLKTKGISKAALTDIKFQGGAIEVNGQHASVRHQLQVGEELRIFFPVEERSEGMIAEDIPLCIVYEDDAVLVINKEANMSTIPSREHPSGSVANALLSHYDKQYLASTVHIVTRLDRDTSGLMLIAKNRFVHHLLSKQHQQKAVKRTYEAIVHGEMVEREGTIDAPIGRKSDSIIERTVCEEGQRAVTHFRVIDSANHKTHVSLELDTGRTHQIRVHMAHIGHPLLGDNLYGGKRDEMKRQALHSTSLTFYHPILEKEMSFTAMIPSDMQEVLRQT
>NC_016779.1|WP_000673194.1|1151499_1152297_+|NAD-kinase
MKFTIMSKGDQSSDTLASTMKEYLLDFGFIMDEQEPDIVISVGGDGTLLYAFHRYYNRLDETAFVGVHTGHLGFYADWLPTEVEKLVIAIAKTPFQVVEYPLLEVIIRYMNGSKESQYLAMNEATVKSAEGTLVTEVEIRGEYFETFRGDGLCISTPSGSTAYNKALGGAIIHPSIEAIQIAEMASINNRVFRTVGSPLVLPKHHTCVLKPTAGMNLQITVDHLTMVHQDVKSIQYRVANEKVRFVRFRPFPFWKRVRDSFVADK
>NC_016779.1|WP_001081482.1|1150842_1151481_+|GTP-pyrophosphokinase-family-protein
MNRNWEEFLAPYHQAVAELKVKLKGMRTQFAMLTEHSPIEFVTGRVKSVASIIDKAEKRNVPLDRLREDMQDIAGLRMMCQFVDEIKPVVEYLRKRNDFEIVEERDYVTQKKDSGYRSYHVVISYPVQTIQGEQKVLVEIQIRTLAMNFWATIEHSLNYKYSGRFPEDIKIRLQRAAEAAFLLDEEMSSIRLEIQEAQKAFSRKQETKDSES
>NC_016779.1|WP_001180009.1|1150440_1150812_+|hypothetical-protein
MQNKIQVKSVEKRENALIFCAENSEIEVKGLSARNHVLVDSDNLSFLYILENESSFIYVSIPHTCWEAMHEAMNNDVVMFVRVNDIEMELEGLKEEVEYLVENIEGNANYGEELVTAVEKVFL
>NC_016779.1|WP_000191105.1|1149715_1150294_-|CYTH-domain-containing-protein
MTQEIEIEFKNIVTEEEFHALCKSFSIEVFTKQVNHYFETPNFSLKEAGSALRIRHKGETYTLTLKQPAEVGLLETHQVVTENEAKMMMETNVIISGAVMNQLCKLQIPVSALTYMGSLTTERAETLFEGGTLVFDHSFYYNHDDYEIEFEVQDEETGKAAFIHLLKQHNIPIRHTNNKVKRFFLAKQNKAR
>NC_016779.1|WP_000043381.1|1149136_1149535_-|hypothetical-protein
MSKQPMTPFEAIGGEQCIAILVDTFYSYVSKHPDLSPIFPDDLTETARKQKQFLTQYLGGPNLYTEEHGHPMLRARHLPFEITPKRAEAWLSCMEQAMDDTGVHGHIREFVFERLALTAQHMVNTPNETGEI
>NC_016779.1|WP_000360638.1|1148243_1149137_-|DsbA-family-protein
MDKQEAKHINMPSPSACEHKSVEAYLFIDPLCKDCWEIEPFIIKLWLEYGKYFSIRHIVTGKVDGTNASSHKWNKPANIRFVWEKTTSLHGFSCDGKVHMQEASSTPYLVSMAIKAAELQGRKAGSKFLRKLQEYIFLENVSNPDCELLLACAKDSDIDVEEFKKDLYSASAKKAFQCDLKFTNEMHITEIPSLVFFHANSDEEGIKIAGTYSYDVYVQLLKELVKCEIEPEPLPPLEVLLEATQFISSKEVAFIYDCSKQEIERELKKLQLKRKVQMIDVKCERYWKWIAKEKDLV
>NC_016779.1|WP_002051510.1|1147840_1148014_-|hypothetical-protein
MKKTYILLIILAVIVSFFLYILSLLQAFPKIIAFPLLFGVIVIALSYFNHKKRFKGF
>NC_016779.1|WP_000003393.1|1145894_1147721_+|oligoendopeptidase-F
MSEQNTAKTLPDRNEIEESSTWRLEDIFQTDTEWEKEFQAIKELLPKLTEFKGKLGDSANNLLEALQYEDEISMRLGKLYTYAHMRYDQDTTNSVYQALNDRATNLYSQVSSSTAYIVPEILSISEDTLQTFLKENRDLSVYEHALEEITRQRPHVLSEAEEALLAEASEVMSASSNTFGMLNNADLKFPSIKGEDGEEVEITHGRYIQFLESDDRRVREDAFKAVYETYGKYKNTFASTLSGAVKRNNFNARVRKYDSARQAALSNNNIPEAVYDQLIESVNDNLHLLHRYIDIRKRALGLDELHMYDLYTPLVPEVKMNVKYEEAQDMLLKSLHVLGDEYVDILKEAYENRWVDVYENKGKRSGAYSSGAYGTNPYILMNWHDNVNNLFTLAHEFGHSVHSYYTRKTQPHVYGDYSIFVAEVASTCNEALLNDYLLKTTEDKKERLYLLNHYLEGFRGTVFRQTMFAEFEHIIHKKVQEGHAVTPDMLTEIYYDLNKKYFGDALVIDEEIGLEWSRIPHFYYNYYVYQYATGFSAATALSKQILEEGQPAVERYINEFLKAGSSDYPIEVLKKAGVDMASPEPVKEALQVFEEKLNELEALLFEEK
>NC_016779.1|WP_000612274.1|1144599_1145844_+|competence-protein
MIPIFIAKRENGEKIHLLDHHDEELLHHMRKRESFFCIACGKEVLMRLGKQKRWHFAHKKVDSCLAFYEAESTYHMYGKELLYRWFKRQNVHVEIEHYLPEIQQRPDIFIERAGRKIAIEYQCANLSIEQLCTRTYSYWQAGIQVIWIIGGNQLKKHSAYWMKFSSIMAFSLQSYPQPLLIFFCSKQKSFMKCTFITSFSTSIAFSHIIYLPIETTTFEMLFSPVPFQREVLNREWKRRKDYFRQNALPIWNYNHKSLLRLLYQCKCNPANFPSEIGVPLPSSFAFQTNLFIWQAFLYMKCIGELAVGDCISLKYVCSYIKKYTKRRMLPYFSQHIWKVAVTEYMTFLCYAGVLYKVGMYTYRKIRDAVPLKTGGEIMKHDEICLAHALSLFEAKFNMRGGKGDIIKTDREGIT
>NC_016779.1|WP_000872717.1|1154784_1155525_-|bis(5'-nucleosyl)-tetraphosphatase-PrpE
MKYDIIGDIHGCLQEFQNLTEKLGYNWSSGLPVHPDQRKLAFVGDITDRGPHSLRMIEIVWELVIHKKEAYYAPGNHCNKLYRFFLGRNVTVAHGLETTVAEYEALPSHKQNMIKEKFITLYEQSPLYHVLDEKRLLVCHAGIRQDYIGRQDKKVQTFVLYGDITGEKHADGSPVRRDWAKEYKGTAWIVYGHTPVKEPRFVNHTVNIDTGAVFGGRLTALRYPEMETVSVPSSLPFVPEKFRPIS
>NC_016779.1|WP_000654717.1|1155599_1156760_-|rod-shape-determining-protein-RodA
MKDPNSQYQIDYVLLFILFAIGTVSCFAIASAQVSLPPFLQNVNFVLKQIQWYFIGFIAIGIIMIIDFDRYQKIAWYLYSFALVLLIGLEFQVPGAITIKGATAWYRLPGIGNFQPSEIMKLFLIIVTGRIIANHNEKYFYRTIHDDFLLLGKICATSLPPLLLIAKEPDLGNTMVISAMLAAMILVSGIRWRFIFGLVSGIFATAVTLTYIFFTHTKFFKAHILQEYQLNRFYGWLAPYKYDAQGYQLRQAFLATGSGEMQGKGWENGQVYFPEPHTDFIFTNVAEQFGFLGASIIITLFFLLIFRMIHIALESNDPFGSYICAGTIGMFTFQVFQNIGMTIGLLPITGITLPLMSYGGSSLLTYMIAIGFVLNVRSRTKIFMFN
>NC_016779.1|WP_001994556.1|1156878_1157805_-|glycosyltransferase-family-2-protein
MTSEKDLPLVSILIPTYNRPHYFKIALESALAQTYSNIEIIIGDDSTNDETETLIHEQYLPHYKNVTYIRNTPPLGQFHNDLMLLEKSNGEYINFLMDDDVFYKHKIQKMMDYFEQDTNKALALVTSYRVRIDDHGDLIGDAHPTQRLYSEDTPLNGMFLGDWMLKEGHNIIGEPTTTLFRKELLTEPFGTLKERQYSCSVDMASWISLLSKGDAVYISEPLSQFRYHAGQQIHNKLLQGCEDFTHLVITAKEYGFLQNTTDYRTALLSAYKWCKSSLKYYLHQLDIFPDAHVRLSHCLVIIIKELNN
>NC_016779.1|WP_001292832.1|1157818_1158571_-|class-I-SAM-dependent-methyltransferase
MSELNKEITLLPPPELVQYVGGDFKEVGKEFLTHFIQIGALKSNEKVLDVGCGVGRMAVPLMNYLTDDGAYYGFDLFKDGITWCQNNIATIRNNFHFEHVDIYNQFYNPEGKEDASQYRFPYEDETFDFIFLTSVFTHLLPKELEHYLSEIVRVLKKDGRCFITFFLINPESSYYLNAGLSTLGFYHQIENCYVVNKDIPNFAVAYPETNIYSLLNKYGLEAINKPYYGLWCGRHEYTSYQDIVITKKRV
>NC_016779.1|WP_000444380.1|1158785_1159631_-|class-I-SAM-dependent-methyltransferase
MESKSAVQLYLELLKKTILFEIWLEYEAYLPASLHISKELEFEPVTVPLPLFIKQYAENHNLKIVKPNVSKSERHDGMDWPRAAHSMIGRERMNQLQEAMETVVRENIEGDFIETGVWRGGSCIFMNGFLQANNITDRNVWVADSFEGLPAPNLEQYPKDYGDYLHTFDYLRVSLEQVQENFKKYDLLNDQVKFLKGWFKDTLPTAPIEKIAIARLDGDMYESTMDGLVNLYDKVSKGGYIIIDDYGLPPCAEAVTDFRNHRNLKAPITKIDVFGVYWRKE
>NC_016779.1|WP_000069734.1|1159753_1160650_-|hypothetical-protein
MSNNNYSNGLNPDESLSASAFDPNLVGPTLPPIPPFTLPTGPTGPTGPTGPTGPTVPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGDTGTTGPTGPTGDTGATGPTGPTGPTGPTGDTGTTGPTGPTGDTGATGLTGPTGATGLTGPTGPTGPTGPSGLGLPAGLYAFNSGGISLDLGINDPVPFNTVGSQFGTAISQLDADTFVISETGFYKITVIVYTAAVSLLGGLTIQVNGIPVPGTGASLISLGAPIVIQAITQITTTPSLVEVIVTGLGLSLALGTSASIIIEKVA
>NC_016779.1|WP_000932918.1|1160815_1161913_+|glycosyltransferase-family-2-protein
MLNKQGITISLCMIVRDEEKTIARCLDSVEKIVDEIIVVDTGSIDRTKEIVEKYTSNIYDFQWIDDFAAARNFSFSKATQEYILWLDADDVLLEDAQEALKLLKREIDPKIDAVSMPYHLAMDSNGKPLYCTKRNRLVKREKQFQWFGKVHEYLAISGEVFSSNVAITHKKEKKVTDRNLKIFQNTVAAGEELSPRDLFYYANESTDNQKYDDAILLYETFLNQDEGWYEEKIYACGKLGDCYAKLGMWEKAIESCVKSFRYDVPRGENCTRIGYIYMEQEKYNEAIFWFKLATEVPMATESPFHSPASYTWLPYLQMCICYSRLGEQDKAYYYNELAASYVPNNAAIEYNRKYFRGVFDKPYKV
>NC_016779.1|WP_001078427.1|1162124_1162814_+|class-I-SAM-dependent-methyltransferase
MNREKSSLYEEKSEHYYNAANPNLLKHIKKEWKEVLDIGCSGGALGAAIKENGTRVSGIEAFPEAAEKAKERLDHVILGDIEKIDLPYEEGQFDCVIFGDVLEHLFDPWAVIEKVKPYIKQNGVILASIPNVAHISVLAPLLAGNWTYTEYGLLDKTHIRFFTFNEMLRMFLKAGYVISKVDRVYVDHKMYEPLIEELYGICKKYRLGSGFMAETVVFQYIIEAEKSQL
>NC_016779.1|WP_001271183.1|1162810_1163497_+|streptomycin-biosynthesis-protein-StrF
MSAADKTILFVTCINDRKLYANCVRHILQLLVPPGYIVQFMPIRNAKSMTSGYNQAISHPAKYKVYLHQDVFIINRAFLYGLLQLFEEHEHLGMIGMVGAQYVPPTGVWNEGRGIVGKVIGYMNDLFYMASLEQPYHESKTFIPVECIDGLLMATQYDVPWREDLFDGFDFYDVSQSFEFKKAGYTVGVPVQRDAWCIHYHFDVNMTNYEKYRKIFVEHYMSDVNKEE
>NC_016779.1|WP_000651527.1|1163511_1164192_+|streptomycin-biosynthesis-protein-StrF
MKDHTILVVVCVNNEELFKQCESQIRNIFVPPGYVVQIFPIRDAQSMASAYNRALSYPAKYKVYIHQDTYLINRDMFSTLISLFKENEKLGLIGVAGAQFLPNNGIWWEGKNLVGKVIEYRRRNYQLLNLDQVFYGNQPFLSVQAIDGLFMATQYDIPWREDLFQGFHFYDVSQSLEFQRAGYLIGIPNQANLWCIHYNGDEFDADTYEKYRKVFVEHYKDILSPS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_016779_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_016779_2

1382752-1383624

Orphan

Consensus_repeat	Method
CACCNGCNGGTCCTTGANCNCCTTGAG	CRT

16 spacers

The CRISPR arrays of NC_016779_2

>merge|NC_016779|2|1382752-1383624|CRT
CACCAGCAGGTCCTTGAACACCTTGAGGTCCTTGAGCCCCCGTAGCGCCAGTAGCACCAGCAGGTCCTTGAACACCTTGAGGTCCTTGAGCCCCCGTAGCGCCAGTAGCACCAGCAGGTCCTTGAACACCTTGAGGTCCTTGAGCCCCCGTAGCGCCAGTAGCACCAGCAGGTCCTTGAACACCTTGAGGTCCTTGAGCCCCCGTAGCACCAGTAGCACCAGCAGGTCCTTGAACGCCTTGAGGTCCTTGAGCACCTGTAGCGCCAGTAGCACCCGCCGGTCCTTGAACGCCTTGAGCCCCTTGAGCCCCCGTAGCACCAGCAGGTCCTTGAACGCCTTGAGGTCCTTGAGCCCCCGTAGCACCAGTAGCGCCAGTAGCACCAGCAGGTCCTTGAGCACCTTGAGCACCAGTAGCGCCAGTAGCACCCGCTGGCCCTTGAGCACCTTGCGCACCAGTAGCGCCAGTAGCACCTGCCGGTCCTTGAATACCCTGAGGCCCTTGAGGTCCAGTAGCGCCAGTAGCACCCGCCGGTCCTTGAATACCTTGAGGTCCTTGAGCACCTGTAGCGCCAGTAGCACCCGCCGGTCCTTGAACGCCTTGAGGTCCTTGAGCCCCCGTAGCACCAGTAGCACCCGCCGGTCCTTGAACGCCTTGAGGTCCTTGAGCCCCCGTAGCACCTGTAGCGCCAGTAGCACCCGCCGGTCCTTGAGCACCCGTAGCACCTGTAGCACCCGCCGGTCCTTGAACGCCTTGAGGTCCTTGAGCCCCCGTAGCACCTGTAGCGCCAGTAGCACCAGCAGGTCCTTGAGCACCTTGAGCCCCCGTAGCGCCAGTAGCACCTGCAGGTCCTTGAATACCTTGAGGTCCTTGAG

>NC_016779|2|1|1382752-1383624|CRT
CACCAGCAGGTCCTTGAACACCTTGAG	GTCCTTGAGCCCCCGTAGCGCCAGTAG
CACCAGCAGGTCCTTGAACACCTTGAG	GTCCTTGAGCCCCCGTAGCGCCAGTAG
CACCAGCAGGTCCTTGAACACCTTGAG	GTCCTTGAGCCCCCGTAGCGCCAGTAG
CACCAGCAGGTCCTTGAACACCTTGAG	GTCCTTGAGCCCCCGTAGCACCAGTAG
CACCAGCAGGTCCTTGAACGCCTTGAG	GTCCTTGAGCACCTGTAGCGCCAGTAG
CACCCGCCGGTCCTTGAACGCCTTGAG	CCCCTTGAGCCCCCGTAG
CACCAGCAGGTCCTTGAACGCCTTGAG	GTCCTTGAGCCCCCGTAGCACCAGTAGCGCCAGTAG
CACCAGCAGGTCCTTGAGCACCTTGAG	CACCAGTAGCGCCAGTAG
CACCCGCTGGCCCTTGAGCACCTTGCG	CACCAGTAGCGCCAGTAG
CACCTGCCGGTCCTTGAATACCCTGAG	GCCCTTGAGGTCCAGTAGCGCCAGTAG
CACCCGCCGGTCCTTGAATACCTTGAG	GTCCTTGAGCACCTGTAGCGCCAGTAG
CACCCGCCGGTCCTTGAACGCCTTGAG	GTCCTTGAGCCCCCGTAGCACCAGTAG
CACCCGCCGGTCCTTGAACGCCTTGAG	GTCCTTGAGCCCCCGTAGCACCTGTAGCGCCAGTAG
CACCCGCCGGTCCTTGAGCACCCGTAG	CACCTGTAGCACCCGCCGGTCCTTGAA
CGCCTTGAGGTCCTTGAGCCCCCGTAG	CACCTGTAGCGCCAGTAGCACCAGCAG
GTCCTTGAGCACCTTGAGCCCCCGTAG	CGCCAGTAGCACCTGCAG
GTCCTTGAATACCTTGAGGTCCTTGAG

Protein	Signature genes	Signature genes Name	Protein_function
NC_016779.1\|WP_000067563.1\|1395019_1395511_+\|YpuI-family-protein	unknown	unknown	gnl\|CDD\|379028
NC_016779.1\|WP_000600586.1\|1375465_1375978_-\|Crp/Fnr-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223736
NC_016779.1\|WP_000380282.1\|1377586_1378585_-\|inorganic-phosphate-transporter	unknown	unknown	gnl\|CDD\|376541
NC_016779.1\|WP_000806236.1\|1387553_1388084_-\|tyrosine-type-recombinase/integrase	unknown	unknown	gnl\|CDD\|271192
NC_016779.1\|WP_001094858.1\|1387239_1387434_-\|DUF3924-domain-containing-protein	unknown	unknown	gnl\|CDD\|289807
NC_016779.1\|WP_000455757.1\|1376668_1377469_-\|sulfite-exporter-TauE/SafE-family-protein	unknown	unknown	gnl\|CDD\|376667
NC_016779.1\|WP_000231442.1\|1378596_1379217_-\|DUF47-domain-containing-protein	unknown	unknown	gnl\|CDD\|224310
NC_016779.1\|WP_000947713.1\|1374226_1375435_+\|NO-inducible-flavohemoprotein	unknown	unknown	gnl\|CDD\|237337
NC_016779.1\|WP_000882907.1\|1376147_1376375_+\|hypothetical-protein	unknown	unknown	unknown
NC_016779.1\|WP_000897348.1\|1386101_1386947_+\|DUF72-domain-containing-protein	unknown	unknown	gnl\|CDD\|224714
NC_016779.1\|WP_000232623.1\|1391042_1391831_+\|hypothetical-protein	unknown	unknown	unknown
NC_016779.1\|WP_001265558.1\|1381690_1382119_-\|hypothetical-protein	unknown	unknown	unknown
NC_016779.1\|WP_000769278.1\|1379529_1381572_+\|PBP1A-family-penicillin-binding-protein	unknown	unknown	gnl\|CDD\|273955
NC_016779.1\|WP_000735211.1\|1373548_1374067_+\|hypothetical-protein	unknown	unknown	unknown
NC_016779.1\|WP_000794481.1\|1372336_1373434_+\|site-2-protease-family-protein	unknown	unknown	gnl\|CDD\|100081
NC_016779.1\|WP_000937256.1\|1384678_1385941_-\|PAS-domain-containing-protein	unknown	unknown	gnl\|CDD\|236901
NC_016779.1\|WP_000583789.1\|1394608_1394998_+\|hypothetical-protein	unknown	unknown	unknown
NC_016779.1\|WP_000110707.1\|1390159_1390867_-\|purine-nucleoside-phosphorylase	unknown	unknown	gnl\|CDD\|180275
NC_016779.1\|WP_000010871.1\|1391835_1394421_-\|bifunctional-lysylphosphatidylglycerol-flippase/synthetase-MprF	unknown	unknown	gnl\|CDD\|225451
NC_016779.1\|WP_000797496.1\|1388191_1390003_-\|sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|274368

Protein	Function_ID	Function_description	E-value
NC_016779.1\|WP_000067563.1\|1395019_1395511_+\|YpuI-family-protein	gnl\|CDD\|379028	pfam13047, DUF3907, Protein of unknown function (DUF3907). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 160 amino acids in length. There is a conserved AYTG sequence motif.	4.13059e-78
NC_016779.1\|WP_000600586.1\|1375465_1375978_-\|Crp/Fnr-family-transcriptional-regulator	gnl\|CDD\|223736	COG0664, Crp, cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms].	4.60365e-22
NC_016779.1\|WP_000380282.1\|1377586_1378585_-\|inorganic-phosphate-transporter	gnl\|CDD\|376541	pfam01384, PHO4, Phosphate transporter family. This family includes PHO-4 from Neurospora crassa which is a is a Na(+)-phosphate symporter. This family also contains the leukaemia virus receptor.	2.54102e-105
NC_016779.1\|WP_001094858.1\|1387239_1387434_-\|DUF3924-domain-containing-protein	gnl\|CDD\|289807	pfam13062, DUF3924, Protein of unknown function (DUF3924). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 60 amino acids in length.	1.20247e-25
NC_016779.1\|WP_000231442.1\|1378596_1379217_-\|DUF47-domain-containing-protein	gnl\|CDD\|224310	COG1392, COG1392, Phosphate transport regulator (distant homolog of PhoU) [Inorganic ion transport and metabolism].	3.70395e-51
NC_016779.1\|WP_000806236.1\|1387553_1388084_-\|tyrosine-type-recombinase/integrase	gnl\|CDD\|271192	cd01192, INT_C_like_3, Uncharacterized site-specific tyrosine recombinase, C-terminal catalytic domain. Tyrosine recombinase (integrase) belongs to a DNA breaking-rejoining enzyme superfamily. The catalytic domain contains six conserved active site residues. The recombination reaction involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA. Many DNA breaking-rejoining enzymes also have N-terminal domains, which show little sequence or structure similarity.	2.9028e-41
NC_016779.1\|WP_000897348.1\|1386101_1386947_+\|DUF72-domain-containing-protein	gnl\|CDD\|224714	COG1801, COG1801, Uncharacterized conserved protein [Function unknown].	1.54848e-73
NC_016779.1\|WP_000455757.1\|1376668_1377469_-\|sulfite-exporter-TauE/SafE-family-protein	gnl\|CDD\|376667	pfam01925, TauE, Sulfite exporter TauE/SafE. This is a family of integral membrane proteins where the alignment appears to contain two duplicated modules of three transmembrane helices. The proteins are involved in the transport of anions across the cytoplasmic membrane during taurine metabolism as an exporter of sulfoacetate. This family used to be known as DUF81.	4.79544e-37
NC_016779.1\|WP_000797496.1\|1388191_1390003_-\|sensor-histidine-kinase	gnl\|CDD\|274368	TIGR02966, Phosphate_regulon_sensor_protein_PhoR, phosphate regulon sensor kinase PhoR. Members of this protein family are the regulatory histidine kinase PhoR associated with the phosphate ABC transporter in most Proteobacteria. Related proteins from Gram-positive organisms are not included in this model. The phoR gene usually is adjacent to the response regulator phoB gene (TIGR02154). [Signal transduction, Two-component systems].	1.86579e-61
NC_016779.1\|WP_000769278.1\|1379529_1381572_+\|PBP1A-family-penicillin-binding-protein	gnl\|CDD\|273955	TIGR02074, Includes:_Penicillin-insensitive_transglycosylase, penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan].	0
NC_016779.1\|WP_000794481.1\|1372336_1373434_+\|site-2-protease-family-protein	gnl\|CDD\|100081	cd06160, S2P-M50_like_2, Uncharacterized homologs of Site-2 protease (S2P), zinc metalloproteases (MEROPS family M50) which cleave transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms. Members of the S2P/M50 family of RIP proteases use proteolytic activity within the membrane to transfer information across membranes to integrate gene expression with physiologic stresses occurring in another cellular compartment. In eukaryotic cells they regulate such processes as sterol and lipid metabolism, and endoplasmic reticulum stress responses. In prokaryotes they regulate such processes as sporulation, cell division, stress response, and cell differentiation. This group includes bacterial, eukaryotic, and Archaeal S2P/M50s homologs with additional putative N- and C-terminal transmembrane spanning regions, relative to the core protein, and no PDZ domains.	7.40034e-42
NC_016779.1\|WP_000937256.1\|1384678_1385941_-\|PAS-domain-containing-protein	gnl\|CDD\|236901	PRK11360, PRK11360, two-component system sensor histidine kinase AtoS.	9.08399e-66
NC_016779.1\|WP_000947713.1\|1374226_1375435_+\|NO-inducible-flavohemoprotein	gnl\|CDD\|237337	PRK13289, PRK13289, NO-inducible flavohemoprotein.	0
NC_016779.1\|WP_000110707.1\|1390159_1390867_-\|purine-nucleoside-phosphorylase	gnl\|CDD\|180275	PRK05819, deoD, DeoD-type purine-nucleoside phosphorylase.	1.77954e-168
NC_016779.1\|WP_000010871.1\|1391835_1394421_-\|bifunctional-lysylphosphatidylglycerol-flippase/synthetase-MprF	gnl\|CDD\|225451	COG2898, COG2898, Uncharacterized conserved protein [Function unknown].	1.17e-138

>NC_016779.1|WP_001265558.1|1381690_1382119_-|hypothetical-protein
MRVMSLIRIWFALMVCIILCVGFFLTLKYSTISKAEKKTTPYKLLYTKQSNIPYSNATKNEKKVIKGMLITKASSSEALLQIAETIKDQYTNKKIDEITLSIHNENNGNYEEELPYEPISKGKVIVTYDSETFGSTNIILNE
>NC_016779.1|WP_000769278.1|1379529_1381572_+|PBP1A-family-penicillin-binding-protein
MKLKNTHLKKMQEWFNKRKKLRNSLIILGSLLATLFIAINIIISIQDISELKQAVPQPTLIYDANNEVATKLASSKTEGVKKKDIPDIMVQAIVAVEDKEFFNHHGIYYSGIISAVFKNITAGEVVAGGSTITQQLAKNVFLTQDRTYSRKIKEYFLTKKIERTYTKDEIIEMYMNQIYFGEGAWGIKRAAKSYFDKDVKDLTISEAATIAGLIKAPSAYSPYKNFNKSIERRNVVLSLMKEQGYISDEQYNKEKESGLVLKRGVDDKYKGKYSQYVDYIVREAMDKYELTQNEILAGGYRIYTELDPKKQQAVEDVVNNNSYFKDSGSDQLMQTGVVLMNPKTGGVPALVGGRGPYQFLQFNHATQLKRQPGSTLKPLAVYVPALEQGYEVYDILKDEPFNIKEYKPQNSDHTFHGDVTMYEAVAKSYNVSAVWLLEQIGLDKGLKSLERFGIPLVPEDRTYPIALGGMHVGTSPFVMAQAYSTFANDGVQVEAHAIREIQNAEGETIGKWYKKETRVTSEKTSQKMTYLLKGVVEKGTGEKAKVTNVDTAGKTGTTQIVNGPSTGAKDSWFVGYTPDLVGAIWVGYDKTDSDHYVPGGSQITTTMFRDIMKKANANPAQKAFQLSLISEADYKKQLTTIEEEKRRKEEEKRRKEEEQQRKQEQQEWLDKVKEWIPSFW
>NC_016779.1|WP_000231442.1|1378596_1379217_-|DUF47-domain-containing-protein
MVFKSKKDKFSEMLMNVSENLKEGAQFFVEYKIKNASDLKEFSMRMKDYESKGDSFIHEIIMELNKAFITPIEREDILQLAMSMDDVLDGLDHSAGLFEMYSITEADEYMIKFVEAINQCAIEIANSVELMSNKKLVDIRTNAIKIKDYESQCDDIRRHAIKHLFSREKDPIKIIQYKEIYEELEEVADSCQSVANVLETIIMKNA
>NC_016779.1|WP_000380282.1|1377586_1378585_-|inorganic-phosphate-transporter
MDTLLILTVLVVICALAFDFINGFHDTANAIATAVSTKALKPRHAIVMAAIMNFLGAMTFTGVAKTITKDIVDPFALQNGSLVILAALLAAIAWNLITWYYGIPSSSSHAIIGSIAGAAIAAAGISSLNLKGFIKIIEALIISPIIAFVIGYTVYSIFKVVFKNFNLTKTNKNFRIFQIFTAALQAYTHGTNDAQKAMGIITMALMANNYHTSSDIPFWVQLSCAIAMGLGTSVGGWKIIKTVGGQIMKIRPVNGVAADLSSSLVIFGATFIHLPVSTTHVISSSILGVGASHRVKGVKWGTAKRMLITWVITLPISASLAALFYSLLHLIF
>NC_016779.1|WP_000455757.1|1376668_1377469_-|sulfite-exporter-TauE/SafE-family-protein
MEYIMLLFIGLIAGTVGSLVGLGGGIIIVPLLIGLHSLSPQLAVGTSMVTVVFTGLSSTLTYMKHKRVDYKSGLILFIGSGPGGIIGSWANKFLNQDTFSLYFGIFLIFVSILLMLRDKLKPLSLSNMTVIKRSFTDNEGNTVHYQFPPLLAIFIAFIVGFISGLFGIGGGALLVPAMMLLFAFPAHIAVATSMFIVFLSAIVSSATHISLGNVSWIYALILIPGAWIGGKIGAYINTKLSGKAVINLLRITLIILGTRLIITSFL
>NC_016779.1|WP_000882907.1|1376147_1376375_+|hypothetical-protein
MLDAIKMTDMRIPANAIIHVEEMKGGVVLSVEVDGQIIYTMAYDEETDSYAELYDRNDKRACQVHEDFMGWSLLH
>NC_016779.1|WP_000600586.1|1375465_1375978_-|Crp/Fnr-family-transcriptional-regulator
MILHKGDVLFRQGEDGPLYFIKTGLLKVVRLEEDGTPFLFNIIVPGETIPHHSLISPKEYHGTAIALMKTEVEPIMSNEWYDQLQANPASYANIAMQLQSKLRMMQQRIDQLTTVSPKERLHRLQEWFTLYLGDIPIYEILTQTEIGQLIGIRRETVNRLLREQIKNEVK
>NC_016779.1|WP_000947713.1|1374226_1375435_+|NO-inducible-flavohemoprotein
MLSEKTIEIVKSTVPLLQEKGVEITTRFYEILFSEHPELLNIFNHTNQKKGRQQQALANAVYAAATYIDNLEAIIPVVKQIGHKHRSLGIKAEHYPIVGTCLLRAIKEVAGAPDEVLNAWGEAYGVIADAFISIEAEMYEEAAHKEGGWKDFRNFVVVKKVKESDVITSFYLKPEDGGKVSSFIPGQYVTVQINIEGETYTHNRQYSLSDAPGKEYYRISVKKEKGVDTPDGKVSNYLHEHVKEGDMLPVSAPAGDFVLNMDSTLPVVLISGGVGITPMMSMLNTLIEQDSKRNVCFVHAAINSNTHAMKEHVEAVDNEYEQVRAYTCYSAPTEKDLEMKNFDKEGFVEREWLQTIIPTTEAEFYFCGPVPFMKHINAVLTDLGVKQEHIHYEFFGPAASLQ
>NC_016779.1|WP_000735211.1|1373548_1374067_+|hypothetical-protein
MKKLLNVFGIIIVMIIASYSLMKVLLHYANKPAGVSTTAEIEDVQEETKVLDFIRMTHESYNNFLNYGKAENYTEGDWNQFKQWFQQQESSLKNIHIDIKNEKIKRDVNRSYEIAKKGVELQNIEYVVYAHRVYHDLDIIVNKYRGETNIWGYTEFGDGKDIRVIEQAIQSK
>NC_016779.1|WP_000794481.1|1372336_1373434_+|site-2-protease-family-protein
MKNNKKGLWGIIVAIGLFLLSKLKWVFAIFKLAKFSTVFSMFLSLGAYAVIYGWKFGVALIYLLFIHEMGHLWAAKRKGIPTSPAIFIPFMGALIGMKEMPKNAKDEAYIAYMGPLFGLLSFLPAIPLYMITKEPFWALIILLGSMINFFNLIPVSPLDGGRIISVVSTKIWGAGLVLLLGYSIYFKSILGGFIVIIGCMELYRVIKRDEPIKELGYRIDGMKEYIARLEEELKETGAVHRNIYMMQHEINVLRQKEREKELKTGEFQKIEVLEYLLPKFEPLDYVPYEDEKETHTIHIREAFKMSERKLEEWDAEKRQQENYYKVDTKTKWTVFACYIGLMAILGYAAYEGYIVLQEHLPTRNV
>NC_016779.1|WP_000937256.1|1384678_1385941_-|PAS-domain-containing-protein
MLPNDDIISHEKRIEELENKVRFYEELVNQLPHHFTYKNPHIGLQIKKTRSTHSIQNIQKENKEADFQLTCDSLFLFKQLETYFIHIFDAFSHHVTFVDNKGNITLCNQAAADDFGVVRNDIIGKPIQQLLKLPEENIKALETLRTGTEIYNEEVLDKNYGILNNRIIRDYNGEIFRVISVFHYLNTERDAEKFSLAGRIAAGIAHEVRNPLTTVRGYLQFLQENVSPSNKELFKNLLIPELDRANSIITKFLSISKTREFTREPFPINTFLREYIQQLLASEVFLHNISIDYNFSTELDDILVHIDRHELVQVFLNLFQNAVDAQGEKKLSIQITSYRLDNFVRITFTDNGTGIPPAIQEYIFDPFFSTKDSGTGLGLSVTKKIIQNHNGTLKMTSNEDGTTFTISIPILPKTALERLN
>NC_016779.1|WP_000897348.1|1386101_1386947_+|DUF72-domain-containing-protein
MLFIGVTGWGDHDSLYIDPYENRNKLRTYSEYFPIVEVDSSFYAMQPERNYTKWAMETPKDFSFIVKAYQGMTGHMKGEIPFSTFDEMFDVYKRSILPLIEAGKLKTILFQYPPWFDCKKKNVDFLRYTKEKMEGLPCAIEFRNQTWFYPEMRDKTLQFLEQEKWIHTICDEPQAGMGSVPLVLEVTSAEMVLIRFHGRNVHGWLDKGENWRAVRCLYRYNNKELEEWVERLEQLKKKTKDIYVLFNNNSGGDAADNAKQLMKMMNITYGEPKPEQLNLFE
>NC_016779.1|WP_001094858.1|1387239_1387434_-|DUF3924-domain-containing-protein
MNTLTIELPKETAEKLDLLKQAYEKKTGASISESTLVQTLISKEFIQAITPFDLQQFITGKEQH
>NC_016779.1|WP_000806236.1|1387553_1388084_-|tyrosine-type-recombinase/integrase
MKQAGQPIQNEKQLETIKNILLQSSKRDGLLFVLAVNSGLKVSEILQLKVSDVIDENENVRHSILFYNEKVKKHKWFAVNEDLQHAIEDYMKERKTWKRNEPLLKSQKGTKSITRQHAWYILNKAAKEVGLEGISSHTLRKTWGYCAYKSGVDIAFLQHFFDHSTPSKTLKYIGIA
>NC_016779.1|WP_000797496.1|1388191_1390003_-|sensor-histidine-kinase
MKNRSIVFKLFLLTSTLFTIIFLLFFLGQSLFLEKFYINKKVKTVQTAFEKFVANYEKSEKDPEEVRKLKQEFHDKTNADMQFLNTNGIIKSDNNYYIDVFNPKNHETYSIPLNNLLTPEEYKKFENLGLKKDDVINVVGLLQNKTITPIKLTTNYNRWQNEYTNSDFSSINGNPSKNRLTNRYKTVTQIEFTGTISKLQLPSKAEVRLANDIETLQAVQYFAELIRNGTANSQQLNTYIIDSGENIKNSIFVKPIIENGEITEYAFAIASLQPVNEAMLVLKDYYVYALIIVFLVIILLSFYYSKIIVKPLIKINRVTKKMANFDFSEKLPVTADDEIGGLSGSINTLSVNLKDRIDRLNVANTKLQQDIERERQLEKTRKEFISGVSHELKTPLSVIRSFAEGIKDGVSKDTTYYTDVILEETENMNRLIVEMLELAKLESGTYKLDMTTFSIGELIQQVYTKLLFSMEEKHLQVNIDVDSSIVVKANRSRIEQVVVNLLSNAIRYTPDGEKIQVSVIAMEDTVKVEIENTGNPIPEESLEKIWDRFYRLDASRSRHTGGTGLGLSIVKNILDLHHAEYGVYNTTNSVVFYFNLQKVKEVK
>NC_016779.1|WP_000110707.1|1390159_1390867_-|purine-nucleoside-phosphorylase
MSVHIEAKQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGVPSISIYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNRLTFPGFDFAPAANFDLLKKAYDAGTEKGLHVRVGNVLTADVFYRESMDMVKKLGDYGVLAVEMETTALYTLAAKYGVNALSVLTVSDHIFTGEETTSEERQTTFNEMIEIALDAAIQQ
>NC_016779.1|WP_000232623.1|1391042_1391831_+|hypothetical-protein
MVGDVLKNLVIGLVALLFIVVGGFYIKKYQETTETVGDVQEVKWDVSYGKENEKVDISFQLLNNKNNEVRGVNDQIRAVVVDGQLKHVQQMKPTFTGNGSYKVSSEIAKDERYTIFLYEDKNKSVKSFAKKDFGREIEEKNKKKVKFPIDSVLTKKIGEYEVSLLFGALHPNEPATLTFQFQAKKGEKLKLHSERGEVEALYIVDDTRENYLYAIPVDTDGQLQYRITFPAEGTYKIWGDFYINGKKYEKEFIVQVQKRKNS
>NC_016779.1|WP_000010871.1|1391835_1394421_-|bifunctional-lysylphosphatidylglycerol-flippase/synthetase-MprF
MSFSWKRFLQIGKIIFPFVVLTIVFFQAKKELAGISFLEAINTIKNIPTGGVFLAITLGAFAVSTMFFYDYVMLRYLKADIPVQKIFRISWIANTLNGFIGFGGLVGAGVRTMLYRPYIKENGKLIKSIAWMTTAFINGLAILSFLGLIGILDTSFILHEKPWLWPVLIFFALFVPIYIGFSKLKNRKTKQAEGQDEGEEEKNPTVLYSLVSLVEWVSAGIVMYVILILFGIDIEFQKFLGVYVIAALAGVVSLVPGGLGSFDLVFLTGLGQYGIDTGVLLPAMLLYRLVYYILPFCLGLIFAAFEMTGVAIKKFEDKPFIAPALETTGVIWTLQRDFLGKLGSWASAALTVFAGLMVILSTILPTSINRAHALHILAPKHLIQFSFSLSLTFGILLLILSRGIYYGTKRSYYMTIISLIGAAIFNTLKGIDIEETFILLIVLAVLYMLRKRFVREKMEVSLSDIVKVFIFLLITLYLYKNLGILFAGAKEAFKPDFVVRNITQVKRSALAAAFFVPTFLLIGSLIANRYRNEFPGQPANDKRLQNFLDEHGGNVLSHLGFLGDKQFFFSSDGKALLLFSITGKRLVVLGDPIGDPSSYRTVLQEFLAEADRFGYICVFYQIESKWMSLYHDFGYNFFKLGEEAVVDLNTFTITGKKRAGMRATFNRFEREGYTFSIHQPPFSNELFEELRKVSDAWLGGKKEKSFSLGYFDREYISRAPIATLSDADGKIIAFTTFMPVYQDGSLSVDLMRYYPDAPSGIMDAIFIHLFQWAKENEYHSFNIGMAPLSNVGLSTQSFWSERVAAAIFNNVRYTYSFSGLRHFKEKYKPAWSGKYLAFRKNHSLPITMLSVTKLIGKRKNS
>NC_016779.1|WP_000583789.1|1394608_1394998_+|hypothetical-protein
MIIIGYAGYELEKAKPNTSEDFFNRSEVTYILNNKERTFSVLYVRYFEEVLQEITLFEGNTVCKVEEQDIHLRDIVAICCLLKENELRTQKRLYLNNIEEFQQYFDKETLLKVQEILAELHKNKRVEIS
>NC_016779.1|WP_000067563.1|1395019_1395511_+|YpuI-family-protein
MSNLMVENQTEQVSIFLEDAITLITNYVNYHTLPSLLEETPAGNEQYYKGLLASMRRLLVFCEEGHDACFVLLNSQPFRKTAAEKTLYKIYHQVIAEFFSPKSDYWYENSRSAYTGKNSIVFQQTPPASVEEVMKSLEGKFQLMREELEYYETDYQTKMLHKY

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_016779_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_016779_3

3262151-3262253

Orphan

Consensus_repeat	Method
AAGTTTAGGTTTCTTTTGAGAATGT	CRISPRCasFinder

1 spacers

csa3

The CRISPR arrays of NC_016779_3

>merge|NC_016779|3|3262151-3262253|CRISPRCasFinder
AAGTTTAGGTTTCTTTTGAGAATGTGGTATATTTACATGCCCCGAAGTAGCCGTGGATTGTCTCCTTTCCTTCCTTGACAATTTAGGTTTCTTTTGAGAATGT

>NC_016779|3|2|3262151-3262253|CRISPRCasFinder
AAGTTTAGGTTTCTTTTGAGAATGT	GGTATATTTACATGCCCCGAAGTAGCCGTGGATTGTCTCCTTTCCTTCCTTGA
CAATTTAGGTTTCTTTTGAGAATGT

Protein	Signature genes	Signature genes Name	Protein_function
NC_016779.1\|WP_000798780.1\|3256816_3257047_+\|hypothetical-protein	unknown	unknown	unknown
NC_016779.1\|WP_000422619.1\|3264151_3265771_-\|FAD-dependent-monooxygenase	unknown	unknown	gnl\|CDD\|366675
NC_016779.1\|WP_000473151.1\|3250949_3252491_-\|alpha-amylase	unknown	unknown	gnl\|CDD\|236518
NC_016779.1\|WP_000813611.1\|3271687_3272215_-\|GrpB-family-protein	unknown	unknown	gnl\|CDD\|377252
NC_016779.1\|WP_000646423.1\|3266748_3267747_+\|NADP-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|176191
NC_016779.1\|WP_000137557.1\|3253602_3255390_+\|oligoendopeptidase-F	unknown	unknown	gnl\|CDD\|341071
NC_016779.1\|WP_000544589.1\|3259325_3259835_+\|DUF3916-domain-containing-protein	unknown	unknown	gnl\|CDD\|372464
NC_016779.1\|WP_000915189.1\|3255425_3256559_-\|serine-hydrolase	unknown	unknown	gnl\|CDD\|365903
NC_016779.1\|WP_000417236.1\|3262892_3263546_-\|hypothetical-protein	unknown	unknown	unknown
NC_016779.1\|WP_000351707.1\|3258481_3259333_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176133
NC_016779.1\|WP_000236538.1\|3259928_3260606_+\|YdcF-family-protein	unknown	unknown	gnl\|CDD\|99750
NC_016779.1\|WP_000719639.1\|3270741_3270879_+\|Phr-family-secreted-Rap-phosphatase-inhibitor	unknown	unknown	gnl\|CDD\|275222
NC_016779.1\|WP_000571876.1\|3266234_3266639_+\|winged-helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|238042
NC_016779.1\|WP_001102735.1\|3269647_3270742_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|376220
NC_016779.1\|WP_000275811.1\|3270953_3271553_-\|protease-synthase/sporulation-negative-transcriptional-regulator-PaiB	unknown	unknown	gnl\|CDD\|377290
NC_016779.1\|WP_000538119.1\|3263562_3263814_-\|hypothetical-protein	unknown	unknown	unknown
NC_016779.1\|WP_001226311.1\|3260650_3261595_-\|glycerophosphodiester-phosphodiesterase	unknown	unknown	gnl\|CDD\|176543
NC_016779.1\|WP_000129214.1\|3252694_3253486_+\|arylamine-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366312
NC_016779.1\|WP_000164935.1\|3267925_3269392_+\|YdiU-family-protein	unknown	unknown	gnl\|CDD\|234583
NC_016779.1\|WP_002003235.1\|3257157_3258396_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|341028

Protein	Function_ID	Function_description	E-value
NC_016779.1\|WP_000422619.1\|3264151_3265771_-\|FAD-dependent-monooxygenase	gnl\|CDD\|366675	pfam01494, FAD_binding_3, FAD binding domain. This domain is involved in FAD binding in a number of enzymes.	2.97731e-107
NC_016779.1\|WP_000473151.1\|3250949_3252491_-\|alpha-amylase	gnl\|CDD\|236518	PRK09441, PRK09441, cytoplasmic alpha-amylase; Reviewed.	0
NC_016779.1\|WP_000813611.1\|3271687_3272215_-\|GrpB-family-protein	gnl\|CDD\|377252	pfam04229, GrpB, GrpB protein. This family has been suggested to belong to the nucleotidyltransferase superfamily. It occurs at the C-terminus of dephospho-CoA kinase (CoaE) in a number of cases, where it plays a role in the proper folding of the enzyme.	8.77932e-57
NC_016779.1\|WP_000646423.1\|3266748_3267747_+\|NADP-dependent-oxidoreductase	gnl\|CDD\|176191	cd05289, MDR_like_2, alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases. Members identified as zinc-dependent alcohol dehydrogenases and quinone oxidoreductase. QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR actin the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction.	6.65827e-149
NC_016779.1\|WP_000137557.1\|3253602_3255390_+\|oligoendopeptidase-F	gnl\|CDD\|341071	cd09608, M3B_PepF, Peptidase family M3B, oligopeptidase F (PepF). Peptidase family M3B oligopeptidase F (PepF; Pz-peptidase B; EC 3.4.24.-) is mostly bacterial and includes oligoendopeptidase F from Lactococcus lactis. This enzyme hydrolyzes peptides containing between 7 and 17 amino acids with fairly broad specificity. The PepF gene is duplicated in L. lactis on the plasmid that bears it, while a shortened second copy is found in Bacillus subtilis. Most bacterial PepFs are cytoplasmic endopeptidases; however, the Bacillus amyloliquefaciens PepF oligopeptidase is a secreted protein and may facilitate the process of sporulation. Specifically, the yjbG gene encoding the homolog of the PepF1 and PepF2 oligoendopeptidases of Lactococcus lactis has been identified in Bacillus subtilis as an inhibitor of sporulation initiation when over-expressed from a multicopy plasmid. This PepF family includes Streptococcus agalactiae PepB, a group B streptococcal oligopeptidase which has been shown to degrade a variety of bioactive peptides as well as the synthetic collagen-like substrate N-(3-[2-furyl]acryloyl)-Leu-Gly- Pro-Ala in vitro.	0
NC_016779.1\|WP_000544589.1\|3259325_3259835_+\|DUF3916-domain-containing-protein	gnl\|CDD\|372464	pfam13079, DUF3916, Protein of unknown function (DUF3916). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 170 amino acids in length. There is a single completely conserved residue S that may be functionally important.	8.92643e-74
NC_016779.1\|WP_000915189.1\|3255425_3256559_-\|serine-hydrolase	gnl\|CDD\|365903	pfam00144, Beta-lactamase, Beta-lactamase. This family appears to be distantly related to pfam00905 and PF00768 D-alanyl-D-alanine carboxypeptidase.	3.15391e-58
NC_016779.1\|WP_000351707.1\|3258481_3259333_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176133	cd08442, PBP2_YofA_SoxR_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators, YofA and SoxR, contains the type 2 periplasmic binding fold. YofA is a LysR-like transcriptional regulator of cell growth in Bacillus subtillis. YofA controls cell viability and the formation of constrictions during cell division. YofaA positively regulates expression of the cell division gene ftsW, and thus is essential for cell viability during stationary-phase growth of Bacillus substilis. YofA shows significant homology to SoxR from Arthrobacter sp. TE1826. SoxR is a negative regulator for the sarcosine oxidase gene soxA. Sarcosine oxidase catalyzes the oxidative demethylation of sarcosine, which is involved in the metabolism of creatine and choline. The topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.22301e-86
NC_016779.1\|WP_000236538.1\|3259928_3260606_+\|YdcF-family-protein	gnl\|CDD\|99750	cd06259, YdcF-like, YdcF-like. YdcF-like is a large family of mainly bacterial proteins, with a few members found in fungi, plants, and archaea. Escherichia coli YdcF has been shown to bind S-adenosyl-L-methionine (AdoMet), but a biochemical function has not been idenitified. The family also includes Escherichia coli sanA and Salmonella typhimurium sfiX, which are involved in vancomycin resistance; sfiX may also be involved in murein synthesis.	1.39155e-21
NC_016779.1\|WP_000719639.1\|3270741_3270879_+\|Phr-family-secreted-Rap-phosphatase-inhibitor	gnl\|CDD\|275222	TIGR04429, hypothetical_protein_bmyco0001_31490, Phr family secreted Rap phosphatase inhibitor. Phr peptides are short peptides, best conserved in their amino-terminal regions, that are almost always encoded immediately downstream of a Rap phosphatase. A portion of the Phr peptide is secreted, enters another cell, and forms a quorum-sensing system by inhibiting its Rap phosphatase partner. The set of Phr peptides recognized by this N-terminal region model is disjoint from the PhrC/PhrF set recognized by pfam11131. [Regulatory functions, Protein interactions].	0.000197254
NC_016779.1\|WP_000571876.1\|3266234_3266639_+\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238042	cd00090, HTH_ARSR, Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to dissociate from DNA in the presence of metal ions.	2.00495e-15
NC_016779.1\|WP_000275811.1\|3270953_3271553_-\|protease-synthase/sporulation-negative-transcriptional-regulator-PaiB	gnl\|CDD\|377290	pfam04299, FMN_bind_2, Putative FMN-binding domain. In Bacillus subtilis, family member PAI 2/ORF-2 was found to be essential for growth. The SUPERFAMILY database finds that this domain is related to FMN-binding domains, suggesting this protein is also FMN-binding.	3.18494e-70
NC_016779.1\|WP_001102735.1\|3269647_3270742_+\|hypothetical-protein	gnl\|CDD\|376220	pfam18801, RapH_N, response regulator aspartate phosphatase H, N terminal. Rap proteins consist of a N-terminal 3-helix bundle and a tetratricopeptide domain. This entry represents the conserved region of the C-terminal bundle.	1.15405e-16
NC_016779.1\|WP_001226311.1\|3260650_3261595_-\|glycerophosphodiester-phosphodiesterase	gnl\|CDD\|176543	cd08601, GDPD_SaGlpQ_like, Glycerophosphodiester phosphodiesterase domain of Staphylococcus aureus and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in uncharacterized glycerophosphodiester phosphodiesterase (GP-GDE, EC 3.1.4.46) from Staphylococcus aureus, Bacillus subtilis and similar proteins. Members in this family show very high sequence similarity to Escherichia coli periplasmic phosphodiesterase GlpQ, which catalyzes the Ca2+-dependent degradation of periplasmic glycerophosphodiesters to produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols.	6.60592e-150
NC_016779.1\|WP_000129214.1\|3252694_3253486_+\|arylamine-N-acetyltransferase	gnl\|CDD\|366312	pfam00797, Acetyltransf_2, N-acetyltransferase. Arylamine N-acetyltransferase (NAT) is a cytosolic enzyme of approximately 30kDa. It facilitates the transfer of an acetyl group from Acetyl Coenzyme A on to a wide range of arylamine, N-hydroxyarylamines and hydrazines. Acetylation of these compounds generally results in inactivation. NAT is found in many species from Mycobacteria (M. tuberculosis, M. smegmatis etc) to man. It was the first enzyme to be observed to have polymorphic activity amongst human individuals. NAT is responsible for the inactivation of Isoniazid (a drug used to treat Tuberculosis) in humans. The NAT protein has also been shown to be involved in the breakdown of folic acid.	4.3288e-48
NC_016779.1\|WP_000164935.1\|3267925_3269392_+\|YdiU-family-protein	gnl\|CDD\|234583	PRK00029, PRK00029, YdiU family protein.	0
NC_016779.1\|WP_002003235.1\|3257157_3258396_-\|MFS-transporter	gnl\|CDD\|341028	cd17475, MFS_MT3072_like, Mycobacterium tuberculosis uncharacterized MFS-type transporter MT3072 and similar transporters of the Major Facilitator Superfamily. This family includes the Mycobacterium tuberculosis uncharacterized MFS-type transporter MT3072. It belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	2.37367e-97

>NC_016779.1|WP_001226311.1|3260650_3261595_-|glycerophosphodiester-phosphodiesterase
MRKIINVLVIFFMTGSIFAGGAVHAKAEGKHEWNKNKFLNIAHRGASGHAPEHTFASYDLVKKMKADYLELDIQLTKDGQLIAMHDTAVDRTTNGTGEVRDKTLSEIKSLDAGSWFNKAYPEKAKQEYVGQKIPTLEEIFQKYGRSMKYYIETKSPDVYPGMEEKLLALLNKYNLVGQNMSSSRVMIQSFSKDSLKKIHSMNKNIPLVQLLWYYSNENNEIVEWSGITHEPKRVTNDDFQEIKKYAVGIGPNLRNDNGELIIDESYMKMARKNGLLIHPYTINEKPDMRLLIKWGATGMFTNYPDRLHSVLKEK
>NC_016779.1|WP_000236538.1|3259928_3260606_+|YdcF-family-protein
MVIPKYPDVPTLTKKQIDQITEITFLKEITPQKCDAIFVFGGSHPGNWQAPLEAYRQGLGNRIIVTGGTSLHGMKHPSWNYGDLSEAEVIVNKLMEHGVPTDAILFETNSLHSIANVMEAKKIFDFTKVNRLLFVCKSLGAGRQYRVLKKHLPKTITCIPYTFDTSFDGEFIMNRYNWMENEKSRSMIFGEYLRNVCYGRKGGIEPPKKEVQGLEEYVSYYYNLA
>NC_016779.1|WP_000544589.1|3259325_3259835_+|DUF3916-domain-containing-protein
MHEKKIRGIKRKANAMIKRIEEHTKTFPSTFYNDEYWYMPLPVSQDFIESHKTPRKVKRLCIQTLIDRVNHLIKIKPSDTHTYRVVALISIENLWRSQIIVFKNDDYFHNFFTRNNEFQKWILLSNEIDFWETWRISICPTPQMLHFQEVTYDEDAIDEKEIWFIGELS
>NC_016779.1|WP_000351707.1|3258481_3259333_+|LysR-family-transcriptional-regulator
MDIKDLTVFYEVAKENNISHAAKNLNYVQSGVTMRMKQLENELGVPLFYRNGKGVTLTSNGEILLTYAKQIIHLMDQSIKAVQSNGTEPKGTLKIGCTESTTAVRLPSILTTYYEKYPEVELILETNTTEQLISLVLDRKLDGAFIAGSTQHNELHSNVFHEEELVLISKKPLSSLKDIEDMNLLAFSHGCYYRSLLEDWLQEEDISPKRVLEFGTIEAILACVKSSMGVAIMMKSILKEHEHDVLFNPLPNSFKKVPTTFITRKDIFRSASLQKFMEVTHNA
>NC_016779.1|WP_002003235.1|3257157_3258396_-|MFS-transporter
MEEDGGIIVLMEERMNSTYKWVMLIVATIAQTTATLITYGVGVFALFWKEEYALTNMESGLLVSVVNVGPLFCMLLAGRLLDQYNEKLLISISSFLLGGSFLLTNIVNGFNVLLFVLLLVGMFYSVSQPGGSKVILKWFPNENRGLAMGIRQAGIPIGGALTGVLIPFLAIQYNVTYAINSMACICIIGGLLFFMFYKEPYVQEDARKEHIKISFWTQLKVVIRKKELYPIYITGICMISLQMVLVGHFMKFLAGEQSITSIVAGTVLSVMFFSGMIGRIALAAISDVFYKGNRRIPLFIAVCASIGLILLLVININIHTITSGVLYSISALLGFFSIGWFSLFIAEVAELASEESVGITVSVALTLNQIAIIVAPVLFGYIVDEKGYTHAWLCIVLLLSISAVSLYSKNKK
>NC_016779.1|WP_000798780.1|3256816_3257047_+|hypothetical-protein
MKNTDKRNRLDAMMFHYRVTKNNIVLIEYYRKQIMILKGTDAEKFLNKINHAHDDTEKQLIMAKVTGNFKRGNERQ
>NC_016779.1|WP_000915189.1|3255425_3256559_-|serine-hydrolase
MLKKWLIVFFIFAIFGGSVVALIHASKGKKYDIKAFSNLNNKQKHDMQEVDANEKKHYEVVAGKLDQYLKDKGFNGSVLVASKDHVILRKGYGYANMKDKVFTTPRTKYRIGSITKTVVAISIMQLKEKGKLNIEDNVNKYIPSFPADKNITLRNLLTHTSGLPDQGKGRVDAASRLKLVTWIGSQALQFPAGTGWKYTDYNYMVLAYIVEKITNKPLAEYVKENIFTPVEMHESGMGATLPEDIFLAEGYTRKDNELIAAPRLKMNWLYGCGEMYTTVEDMKRLDEAIMNGKLLSKQSVLDMFTASPARKYGFSFYTYPDYYHNHGVLAGWNTFNNFNWDKRTFVILFSNVQNGMNDAFNQEFRKMANDLIEGKGA
>NC_016779.1|WP_000137557.1|3253602_3255390_+|oligoendopeptidase-F
MTELKDRLQVADKEKWDLTDIYDTIEDWESDFHKIEVLTNELHEFNGNIHDGNSLLAYLTKSEEISSIISLMFAYARLQSDLDTRDTDAQSLVDKVSQLHVKVSAAKSFFSPFLLSIDEDTLHTYIEEAEGLQYYKEDLFELYRYKKHVLNKDQEEILSQMGEALSSPQHTYGMLNNADILFGEVTTNDGEKVTLTRGMYAKLIEDESREKRKEAYKAYYKPYVQLKNSIASTLSAAIKNNVTVSKLRKYPSALEKSLFGDMVPKEVYDNLIETTKKNIQSLHTYNELRKEKLNVDELRQYDLSVDLVKGVKQDIPYDNAFDIMIESLAPLGEEYIETLKSFKDKRYIDVRETPGKRSGAYNFGVYGVHPFILLNHHDDLNSLFTLTHECGHGMHTHYSHGYQPRISAHYTIFVAEVASTVNEVLLIHHLLKEAKDANVRNHLVNHFIEKFKGTFFTQIMFAEFEKITHEMVQQGKPLNAQVFSEVYENLFREYNGDSLVFDEEVKYGWARIPHFYRPFYVYKYATGFASAIQIADNLLSGDPNAQKNYLEFLKGGSSDYPLNLLKKAGVDLTTPEPIESALNRFSELVEEFSTL
>NC_016779.1|WP_000129214.1|3252694_3253486_+|arylamine-N-acetyltransferase
MTDFQKQFFARLNIEEKQKVSFEDLSNIMYAMAQTVPFENLNILENNFTEISKENLKEKILVNNRGGLCYELNPTMYYFLKDAGFDVYLVSGTVYNAANSIWAVDSGHIATVLKHHNELYLIEVGFGSYLPLAPVPFSGEVVQSVTGDYRIRKEMTEKGNYMLEMRKNDEFLDQSSTDDWTLGYAFYIEEVDEKKANAAQKIIVEHDGSPFNKVPLIVKLTEDGHASLTKDSLTIAKNGKKTKEKVTDVQYKNLLHSKFGITL
>NC_016779.1|WP_000473151.1|3250949_3252491_-|alpha-amylase
MFKKIAIVGFSVVLFLPSIYGGSKVYADTVNNGTLMQYFEWYAPNDGNHWNRLHSDAGNLAQKGITSVWIPPAYKGTTQNDVGYGAYDLYDLGEFNQKGTVRTKYGTKAQLKSAIEALHKQNIDVYGDVVMNHKGGADYTEIVTAVEVDRNNRNIEVSGDYEINAWTGFNFPGRGDNYSNFKWKWYHFDGTDWDEGRKLNRIYKFRGIGKAWDWEVSSENGNYDYLMYADLDFDHPDVANEMKNWGTWYANELNLDGFRLDAVKHIDHEYLRDWVNHVRQQTGKEMFTVAEYWQNDIRTLNNYLAKVNYNQSVFDAPLHYNFHYASKGNGNYDMRNILNGTVMQNHPALAVTLVENHDSQPGQSLESVVSPWFKPLAYAFILTRAEGYPSVFYGDYYGTSGNSSYEIPALKDKIDPILTARKNFAYGTQRDYLDHPDVIGWIREGDSVHADSGLATLISDGPGGSKWMDVGKNNAGEVWHDMTGNQTNTVTINKDGWGQFHVSGGSVSIYVQQ
>NC_016779.1|WP_000417236.1|3262892_3263546_-|hypothetical-protein
MEKYHGKSTEQIIQKLMPGSVRSSVVMVWVVINFMILTPFLFPPTFTIYLYIILPFLLIANIWGVWVFFYKPNELRLVHILYNGFMGITFSFGSFIVIQKMAYTFIKIETPLFFIVTFLLYILTNYKLISIGMKSFLRRLNNEENDNIKISPIVYLSGLGYVIGQICIGTLSQNGLATVLILVFSLFAVVLSISGVYIWVYVDLKRKEMDGMHNEQI
>NC_016779.1|WP_000538119.1|3263562_3263814_-|hypothetical-protein
MGVGTTAVSAFAGAKLGAAVGTVFGGPIGTVAGACIGFGVSIGASIVTDGIKFNKGDWNHDGKQDSIKDKVKTGIGAALDKII
>NC_016779.1|WP_000422619.1|3264151_3265771_-|FAD-dependent-monooxygenase
MELNYVPVLIVGGGLSGLASALFLAKHNVDYSLVERHTSTAIHPKAGGITFRTMELFRELGLEQRIRSAGKALENCRGRIAVHTIAEANQEELAQMRANQYENDEKLLQKIEEISPSKQTACYQITLEEIMLQEARTLGGELSFYHELVSYEQNEQGVIATIRNRETEEESIIHCDYVIAADGAKSKIREQLGISTEGRGTIGGYYMNIYFEADLSEFIQGDAFGFSMVLHPEVLGALIPVDNERRWIYHVSYDPLKGERPEDFTIERCKQIIQTAIGSTNVESEIVSVLPWEATESTATKFQDNRIFLVGDSAHIMPPTGGFGSNTGIQDAHNLAWKLAAVIKGKANPKLLETYHEERYPVAKLTTYYASSLLFRAANREESSLNIMDGLAVTVGYQYSSKAIIDDSDNPHRMDSVELNGRPGTRAPHFFGTYDGKEISILDLLGNDFVLLTISENRTWAEYVQNVSSTLGINIKFYSVGLRGDFIAQEDIFSKLYGIENGGAVLIRPDAFIGWRLEKEVVNLDVVLEEVMGNLLCDF
>NC_016779.1|WP_000571876.1|3266234_3266639_+|winged-helix-turn-helix-transcriptional-regulator
MIEMNKQEQLNVIKKDFIDSQKVLLAIGDETRQAILFVLMETECQTGLRVGEITKQTHLSRPAVSHHLRILREAGIILMRKEGTKNFYYIDIRTKLGLLKNLVLDIEKLLHNFYPTLTGSKTPTSEFSESKEFR
>NC_016779.1|WP_000646423.1|3266748_3267747_+|NADP-dependent-oxidoreductase
MKAMIIDKYGKVPMRMAEVPTPEINEYEVLAEIHAASINPIDFKIRDGKVKMLLKYEMPLILGNDFSGVIVKVGSKVTRFKVGDEIYARPRKNKIGTFAEYIAIHEDDIALKPKNLSFEEAASIPLVGLTSYQALHDIMQLQKDQKILIHAGSGGVGTFAIQLAKIMGATVTTTASEAGSDLVKSLGADQIINYKTEKFEEILKDYDAVFDTIGGTTLEKSFNIIKSGGNIVSVSGMPNARFGKEFGSGFFKTLLFSLASKKLTALEKKHNAQYSFLFMKPSGDQLRIIANYIEAGKIKPVIDRVFSFEDAQKAMEYSEAGRAKGKIIVKIK
>NC_016779.1|WP_000164935.1|3267925_3269392_+|YdiU-family-protein
MTKNNEVGWNLDNSYATLPQSFYTEIPPTPVSSPELVKLNHSLAISLGFNPEELKKEAEIAIFAGNALPEGAHPLAQAYAGHQFGHFNMLGDGRALLIGEQITPSGKRFDIQLKGSGPTPYSRRGDGRAALGPMLREYIISEAMYALDIPTTRSLAVVTTGEPTYRETKLPGAILTRVASSHIRVGTFQYAAARGSIEDLQSLADYTIKRHYPEIEAHENRYTALLQEVIKKQASLIAKWQLVGFIHGVMNTDNITISGETIDYGPCAFMDNYDQGTVFSSIDTQGRYAYGNQPYMAAWDLARLAESLIPILHEDEEEALKIAQDEISKFSVQYEKQWFIGMKKKLGLFSNEEQDQSLIEQLFKMMEKYKADYTNTFRSLTLDTLENTPLFDSPEFKEWYKLWQSRLEKQEESKENAYEMMKNNNPSIIPRNHRVEEALEAAVTNGDYSVMEKLLEALANPYAYSTDQEEYCVPPAPTNRPYRTFCGT
>NC_016779.1|WP_001102735.1|3269647_3270742_+|hypothetical-protein
MNVQLQGNEQITKLFNDWYRIILQHQTIEATKIKNDIEDKISNSDKDTNLLLYYSLLNFRYEVLTNGLNITKDAFNKIDSYPIPENNCLTYYYHFFKAIHNTILADYNEAKNHFEKAEKLLKYVPEELELAEFNYRIASFYYQIYKPLLAINYIQQAKIFFSTHTGYEVNLAACDNVFGLSCLDLRQFEQAEESFNSAIDILKKKGEESLLLRTRNNIGLLYANQNLSSLAIRHLSEVTESMPNHFKALYLQADEYLKLGEKESASQFIERGLSVCNKLEIKEYQYRFKILDELCKESNTIEIEKVVLAGVSYFETEELWECIEEYTERIANKFYAEENHFKASKYFYLSNQARKKSLAKGALK
>NC_016779.1|WP_000719639.1|3270741_3270879_+|Phr-family-secreted-Rap-phosphatase-inhibitor
MKKIGLTLSAIALTLILSFGFSHNSKDVALNKGDTWSPAYGLKQA
>NC_016779.1|WP_000275811.1|3270953_3271553_-|protease-synthase/sporulation-negative-transcriptional-regulator-PaiB
MYIPKYFAIQDEKMKYKIIEQNSFATLFSQHNGEPYATHLPLLLNRETLTLHGHFARPNEQWKDIGTQQVLAIFQGPHSYISPSWYETKNAVPTWNYVAVHVYGELELVEDEQELIDSLQDLVDTYEDPQSTYSLNDVDLNYMEGLSKGIVGFKIKISKIEGKAKLSQNHSVERRKLVVGELEKVGSEGSRGIAELMKD
>NC_016779.1|WP_000813611.1|3271687_3272215_-|GrpB-family-protein
MKQRITIEEYNIKWESEFNKLQTLINDVMEDSILSIEHVGSTSIKGLAAKPVLDIDIVIEDYVFFPKVVTKLEAIGYYHQAEWSYKGREAFGRKDAFVPWDGESTDWMEHHLYVCDKESEELRRHIAFRDYLREHEDVAVEYGHLKEELARETKSRTSYSEGKTAFITNILEKIN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_016779_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_016779_4

3480735-3481238

Orphan

Consensus_repeat	Method
NGCNACTGGACCTCANGG	CRT

12 spacers

The CRISPR arrays of NC_016779_4

>merge|NC_016779|4|3480735-3481238|CRT
ACCTACTGGACCTACTGGGCCTACTGGGCCAGCTGGTGCTACTGGACCTCAGGGTGCTCAAGGTAACACAGGTGCTACTGGTGCCACTGGACCTCAAGGTGCTCAAGGTAACACAGGTGCTACTGGTGCCACTGGACCTCAAGGCGCTCAAGGTAACACGGGCGCTACTGGACCTCAGGGTGCTCAAGGTAACACGGGCGCTACTGGACCTCAGGGTGTTCAAGGTAACACGGGCGCTACTGGTGCCACTGGACCTCAAGGTGCTCAAGGTAACACAGGTGCTACTGGTGCCACTGGACCTCAAGGTGCTCAAGGTAACACAGGCGCTACTGGACCTCAAGGCGCTCAAGGACCAGCGGGTGCTACTGGCGCTACTGGACCTCAAGGTGCTCAAGGTAACACAGGTGCTACTGGACCTCAAGGCGCTCAAGGACCAGCGGGTGCTACTGGCGCTACTGGACCTCAAGGTGCTCAAGGTAACACAGGTGCTACTGGACCTCAGGG

>NC_016779|4|2|3480735-3481238|CRT
ACCTACTGGACCTACTGG	GCCTACTGGGCCAGCTGG
TGCTACTGGACCTCAGGG	TGCTCAAGGTAACACAGGTGCTACTGG
TGCCACTGGACCTCAAGG	TGCTCAAGGTAACACAGGTGCTACTGG
TGCCACTGGACCTCAAGG	CGCTCAAGGTAACACGGG
CGCTACTGGACCTCAGGG	TGCTCAAGGTAACACGGG
CGCTACTGGACCTCAGGG	TGTTCAAGGTAACACGGGCGCTACTGG
TGCCACTGGACCTCAAGG	TGCTCAAGGTAACACAGGTGCTACTGG
TGCCACTGGACCTCAAGG	TGCTCAAGGTAACACAGG
CGCTACTGGACCTCAAGG	CGCTCAAGGACCAGCGGGTGCTACTGG
CGCTACTGGACCTCAAGG	TGCTCAAGGTAACACAGG
TGCTACTGGACCTCAAGG	CGCTCAAGGACCAGCGGGTGCTACTGG
CGCTACTGGACCTCAAGG	TGCTCAAGGTAACACAGG
TGCTACTGGACCTCAGGG

Protein	Signature genes	Signature genes Name	Protein_function
NC_016779.1\|WP_000391400.1\|3475852_3477127_-\|GTPase-HflX	unknown	unknown	gnl\|CDD\|274455
NC_016779.1\|WP_000957268.1\|3489281_3490034_-\|DeoR/GlpR-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224268
NC_016779.1\|WP_000438185.1\|3478112_3479069_-\|stage-V-sporulation-protein-K	unknown	unknown	gnl\|CDD\|163057
NC_016779.1\|WP_000460285.1\|3474588_3475860_-\|methionine-gamma-lyase-family-protein	unknown	unknown	gnl\|CDD\|311036
NC_016779.1\|WP_000734626.1\|3485222_3486155_-\|SH3-domain-containing-protein	unknown	unknown	gnl\|CDD\|226112
NC_016779.1\|WP_000813896.1\|3483533_3483758_-\|RNA-chaperone-Hfq	unknown	unknown	gnl\|CDD\|179001
NC_016779.1\|WP_000504940.1\|3483779_3484733_-\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	unknown	unknown	gnl\|CDD\|234626
NC_016779.1\|WP_000228316.1\|3491472_3492015_-\|DUF420-domain-containing-protein	unknown	unknown	gnl\|CDD\|225204
NC_016779.1\|WP_000656783.1\|3474024_3474414_-\|transcriptional-repressor-GlnR	unknown	unknown	gnl\|CDD\|133380
NC_016779.1\|WP_000976118.1\|3470655_3471459_-\|DUF4097-family-beta-strand-repeat-protein	unknown	unknown	gnl\|CDD\|372574
NC_016779.1\|WP_000704641.1\|3486503_3488360_-\|PTS-sugar-transporter-subunit-IIA	unknown	unknown	gnl\|CDD\|182066
NC_016779.1\|WP_000312272.1\|3477219_3477843_+\|trimeric-intracellular-cation-channel-family-protein	unknown	unknown	gnl\|CDD\|225415
NC_016779.1\|WP_000135328.1\|3472641_3473976_-\|type-I-glutamate--ammonia-ligase	unknown	unknown	gnl\|CDD\|273198
NC_016779.1\|WP_000814423.1\|3484914_3485160_+\|hypothetical-protein	unknown	unknown	unknown
NC_016779.1\|WP_000032393.1\|3471459_3472002_-\|DUF1700-domain-containing-protein	unknown	unknown	gnl\|CDD\|285278
NC_016779.1\|WP_000640849.1\|3488373_3489285_-\|1-phosphofructokinase	unknown	unknown	gnl\|CDD\|238570
NC_016779.1\|WP_000450309.1\|3479182_3480148_+\|tyrosine-type-recombinase/integrase	unknown	unknown	gnl\|CDD\|227308
NC_016779.1\|WP_001989514.1\|3492326_3492668_-\|hypothetical-protein	unknown	unknown	unknown
NC_016779.1\|WP_001102624.1\|3471994_3472318_-\|PadR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224609
NC_016779.1\|WP_001179102.1\|3490192_3491356_-\|iron-containing-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|341466

Protein	Function_ID	Function_description	E-value
NC_016779.1\|WP_000391400.1\|3475852_3477127_-\|GTPase-HflX	gnl\|CDD\|274455	TIGR03156, GTP_HflX, GTP-binding protein HflX. This protein family is one of a number of homologous small, well-conserved GTP-binding proteins with pleiotropic effects. Bacterial members are designated HflX, following the naming convention in Escherichia coli where HflX is encoded immediately downstream of the RNA chaperone Hfq, and immediately upstream of HflKC, a membrane-associated protease pair with an important housekeeping function. Over large numbers of other bacterial genomes, the pairing with hfq is more significant than with hflK and hlfC. The gene from Homo sapiens in this family has been named PGPL (pseudoautosomal GTP-binding protein-like). [Unknown function, General].	0
NC_016779.1\|WP_000957268.1\|3489281_3490034_-\|DeoR/GlpR-transcriptional-regulator	gnl\|CDD\|224268	COG1349, GlpR, Transcriptional regulators of sugar metabolism [Transcription / Carbohydrate transport and metabolism].	8.90772e-82
NC_016779.1\|WP_000438185.1\|3478112_3479069_-\|stage-V-sporulation-protein-K	gnl\|CDD\|163057	TIGR02881, Stage_V_sporulation_protein_K, stage V sporulation protein K. Members of this protein family are the stage V sporulation protein K (SpoVK), a close homolog of the Rubisco expression protein CbbX (TIGR02880) and a members of the ATPase family associated with various cellular activities (pfam00004). Members are strictly limited to bacterial endospore-forming species, but are not universal in this group and are missing from the Clostridium group. [Cellular processes, Sporulation and germination].	1.45261e-155
NC_016779.1\|WP_000460285.1\|3474588_3475860_-\|methionine-gamma-lyase-family-protein	gnl\|CDD\|311036	pfam06838, Met_gamma_lyase, Methionine gamma-lyase. This is a putative pyridoxal 5'-phosphate-dependent methionine gamma-lyase enzyme involved in methionine catabolism.	0
NC_016779.1\|WP_000734626.1\|3485222_3486155_-\|SH3-domain-containing-protein	gnl\|CDD\|226112	COG3584, COG3584, Uncharacterized protein conserved in bacteria [Function unknown].	3.45308e-35
NC_016779.1\|WP_000813896.1\|3483533_3483758_-\|RNA-chaperone-Hfq	gnl\|CDD\|179001	PRK00395, hfq, RNA-binding protein Hfq; Provisional.	3.4363e-41
NC_016779.1\|WP_000504940.1\|3483779_3484733_-\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	gnl\|CDD\|234626	PRK00091, miaA, tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed.	5.63434e-166
NC_016779.1\|WP_000228316.1\|3491472_3492015_-\|DUF420-domain-containing-protein	gnl\|CDD\|225204	COG2322, COG2322, Predicted membrane protein [Function unknown].	1.75148e-56
NC_016779.1\|WP_000656783.1\|3474024_3474414_-\|transcriptional-repressor-GlnR	gnl\|CDD\|133380	cd01105, HTH_GlnR-like, Helix-Turn-Helix DNA binding domain of GlnR-like transcription regulators. Helix-turn-helix (HTH) transcription regulator GlnR and related proteins, N-terminal domain. The GlnR and TnrA (also known as ScgR) proteins have been shown to regulate expression of glutamine synthetase as well as several genes involved in nitrogen metabolism. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain predicted winged HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules.	1.14369e-23
NC_016779.1\|WP_000976118.1\|3470655_3471459_-\|DUF4097-family-beta-strand-repeat-protein	gnl\|CDD\|372574	pfam13349, DUF4097, Putative adhesin. This has a putative all-beta structure with a twenty-residue repeat with a highly conserved repeating GD, gly-asp, motif. It may form part of a bacterial adhesin.	1.48318e-19
NC_016779.1\|WP_000704641.1\|3486503_3488360_-\|PTS-sugar-transporter-subunit-IIA	gnl\|CDD\|182066	PRK09765, PRK09765, PTS system 2-O-a-mannosyl-D-glycerate specific transporter subunit IIABC; Provisional.	3.73704e-140
NC_016779.1\|WP_000312272.1\|3477219_3477843_+\|trimeric-intracellular-cation-channel-family-protein	gnl\|CDD\|225415	COG2860, COG2860, Predicted membrane protein [Function unknown].	1.58902e-60
NC_016779.1\|WP_000135328.1\|3472641_3473976_-\|type-I-glutamate--ammonia-ligase	gnl\|CDD\|273198	TIGR00653, Glutamine_synthetase, glutamine synthetase, type I. Alternate name: glutamate--ammonia ligase. This model represents the dodecameric form, which can be subdivided into 1-alpha and 1-beta forms. The phylogeny of the 1-alpha and 1-beta forms appears polyphyletic. E. coli, Synechocystis PCC6803, Aquifex aeolicus, and the crenarcheon Sulfolobus acidocaldarius have form 1-beta, while Bacillus subtilis, Thermotoga maritima, and various euryarchaea has form 1-alpha. The 1-beta dodecamer from the crenarcheon Sulfolobus acidocaldarius differs from that in E. coli in that it is not regulated by adenylylation. [Amino acid biosynthesis, Glutamate family].	0
NC_016779.1\|WP_000032393.1\|3471459_3472002_-\|DUF1700-domain-containing-protein	gnl\|CDD\|285278	pfam08006, DUF1700, Protein of unknown function (DUF1700). This family contains many hypothetical bacterial proteins and putative membrane proteins.	4.79006e-84
NC_016779.1\|WP_000640849.1\|3488373_3489285_-\|1-phosphofructokinase	gnl\|CDD\|238570	cd01164, FruK_PfkB_like, 1-phosphofructokinase (FruK), minor 6-phosphofructokinase (pfkB) and related sugar kinases. FruK plays an important role in the predominant pathway for fructose utilisation.This group also contains tagatose-6-phophate kinase, an enzyme of the tagatose 6-phosphate pathway, which responsible for breakdown of the galactose moiety during lactose metabolism by bacteria such as L. lactis.	1.01573e-142
NC_016779.1\|WP_000450309.1\|3479182_3480148_+\|tyrosine-type-recombinase/integrase	gnl\|CDD\|227308	COG4974, XerD, Site-specific recombinase XerD [DNA replication, recombination, and repair].	2.42194e-13
NC_016779.1\|WP_001102624.1\|3471994_3472318_-\|PadR-family-transcriptional-regulator	gnl\|CDD\|224609	COG1695, COG1695, Predicted transcriptional regulators [Transcription].	1.87607e-24
NC_016779.1\|WP_001179102.1\|3490192_3491356_-\|iron-containing-alcohol-dehydrogenase	gnl\|CDD\|341466	cd08187, BDH, Butanol dehydrogenase catalyzes the conversion of butyraldehyde to butanol with the cofactor NAD(P)H being oxidized in the process. The butanol dehydrogenase (BDH) is involved in the final step of the butanol formation pathway in anaerobic micro-organism. Butanol dehydrogenase catalyzes the conversion of butyraldehyde to butanol with the cofactor NAD(P)H being oxidized in the process. Activity in the reverse direction is 50-fold lower than that in the forward direction. The NADH-BDH has higher activity with longer chained aldehydes and is inhibited by metabolites containing an adenine moiety. This protein family belongs to the so-called iron-containing alcohol dehydrogenase superfamily. Since members of this superfamily use different divalent ions, preferentially iron or zinc, it has been suggested to be renamed to family III metal-dependent polyol dehydrogenases. This family also includes E. coli YqhD enzyme, an NADP-dependent dehydrogenase whose activity measurements with several alcohols demonstrate preference for alcohols longer than C3. The active site of YqhD contains a Zn metal, and a modified NADPH cofactor bearing OH groups on the saturated C5 and C6 atoms, possibly due to oxygen stress on the enzyme, which would functionally work under anaerobic conditions.	0

>NC_016779.1|WP_000450309.1|3479182_3480148_+|tyrosine-type-recombinase/integrase
METTEFHDTIQAFSIFLLNKGRKPSTIKRYVYDIEDFGHWLEKNKKLPSSNIWATLCTKDYEDYFSDLKKNRHYSEKTMHRVFIVLNRMHHFLNIPNPLKNMEISIQPDRTLRNEDFISSDEEKRLKHIVTSLEGLSEKQRPVRPLLMDRNIAILNLLIDYGLSLQELTALTMHHVHFETNTLSIPATAGVERTISLTSEDKKQLYTYYKSIPEPVRPKYHSNDPLFVAFDFNRGTYRWVYENDAPKGLTEIAIQKMIRLEVSRANLRKGISGQHFRNTYILNLIKKETPESEIIKLAGFKSKISLKRYYQYAENGKNALS
>NC_016779.1|WP_000438185.1|3478112_3479069_-|stage-V-sporulation-protein-K
MEQSMRKKNNNQINIVLNHRKKISLPAAENKTVISSETTTKHEMLQRIEEEMGKLVGMDDIKKIIKEIYAWIYVNKKRQEIGLKSEKQVLHMLFKGNPGTGKTTVARMIGKLLFEMNILSKGHLVEAERADLVGEYIGHTAQKTRDLIKKAMGGILFIDEAYSLARGGEKDFGKEAIDTLVKHMEDKQHGFVLILAGYSREMNHFLSLNPGLQSRFPFIIEFADYSVNQLLEIGKRMYEEREYQLSKEAEWKFRDHLHAVKYSSQITSFSNGRYVRNIVEKSIRTQAMRLLQEDAYDKYDLVGISSSDLMLEEETHST
>NC_016779.1|WP_000312272.1|3477219_3477843_+|trimeric-intracellular-cation-channel-family-protein
MAWEIFSIIGTIAFALSGAIVAMEEDYDIFGVYILGMATAFGGGALRNLLIGYPIVAFWQQDMLFQIALLSMTIIFLFPNKLIRHWKKWENITDAIGLSAFAVQGALYAQKLNLPISATIVAAVLTGIGGGIIRDLLARRKPLVLRAEVYAFWTILAGFLIGAQIIVSDWALYTLFILIVCFRMVSIHYKWHLPHRRIDTNERSMHK
>NC_016779.1|WP_000391400.1|3475852_3477127_-|GTPase-HflX
MEEKEKVILVGCQLPQDDDEKFMHSMKELASLAKTARAELLVSTTQKRPKFHPATYIGKGKLEELTMLTEELEPDVIVFNNELTPSQIRNLSSVLDARVIDRTQLILDIFAQRAKSREGKLQVELAQLQYTMPRLMGQGLSLSRLGGGIGTRGPGETKLETDRRHIRSRIDEIKKQLAVVVEHRKRYRERRKDNKVFQVSLIGYTNAGKSTLFNRLTEADTFEENLLFATLDPTTRKMPLPSGYTVLLTDTVGFIQDLPTSLIAAFRSTLEEAGEADVILHVVDSADPNYVGHEKTVKQLLSELEINHIPIITLYNKKDELHQNFIPFPKNDFLMTSAFEEKDLLHIKEAIETKMKEEMNRYQVEIPPSEGKLLTLLKTETLLTKMEFLEDKFVYDCAGYIFAHSSLNVQLKRFLVEEGENKNV
>NC_016779.1|WP_000460285.1|3474588_3475860_-|methionine-gamma-lyase-family-protein
MFDRLKNGEKIAPIVKEVESQITEVHKLADEVIESNQFRVLESFRKHKISDSHFIPTTGYGYDDIGRDTLEKVYADVFGAEAGLVRPQIISGTHAISTALFGILRPGDELLYITGKPYDTLEEIVGVRGKGVGSFKEYNIGYNAVPLTEEGLVDLGAVAAAIHSNTKMIGIQRSKGYATRPSFTISQIKEMIAFVKEIKPDVVVFVDNCYGEFIEEQEPCHVGADLMAGSLIKNPGGGIVKTGGYIVGKEQYVEACAYRLTSPGIGAEAGASLYSLQEMYQGFFLAPHVAGQALKGAIFTAAFLEKLGMNTSPAWNAPRTDLIQSVQFDDKDRMIAFCQAIQYASPINSHFTPYANYMPGYEDDVIMAAGTFIQGASIELSADGPIRPPYVAYVQGGLTYSHVKIAICSAIDALIEKELLTIS
>NC_016779.1|WP_000656783.1|3474024_3474414_-|transcriptional-repressor-GlnR
MKEDRRSAPLFPIGIVMDLTQLSARQIRYYEEHNLVSPTRTKGNRRLFSFNDVDKLLEIKDLLDQGLNMAGIKQVLLMKENQTEAVKVKEETKEISKTELRKILRDELQHTGRFNRTSLRQGDISRFFH
>NC_016779.1|WP_000135328.1|3472641_3473976_-|type-I-glutamate--ammonia-ligase
MARYTKEDIFRLAKEENVKYIRLQFTDLLGVIKNVEIPVSQLTKALDNKMMFDGSSIEGFVRIEESDMYLYPDLDTWVIFPWTAEKGKVARLICDIYNADGTPFEGDPRNNLKRVLKEMEALGFSDFNLGPEPEFFLFKVDEKGNPTLELNDNGGYFDLAPMDLGENCRRDIVLELEEMGFEIEASHHEVAPGQHEIDFKYANAIRSCDDIQTFKLVVKTIARKHGLHATFMPKPLYGVNGSGMHCNLSLFKNGENVFFDQNGDLQLSDDARHFIAGILKHAPAFTAVANPTVNSYKRLVPGYEAPCYVAWSAQNRSPLVRIPASRGISTRVEVRSVDPAANPYLVMATLLAAGLDGIKNKLTPPAAVDRNIYVMTKEEREEAGIVDLPATLAQALVTLQSNEVISNALGDHLLEHFIEAKEIEWDIFRTQVHQWERDQYMSLY
>NC_016779.1|WP_001102624.1|3471994_3472318_-|PadR-family-transcriptional-regulator
MNVQFKKGVLELCVLALVKRKDCYGYELVQQISNKFLISEGSVYPLLRRLTKEGYFQTYLKESTEGPPRKYYQLTEQGGTQLNLLVTEWRDFAKGVQEIIEGVQWDE
>NC_016779.1|WP_000032393.1|3471459_3472002_-|DUF1700-domain-containing-protein
MSKEQFLKELSSHLRKLPDEERKDILFDYEEHFQFGIEEGKNESDIIKGLGSPKVIAKELLAMYRFDEMKKDPSTSNVTRAVMAAIGLSLFNFIIVLGPLLAIIAFIFSFWVGGIVSVVTPFFVIGKVFMGTFIWLDLFVSITFVGVGLLLCIIAYYSTKWFKRLCVRYVIWNFKMIKGE
>NC_016779.1|WP_000976118.1|3470655_3471459_-|DUF4097-family-beta-strand-repeat-protein
MMKKILLVAIACIIIGVIGISQTYEKAVQTAEKGNKEDIIKNETLKNIEVKLDAGDIAIQKSPDSSFYVKQSGDARKQELRIAEDGDTLKIIGKREKGASFDFSFYDFKFQTSTLTLLVPERSYQDVKVNSSAGQIEISDLKSERVSVETVAGEVNLKHVTAKNVEGATKAGEMNFKKVKGKVSTKTTSGEINILDHDATFNLEASSTAGDIDITLSEKPQDAIITGQSAAGDVTIFNEENNNVTIGNGSKKISGKTTAGDITIATR
>NC_016779.1|WP_000813896.1|3483533_3483758_-|RNA-chaperone-Hfq
MKQSINIQDQFLNQLRKENTFVTLYLLNGFQLRGLIKGFDNFTVLLETEGKQQLIYKHAISTFVPQKNVSIELE
>NC_016779.1|WP_000504940.1|3483779_3484733_-|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA
MGEVQREKVAVIIGPTAVGKTKLSIDLAKALNGEIISGDSMQIYRTMDIGTAKVTKEEMDGIPHYMVDIKNPEESFSVAEFQERVRKHIREITERGKLPIIVGGTGLYIQSVLFDYQFTDDAGDAIYREQMEKLALERGVEYVHKKLQEVDPESAERIHANNVRRVIRALEIFHTSGEKMSDQLEKQENELLYDVSLIGLTMDREMLYDRINLRVDIMMDQGLLEEVEGLYNRGIRDCQSIQAIGYKEIYDYFEDRVSLEEAVSQLKTNSRRYAKRQLTWFRNKMDVTWFDVTDGEKTSEILRYIEGKLQLKSNNSK
>NC_016779.1|WP_000814423.1|3484914_3485160_+|hypothetical-protein
MKQSTINFSSLTKDLILATATKEQNCSQEELYFALNCLLRSFHSTLQETTLHTENKNTEYVQNQFCSAYKIITGKTIYPFQ
>NC_016779.1|WP_000734626.1|3485222_3486155_-|SH3-domain-containing-protein
MKKLLGIATAAVFGLGIFAGSAKAETIVTTDVLNVRENPTVESKLVGKMLSGNKLDVINTENGWTKIKVNGKEAFVSAEFTKSTYYVTAGVLNVRAGANTDSEILGKLNKDDVIETTNQVQNEWLQFDYNGKVGYVHVPFLTGTAPVVEKKEVVTQEEAPVRVNAPVKNNKVVKNKESVKNVESSKPVAKAKPAVQQVTKSKGTSAPAGGREITVEATAYTAHPSENGTYGGRVLTAMGHDLTANPNMKVIAVDPKVIPLGSKVWVEGYGEAIAGDTGGAIKGNRIDVLVGSDGSANSWGRKSVKVKVIE
>NC_016779.1|WP_000704641.1|3486503_3488360_-|PTS-sugar-transporter-subunit-IIA
MKITELLKRDTVIMNLTASNKEAVIDELVEKLNGANRLNSKAEFKEAILKRESQSTTGIGEGIAIPHAKTKAVKQPAICFGRSVSGINYESLDGQPAHLFFMIAASEGANNTHLETLSRLSTLLMDEGFRKQLLEAKDEEELLRLFDEKESEKEEEVEVAQPEGNEPYVLAVTACPTGIAHTYMAADSLKAKAAELGIAIKVETNGSTGIKNGLTKVDIEGATAIIVAADKQVEMNRFAGKHVIQVPVADGIRKTEKLLNRAVKQDAPIFKGIKEDGKTESTEKEKGLGIYKHLMNGVSNMLPFVVGGGILIALAFSFGGIKAEGPLAELFMSIGGGGTGAFLFLVPILAGFIASSIADRPGFMPGVVGGFLAAHANAGFLGGLIAGFLAGYVVLGLKRLFSGLPVQLEGIKPVLLYPVFGLLITGVVMQKVVIPPVVALNEMLTGWLNGLNGTNAILLGLILGAMMAIDMGGPINKAAFTFGIAAIEAQNFGVHSAVMAGGMVPPLAIAFATTFFKSKFTEAERKSGLTNYIMGASFITEGAIPFAAADPVRVIVSCVVGSSIAGALSMLFQITLPAPHGGLFVIALVNKPVLYIFSILIGAVVSALMMGIWKKKVK
>NC_016779.1|WP_000640849.1|3488373_3489285_-|1-phosphofructokinase
MIYTVTLNPSIDYVVQVNSLDLGAVNRAEKDMKFPGGKGINVSRVLHRLGVENVALGFTGGFTGRFIKDVLQTEGVITNFVQVDGDSRINVKIKGQEETELNGQGPSVTNEQFEQLMKQIESMQKGDYVVLAGSVPASIPTTFYESIAAFGAEKGIRVVVDASGSALQHVVKNKPFLIKPNHHELGELFGVEISTAEDILPYGRKLIEQGVEHVIVSMAGDGALLFTEEGIYEATVPKGVVINSVGAGDSLVAGFVGKYEQTKDIEKAFQYGVATGSATAFSADLCEKEKVEELLSQVIVTKR
>NC_016779.1|WP_000957268.1|3489281_3490034_-|DeoR/GlpR-transcriptional-regulator
MLTPERHQMILQLVKEQKVVKLQQLVERTASSESTIRRDLAQLEKQRLLKRVHGGAAVLTGKGQEPTMVEKSSKNIQIKQQIAKYAASVVEQGDCIYLDAGSTTFEMIPFLINKDVTVVTNGLMHIEALVENNIRAYLLGGMMKSRTKALIGAMAQESMQKYRFDKCFLGANGVHEQLGFTTPDPEEALLKQMALTLANEGYFLIDESKFSEVAFAKIANVEEANIITNHLEIDLEKYKRQTNVIEADKQ
>NC_016779.1|WP_001179102.1|3490192_3491356_-|iron-containing-alcohol-dehydrogenase
MQNFVFRNPTKLIFGKGQLEQLKTEIPQFGKKVLLVYGGGSIKRNGIYDNVISILKEINAEVFELTGVEPNPRVSTVKKGIQICKDNGVEFILAVGGGSVIDCTKAIAAGSKYDGDVWDIVTKKTFASEALPFGTVLTLAATGSEMNAGSVITNWETNEKYGWGSPVTFPQFSILDPAHTASVPKDQTIYGMVDIMSHVLEQYFHHGTNTELQDRYCESVLKTVIETAPKLLSDLENYEHRETILYCGTMALNGILAMGVKGDWATHNIEHAVSAVHDIPHGGGLAILFPNWMKHVVDENVSRFKQFAIRVFDVKTDGKTDREIALEGIEALRQFWTSIEAPVTLSDYAIGENEIDVMADKAMAYGEFGNFKKLNKDDVLSIYRASL
>NC_016779.1|WP_000228316.1|3491472_3492015_-|DUF420-domain-containing-protein
MVDQSTNQKSYAPIVITLSVIVNAIILFLFFGPVGYEGEVHFDVTILPMLNAIFNSFTFVFLLAALYSIIKKNVKMHRGFILAAFTTTLLFCVSYLSYHYLAPATHFGGEGFIKYVYFIILITHIILAAIIVPLALFALVFGFTNQLTRHRKIVRWTMPIWLYVSLSGVIVYLMISPYYQ
>NC_016779.1|WP_001989514.1|3492326_3492668_-|hypothetical-protein
MIKKEGGMTMEEYVLELYNLLYTTEWQDIVSFLGIVFCMKIVIVYMEEQGMFYSFSSPFDMQREPLLNYAKVNYEQFPFVVFFMIRFITAIVKKKESDDEECHSTCNVANVFS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_016779_5

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_016779_5

3481332-3482051

Orphan

Consensus_repeat	Method
TCAAGGNNNNNCAGGTGC	CRT

16 spacers

The CRISPR arrays of NC_016779_5

>merge|NC_016779|5|3481332-3482051|CRT
TCAAGGTAACACAGGTGCTACTGGTGCCACTGGACCTCAAGGCGCTCAAGGACCAGCAGGTGCTACTGGCGCTACTGGACCTCAAGGCGTTCAAGGTAACACAGGTGCTACTGGCGCTACTGGACCTCAAGGCGTTCAAGGTAACACAGGTGCTACTGGACCTCAGGGTGTTCAAGGTAACACAGGTGCTACTGGCGCTACTGGACCTCAAGGCGTTCAAGGTAACACAGGTGCTACTGGCGCTACTGGACCTCAGGGTGTTCAAGGACCAGCGGGTGCTACCGGTGCCACTGGACCTCAAGGTATTCAAGGACCAGCAGGTGCTACTGGCGCTACTGGACCTCAAGGCGTTCAAGGTAACACGGGTGCTACTGGTGCCACTGGACCTCAAGGTGTTCAAGGGCCAGCAGGTGCTACCGGTGCCACTGGACCTCAAGGTGTTCAAGGGCCAGCAGGTGCTACCGGTGCTACTGGACCTCAAGGTGTTCAAGGACCAGCAGGTGCTACCGGTGCTACTGGACCTCAAGGTGTTCAAGGGCCAGCAGGTGCTACCGGTGCCACTGGACCTCAAGGTGTTCAAGGTAACACGGGTGCTACTGGTGCCACTGGACCTCAAGGTGCTCAAGGTAACACGGGCGCTACTGGACCTCAAGGTGTTCAAGGACCAGCAGGTGCTACTGGCGCTACTGGACCTCAAGGTGCTCAAGGACCAGCAGGTGC

>NC_016779|5|3|3481332-3482051|CRT
TCAAGGTAACACAGGTGC	TACTGGTGCCACTGGACCTCAAGGCGC
TCAAGGACCAGCAGGTGC	TACTGGCGCTACTGGACCTCAAGGCGT
TCAAGGTAACACAGGTGC	TACTGGCGCTACTGGACCTCAAGGCGT
TCAAGGTAACACAGGTGC	TACTGGACCTCAGGGTGT
TCAAGGTAACACAGGTGC	TACTGGCGCTACTGGACCTCAAGGCGT
TCAAGGTAACACAGGTGC	TACTGGCGCTACTGGACCTCAGGGTGT
TCAAGGACCAGCGGGTGC	TACCGGTGCCACTGGACCTCAAGGTAT
TCAAGGACCAGCAGGTGC	TACTGGCGCTACTGGACCTCAAGGCGT
TCAAGGTAACACGGGTGC	TACTGGTGCCACTGGACCTCAAGGTGT
TCAAGGGCCAGCAGGTGC	TACCGGTGCCACTGGACCTCAAGGTGT
TCAAGGGCCAGCAGGTGC	TACCGGTGCTACTGGACCTCAAGGTGT
TCAAGGACCAGCAGGTGC	TACCGGTGCTACTGGACCTCAAGGTGT
TCAAGGGCCAGCAGGTGC	TACCGGTGCCACTGGACCTCAAGGTGT
TCAAGGTAACACGGGTGC	TACTGGTGCCACTGGACCTCAAGGTGC
TCAAGGTAACACGGGCGC	TACTGGACCTCAAGGTGT
TCAAGGACCAGCAGGTGC	TACTGGCGCTACTGGACCTCAAGGTGC
TCAAGGACCAGCAGGTGC

Protein	Signature genes	Signature genes Name	Protein_function
NC_016779.1\|WP_000391400.1\|3475852_3477127_-\|GTPase-HflX	unknown	unknown	gnl\|CDD\|274455
NC_016779.1\|WP_000957268.1\|3489281_3490034_-\|DeoR/GlpR-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224268
NC_016779.1\|WP_000438185.1\|3478112_3479069_-\|stage-V-sporulation-protein-K	unknown	unknown	gnl\|CDD\|163057
NC_016779.1\|WP_000460285.1\|3474588_3475860_-\|methionine-gamma-lyase-family-protein	unknown	unknown	gnl\|CDD\|311036
NC_016779.1\|WP_000734626.1\|3485222_3486155_-\|SH3-domain-containing-protein	unknown	unknown	gnl\|CDD\|226112
NC_016779.1\|WP_000813896.1\|3483533_3483758_-\|RNA-chaperone-Hfq	unknown	unknown	gnl\|CDD\|179001
NC_016779.1\|WP_000504940.1\|3483779_3484733_-\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	unknown	unknown	gnl\|CDD\|234626
NC_016779.1\|WP_000228316.1\|3491472_3492015_-\|DUF420-domain-containing-protein	unknown	unknown	gnl\|CDD\|225204
NC_016779.1\|WP_000656783.1\|3474024_3474414_-\|transcriptional-repressor-GlnR	unknown	unknown	gnl\|CDD\|133380
NC_016779.1\|WP_000976118.1\|3470655_3471459_-\|DUF4097-family-beta-strand-repeat-protein	unknown	unknown	gnl\|CDD\|372574
NC_016779.1\|WP_000704641.1\|3486503_3488360_-\|PTS-sugar-transporter-subunit-IIA	unknown	unknown	gnl\|CDD\|182066
NC_016779.1\|WP_000312272.1\|3477219_3477843_+\|trimeric-intracellular-cation-channel-family-protein	unknown	unknown	gnl\|CDD\|225415
NC_016779.1\|WP_000135328.1\|3472641_3473976_-\|type-I-glutamate--ammonia-ligase	unknown	unknown	gnl\|CDD\|273198
NC_016779.1\|WP_000814423.1\|3484914_3485160_+\|hypothetical-protein	unknown	unknown	unknown
NC_016779.1\|WP_000032393.1\|3471459_3472002_-\|DUF1700-domain-containing-protein	unknown	unknown	gnl\|CDD\|285278
NC_016779.1\|WP_000640849.1\|3488373_3489285_-\|1-phosphofructokinase	unknown	unknown	gnl\|CDD\|238570
NC_016779.1\|WP_000450309.1\|3479182_3480148_+\|tyrosine-type-recombinase/integrase	unknown	unknown	gnl\|CDD\|227308
NC_016779.1\|WP_001989514.1\|3492326_3492668_-\|hypothetical-protein	unknown	unknown	unknown
NC_016779.1\|WP_001102624.1\|3471994_3472318_-\|PadR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224609
NC_016779.1\|WP_001179102.1\|3490192_3491356_-\|iron-containing-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|341466

Protein	Function_ID	Function_description	E-value
NC_016779.1\|WP_000391400.1\|3475852_3477127_-\|GTPase-HflX	gnl\|CDD\|274455	TIGR03156, GTP_HflX, GTP-binding protein HflX. This protein family is one of a number of homologous small, well-conserved GTP-binding proteins with pleiotropic effects. Bacterial members are designated HflX, following the naming convention in Escherichia coli where HflX is encoded immediately downstream of the RNA chaperone Hfq, and immediately upstream of HflKC, a membrane-associated protease pair with an important housekeeping function. Over large numbers of other bacterial genomes, the pairing with hfq is more significant than with hflK and hlfC. The gene from Homo sapiens in this family has been named PGPL (pseudoautosomal GTP-binding protein-like). [Unknown function, General].	0
NC_016779.1\|WP_000957268.1\|3489281_3490034_-\|DeoR/GlpR-transcriptional-regulator	gnl\|CDD\|224268	COG1349, GlpR, Transcriptional regulators of sugar metabolism [Transcription / Carbohydrate transport and metabolism].	8.90772e-82
NC_016779.1\|WP_000438185.1\|3478112_3479069_-\|stage-V-sporulation-protein-K	gnl\|CDD\|163057	TIGR02881, Stage_V_sporulation_protein_K, stage V sporulation protein K. Members of this protein family are the stage V sporulation protein K (SpoVK), a close homolog of the Rubisco expression protein CbbX (TIGR02880) and a members of the ATPase family associated with various cellular activities (pfam00004). Members are strictly limited to bacterial endospore-forming species, but are not universal in this group and are missing from the Clostridium group. [Cellular processes, Sporulation and germination].	1.45261e-155
NC_016779.1\|WP_000460285.1\|3474588_3475860_-\|methionine-gamma-lyase-family-protein	gnl\|CDD\|311036	pfam06838, Met_gamma_lyase, Methionine gamma-lyase. This is a putative pyridoxal 5'-phosphate-dependent methionine gamma-lyase enzyme involved in methionine catabolism.	0
NC_016779.1\|WP_000734626.1\|3485222_3486155_-\|SH3-domain-containing-protein	gnl\|CDD\|226112	COG3584, COG3584, Uncharacterized protein conserved in bacteria [Function unknown].	3.45308e-35
NC_016779.1\|WP_000813896.1\|3483533_3483758_-\|RNA-chaperone-Hfq	gnl\|CDD\|179001	PRK00395, hfq, RNA-binding protein Hfq; Provisional.	3.4363e-41
NC_016779.1\|WP_000504940.1\|3483779_3484733_-\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	gnl\|CDD\|234626	PRK00091, miaA, tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed.	5.63434e-166
NC_016779.1\|WP_000228316.1\|3491472_3492015_-\|DUF420-domain-containing-protein	gnl\|CDD\|225204	COG2322, COG2322, Predicted membrane protein [Function unknown].	1.75148e-56
NC_016779.1\|WP_000656783.1\|3474024_3474414_-\|transcriptional-repressor-GlnR	gnl\|CDD\|133380	cd01105, HTH_GlnR-like, Helix-Turn-Helix DNA binding domain of GlnR-like transcription regulators. Helix-turn-helix (HTH) transcription regulator GlnR and related proteins, N-terminal domain. The GlnR and TnrA (also known as ScgR) proteins have been shown to regulate expression of glutamine synthetase as well as several genes involved in nitrogen metabolism. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain predicted winged HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules.	1.14369e-23
NC_016779.1\|WP_000976118.1\|3470655_3471459_-\|DUF4097-family-beta-strand-repeat-protein	gnl\|CDD\|372574	pfam13349, DUF4097, Putative adhesin. This has a putative all-beta structure with a twenty-residue repeat with a highly conserved repeating GD, gly-asp, motif. It may form part of a bacterial adhesin.	1.48318e-19
NC_016779.1\|WP_000704641.1\|3486503_3488360_-\|PTS-sugar-transporter-subunit-IIA	gnl\|CDD\|182066	PRK09765, PRK09765, PTS system 2-O-a-mannosyl-D-glycerate specific transporter subunit IIABC; Provisional.	3.73704e-140
NC_016779.1\|WP_000312272.1\|3477219_3477843_+\|trimeric-intracellular-cation-channel-family-protein	gnl\|CDD\|225415	COG2860, COG2860, Predicted membrane protein [Function unknown].	1.58902e-60
NC_016779.1\|WP_000135328.1\|3472641_3473976_-\|type-I-glutamate--ammonia-ligase	gnl\|CDD\|273198	TIGR00653, Glutamine_synthetase, glutamine synthetase, type I. Alternate name: glutamate--ammonia ligase. This model represents the dodecameric form, which can be subdivided into 1-alpha and 1-beta forms. The phylogeny of the 1-alpha and 1-beta forms appears polyphyletic. E. coli, Synechocystis PCC6803, Aquifex aeolicus, and the crenarcheon Sulfolobus acidocaldarius have form 1-beta, while Bacillus subtilis, Thermotoga maritima, and various euryarchaea has form 1-alpha. The 1-beta dodecamer from the crenarcheon Sulfolobus acidocaldarius differs from that in E. coli in that it is not regulated by adenylylation. [Amino acid biosynthesis, Glutamate family].	0
NC_016779.1\|WP_000032393.1\|3471459_3472002_-\|DUF1700-domain-containing-protein	gnl\|CDD\|285278	pfam08006, DUF1700, Protein of unknown function (DUF1700). This family contains many hypothetical bacterial proteins and putative membrane proteins.	4.79006e-84
NC_016779.1\|WP_000640849.1\|3488373_3489285_-\|1-phosphofructokinase	gnl\|CDD\|238570	cd01164, FruK_PfkB_like, 1-phosphofructokinase (FruK), minor 6-phosphofructokinase (pfkB) and related sugar kinases. FruK plays an important role in the predominant pathway for fructose utilisation.This group also contains tagatose-6-phophate kinase, an enzyme of the tagatose 6-phosphate pathway, which responsible for breakdown of the galactose moiety during lactose metabolism by bacteria such as L. lactis.	1.01573e-142
NC_016779.1\|WP_000450309.1\|3479182_3480148_+\|tyrosine-type-recombinase/integrase	gnl\|CDD\|227308	COG4974, XerD, Site-specific recombinase XerD [DNA replication, recombination, and repair].	2.42194e-13
NC_016779.1\|WP_001102624.1\|3471994_3472318_-\|PadR-family-transcriptional-regulator	gnl\|CDD\|224609	COG1695, COG1695, Predicted transcriptional regulators [Transcription].	1.87607e-24
NC_016779.1\|WP_001179102.1\|3490192_3491356_-\|iron-containing-alcohol-dehydrogenase	gnl\|CDD\|341466	cd08187, BDH, Butanol dehydrogenase catalyzes the conversion of butyraldehyde to butanol with the cofactor NAD(P)H being oxidized in the process. The butanol dehydrogenase (BDH) is involved in the final step of the butanol formation pathway in anaerobic micro-organism. Butanol dehydrogenase catalyzes the conversion of butyraldehyde to butanol with the cofactor NAD(P)H being oxidized in the process. Activity in the reverse direction is 50-fold lower than that in the forward direction. The NADH-BDH has higher activity with longer chained aldehydes and is inhibited by metabolites containing an adenine moiety. This protein family belongs to the so-called iron-containing alcohol dehydrogenase superfamily. Since members of this superfamily use different divalent ions, preferentially iron or zinc, it has been suggested to be renamed to family III metal-dependent polyol dehydrogenases. This family also includes E. coli YqhD enzyme, an NADP-dependent dehydrogenase whose activity measurements with several alcohols demonstrate preference for alcohols longer than C3. The active site of YqhD contains a Zn metal, and a modified NADPH cofactor bearing OH groups on the saturated C5 and C6 atoms, possibly due to oxygen stress on the enzyme, which would functionally work under anaerobic conditions.	0

>NC_016779.1|WP_000450309.1|3479182_3480148_+|tyrosine-type-recombinase/integrase
METTEFHDTIQAFSIFLLNKGRKPSTIKRYVYDIEDFGHWLEKNKKLPSSNIWATLCTKDYEDYFSDLKKNRHYSEKTMHRVFIVLNRMHHFLNIPNPLKNMEISIQPDRTLRNEDFISSDEEKRLKHIVTSLEGLSEKQRPVRPLLMDRNIAILNLLIDYGLSLQELTALTMHHVHFETNTLSIPATAGVERTISLTSEDKKQLYTYYKSIPEPVRPKYHSNDPLFVAFDFNRGTYRWVYENDAPKGLTEIAIQKMIRLEVSRANLRKGISGQHFRNTYILNLIKKETPESEIIKLAGFKSKISLKRYYQYAENGKNALS
>NC_016779.1|WP_000438185.1|3478112_3479069_-|stage-V-sporulation-protein-K
MEQSMRKKNNNQINIVLNHRKKISLPAAENKTVISSETTTKHEMLQRIEEEMGKLVGMDDIKKIIKEIYAWIYVNKKRQEIGLKSEKQVLHMLFKGNPGTGKTTVARMIGKLLFEMNILSKGHLVEAERADLVGEYIGHTAQKTRDLIKKAMGGILFIDEAYSLARGGEKDFGKEAIDTLVKHMEDKQHGFVLILAGYSREMNHFLSLNPGLQSRFPFIIEFADYSVNQLLEIGKRMYEEREYQLSKEAEWKFRDHLHAVKYSSQITSFSNGRYVRNIVEKSIRTQAMRLLQEDAYDKYDLVGISSSDLMLEEETHST
>NC_016779.1|WP_000312272.1|3477219_3477843_+|trimeric-intracellular-cation-channel-family-protein
MAWEIFSIIGTIAFALSGAIVAMEEDYDIFGVYILGMATAFGGGALRNLLIGYPIVAFWQQDMLFQIALLSMTIIFLFPNKLIRHWKKWENITDAIGLSAFAVQGALYAQKLNLPISATIVAAVLTGIGGGIIRDLLARRKPLVLRAEVYAFWTILAGFLIGAQIIVSDWALYTLFILIVCFRMVSIHYKWHLPHRRIDTNERSMHK
>NC_016779.1|WP_000391400.1|3475852_3477127_-|GTPase-HflX
MEEKEKVILVGCQLPQDDDEKFMHSMKELASLAKTARAELLVSTTQKRPKFHPATYIGKGKLEELTMLTEELEPDVIVFNNELTPSQIRNLSSVLDARVIDRTQLILDIFAQRAKSREGKLQVELAQLQYTMPRLMGQGLSLSRLGGGIGTRGPGETKLETDRRHIRSRIDEIKKQLAVVVEHRKRYRERRKDNKVFQVSLIGYTNAGKSTLFNRLTEADTFEENLLFATLDPTTRKMPLPSGYTVLLTDTVGFIQDLPTSLIAAFRSTLEEAGEADVILHVVDSADPNYVGHEKTVKQLLSELEINHIPIITLYNKKDELHQNFIPFPKNDFLMTSAFEEKDLLHIKEAIETKMKEEMNRYQVEIPPSEGKLLTLLKTETLLTKMEFLEDKFVYDCAGYIFAHSSLNVQLKRFLVEEGENKNV
>NC_016779.1|WP_000460285.1|3474588_3475860_-|methionine-gamma-lyase-family-protein
MFDRLKNGEKIAPIVKEVESQITEVHKLADEVIESNQFRVLESFRKHKISDSHFIPTTGYGYDDIGRDTLEKVYADVFGAEAGLVRPQIISGTHAISTALFGILRPGDELLYITGKPYDTLEEIVGVRGKGVGSFKEYNIGYNAVPLTEEGLVDLGAVAAAIHSNTKMIGIQRSKGYATRPSFTISQIKEMIAFVKEIKPDVVVFVDNCYGEFIEEQEPCHVGADLMAGSLIKNPGGGIVKTGGYIVGKEQYVEACAYRLTSPGIGAEAGASLYSLQEMYQGFFLAPHVAGQALKGAIFTAAFLEKLGMNTSPAWNAPRTDLIQSVQFDDKDRMIAFCQAIQYASPINSHFTPYANYMPGYEDDVIMAAGTFIQGASIELSADGPIRPPYVAYVQGGLTYSHVKIAICSAIDALIEKELLTIS
>NC_016779.1|WP_000656783.1|3474024_3474414_-|transcriptional-repressor-GlnR
MKEDRRSAPLFPIGIVMDLTQLSARQIRYYEEHNLVSPTRTKGNRRLFSFNDVDKLLEIKDLLDQGLNMAGIKQVLLMKENQTEAVKVKEETKEISKTELRKILRDELQHTGRFNRTSLRQGDISRFFH
>NC_016779.1|WP_000135328.1|3472641_3473976_-|type-I-glutamate--ammonia-ligase
MARYTKEDIFRLAKEENVKYIRLQFTDLLGVIKNVEIPVSQLTKALDNKMMFDGSSIEGFVRIEESDMYLYPDLDTWVIFPWTAEKGKVARLICDIYNADGTPFEGDPRNNLKRVLKEMEALGFSDFNLGPEPEFFLFKVDEKGNPTLELNDNGGYFDLAPMDLGENCRRDIVLELEEMGFEIEASHHEVAPGQHEIDFKYANAIRSCDDIQTFKLVVKTIARKHGLHATFMPKPLYGVNGSGMHCNLSLFKNGENVFFDQNGDLQLSDDARHFIAGILKHAPAFTAVANPTVNSYKRLVPGYEAPCYVAWSAQNRSPLVRIPASRGISTRVEVRSVDPAANPYLVMATLLAAGLDGIKNKLTPPAAVDRNIYVMTKEEREEAGIVDLPATLAQALVTLQSNEVISNALGDHLLEHFIEAKEIEWDIFRTQVHQWERDQYMSLY
>NC_016779.1|WP_001102624.1|3471994_3472318_-|PadR-family-transcriptional-regulator
MNVQFKKGVLELCVLALVKRKDCYGYELVQQISNKFLISEGSVYPLLRRLTKEGYFQTYLKESTEGPPRKYYQLTEQGGTQLNLLVTEWRDFAKGVQEIIEGVQWDE
>NC_016779.1|WP_000032393.1|3471459_3472002_-|DUF1700-domain-containing-protein
MSKEQFLKELSSHLRKLPDEERKDILFDYEEHFQFGIEEGKNESDIIKGLGSPKVIAKELLAMYRFDEMKKDPSTSNVTRAVMAAIGLSLFNFIIVLGPLLAIIAFIFSFWVGGIVSVVTPFFVIGKVFMGTFIWLDLFVSITFVGVGLLLCIIAYYSTKWFKRLCVRYVIWNFKMIKGE
>NC_016779.1|WP_000976118.1|3470655_3471459_-|DUF4097-family-beta-strand-repeat-protein
MMKKILLVAIACIIIGVIGISQTYEKAVQTAEKGNKEDIIKNETLKNIEVKLDAGDIAIQKSPDSSFYVKQSGDARKQELRIAEDGDTLKIIGKREKGASFDFSFYDFKFQTSTLTLLVPERSYQDVKVNSSAGQIEISDLKSERVSVETVAGEVNLKHVTAKNVEGATKAGEMNFKKVKGKVSTKTTSGEINILDHDATFNLEASSTAGDIDITLSEKPQDAIITGQSAAGDVTIFNEENNNVTIGNGSKKISGKTTAGDITIATR
>NC_016779.1|WP_000813896.1|3483533_3483758_-|RNA-chaperone-Hfq
MKQSINIQDQFLNQLRKENTFVTLYLLNGFQLRGLIKGFDNFTVLLETEGKQQLIYKHAISTFVPQKNVSIELE
>NC_016779.1|WP_000504940.1|3483779_3484733_-|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA
MGEVQREKVAVIIGPTAVGKTKLSIDLAKALNGEIISGDSMQIYRTMDIGTAKVTKEEMDGIPHYMVDIKNPEESFSVAEFQERVRKHIREITERGKLPIIVGGTGLYIQSVLFDYQFTDDAGDAIYREQMEKLALERGVEYVHKKLQEVDPESAERIHANNVRRVIRALEIFHTSGEKMSDQLEKQENELLYDVSLIGLTMDREMLYDRINLRVDIMMDQGLLEEVEGLYNRGIRDCQSIQAIGYKEIYDYFEDRVSLEEAVSQLKTNSRRYAKRQLTWFRNKMDVTWFDVTDGEKTSEILRYIEGKLQLKSNNSK
>NC_016779.1|WP_000814423.1|3484914_3485160_+|hypothetical-protein
MKQSTINFSSLTKDLILATATKEQNCSQEELYFALNCLLRSFHSTLQETTLHTENKNTEYVQNQFCSAYKIITGKTIYPFQ
>NC_016779.1|WP_000734626.1|3485222_3486155_-|SH3-domain-containing-protein
MKKLLGIATAAVFGLGIFAGSAKAETIVTTDVLNVRENPTVESKLVGKMLSGNKLDVINTENGWTKIKVNGKEAFVSAEFTKSTYYVTAGVLNVRAGANTDSEILGKLNKDDVIETTNQVQNEWLQFDYNGKVGYVHVPFLTGTAPVVEKKEVVTQEEAPVRVNAPVKNNKVVKNKESVKNVESSKPVAKAKPAVQQVTKSKGTSAPAGGREITVEATAYTAHPSENGTYGGRVLTAMGHDLTANPNMKVIAVDPKVIPLGSKVWVEGYGEAIAGDTGGAIKGNRIDVLVGSDGSANSWGRKSVKVKVIE
>NC_016779.1|WP_000704641.1|3486503_3488360_-|PTS-sugar-transporter-subunit-IIA
MKITELLKRDTVIMNLTASNKEAVIDELVEKLNGANRLNSKAEFKEAILKRESQSTTGIGEGIAIPHAKTKAVKQPAICFGRSVSGINYESLDGQPAHLFFMIAASEGANNTHLETLSRLSTLLMDEGFRKQLLEAKDEEELLRLFDEKESEKEEEVEVAQPEGNEPYVLAVTACPTGIAHTYMAADSLKAKAAELGIAIKVETNGSTGIKNGLTKVDIEGATAIIVAADKQVEMNRFAGKHVIQVPVADGIRKTEKLLNRAVKQDAPIFKGIKEDGKTESTEKEKGLGIYKHLMNGVSNMLPFVVGGGILIALAFSFGGIKAEGPLAELFMSIGGGGTGAFLFLVPILAGFIASSIADRPGFMPGVVGGFLAAHANAGFLGGLIAGFLAGYVVLGLKRLFSGLPVQLEGIKPVLLYPVFGLLITGVVMQKVVIPPVVALNEMLTGWLNGLNGTNAILLGLILGAMMAIDMGGPINKAAFTFGIAAIEAQNFGVHSAVMAGGMVPPLAIAFATTFFKSKFTEAERKSGLTNYIMGASFITEGAIPFAAADPVRVIVSCVVGSSIAGALSMLFQITLPAPHGGLFVIALVNKPVLYIFSILIGAVVSALMMGIWKKKVK
>NC_016779.1|WP_000640849.1|3488373_3489285_-|1-phosphofructokinase
MIYTVTLNPSIDYVVQVNSLDLGAVNRAEKDMKFPGGKGINVSRVLHRLGVENVALGFTGGFTGRFIKDVLQTEGVITNFVQVDGDSRINVKIKGQEETELNGQGPSVTNEQFEQLMKQIESMQKGDYVVLAGSVPASIPTTFYESIAAFGAEKGIRVVVDASGSALQHVVKNKPFLIKPNHHELGELFGVEISTAEDILPYGRKLIEQGVEHVIVSMAGDGALLFTEEGIYEATVPKGVVINSVGAGDSLVAGFVGKYEQTKDIEKAFQYGVATGSATAFSADLCEKEKVEELLSQVIVTKR
>NC_016779.1|WP_000957268.1|3489281_3490034_-|DeoR/GlpR-transcriptional-regulator
MLTPERHQMILQLVKEQKVVKLQQLVERTASSESTIRRDLAQLEKQRLLKRVHGGAAVLTGKGQEPTMVEKSSKNIQIKQQIAKYAASVVEQGDCIYLDAGSTTFEMIPFLINKDVTVVTNGLMHIEALVENNIRAYLLGGMMKSRTKALIGAMAQESMQKYRFDKCFLGANGVHEQLGFTTPDPEEALLKQMALTLANEGYFLIDESKFSEVAFAKIANVEEANIITNHLEIDLEKYKRQTNVIEADKQ
>NC_016779.1|WP_001179102.1|3490192_3491356_-|iron-containing-alcohol-dehydrogenase
MQNFVFRNPTKLIFGKGQLEQLKTEIPQFGKKVLLVYGGGSIKRNGIYDNVISILKEINAEVFELTGVEPNPRVSTVKKGIQICKDNGVEFILAVGGGSVIDCTKAIAAGSKYDGDVWDIVTKKTFASEALPFGTVLTLAATGSEMNAGSVITNWETNEKYGWGSPVTFPQFSILDPAHTASVPKDQTIYGMVDIMSHVLEQYFHHGTNTELQDRYCESVLKTVIETAPKLLSDLENYEHRETILYCGTMALNGILAMGVKGDWATHNIEHAVSAVHDIPHGGGLAILFPNWMKHVVDENVSRFKQFAIRVFDVKTDGKTDREIALEGIEALRQFWTSIEAPVTLSDYAIGENEIDVMADKAMAYGEFGNFKKLNKDDVLSIYRASL
>NC_016779.1|WP_000228316.1|3491472_3492015_-|DUF420-domain-containing-protein
MVDQSTNQKSYAPIVITLSVIVNAIILFLFFGPVGYEGEVHFDVTILPMLNAIFNSFTFVFLLAALYSIIKKNVKMHRGFILAAFTTTLLFCVSYLSYHYLAPATHFGGEGFIKYVYFIILITHIILAAIIVPLALFALVFGFTNQLTRHRKIVRWTMPIWLYVSLSGVIVYLMISPYYQ
>NC_016779.1|WP_001989514.1|3492326_3492668_-|hypothetical-protein
MIKKEGGMTMEEYVLELYNLLYTTEWQDIVSFLGIVFCMKIVIVYMEEQGMFYSFSSPFDMQREPLLNYAKVNYEQFPFVVFFMIRFITAIVKKKESDDEECHSTCNVANVFS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_016779_6

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_016779_6

4444152-4444259

Orphan

Consensus_repeat	Method
TATATCAGCGATTTTTTGAATATATC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_016779_6

>merge|NC_016779|6|4444152-4444259|CRISPRCasFinder
TATATCAGCGATTTTTTGAATATATCAACCGCAACTCGAAATATATCAGCGATTTTTTAAATATATCGACCACAACTCGAAATATATCAGCGATTTTTTGAATATATC

>NC_016779|6|3|4444152-4444259|CRISPRCasFinder
TATATCAGCGATTTTTTGAATATATC	AACCGCAACTCGAAATATATCAGCGATTTTTTAAATATATCGACCACAACTCGAAA
TATATCAGCGATTTTTTGAATATATC

Protein	Signature genes	Signature genes Name	Protein_function
NC_016779.1\|WP_000389141.1\|4441842_4442139_+\|hypothetical-protein	unknown	unknown	unknown
NC_016779.1\|WP_001010636.1\|4448407_4448812_-\|PH-domain-containing-protein	unknown	unknown	gnl\|CDD\|369049
NC_016779.1\|WP_000636588.1\|4441419_4441692_-\|DUF3917-domain-containing-protein	unknown	unknown	gnl\|CDD\|372449
NC_016779.1\|WP_001103292.1\|4442854_4443853_-\|catabolite-control-protein-A	unknown	unknown	gnl\|CDD\|130546
NC_016779.1\|WP_001057490.1\|4445598_4445925_-\|bacillithiol-system-redox-active-protein-YtxJ	unknown	unknown	gnl\|CDD\|378538
NC_016779.1\|WP_000494671.1\|4448903_4449458_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|224584
NC_016779.1\|WP_000738004.1\|4444463_4445480_-\|CamS-family-sex-pheromone-protein	unknown	unknown	gnl\|CDD\|227188
NC_016779.1\|WP_000637892.1\|4442220_4442457_+\|DUF3949-domain-containing-protein	unknown	unknown	gnl\|CDD\|315735
NC_016779.1\|WP_001197726.1\|4445924_4446437_-\|DUF948-domain-containing-protein	unknown	unknown	gnl\|CDD\|227109
NC_016779.1\|WP_001039688.1\|4439915_4440842_+\|Gfo/Idh/MocA-family-oxidoreductase	unknown	unknown	gnl\|CDD\|223745
NC_016779.1\|WP_002004064.1\|4442458_4442821_+\|DUF4288-domain-containing-protein	unknown	unknown	gnl\|CDD\|379479
NC_016779.1\|WP_000219465.1\|4449656_4450967_-\|UDP-N-acetylmuramate--L-alanine-ligase	unknown	unknown	gnl\|CDD\|234757
NC_016779.1\|WP_001994520.1\|4448228_4448411_-\|hypothetical-protein	unknown	unknown	unknown
NC_016779.1\|WP_000267014.1\|4440970_4441369_+\|large-conductance-mechanosensitive-channel-protein-MscL	unknown	unknown	gnl\|CDD\|184416
NC_016779.1\|WP_000658369.1\|4451219_4452338_-\|nicotinate-phosphoribosyltransferase	unknown	unknown	gnl\|CDD\|235953
NC_016779.1\|WP_000023848.1\|4437551_4439006_-\|HAMP-domain-containing-histidine-kinase	unknown	unknown	gnl\|CDD\|223715
NC_016779.1\|WP_000757115.1\|4447778_4448213_-\|hypothetical-protein	unknown	unknown	unknown
NC_016779.1\|WP_000654739.1\|4446624_4447740_+\|aminopeptidase	unknown	unknown	gnl\|CDD\|225191
NC_016779.1\|WP_001982862.1\|4436860_4437550_-\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|223816
NC_016779.1\|WP_000475139.1\|4439155_4439836_+\|ankyrin-repeat-domain-containing-protein	unknown	unknown	gnl\|CDD\|293786

Protein	Function_ID	Function_description	E-value
NC_016779.1\|WP_001010636.1\|4448407_4448812_-\|PH-domain-containing-protein	gnl\|CDD\|369049	pfam06713, bPH_4, Bacterial PH domain. This family consists of several hypothetical proteins specific to Oceanobacillus and Bacillus species. Members of this family are typically around 130 residues in length. The function of this family is unknown. Members of this family have a PH domain like structure.	4.32544e-11
NC_016779.1\|WP_000267014.1\|4440970_4441369_+\|large-conductance-mechanosensitive-channel-protein-MscL	gnl\|CDD\|184416	PRK13955, mscL, large conductance mechanosensitive channel protein MscL.	3.4407e-77
NC_016779.1\|WP_001103292.1\|4442854_4443853_-\|catabolite-control-protein-A	gnl\|CDD\|130546	TIGR01481, catabolite_control_protein_A, catabolite control protein A. Catabolite control protein A is a LacI family global transcriptional regulator found in Gram-positive bacteria. CcpA is involved in repressing carbohydrate utilization genes [ex: alpha-amylase (amyE), acetyl-coenzyme A synthase (acsA)] and in activating genes involved in transporting excess carbon from the cell [ex: acetate kinase (ackA), alpha-acetolactate synthase (alsS)]. Additionally, disruption of CcpA in Bacillus megaterium, Staphylococcus xylosus, Lactobacillus casei and Lactocacillus pentosus also decreases growth rate, which suggests CcpA is involved in the regulation of other metabolic pathways. [Regulatory functions, DNA interactions].	0
NC_016779.1\|WP_000636588.1\|4441419_4441692_-\|DUF3917-domain-containing-protein	gnl\|CDD\|372449	pfam13055, DUF3917, Protein of unknown function (DUF3917). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 90 amino acids in length.	1.15414e-23
NC_016779.1\|WP_000738004.1\|4444463_4445480_-\|CamS-family-sex-pheromone-protein	gnl\|CDD\|227188	COG4851, CamS, Protein involved in sex pheromone biosynthesis [General function prediction only].	4.95096e-63
NC_016779.1\|WP_000637892.1\|4442220_4442457_+\|DUF3949-domain-containing-protein	gnl\|CDD\|315735	pfam13133, DUF3949, Protein of unknown function (DUF3949). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 69 and 87 amino acids in length.	2.29067e-24
NC_016779.1\|WP_001197726.1\|4445924_4446437_-\|DUF948-domain-containing-protein	gnl\|CDD\|227109	COG4768, COG4768, Uncharacterized protein containing a divergent version of the methyl-accepting chemotaxis-like domain [General function prediction only].	5.79799e-35
NC_016779.1\|WP_001039688.1\|4439915_4440842_+\|Gfo/Idh/MocA-family-oxidoreductase	gnl\|CDD\|223745	COG0673, MviM, Predicted dehydrogenases and related proteins [General function prediction only].	1.39467e-48
NC_016779.1\|WP_002004064.1\|4442458_4442821_+\|DUF4288-domain-containing-protein	gnl\|CDD\|379479	pfam14119, DUF4288, Domain of unknown function (DUF4288). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 120 amino acids in length.	7.36631e-20
NC_016779.1\|WP_000219465.1\|4449656_4450967_-\|UDP-N-acetylmuramate--L-alanine-ligase	gnl\|CDD\|234757	PRK00421, murC, UDP-N-acetylmuramate--L-alanine ligase; Provisional.	0
NC_016779.1\|WP_001057490.1\|4445598_4445925_-\|bacillithiol-system-redox-active-protein-YtxJ	gnl\|CDD\|378538	pfam11009, DUF2847, Protein of unknown function (DUF2847). Some members in this bacterial family of proteins with unknown function are annotated as YtxJ, a putative general stress protein. This cannot be confirmed.	4.38943e-48
NC_016779.1\|WP_000658369.1\|4451219_4452338_-\|nicotinate-phosphoribosyltransferase	gnl\|CDD\|235953	PRK07188, PRK07188, nicotinate phosphoribosyltransferase; Provisional.	0
NC_016779.1\|WP_000023848.1\|4437551_4439006_-\|HAMP-domain-containing-histidine-kinase	gnl\|CDD\|223715	COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms].	1.88519e-61
NC_016779.1\|WP_000494671.1\|4448903_4449458_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|224584	COG1670, RimL, Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis].	2.90673e-28
NC_016779.1\|WP_000654739.1\|4446624_4447740_+\|aminopeptidase	gnl\|CDD\|225191	COG2309, AmpS, Leucyl aminopeptidase (aminopeptidase T) [Amino acid transport and metabolism].	2.90365e-128
NC_016779.1\|WP_001982862.1\|4436860_4437550_-\|response-regulator-transcription-factor	gnl\|CDD\|223816	COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription].	1.29328e-84
NC_016779.1\|WP_000475139.1\|4439155_4439836_+\|ankyrin-repeat-domain-containing-protein	gnl\|CDD\|293786	sd00045, ANK, ankyrin repeats. Ankyrin repeats are one of the most abundant repeat motifs, and generally function as scaffolds for protein-protein interactions in processes including cell cycle, transcriptional regulation, signal transduction, vesicular trafficking, and inflammatory response. Although predominantly found in eukaryotic proteins, they are also found in some bacterial and viral proteins. Less is known of their physiological roles in prokaryotes. Some bacterial ANK proteins play key roles in microbial pathogenesis by mimicking or manipulating host function(s). The pathogen Providencia alcalifaciens N-formyltransferase ankyrin repeats function in small molecule binding and allosteric control. Ankyrin-repeat proteins have been associated with a number of human diseases.	8.24961e-25

>NC_016779.1|WP_001103292.1|4442854_4443853_-|catabolite-control-protein-A
MNVTIYDVAREANVSMATVSRVVNGNPNVKPTTRKKVLEAIDRLGYRPNAVARGLASKKTTTVGVIIPDISNTFYAELARGIEDIATMYKYNIILSNSDQNKEKEFHLLNTMLGKQVDGIVFMGEDITDIHIEEFKKSPVPIVLAASFDEQNETPSVNIDYTQAAYDAMKHFIEQGHKRIGFVSGPFIDKAGSAKKLQGYKKALEEAGISYDENLVIDGDYTYDSGIEAFEKLWGLDEKPSAIFVSSDEMALGVIHAAQDAGLNVPTDVEVLGFDNTRLALMVRPQLSTVVQPMYDIGAVAMRLLTKYMNKEKVEDHTVILPHRIQFRDSTK
>NC_016779.1|WP_002004064.1|4442458_4442821_+|DUF4288-domain-containing-protein
MYAVKLLFESVHSGEPDPTKMDEHYEENHDTLFEESIILVKAHSLEEAHALGEQIAIQSEHTYDNMDGEQITWTFRKVLHVFELDNAPFETGKELYARFLHVKKNETVDTIIQTYYPEYK
>NC_016779.1|WP_000637892.1|4442220_4442457_+|DUF3949-domain-containing-protein
MIWISLIVLAYFIILVPIQYNYIKLLKEKQKKLNVSQNELYDNMSYEESQIHYHYQSNVFTIPASLVASIIYRVKHAA
>NC_016779.1|WP_000389141.1|4441842_4442139_+|hypothetical-protein
MEDDIVGYFTQVERFDYITIDLDKKFFYMEVVQLETNITSLKISLNLDKDETIIAGNVKQYDPSRLEQFIQSFKHTAQTCLAHNLRSPEELFAFWKGN
>NC_016779.1|WP_000636588.1|4441419_4441692_-|DUF3917-domain-containing-protein
MIVLWIITLCMTAIFAYMTLKQNGLKRFVPGSILAGIALITYVISIFIESVSVDMSTSFMFIGITLFASSLMILMVAGIILFIHMNSETL
>NC_016779.1|WP_000267014.1|4440970_4441369_+|large-conductance-mechanosensitive-channel-protein-MscL
MWNEFKKFAFKGNVVDLAVGVVIGAAFGKIVSSLVKDIITPLLGMVLGGVDFTSLKITFGKSSIMYGNFIQTIFDFLIIAAAIFMFVKVFNKLTSKREEEKEEEIPEPTKEEELLGEIRDLLKQQNSSKDRA
>NC_016779.1|WP_001039688.1|4439915_4440842_+|Gfo/Idh/MocA-family-oxidoreductase
MNKPKIGMIGLGSIAQKAYLPTLTKETDWNFVGAFTPNAEKRKQICQQYRIQDFHSIETLASECDAIFVHSSTATHYEIVSELLKKGIDVYVDKPIAATVEQAEKLVELSEKYNRKLMVGFNRRFVPMYVAAKEQAHHISWIRIEKHRTNKVGPYTYDFTMLDDYLHIVDTARWLANDELNVVHNMMQINEKNELLYGHHTYTTANGLLLSTAMHRHAGTNLEQIELVTAGKIIRVKNMNTFEVEQENSVSQSGSPSWETTLKQRGFEDAVHHFIDCVHGDTKPLVDGLEGLKTQQMLQSLLNDVNTN
>NC_016779.1|WP_000475139.1|4439155_4439836_+|ankyrin-repeat-domain-containing-protein
MFKKTLSMICCVIFLQGCSQEQEVKKEMTNMETALLTATEKQETNTVISLLKKGADINIIDNKGRTPLMIATYKNDVKTAKALIDAGADVNIQDDMKNNPFLYAGAEGYLDILKLTIDAGADPSLTNRYGGTALIPASEHGYIDVIKELLTRTNIDVNHVNNLGWTALMEAIVLSNGNETQQQVIRLLIEHGADINIPDNDGVTPLEHARAHNFEEIEKILLEGHK
>NC_016779.1|WP_000023848.1|4437551_4439006_-|HAMP-domain-containing-histidine-kinase
MSIKTRFLFSYIAVILVSITLILIAGFLIVFSITGDLEAVKNFYKSSYIQKPLTSEEENAYIELKTAAKKHQSQLLDESFVSSLEREGVKIVVRKGETISYATKVFESVALKEALPKFESANINSRGTTELGDTFYRYVKFDFYFPQEEEGSIFVLKKQSSFVDLTQKLFPILFVSLLLLAILLIGLLSYLVSRSVVKPIFVLKDATEKIKEGNLDFQIPVTSHDEIGQLNQGFEEMRKKLKESIEMQTQYEENRKELISNISHDLKTPITSIIGYVEGIKDGVANTPEKMDKYLTTIHTKARHMDTLIDELFLFSKLDLNRVPFQFETVELNMFMQELIEEMQMDLSKEGIEVNLQLHASPLYVTADCEKINRVISNLIHNSVKYMDKEEKKITVTVSSDNNKVIVTVMDNGSGIESDTLPYIFERFYRAEQSRNSSTGGSGLGLAIAKQIIEEHGGNIWAESELGKGTSIFFSLEKVEKCGE
>NC_016779.1|WP_001982862.1|4436860_4437550_-|response-regulator-transcription-factor
MKRILLIEDEVSIAELQRDYLEINDFQVDVEHSGETGLQMALQEDYDLIILDIMLPKMNGFEICKQIRAIKDIPILLVSAKKEDIDKIRGLGLGADDYITKPFSPSELVARVKAHISRYERLLGNVSKQRDTLYIHGISIDQRARKVFINNEEIAFTTKEFDLLTFFVTNPNQVLNKEQLFERIWGLDSAGDLATVVVHIRKLREKIERDPAHPQYIETVWGAGYRFNV
>NC_016779.1|WP_000738004.1|4444463_4445480_-|CamS-family-sex-pheromone-protein
MKKMALSFAVVSLLLGACSNDTISKKDEVIQKDTKEKSMIPRTAVSKDYYRTVIPLKEQKVINTANIKTNSKLDLAEYENGLMNIAKEQFDTENHVLQLNQYIPEKLVDELVAKVEAPVLTNIIEQDYFGKQNSNELSLSGVMIGLAMSSSVSNEEAMSKGTEVANQLIEAIHKNDKYNKSPITFAIFKQESTSSLKNGTYIASATVQKNDTNLGNWNAIEEKAYSYPSDEFTQAHGEDNTKINKFAEEMKGFSPGDFIPVNAKVSYKKNQMDTLNMNIVIKYNGKTELMALTQLAAQIMLEQLPKDAKVQLQIKSENKIEAIVIKEKNSDKPFVSFL
>NC_016779.1|WP_001057490.1|4445598_4445925_-|bacillithiol-system-redox-active-protein-YtxJ
MNMTKVETIEELEVLVEKNEPYVLFKHSTTCPISHGAYTEFQAYCSEERAVPAYYLYVQDARDVSNRVAEQYSIKHESPQVLYIKDGMVVWNTSHWNIKKDALEENIK
>NC_016779.1|WP_001197726.1|4445924_4446437_-|DUF948-domain-containing-protein
MQVLLYVSAAIIAVAFAVLVVYVCRTLLSVQKTLENVASTLEGLEKQMQGISVETEQLLHKTNALADDIQQKSQSLNKVVSGVDGIGTTIHSLNTKLRNVSESVTDEIENNADKVAQVVQWSSAAIEVYNHYRATRQEKKVEKEERKLERLEKKAEKKEKRSRLRMRGES
>NC_016779.1|WP_000654739.1|4446624_4447740_+|aminopeptidase
MKDPRIEKLAYNLINYSIRLQKGEKVLIENFGLQKELVTALVKEAYAAGGFPFVSLKDHQVDRSLLMGATEEHFEQIAAYEASVMKDMDAYIGLRSGDNINEQADVPSERMQIHGQTVGKKVHRDIRVPKTRWVVLRYPNASMAQLAKMSTEAFEDFYFEVCNLDYGKMDKAMDSLVTLMNKTDKVRLTGPGTDLTFSIKDIPAIKCSGHLNIPDGEVYSAPVRDSVNGTVSYNTPSPYNGYTFENVQLKFENGQIVEATANDTERINKIFDTDEGARYVGEFAIGVNPYILHPMGDILFDEKIDGSFHFTPGQAYDDAWNGNNSNIHWDLVCIQRPEYGGGEIYFDDVLIRKDGRFVVPELEALNPENLK
>NC_016779.1|WP_000757115.1|4447778_4448213_-|hypothetical-protein
MKKVLMLFVLLLTASVLLLGCSMKKEKADMNLEKAQKVEIESLTDSSEKKVITDKKEIEKLFEVMKMDKWEMQSAPLDTPQGKTFKMYQEDTTKLSESSKDKKELHEIGTMIVYKDVPYVEVEMKNKKMSFKVPEDAAKELLKY
>NC_016779.1|WP_001994520.1|4448228_4448411_-|hypothetical-protein
MKYVKPLFCLEILFVIVGCTRVYTKWDLPLYVPIVIGTIAVALLYYFHFQQTKSEKSSSI
>NC_016779.1|WP_001010636.1|4448407_4448812_-|PH-domain-containing-protein
MNFPIQRSKSVVIFVCLTLAFMFVYPLVMIVTNKEQWMSALIGMGLCFLVNVPLVWEVFIKQHKVENGVLKYGILNDDIVLKEIRIIRQVGKSLEITTNAYKVHMVAMPQDMNEFLVLIEKENPHVKIEMAGKK
>NC_016779.1|WP_000494671.1|4448903_4449458_-|GNAT-family-N-acetyltransferase
MFTLRVDDEIELQLLEKHHKEELYQLINQNRNHLRRWLPWVDGTKSADAYNEICPMWLKKFAEGDGFESGIRYKGKLVGMVGIHPVSWGKKAASLGYYLAEDAGGKGIMTRSVKAVLHYAFENLKLNKMEIRCGVENVKSRAIPERLGFKLDGILRDEEWLYDHFHDIAVYSLLASEWKEIQDK
>NC_016779.1|WP_000219465.1|4449656_4450967_-|UDP-N-acetylmuramate--L-alanine-ligase
MTVYHFVGIKGTGMSSLAQILHDMKHTVQGSDYEKRFFTQTALEKRNISILPFDKSNVKEGQVIIAGNAFPDTHEEIVAAKELNIPVHRYHHFLGDLMNQYTSVAVTGAHGKTSTTGLLAHVMQGAHPTSYLIGDGTGHGVENSKYFVFEACEYRRHFLSYNPDYAIMTNIDFDHPDYFTDINDVFSAFQEMALQVKKGIIACGDDEELQKIQAKVPVIFYGFGEDNDFQARNIQKRTDGTIFDVFVRNTYYDTFKITGYGNHSVLNALAVIALCHYENVDVEAVKHQLTTFEGVKRRFNEKPMGEQVIIDDYAHHPTEINATIEAARQKHPEREIVAVFQPHTFSRTEKFLDEFAESLSKADQVYLCDIFGSARENKGELTIEDLQKRIDGAELITDTTTDVLKKHKNGVLIFMGAGDIQKFEAAYVKEVQVAEK
>NC_016779.1|WP_000658369.1|4451219_4452338_-|nicotinate-phosphoribosyltransferase
MKEIELKLKGEINRLTNKTFKFDERVGEGWFSAVYFLKTREIIEEFRPKSVVTMQFFQKENAVLCGTDEVIALLQTFAKNPEELEINSLKDGDKISPFETVLTIHGPYENFGFLEGVIDGILARRTSVATNVYNVVQAARSVDKEKPVIFMGDRDDHYTQQAGDGYAAYIGGMSAQATHAMNEWWGKSGMGTMPHALIQMFNGDVVEAAKAYHKKFPEDELVVLIDYNNDVITDALRVAREFGSTLKGVRVDTSRTMIDQYFIRHPEVLGTFDPRGVNPSLVFALRKALDEEGFQHVDIVVTGGFDEKRIREFEAQNVPVDIYGVGSSLLKMNIGFTGDNVELNGKPEAKAGRKYRPNPRLERVQLEKREDM

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_016779_7

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_016779_7

4608519-4608605

Orphan

Consensus_repeat	Method
GATATATCTTAAAAATCGCTGATATA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_016779_7

>merge|NC_016779|7|4608519-4608605|CRISPRCasFinder
GATATATCTTAAAAATCGCTGATATATTTTAAGTATCGGTCGATAAAATGTGAAAATCGCCGATAAAAGTTAAGAATCGCTGATATA

>NC_016779|7|4|4608519-4608605|CRISPRCasFinder
GATATATCTTAAAAATCGCTGATATA	TTTTAAGTATCGGTCGATAAAATGTGAAAATCGCC
GATAAAAGTTAAGAATCGCTGATATA

Protein	Signature genes	Signature genes Name	Protein_function
NC_016779.1\|WP_000842310.1\|4631832_4632828_+\|potassium-channel-protein	unknown	unknown	gnl\|CDD\|369572
NC_016779.1\|WP_000425747.1\|4604084_4605038_+\|1,4-dihydroxy-2-naphthoate-polyprenyltransferase	unknown	unknown	gnl\|CDD\|235695
NC_016779.1\|WP_000728863.1\|4617805_4622029_+\|S8-family-serine-peptidase	unknown	unknown	gnl\|CDD\|173800
NC_016779.1\|WP_033681254.1\|4611087_4612518_-\|glycogen-synthase-GlgA	unknown	unknown	gnl\|CDD\|234809
NC_016779.1\|WP_001260120.1\|4607511_4608234_+\|lipase-family-protein	unknown	unknown	gnl\|CDD\|238287
NC_016779.1\|WP_000111376.1\|4614761_4616699_-\|1,4-alpha-glucan-branching-protein-GlgB	unknown	unknown	gnl\|CDD\|235445
NC_016779.1\|WP_000504155.1\|4612630_4613665_-\|glucose-1-phosphate-adenylyltransferase-subunit-GlgD	unknown	unknown	gnl\|CDD\|273966
NC_016779.1\|WP_000053946.1\|4617167_4617773_+\|M73-family-metallopeptidase	unknown	unknown	gnl\|CDD\|372085
NC_016779.1\|WP_000494083.1\|4608660_4611069_-\|glycogen-phosphorylase	unknown	unknown	gnl\|CDD\|340853
NC_016779.1\|WP_000449558.1\|4597371_4598817_-\|o-succinylbenzoate--CoA-ligase	unknown	unknown	gnl\|CDD\|235146
NC_016779.1\|WP_000616715.1\|4602495_4603890_-\|isochorismate-synthase	unknown	unknown	gnl\|CDD\|224091
NC_016779.1\|WP_000715339.1\|4622200_4623145_-\|L-lactate-dehydrogenase	unknown	unknown	gnl\|CDD\|178836
NC_016779.1\|WP_000957373.1\|4605147_4605879_+\|yteA-family-sporulation-protein	unknown	unknown	gnl\|CDD\|274340
NC_016779.1\|WP_000963876.1\|4599047_4599866_-\|1,4-dihydroxy-2-naphthoyl-CoA-synthase	unknown	unknown	gnl\|CDD\|180958
NC_016779.1\|WP_001059235.1\|4600744_4602499_-\|2-succinyl-5-enolpyruvyl-6-hydroxy-3--cyclohexene-1-carboxylic-acid-synthase	unknown	unknown	gnl\|CDD\|236020
NC_016779.1\|WP_001103368.1\|4599935_4600748_-\|2-succinyl-6-hydroxy-2,-4-cyclohexadiene-1-carboxylate-synthase	unknown	unknown	gnl\|CDD\|274729
NC_016779.1\|WP_001193054.1\|4605923_4606124_-\|cold-shock-protein	unknown	unknown	gnl\|CDD\|224197
NC_016779.1\|WP_001147838.1\|4606450_4607233_+\|TIGR00266-family-protein	unknown	unknown	gnl\|CDD\|376704
NC_016779.1\|WP_000386685.1\|4631056_4631737_+\|MgtC/SapB-family-protein	unknown	unknown	gnl\|CDD\|224204
NC_016779.1\|WP_000057611.1\|4613683_4614814_-\|glucose-1-phosphate-adenylyltransferase	unknown	unknown	gnl\|CDD\|179997

Protein	Function_ID	Function_description	E-value
NC_016779.1\|WP_000842310.1\|4631832_4632828_+\|potassium-channel-protein	gnl\|CDD\|369572	pfam07885, Ion_trans_2, Ion channel. This family includes the two membrane helix type ion channels found in bacteria.	1.50592e-14
NC_016779.1\|WP_000425747.1\|4604084_4605038_+\|1,4-dihydroxy-2-naphthoate-polyprenyltransferase	gnl\|CDD\|235695	PRK06080, PRK06080, 1,4-dihydroxy-2-naphthoate octaprenyltransferase; Validated.	1.86783e-131
NC_016779.1\|WP_000728863.1\|4617805_4622029_+\|S8-family-serine-peptidase	gnl\|CDD\|173800	cd07474, Peptidases_S8_subtilisin_Vpr-like, Peptidase S8 family domain in Vpr-like proteins. The maturation of the peptide antibiotic (lantibiotic) subtilin in Bacillus subtilis ATCC 6633 includes posttranslational modifications of the propeptide and proteolytic cleavage of the leader peptide. Vpr was identified as one of the proteases, along with WprA, that are capable of processing subtilin. Asp, Ser, His triadPeptidases S8 or Subtilases are a serine endo- and exo-peptidase clan. They have an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. The stability of subtilases may be enhanced by calcium, some members have been shown to bind up to 4 ions via binding sites with different affinity. Some members of this clan contain disulfide bonds. These enzymes can be intra- and extracellular, some function at extreme temperatures and pH values.	1.27528e-72
NC_016779.1\|WP_033681254.1\|4611087_4612518_-\|glycogen-synthase-GlgA	gnl\|CDD\|234809	PRK00654, glgA, glycogen synthase GlgA.	0
NC_016779.1\|WP_001260120.1\|4607511_4608234_+\|lipase-family-protein	gnl\|CDD\|238287	cd00519, Lipase_3, Lipase (class 3). Lipases are esterases that can hydrolyze long-chain acyl-triglycerides into di- and monoglycerides, glycerol, and free fatty acids at a water/lipid interface. A typical feature of lipases is "interfacial activation," the process of becoming active at the lipid/water interface, although several examples of lipases have been identified that do not undergo interfacial activation . The active site of a lipase contains a catalytic triad consisting of Ser - His - Asp/Glu, but unlike most serine proteases, the active site is buried inside the structure. A "lid" or "flap" covers the active site, making it inaccessible to solvent and substrates. The lid opens during the process of interfacial activation, allowing the lipid substrate access to the active site. .	6.32344e-48
NC_016779.1\|WP_000111376.1\|4614761_4616699_-\|1,4-alpha-glucan-branching-protein-GlgB	gnl\|CDD\|235445	PRK05402, PRK05402, 1,4-alpha-glucan branching protein GlgB.	0
NC_016779.1\|WP_000504155.1\|4612630_4613665_-\|glucose-1-phosphate-adenylyltransferase-subunit-GlgD	gnl\|CDD\|273966	TIGR02092, Glycogen_biosynthesis_protein_GlgD, glucose-1-phosphate adenylyltransferase, GlgD subunit. This family is GlgD, an apparent regulatory protein that appears in an alpha2/beta2 heterotetramer with GlgC (glucose-1-phosphate adenylyltransferase, TIGR02091) in a subset of bacteria that use GlgC for glycogen biosynthesis. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	1.51781e-124
NC_016779.1\|WP_000053946.1\|4617167_4617773_+\|M73-family-metallopeptidase	gnl\|CDD\|372085	pfam12389, Peptidase_M73, Camelysin metallo-endopeptidase.	1.50543e-97
NC_016779.1\|WP_000494083.1\|4608660_4611069_-\|glycogen-phosphorylase	gnl\|CDD\|340853	cd04300, GT35_Glycogen_Phosphorylase, glycogen phosphorylase and similar proteins. This is a family of oligosaccharide phosphorylases. It includes yeast and mammalian glycogen phosphorylases, plant starch/glucan phosphorylase, as well as the maltodextrin phosphorylases of bacteria. The members of this family catalyze the breakdown of oligosaccharides into glucose-1-phosphate units. They are important allosteric enzymes in carbohydrate metabolism. The allosteric control mechanisms of yeast and mammalian members of this family are different from that of bacterial members. The members of this family belong to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.	0
NC_016779.1\|WP_000449558.1\|4597371_4598817_-\|o-succinylbenzoate--CoA-ligase	gnl\|CDD\|235146	PRK03640, PRK03640, o-succinylbenzoate--CoA ligase.	0
NC_016779.1\|WP_000616715.1\|4602495_4603890_-\|isochorismate-synthase	gnl\|CDD\|224091	COG1169, MenF, Isochorismate synthase [Coenzyme metabolism / Secondary metabolites biosynthesis, transport, and catabolism].	2.58992e-115
NC_016779.1\|WP_000715339.1\|4622200_4623145_-\|L-lactate-dehydrogenase	gnl\|CDD\|178836	PRK00066, ldh, L-lactate dehydrogenase; Reviewed.	0
NC_016779.1\|WP_000957373.1\|4605147_4605879_+\|yteA-family-sporulation-protein	gnl\|CDD\|274340	TIGR02890, conserved_hypothetical_protein, regulatory protein, yteA family. Members of this predicted regulatory protein are found only in endospore-forming members of the Firmicutes group of bacteria, and in nearly every such species; Clostridium perfringens seems to be an exception. The member from Bacillus subtilis, the model system for the study of the sporulation program, has been designated both yteA and yzwB. Some (but not all) members of this family show a strong sequence match to Pfam family pfam01258 the C4-type zinc finger protein, DksA/TraR family, but only one of the four key Cys residues is conserved. All members of this protein family share an additional C-terminal domain. Smaller proteins from the proteobacteria with just the N-terminal domain, including DksA and DksA2 are RNA polymerase-binding regulatory proteins even if the Zn-binding site is not conserved. [Unknown function, General].	3.02546e-74
NC_016779.1\|WP_000963876.1\|4599047_4599866_-\|1,4-dihydroxy-2-naphthoyl-CoA-synthase	gnl\|CDD\|180958	PRK07396, PRK07396, dihydroxynaphthoic acid synthetase; Validated.	0
NC_016779.1\|WP_001059235.1\|4600744_4602499_-\|2-succinyl-5-enolpyruvyl-6-hydroxy-3--cyclohexene-1-carboxylic-acid-synthase	gnl\|CDD\|236020	PRK07449, PRK07449, 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase; Validated.	0
NC_016779.1\|WP_001103368.1\|4599935_4600748_-\|2-succinyl-6-hydroxy-2,-4-cyclohexadiene-1-carboxylate-synthase	gnl\|CDD\|274729	TIGR03695, menH_SHCHC, 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase. This protein catalyzes the formation of SHCHC, or (1 R,6 R)-2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate, by elmination of pyruvate from 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate (SEPHCHC). Note that SHCHC synthase activity previously was attributed to MenD, which in fact is SEPHCHC synthase. [Biosynthesis of cofactors, prosthetic groups, and carriers, Menaquinone and ubiquinone].	9.62975e-130
NC_016779.1\|WP_001193054.1\|4605923_4606124_-\|cold-shock-protein	gnl\|CDD\|224197	COG1278, CspC, Cold shock proteins [Transcription].	2.0492e-32
NC_016779.1\|WP_001147838.1\|4606450_4607233_+\|TIGR00266-family-protein	gnl\|CDD\|376704	pfam01987, AIM24, Mitochondrial biogenesis AIM24. In eukaryotes, this domain is involved in mitochondrial biogenesis. Its function in prokaryotes in unknown.	2.19617e-86
NC_016779.1\|WP_000386685.1\|4631056_4631737_+\|MgtC/SapB-family-protein	gnl\|CDD\|224204	COG1285, SapB, Uncharacterized membrane protein [Function unknown].	4.42486e-52
NC_016779.1\|WP_000057611.1\|4613683_4614814_-\|glucose-1-phosphate-adenylyltransferase	gnl\|CDD\|179997	PRK05293, glgC, glucose-1-phosphate adenylyltransferase; Provisional.	0

>NC_016779.1|WP_001260120.1|4607511_4608234_+|lipase-family-protein
MRTPLSFDKDTAILLASCCELTYEQYKQNGIFEIPDGFQYVQGFQGKTIQTTEWFGFILESEDTIIVAFRGTQTDTDWIIDSLVNQKPYPYALNSGNVHNGFLSIYESCRDSIMDMLVSLPAHKKLLATGHSLGGALATLHILDARINTAFAQYGLYTFASPKVGDIAFRNYYKLQVASSFRFVNLFDVVPLLPPRNVHFNEQDWEYAHVHHNMTFTKNTKSIANNHAMTTYKTCLTSHF
>NC_016779.1|WP_001147838.1|4606450_4607233_+|TIGR00266-family-protein
MQAHEIEYKLYGDDMQFVEIELDPEESVIAEAGAMMMMEDYIEMETIFGDGSGPSGGLFGKLMGAGKRLVTGESMFMTVFTNTGHGKRHVSFAAPYPGKIIPVDLTEYQGKVVCQKDAFLCAAKGVSIGIEFTKKIGTGFFGGEGFIMQKLEGDGLAFMHAGGTVYKRELKPGEKLRIDTGCLVAMTKDVNYDVEFVGKVKTALFGGEGLFFATLEGPGTVWIQSLTLSRLSARLTSPAAQGSGEGSVLGGLGRLLDGKE
>NC_016779.1|WP_001193054.1|4605923_4606124_-|cold-shock-protein
MQTGKVKWFNSEKGFGFIEVEGGDDVFVHFSAIQGDGFKTLEEGQEVSFEIVEGNRGPQAANVTKN
>NC_016779.1|WP_000957373.1|4605147_4605879_+|yteA-family-sporulation-protein
MLTPQQINQFKSVLEKQKQELEQTIQTHENEDRASERESVGELSSYDNHPADMATELYEREKDFGLIELWHKQLEDTKHALQKIEAGTYGICEVSDEEIPFERLEAMPTATTCIQHATNKLNMDTRPVEEEVLSPSFHKHDEDRSVEYDAEDAWQDVANYGTSETPADLERRDSKNYNGMYVNSEENVGYVEDFENFIGTDMYGKNPQVFATEEHEEYEQMLDDFEDRTFKGELSSNESSSKE
>NC_016779.1|WP_000425747.1|4604084_4605038_+|1,4-dihydroxy-2-naphthoate-polyprenyltransferase
MEMNVETNSSPTAPKPSKQTGWRIWWSLLRPHTLTAAFVPVFIGTAYAMQVGGINQIHLPLFLIMLLACLLIQAATNMFNEYFDYKRGLDHEGSVGIGGAIVRDGIQPKTVLNLAFGFFGIAILLGVYICMNSSWWLAAIGLVCMAVAYLYTGGPLPIAYTPFGELTAGLFMGVIIIGISFFIQTGTVTSEVVLLSIPSSILIGAILLANNIRDLDGDKENGRKTLAILVGRERAVGVLASMFIVSYIWTIALIIVGIVSPWMLIVFLSAPKAFKATKGFIGKSIPMEMVPAMIATAKTNTIFGLLMGIGLLLGYFL
>NC_016779.1|WP_000616715.1|4602495_4603890_-|isochorismate-synthase
MIQTKQIGLQEVLSAAIKRATDEKILVSFVKQIDWMDPLLFYAAGKRIAFENRCYFADPAQHVIFAGIGSVFTIATASHKRFQTARDEWDKVKEKAFVQREKYEFGTGPLLFGGFSFDQEKEKTDLWKEFDDTTFSLPAFLLTVKNEKAWLTMNTFVSATDCAETLYNEIVSLEEKIFEESKCALEGSKLTVTSKVEVDPKGWMKAIEKVQDEMKQGNVQKVVLARELKVEMDHHIDSALVLEALRIGQPDCYVFSFDYKGACFLGATPERLIRKEDEKFTSMCLAGSTGHGQSIEESKRNSNALLHDEKNLAEHGYVVNMIRSVLNEHCEYVNIPESPGLLTTKNLIHLYTPVEAKGDASLLTMVEELHPTPALGGTPRLEAMKLIRDVELLDRGLYGAPIGWIDDEGNGEFAVALRCGLLNGEKASLFAGCGIVIDSVPQLEYEETSLKFRPMLGALEELMK
>NC_016779.1|WP_001059235.1|4600744_4602499_-|2-succinyl-5-enolpyruvyl-6-hydroxy-3--cyclohexene-1-carboxylic-acid-synthase
MNNHIEALSYYLGAFVDELTRLNVCDVVISPGSRSTPIALLMEQHEGMNTYLHVDERSAGFFALGIAKAKKRPVALLCTSGTAAANYYPAVCEAFHSRVPLIVLTADRPHELRDVGAPQAMNQINLYGTFVKQFTEMALPEANEAMYHYARMTTQRMIASACLAPQGPVHLNFPVREPLIPDFSLESLWDKGRGEYTGVVQQGNVTMPSEYVDSLVGRLSHMEKGLIICGDDSHSEIATFAAELAEKTGYPILADPLSNIRSGHHDKTMVIDCYDTFLRNELLKETWKPDVLIRFGGMPVSKALTQFIKKQTKAVHIVVDESGQWRDPALVATEVVQANDIAFCSALIEKMPVMKKNDWFRMWQHINEKTKETLREMETYDTAFEGRVITDIVRVLPEGATLFASNSMPIRDTDSFFFTSDKNIQVMANRGVNGIDGIISTALGASMICDPLVLVIGDLSFYHDLNGLLAAKLHELNITIVVVNNDGGGIFSFLPQYEKKEHFESLFGTPIGLDYEHVVTMYGGSFSRVNGWEQFREEVQKGATTEGLHVVEICTNRDENLTLHRTLWAKTQDVITTSLQGESK
>NC_016779.1|WP_001103368.1|4599935_4600748_-|2-succinyl-6-hydroxy-2,-4-cyclohexadiene-1-carboxylate-synthase
MNVTLQGVSYEYEVVGSGEPLLLLHGFTGSMETWRSFVPSWSEQFQVILVDIVGHGKTESPEDVTHYDIRNAALQMKELLDYLHIEKAHILGYSMGGRLAITMACLYPEYVRSLLLENCTAGLEREDERKERCEKDERLADKIEREGIESFVTMWENIPLFETQKSLAQNVQEAVRKERLANNSNGLANSLRGMGTGAQPSWWNELQNLKMPVLLMNGEYDEKFFRILKNIEKCVSDAKFVKIDGAGHAIHVEQPEKFDTIVKGFLKTMQ
>NC_016779.1|WP_000963876.1|4599047_4599866_-|1,4-dihydroxy-2-naphthoyl-CoA-synthase
MAIEWVKEGNYEDIIYSTYNGIAKISINRPEVHNAFRPKTVMELIDAFAHARDDANVGVIILTGEGGRAFCSGGDQKVRGHGGYVGDDQIPRLNVLDLQRLIRAIPKPVIAMVAGYAIGGGHVLHIVCDLTIAADNAVFGQTGPKVGSFDGGYGAGYLARMVGHKKAREIWYLCRQYNAQEALDMGLVNTVVPLEQLEAETVQWAQEILANSPMALRFLKAAFNADTDGLAGIQQLAGDATLLYYTTDEAKEGRDAFKEKRSPDFGQFPRFP
>NC_016779.1|WP_000449558.1|4597371_4598817_-|o-succinylbenzoate--CoA-ligase
METMPNWLKQRAFLTPDRTAIEIEEEKVTFVQLHEKVVSVCEHLTHVGVKRGQKVAVLMKNGMEMITVIHALSYVGAVAVLLNTRLSREELLWQMDDAEVICLVTDQDFEAKDIPVYSFAEVMNGPKEEASIQEEFSLREAMTIIYTSGTTGKPKGVILTYGNHWASAVGSSLNLGLRDDDCWLACMPMFHVGGLSLLMKNIMYGMRILLVPKYDANFIHKALQTRGVTIISVVSKMLTDLLERLGEGTYPSSLRCMLLGGGPAPKPLLETCVDKGIPVYQTYGMTETSSQICTLSADYMLTKVGSAGKPLFQCQLRIEKDGVVVPPFVEGEIVVKGPNVTGGYFNREDATRETIQNGWLHTGDLGYLDEEGFLYVLDRRSDLIISGGENIYPAQIEEVLLSHPMVAEAGVVGMTDDKWGQVPAAFVVKSGEITEEEILHFCEEKLAKYKVPKKACFLEELPRNASKKLLRRELRQLVEEM
>NC_016779.1|WP_000494083.1|4608660_4611069_-|glycogen-phosphorylase
MFTHVESFKSAFLEKLETMYGKSFKDSTTRDQYNTLGYMVREYMNSQWIATNESYRSGERKQMYYLSIEFLLGRLLGSNILNLGIRDVCEQGLSELGISLQQLEEVEADAGLGNGGLGRLAACFLDSLASLNLPGHGCGIRYKHGLFDQKIVDGYQVEFPEQWLLHENVWEVRRHDQAVEVSYFGNVEPLYIDGRLEFRHTNAEVIMAVPYDVPVVGYETSTVNTLRLWNAEPVPFPQNCKDILKYKRETEAVSEFLYPDDTHDEGKILRLKQQYFLVSASLQNIVRLHRERYGDLRQLHEKIAIHINDTHPVLAIPELMRILLDEEKLAWEEAWHITTQTISYTNHTTLSEALEKWPIHIFKPLLPRIYMIIEEINERFCHELWERYPYEWHRIEEMAIIAHDLVKMAHLAIVGSHSVNGVAKIHTEILKQREMRLFYEFYPDKFNNKTNGIAHRRWLMKANPQLTNLISEAIGTEWKKEPIKLQELQLVQYDASFQEKFAEVKQERKEILAERIHNTMGITIDPNSIFDVQVKRLHAYKRQLLNVLHILYLYNRLKEDASFTFYPRTFIFGAKASPGYYYAKKIIKLINELARKVNNDPYVSQYMKVIFLENYRVSLAEDIFPAADVSEQISTASKEASGTGNMKFMMNGAITLGTLDGANIEIKDRVGDDNCFIFGLTAEEVLHYYQNGGYRASDYYHHNGHIKKVVDQLTNGFFAQSGAEFEAIYDSLVIQNDEYFVLRDFGPYAERQEAVGRAYENRTKWLEMSILNIAQSGHFASDRTILQYSNEIWGIGNTVTQI
>NC_016779.1|WP_033681254.1|4611087_4612518_-|glycogen-synthase-GlgA
MNILFAVSECVPFVKSGGLADVAGALPKELKKLGVEVRIILPNYSLIPQKLRDGCTLHKVINVPLGWRNQYCGILKGEQDGITYYLIDNEYYFKRDSLYGHYDDGERFSYFSKAVLECIPHLDFEVDVLHSHDWHTAMVNFLLREKYQDNPLYEHIKTVYTIHNLQFQGVFPPEVMYDLLELGDEYFHSEQLEFYGNVNFMKGGIIASDQITAVSPTYKEEIQYEFFGEKLDGLLRKYNDKLSGIVNGIDTSVYNPETDSYITAQYAVDSLYEKNENKRALQRYFGLPEKEDTPIISMVTRLTKQKGLDLVRTVFREIMEEDVQCIILGSGDSEYEQFFEWMAYEYPEKVKVYIGFNEELAHQVYAGSDLFLMPSLFEPCGLGQLIALAYGTIPIVRETGGLNDTVQSYDEETGEGNGFSFTNFNAHDMLHTVLRAIEFYHDKPVWDRLVKQAMTEDYSWEKSALAYKKLYKSLME
>NC_016779.1|WP_000504155.1|4612630_4613665_-|glucose-1-phosphate-adenylyltransferase-subunit-GlgD
MGEKMLGIINATGSFPSLKKVTGHRSLAALPFGGRYRLIDFMLSNMVNSNIHSVAVFTSHKNRSLMDHVGSGKQWDLDRKRDGLFLFPPNCQCDQDEFGSFAHFRRHIDYFLRSREEYVVITNSHLVTALNFQAVLERHIHTAADITEVCHEGVSLQTYVLKKQLLLDLFEAYKDMEQYSLFDVVREKRGKSLHIATYEHTGYVAIIDSIESYYKHSLEILQPAIWKQVFKKEAPIFTKVKDEPPTRYVKGAAVKNTMIANGSIIEGEVENSVVSRSVKIGKGSIVRNSIIMQKSQIGDNCIIDGVIIDKDVKIGDGVVLKGNADEPYVVEKGSVQNSTINSYS
>NC_016779.1|WP_000057611.1|4613683_4614814_-|glucose-1-phosphate-adenylyltransferase
MAQKQKCVAMLLAGGKGSRLSALTKNLAKPAVPFGGKYRIIDFTLSNCANSGIETVGILTQYQPLELHNYIGIGNAWDLDRVSGGVTVLPPYAESSGVKWYTGTASAIYQNLNYLSQYEPEYVLILSGDHIYKMDYSKMLDYHIEKEADVSISVIEVPWDEASRFGIMNTNEEMEIVEFEEKPQFPRSNLASMGIYIFNWAILKEYLEMDARNPESSNDFGKDVLPLLLDEGKKLMAYPFEGYWKDVGTVKSLWEANMDLLRDETSLNLNDRDWRIYSVNPNEPPQYIAEKAKVEESLINEGCVIEGDVKHSVLFQGVTVEEGSMVIDSVVMPGAKIGKNVVIERAIVGSEMVIEDGTIIRPEKNVDDVVLIAEGK
>NC_016779.1|WP_000111376.1|4614761_4616699_-|1,4-alpha-glucan-branching-protein-GlgB
MSVINCEEVKRDEFHTEKYYESYNIFGAHIVTEDEMRGVRFTVWAPHAKAMSVVGDFNEWDYEQHKMLQVTEEGIWSLFIPHIEEREIYKYAIETMAGDVIFKADPYAVYAEVRPNTASVVFDIEGYEWNDKNWSRKKKKKSVYKEAMTVYELHFGSWKKKEDGTLYSYREMAEELIPYVVEHQFTHIEIMPLVEHPYDRSWGYQGTGYYAATSRFGTPHDLMHFVDECHKYGIGVILDWVPGHFCKDAHGLYLFDGTPTYEYKDKDVQENPVWGTVNFDLGKREVRNFLISNALFWMRYFHIDGFRVDAVANMLYWNKEGQEQSNEHAVSFLRELNEAVFAEDEDFLMTAEDSTAWPLVTAPTYEGGLGFNYKWNMGWMNDVLKYMECAPEYRKYIHDKMTFSLLYTYSENFILPLSHDEVVHGKKSLLNKMPGDYWDKFAQLRLLYGYFFTHPGKKLLFMGGEFGQFDEWKDLEDLDWNLHDFEMHRYMHDYFKELIALYKRSKPLWQLDHSREGFQWIDANNNEQSIFSFIRQGDKQEDALVVVCNFTKATYENYKVGVPDFEYYNEILNSDAEQYGGSGQVNKKRLKTIQEPYHNQTAHVEITIPPFGVSILRPVKTRKGSKKQDGSKTKVRSNVTSRGKR
>NC_016779.1|WP_000053946.1|4617167_4617773_+|M73-family-metallopeptidase
MSLKQKVGMGVVTATLGLSLTFGGVFAYFSDSETSSNSFQAGTLDLSINPSVIIDVKDLKPGDFIEKNFTLENKGTLDIAKVALETSYEVTDAKKNNDGEDLGDHIIVKFLVNDGKPSNPNDDHEILWETKLSQLKTMKPEDVATSLERHNLIDGIKSGETDYLHVLFSFEDNEQDQNKFQGDSLQLNWTFHAKQTPGTEK
>NC_016779.1|WP_000728863.1|4617805_4622029_+|S8-family-serine-peptidase
MKKKNRFVTGIVTAGVLFSTALPFNVLAENPINQIDSSNAQSLLSKLSKEQRQALQTLDANPGFTISPDINTSSSEPVNIIVEFQTAPVKINELKQKEKGLQAAPENIKARIDQEHEEFQKGLKRLHQFSPSVKSGNFQSVQIKRSYKHAINGVALTLPANTVEELLRIGVVKRIWKDYEVKLNLPKQAEQKAPQKLTDSIPQIGVDKLHNEGITGKGIKIGVLDTGIDYNHPDLKDVYKGYRAKPGEDSSKVDPNSVKGWDFINNDADPMETTYTEWQQSGAPEFDDRGSSFYTAHGTHVAGIVSAQKKNKSDSAVKGVAPDIELYNYRVLGPYGSGDSSGIIAAIDKSISDGMNVINLSLGDDSNNPLDPTSIAVNNAMLSGVVTVVAAGNSGPNPATLGSPGASPFAITVGASDSSISLPKLSGHAGQVQFPNLILFGKNFTDKIEDFKGQSLPIESVGIGTPDEFSTKDVKGKIALVARGTISFDEKIANAKQAGAKAVIIYNNVDGEIPFYIGESTKYIPAFRLPKEDGEKLKAQIEQGNTSFTFDELTYIQTEGDHLADFSSRGPVTSNDDIKPDITAPGVAVLSTVPEYINDPQEGENYDVSYERMQGTSMASPHIAGVAALILQEHPEYSPFDVKASLMNTADDLKEKYSVYEVGAGRIDAYNAVHTETSFKVLDTTKTVVNDEIIEVPEETGSIAFGKFYQKDGEALEQKRNIKVENHNKQEKKEFKTEISYTPASSSINDAIANGVKVSTPETITLDAGKSDEIEAKINVPAGVKQGRYEGYIHITNTKNKEETYQIPFSIRVSEPGIEDAILSRKAISTDTTKFNPYRESYVHGAFQLNSNLETLDLIVKDSKTNKALGFLGTLNTSGLQTDVYYYLESFFNGKVYPFTNDSAKPIGDEKIDLPEGDYTIEFVGYDKDGKARVKDDYVVIDNTPPEVKLTGLKPGIYELNEENYAVEDGKKALWIKGNVYDSNVDYLKGKGLNITQEANGVMYYDYSPYLHKFLPIDANGDFKIGITPESFKVEGPMNTGVYIFDYATAGPDYPSGVNNYWFIQQGAQYAKASYDKKELYKGDEFTVTLNAKHVKQFVAGEFNVKFLEKNFKFANVKLNPAFEKLLSEKGVTAKVNEPKLEEGSVTVGGTIDDKNFAGLDGDFPFIDVTFKVENDEFYEANAQLESPVFVYWKPGETEPNRMRVLQDQTFSVMSLNSLVEGNIKPGAFLNERGYLDEKFDYTKLGVKVYATDSYRHKFEGSLDKYGYFKLNGLPVNKRDYNLFVEVPGHLTSRLTTKLGTEKDGKLLGQYYYARLDENLAGDVNGDKVIDIKDAEIIASNYGKKGLSVKDGDLNKDGIVDEKDIRFVEKNFLKKGPDASKSQTAAEKSKSGTLADILKKLGLTPKK
>NC_016779.1|WP_000715339.1|4622200_4623145_-|L-lactate-dehydrogenase
MKKGINRVVLVGTGAVGCSYAYSMINQGVAEEFVLVDVNEAKAEGEAMDLSHAVPFSPSPTKVWSGSYADCKDADLVVITAGLPQKPGETRLDLVEKNTKIFKQIVRGIMDSGFDGIFLIATNPVDILTYVTWKESGLPKERVIGSGTTLDSARFRYMLGDYLDVDPRNVHAYIVGEHGDTELPVWSHATIGVQKLETILANNEQYKQEDLDKIFENVRDAAYHIIERKGATYYGIGMSLLRVTKAILNNENSVLTVSAYLEGQYGEKDAYVGVPAVINREGVREIVELELNEEEKAKFAHSVKVLKETMAPVL
>NC_016779.1|WP_000386685.1|4631056_4631737_+|MgtC/SapB-family-protein
MDYTDLLIKLGLSAILGFAIGLERELKRKPLGLKTCLVISIISCLLTIVSIKAAYNLPHTDHMNMDPLRLAAQIVSGIGFLGAGVILRRGNDSIAGLTTAAMIWGASGIGIAVGAGFYIEAIFGMCFLMISVELIPLTMKFVGPRSFRQRDIVVKLVVRNMDNIPVVIEEIKEMDIKVKNMKLKTLENGSHYLHLKLCIDQKRHTADVYYALQHLESVQQTEVESM
>NC_016779.1|WP_000842310.1|4631832_4632828_+|potassium-channel-protein
MKSRPKLVDAFRDSIIFRLICFIVVLTAFSGFLIHILEPSHFTTWFDGIWWSIVTIFTVGYGDFAPHTLIGKLIGIGIILFGTGFCSYYMVLFATDMINKQYMKVKGEEAATSNGHMIIVGWNERAKHVVKQMHILQPNLDIVLIDETLSLLPKPFHHLEFIKGCPHHDQTLLKANITTAHTILITADKEKNESLADTQSILNILTAKGLNPNIHCIAELLTSEQIQNATRAGASEIIEGNKLTSYVFTASLLFPSISGVLFSLYNEISDNKLQLMELPSSCTGQTFANCSYTLLKQNILLLGIKRDEQYMINPVHSFVLIQSDILIVIHH

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NC_016779_2	2.8\|1383157\|18\|NC_016779\|CRT	1383157-1383174	18	NC_016779.1	1383661-1383678	0	1.0
NC_016779_2	2.9\|1383202\|18\|NC_016779\|CRT	1383202-1383219	18	NC_016779.1	1383661-1383678	0	1.0
NC_016779_2	2.10\|1383247\|27\|NC_016779\|CRT	1383247-1383273	27	NC_016779.1	1383706-1383732	0	1.0
NC_016779_4	4.5\|3480915\|18\|NC_016779\|CRT	3480915-3480932	18	NC_016779.1	3482076-3482093	0	1.0
NC_016779_4	4.5\|3480915\|18\|NC_016779\|CRT	3480915-3480932	18	NC_016779.1	3482382-3482399	0	1.0
NC_016779_5	5.10\|3481746\|27\|NC_016779\|CRT	3481746-3481772	27	NC_016779.1	3482313-3482339	0	1.0
NC_016779_5	5.11\|3481791\|27\|NC_016779\|CRT	3481791-3481817	27	NC_016779.1	3482178-3482204	0	1.0
NC_016779_5	5.11\|3481791\|27\|NC_016779\|CRT	3481791-3481817	27	NC_016779.1	3482268-3482294	0	1.0
NC_016779_5	5.12\|3481836\|27\|NC_016779\|CRT	3481836-3481862	27	NC_016779.1	3482178-3482204	0	1.0
NC_016779_5	5.12\|3481836\|27\|NC_016779\|CRT	3481836-3481862	27	NC_016779.1	3482268-3482294	0	1.0
NC_016779_5	5.13\|3481881\|27\|NC_016779\|CRT	3481881-3481907	27	NC_016779.1	3482313-3482339	0	1.0
NC_016779_5	5.14\|3481926\|27\|NC_016779\|CRT	3481926-3481952	27	NC_016779.1	3482358-3482384	0	1.0
NC_016779_5	5.14\|3481926\|27\|NC_016779\|CRT	3481926-3481952	27	NC_016779.1	3482925-3482951	0	1.0
NC_016779_5	5.15\|3481971\|18\|NC_016779\|CRT	3481971-3481988	18	NC_016779.1	3482097-3482114	0	1.0
NC_016779_5	5.15\|3481971\|18\|NC_016779\|CRT	3481971-3481988	18	NC_016779.1	3482187-3482204	0	1.0
NC_016779_5	5.15\|3481971\|18\|NC_016779\|CRT	3481971-3481988	18	NC_016779.1	3482277-3482294	0	1.0
NC_016779_5	5.15\|3481971\|18\|NC_016779\|CRT	3481971-3481988	18	NC_016779.1	3482403-3482420	0	1.0
NC_016779_5	5.15\|3481971\|18\|NC_016779\|CRT	3481971-3481988	18	NC_016779.1	3482763-3482780	0	1.0
NC_016779_5	5.15\|3481971\|18\|NC_016779\|CRT	3481971-3481988	18	NC_016779.1	3482979-3482996	0	1.0
NC_016779_2	2.10\|1383247\|27\|NC_016779\|CRT	1383247-1383273	27	NC_016779.1	1383940-1383966	1	0.963
NC_016779_2	2.16\|1383580\|18\|NC_016779\|CRT	1383580-1383597	18	NC_016779.1	1382743-1382760	1	0.944
NC_016779_4	4.6\|3480951\|27\|NC_016779\|CRT	3480951-3480977	27	NC_016779.1	3482076-3482102	1	0.963
NC_016779_4	4.6\|3480951\|27\|NC_016779\|CRT	3480951-3480977	27	NC_016779.1	3482382-3482408	1	0.963
NC_016779_4	4.8\|3481041\|18\|NC_016779\|CRT	3481041-3481058	18	NC_016779.1	3482076-3482093	1	0.944
NC_016779_4	4.8\|3481041\|18\|NC_016779\|CRT	3481041-3481058	18	NC_016779.1	3482382-3482399	1	0.944
NC_016779_4	4.10\|3481122\|18\|NC_016779\|CRT	3481122-3481139	18	NC_016779.1	3482076-3482093	1	0.944
NC_016779_4	4.10\|3481122\|18\|NC_016779\|CRT	3481122-3481139	18	NC_016779.1	3482382-3482399	1	0.944
NC_016779_4	4.12\|3481203\|18\|NC_016779\|CRT	3481203-3481220	18	NC_016779.1	3482076-3482093	1	0.944
NC_016779_4	4.12\|3481203\|18\|NC_016779\|CRT	3481203-3481220	18	NC_016779.1	3482382-3482399	1	0.944
NC_016779_5	5.1\|3481350\|27\|NC_016779\|CRT	3481350-3481376	27	NC_016779.1	3482358-3482384	1	0.963
NC_016779_5	5.1\|3481350\|27\|NC_016779\|CRT	3481350-3481376	27	NC_016779.1	3482925-3482951	1	0.963
NC_016779_5	5.4\|3481485\|18\|NC_016779\|CRT	3481485-3481502	18	NC_016779.1	3482097-3482114	1	0.944
NC_016779_5	5.4\|3481485\|18\|NC_016779\|CRT	3481485-3481502	18	NC_016779.1	3482187-3482204	1	0.944
NC_016779_5	5.4\|3481485\|18\|NC_016779\|CRT	3481485-3481502	18	NC_016779.1	3482277-3482294	1	0.944
NC_016779_5	5.4\|3481485\|18\|NC_016779\|CRT	3481485-3481502	18	NC_016779.1	3482403-3482420	1	0.944
NC_016779_5	5.4\|3481485\|18\|NC_016779\|CRT	3481485-3481502	18	NC_016779.1	3482763-3482780	1	0.944
NC_016779_5	5.4\|3481485\|18\|NC_016779\|CRT	3481485-3481502	18	NC_016779.1	3482979-3482996	1	0.944
NC_016779_5	5.7\|3481611\|27\|NC_016779\|CRT	3481611-3481637	27	NC_016779.1	3482709-3482735	1	0.963
NC_016779_5	5.9\|3481701\|27\|NC_016779\|CRT	3481701-3481727	27	NC_016779.1	3482313-3482339	1	0.963
NC_016779_5	5.10\|3481746\|27\|NC_016779\|CRT	3481746-3481772	27	NC_016779.1	3482178-3482204	1	0.963
NC_016779_5	5.10\|3481746\|27\|NC_016779\|CRT	3481746-3481772	27	NC_016779.1	3482268-3482294	1	0.963
NC_016779_5	5.11\|3481791\|27\|NC_016779\|CRT	3481791-3481817	27	NC_016779.1	3482133-3482159	1	0.963
NC_016779_5	5.11\|3481791\|27\|NC_016779\|CRT	3481791-3481817	27	NC_016779.1	3482223-3482249	1	0.963
NC_016779_5	5.11\|3481791\|27\|NC_016779\|CRT	3481791-3481817	27	NC_016779.1	3482313-3482339	1	0.963
NC_016779_5	5.11\|3481791\|27\|NC_016779\|CRT	3481791-3481817	27	NC_016779.1	3482529-3482555	1	0.963
NC_016779_5	5.11\|3481791\|27\|NC_016779\|CRT	3481791-3481817	27	NC_016779.1	3482970-3482996	1	0.963
NC_016779_5	5.12\|3481836\|27\|NC_016779\|CRT	3481836-3481862	27	NC_016779.1	3482133-3482159	1	0.963
NC_016779_5	5.12\|3481836\|27\|NC_016779\|CRT	3481836-3481862	27	NC_016779.1	3482223-3482249	1	0.963
NC_016779_5	5.12\|3481836\|27\|NC_016779\|CRT	3481836-3481862	27	NC_016779.1	3482313-3482339	1	0.963
NC_016779_5	5.12\|3481836\|27\|NC_016779\|CRT	3481836-3481862	27	NC_016779.1	3482529-3482555	1	0.963
NC_016779_5	5.12\|3481836\|27\|NC_016779\|CRT	3481836-3481862	27	NC_016779.1	3482970-3482996	1	0.963
NC_016779_5	5.13\|3481881\|27\|NC_016779\|CRT	3481881-3481907	27	NC_016779.1	3482178-3482204	1	0.963
NC_016779_5	5.13\|3481881\|27\|NC_016779\|CRT	3481881-3481907	27	NC_016779.1	3482268-3482294	1	0.963
NC_016779_5	5.14\|3481926\|27\|NC_016779\|CRT	3481926-3481952	27	NC_016779.1	3482052-3482078	1	0.963
NC_016779_5	5.14\|3481926\|27\|NC_016779\|CRT	3481926-3481952	27	NC_016779.1	3482619-3482645	1	0.963
NC_016779_5	5.15\|3481971\|18\|NC_016779\|CRT	3481971-3481988	18	NC_016779.1	3482142-3482159	1	0.944
NC_016779_5	5.15\|3481971\|18\|NC_016779\|CRT	3481971-3481988	18	NC_016779.1	3482232-3482249	1	0.944
NC_016779_5	5.15\|3481971\|18\|NC_016779\|CRT	3481971-3481988	18	NC_016779.1	3482538-3482555	1	0.944
NC_016779_2	2.1\|1382779\|27\|NC_016779\|CRT	1382779-1382805	27	NC_016779.1	1382725-1382751	2	0.926
NC_016779_2	2.2\|1382833\|27\|NC_016779\|CRT	1382833-1382859	27	NC_016779.1	1382725-1382751	2	0.926
NC_016779_2	2.3\|1382887\|27\|NC_016779\|CRT	1382887-1382913	27	NC_016779.1	1382725-1382751	2	0.926
NC_016779_2	2.4\|1382941\|27\|NC_016779\|CRT	1382941-1382967	27	NC_016779.1	1383904-1383930	2	0.926
NC_016779_2	2.12\|1383355\|27\|NC_016779\|CRT	1383355-1383381	27	NC_016779.1	1383904-1383930	2	0.926
NC_016779_2	2.14\|1383472\|27\|NC_016779\|CRT	1383472-1383498	27	NC_016779.1	1383733-1383759	2	0.926
NC_016779_4	4.2\|3480789\|27\|NC_016779\|CRT	3480789-3480815	27	NC_016779.1	3482076-3482102	2	0.926
NC_016779_4	4.2\|3480789\|27\|NC_016779\|CRT	3480789-3480815	27	NC_016779.1	3482337-3482363	2	0.926
NC_016779_4	4.2\|3480789\|27\|NC_016779\|CRT	3480789-3480815	27	NC_016779.1	3482382-3482408	2	0.926
NC_016779_4	4.3\|3480834\|27\|NC_016779\|CRT	3480834-3480860	27	NC_016779.1	3482076-3482102	2	0.926
NC_016779_4	4.3\|3480834\|27\|NC_016779\|CRT	3480834-3480860	27	NC_016779.1	3482337-3482363	2	0.926
NC_016779_4	4.3\|3480834\|27\|NC_016779\|CRT	3480834-3480860	27	NC_016779.1	3482382-3482408	2	0.926
NC_016779_4	4.6\|3480951\|27\|NC_016779\|CRT	3480951-3480977	27	NC_016779.1	3482337-3482363	2	0.926
NC_016779_4	4.7\|3480996\|27\|NC_016779\|CRT	3480996-3481022	27	NC_016779.1	3482076-3482102	2	0.926
NC_016779_4	4.7\|3480996\|27\|NC_016779\|CRT	3480996-3481022	27	NC_016779.1	3482337-3482363	2	0.926
NC_016779_4	4.7\|3480996\|27\|NC_016779\|CRT	3480996-3481022	27	NC_016779.1	3482382-3482408	2	0.926
NC_016779_4	4.9\|3481077\|27\|NC_016779\|CRT	3481077-3481103	27	NC_016779.1	3482598-3482624	2	0.926
NC_016779_4	4.11\|3481158\|27\|NC_016779\|CRT	3481158-3481184	27	NC_016779.1	3482598-3482624	2	0.926
NC_016779_5	5.1\|3481350\|27\|NC_016779\|CRT	3481350-3481376	27	NC_016779.1	3482052-3482078	2	0.926
NC_016779_5	5.1\|3481350\|27\|NC_016779\|CRT	3481350-3481376	27	NC_016779.1	3482574-3482600	2	0.926
NC_016779_5	5.1\|3481350\|27\|NC_016779\|CRT	3481350-3481376	27	NC_016779.1	3482619-3482645	2	0.926
NC_016779_5	5.2\|3481395\|27\|NC_016779\|CRT	3481395-3481421	27	NC_016779.1	3482133-3482159	2	0.926
NC_016779_5	5.2\|3481395\|27\|NC_016779\|CRT	3481395-3481421	27	NC_016779.1	3482223-3482249	2	0.926
NC_016779_5	5.2\|3481395\|27\|NC_016779\|CRT	3481395-3481421	27	NC_016779.1	3482529-3482555	2	0.926
NC_016779_5	5.2\|3481395\|27\|NC_016779\|CRT	3481395-3481421	27	NC_016779.1	3482970-3482996	2	0.926
NC_016779_5	5.3\|3481440\|27\|NC_016779\|CRT	3481440-3481466	27	NC_016779.1	3482133-3482159	2	0.926
NC_016779_5	5.3\|3481440\|27\|NC_016779\|CRT	3481440-3481466	27	NC_016779.1	3482223-3482249	2	0.926
NC_016779_5	5.3\|3481440\|27\|NC_016779\|CRT	3481440-3481466	27	NC_016779.1	3482529-3482555	2	0.926
NC_016779_5	5.3\|3481440\|27\|NC_016779\|CRT	3481440-3481466	27	NC_016779.1	3482970-3482996	2	0.926
NC_016779_5	5.5\|3481521\|27\|NC_016779\|CRT	3481521-3481547	27	NC_016779.1	3482133-3482159	2	0.926
NC_016779_5	5.5\|3481521\|27\|NC_016779\|CRT	3481521-3481547	27	NC_016779.1	3482223-3482249	2	0.926
NC_016779_5	5.5\|3481521\|27\|NC_016779\|CRT	3481521-3481547	27	NC_016779.1	3482529-3482555	2	0.926
NC_016779_5	5.5\|3481521\|27\|NC_016779\|CRT	3481521-3481547	27	NC_016779.1	3482970-3482996	2	0.926
NC_016779_5	5.6\|3481566\|27\|NC_016779\|CRT	3481566-3481592	27	NC_016779.1	3482970-3482996	2	0.926
NC_016779_5	5.7\|3481611\|27\|NC_016779\|CRT	3481611-3481637	27	NC_016779.1	3482880-3482906	2	0.926
NC_016779_5	5.8\|3481656\|27\|NC_016779\|CRT	3481656-3481682	27	NC_016779.1	3482133-3482159	2	0.926
NC_016779_5	5.8\|3481656\|27\|NC_016779\|CRT	3481656-3481682	27	NC_016779.1	3482223-3482249	2	0.926
NC_016779_5	5.8\|3481656\|27\|NC_016779\|CRT	3481656-3481682	27	NC_016779.1	3482529-3482555	2	0.926
NC_016779_5	5.8\|3481656\|27\|NC_016779\|CRT	3481656-3481682	27	NC_016779.1	3482970-3482996	2	0.926
NC_016779_5	5.9\|3481701\|27\|NC_016779\|CRT	3481701-3481727	27	NC_016779.1	3482178-3482204	2	0.926
NC_016779_5	5.9\|3481701\|27\|NC_016779\|CRT	3481701-3481727	27	NC_016779.1	3482268-3482294	2	0.926
NC_016779_5	5.10\|3481746\|27\|NC_016779\|CRT	3481746-3481772	27	NC_016779.1	3482133-3482159	2	0.926
NC_016779_5	5.10\|3481746\|27\|NC_016779\|CRT	3481746-3481772	27	NC_016779.1	3482223-3482249	2	0.926
NC_016779_5	5.10\|3481746\|27\|NC_016779\|CRT	3481746-3481772	27	NC_016779.1	3482529-3482555	2	0.926
NC_016779_5	5.10\|3481746\|27\|NC_016779\|CRT	3481746-3481772	27	NC_016779.1	3482970-3482996	2	0.926
NC_016779_5	5.13\|3481881\|27\|NC_016779\|CRT	3481881-3481907	27	NC_016779.1	3482133-3482159	2	0.926
NC_016779_5	5.13\|3481881\|27\|NC_016779\|CRT	3481881-3481907	27	NC_016779.1	3482223-3482249	2	0.926
NC_016779_5	5.13\|3481881\|27\|NC_016779\|CRT	3481881-3481907	27	NC_016779.1	3482529-3482555	2	0.926
NC_016779_5	5.13\|3481881\|27\|NC_016779\|CRT	3481881-3481907	27	NC_016779.1	3482970-3482996	2	0.926
NC_016779_5	5.14\|3481926\|27\|NC_016779\|CRT	3481926-3481952	27	NC_016779.1	3482439-3482465	2	0.926
NC_016779_5	5.14\|3481926\|27\|NC_016779\|CRT	3481926-3481952	27	NC_016779.1	3482484-3482510	2	0.926
NC_016779_5	5.14\|3481926\|27\|NC_016779\|CRT	3481926-3481952	27	NC_016779.1	3482664-3482690	2	0.926
NC_016779_5	5.16\|3482007\|27\|NC_016779\|CRT	3482007-3482033	27	NC_016779.1	3482358-3482384	2	0.926
NC_016779_5	5.16\|3482007\|27\|NC_016779\|CRT	3482007-3482033	27	NC_016779.1	3482439-3482465	2	0.926
NC_016779_5	5.16\|3482007\|27\|NC_016779\|CRT	3482007-3482033	27	NC_016779.1	3482484-3482510	2	0.926
NC_016779_5	5.16\|3482007\|27\|NC_016779\|CRT	3482007-3482033	27	NC_016779.1	3482664-3482690	2	0.926
NC_016779_5	5.16\|3482007\|27\|NC_016779\|CRT	3482007-3482033	27	NC_016779.1	3482925-3482951	2	0.926

1. spacer 2.8|1383157|18|NC_016779|CRT matches to position: 1383661-1383678, mismatch: 0, identity: 1.0

caccagtagcgccagtag	CRISPR spacer
caccagtagcgccagtag	Protospacer
******************

2. spacer 2.9|1383202|18|NC_016779|CRT matches to position: 1383661-1383678, mismatch: 0, identity: 1.0

caccagtagcgccagtag	CRISPR spacer
caccagtagcgccagtag	Protospacer
******************

3. spacer 2.10|1383247|27|NC_016779|CRT matches to position: 1383706-1383732, mismatch: 0, identity: 1.0

gcccttgaggtccagtagcgccagtag	CRISPR spacer
gcccttgaggtccagtagcgccagtag	Protospacer
***************************

4. spacer 4.5|3480915|18|NC_016779|CRT matches to position: 3482076-3482093, mismatch: 0, identity: 1.0

tgctcaaggtaacacggg	CRISPR spacer
tgctcaaggtaacacggg	Protospacer
******************

5. spacer 4.5|3480915|18|NC_016779|CRT matches to position: 3482382-3482399, mismatch: 0, identity: 1.0

tgctcaaggtaacacggg	CRISPR spacer
tgctcaaggtaacacggg	Protospacer
******************

6. spacer 5.10|3481746|27|NC_016779|CRT matches to position: 3482313-3482339, mismatch: 0, identity: 1.0

taccggtgccactggacctcaaggtgt	CRISPR spacer
taccggtgccactggacctcaaggtgt	Protospacer
***************************

7. spacer 5.11|3481791|27|NC_016779|CRT matches to position: 3482178-3482204, mismatch: 0, identity: 1.0

taccggtgctactggacctcaaggtgt	CRISPR spacer
taccggtgctactggacctcaaggtgt	Protospacer
***************************

8. spacer 5.11|3481791|27|NC_016779|CRT matches to position: 3482268-3482294, mismatch: 0, identity: 1.0

taccggtgctactggacctcaaggtgt	CRISPR spacer
taccggtgctactggacctcaaggtgt	Protospacer
***************************

9. spacer 5.12|3481836|27|NC_016779|CRT matches to position: 3482178-3482204, mismatch: 0, identity: 1.0

taccggtgctactggacctcaaggtgt	CRISPR spacer
taccggtgctactggacctcaaggtgt	Protospacer
***************************

10. spacer 5.12|3481836|27|NC_016779|CRT matches to position: 3482268-3482294, mismatch: 0, identity: 1.0

taccggtgctactggacctcaaggtgt	CRISPR spacer
taccggtgctactggacctcaaggtgt	Protospacer
***************************

11. spacer 5.13|3481881|27|NC_016779|CRT matches to position: 3482313-3482339, mismatch: 0, identity: 1.0

taccggtgccactggacctcaaggtgt	CRISPR spacer
taccggtgccactggacctcaaggtgt	Protospacer
***************************

12. spacer 5.14|3481926|27|NC_016779|CRT matches to position: 3482358-3482384, mismatch: 0, identity: 1.0

tactggtgccactggacctcaaggtgc	CRISPR spacer
tactggtgccactggacctcaaggtgc	Protospacer
***************************

13. spacer 5.14|3481926|27|NC_016779|CRT matches to position: 3482925-3482951, mismatch: 0, identity: 1.0

tactggtgccactggacctcaaggtgc	CRISPR spacer
tactggtgccactggacctcaaggtgc	Protospacer
***************************

14. spacer 5.15|3481971|18|NC_016779|CRT matches to position: 3482097-3482114, mismatch: 0, identity: 1.0

tactggacctcaaggtgt	CRISPR spacer
tactggacctcaaggtgt	Protospacer
******************

15. spacer 5.15|3481971|18|NC_016779|CRT matches to position: 3482187-3482204, mismatch: 0, identity: 1.0

tactggacctcaaggtgt	CRISPR spacer
tactggacctcaaggtgt	Protospacer
******************

16. spacer 5.15|3481971|18|NC_016779|CRT matches to position: 3482277-3482294, mismatch: 0, identity: 1.0

tactggacctcaaggtgt	CRISPR spacer
tactggacctcaaggtgt	Protospacer
******************

17. spacer 5.15|3481971|18|NC_016779|CRT matches to position: 3482403-3482420, mismatch: 0, identity: 1.0

tactggacctcaaggtgt	CRISPR spacer
tactggacctcaaggtgt	Protospacer
******************

18. spacer 5.15|3481971|18|NC_016779|CRT matches to position: 3482763-3482780, mismatch: 0, identity: 1.0

tactggacctcaaggtgt	CRISPR spacer
tactggacctcaaggtgt	Protospacer
******************

19. spacer 5.15|3481971|18|NC_016779|CRT matches to position: 3482979-3482996, mismatch: 0, identity: 1.0

tactggacctcaaggtgt	CRISPR spacer
tactggacctcaaggtgt	Protospacer
******************

20. spacer 2.10|1383247|27|NC_016779|CRT matches to position: 1383940-1383966, mismatch: 1, identity: 0.963

gcccttgaggtccagtagcgccagtag	CRISPR spacer
gcccttgaggcccagtagcgccagtag	Protospacer
**********.****************

21. spacer 2.16|1383580|18|NC_016779|CRT matches to position: 1382743-1382760, mismatch: 1, identity: 0.944

cgccagtagcacctgcag	CRISPR spacer
cgccagtagcaccagcag	Protospacer
************* ****

22. spacer 4.6|3480951|27|NC_016779|CRT matches to position: 3482076-3482102, mismatch: 1, identity: 0.963

tgttcaaggtaacacgggcgctactgg	CRISPR spacer
tgctcaaggtaacacgggcgctactgg	Protospacer
**.************************

23. spacer 4.6|3480951|27|NC_016779|CRT matches to position: 3482382-3482408, mismatch: 1, identity: 0.963

tgttcaaggtaacacgggcgctactgg	CRISPR spacer
tgctcaaggtaacacgggcgctactgg	Protospacer
**.************************

24. spacer 4.8|3481041|18|NC_016779|CRT matches to position: 3482076-3482093, mismatch: 1, identity: 0.944

tgctcaaggtaacacagg	CRISPR spacer
tgctcaaggtaacacggg	Protospacer
***************.**

25. spacer 4.8|3481041|18|NC_016779|CRT matches to position: 3482382-3482399, mismatch: 1, identity: 0.944

tgctcaaggtaacacagg	CRISPR spacer
tgctcaaggtaacacggg	Protospacer
***************.**

26. spacer 4.10|3481122|18|NC_016779|CRT matches to position: 3482076-3482093, mismatch: 1, identity: 0.944

tgctcaaggtaacacagg	CRISPR spacer
tgctcaaggtaacacggg	Protospacer
***************.**

27. spacer 4.10|3481122|18|NC_016779|CRT matches to position: 3482382-3482399, mismatch: 1, identity: 0.944

tgctcaaggtaacacagg	CRISPR spacer
tgctcaaggtaacacggg	Protospacer
***************.**

28. spacer 4.12|3481203|18|NC_016779|CRT matches to position: 3482076-3482093, mismatch: 1, identity: 0.944

tgctcaaggtaacacagg	CRISPR spacer
tgctcaaggtaacacggg	Protospacer
***************.**

29. spacer 4.12|3481203|18|NC_016779|CRT matches to position: 3482382-3482399, mismatch: 1, identity: 0.944

tgctcaaggtaacacagg	CRISPR spacer
tgctcaaggtaacacggg	Protospacer
***************.**

30. spacer 5.1|3481350|27|NC_016779|CRT matches to position: 3482358-3482384, mismatch: 1, identity: 0.963

tactggtgccactggacctcaaggcgc	CRISPR spacer
tactggtgccactggacctcaaggtgc	Protospacer
************************.**

31. spacer 5.1|3481350|27|NC_016779|CRT matches to position: 3482925-3482951, mismatch: 1, identity: 0.963

tactggtgccactggacctcaaggcgc	CRISPR spacer
tactggtgccactggacctcaaggtgc	Protospacer
************************.**

32. spacer 5.4|3481485|18|NC_016779|CRT matches to position: 3482097-3482114, mismatch: 1, identity: 0.944

tactggacctcagggtgt	CRISPR spacer
tactggacctcaaggtgt	Protospacer
************.*****

33. spacer 5.4|3481485|18|NC_016779|CRT matches to position: 3482187-3482204, mismatch: 1, identity: 0.944

tactggacctcagggtgt	CRISPR spacer
tactggacctcaaggtgt	Protospacer
************.*****

34. spacer 5.4|3481485|18|NC_016779|CRT matches to position: 3482277-3482294, mismatch: 1, identity: 0.944

tactggacctcagggtgt	CRISPR spacer
tactggacctcaaggtgt	Protospacer
************.*****

35. spacer 5.4|3481485|18|NC_016779|CRT matches to position: 3482403-3482420, mismatch: 1, identity: 0.944

tactggacctcagggtgt	CRISPR spacer
tactggacctcaaggtgt	Protospacer
************.*****

36. spacer 5.4|3481485|18|NC_016779|CRT matches to position: 3482763-3482780, mismatch: 1, identity: 0.944

tactggacctcagggtgt	CRISPR spacer
tactggacctcaaggtgt	Protospacer
************.*****

37. spacer 5.4|3481485|18|NC_016779|CRT matches to position: 3482979-3482996, mismatch: 1, identity: 0.944

tactggacctcagggtgt	CRISPR spacer
tactggacctcaaggtgt	Protospacer
************.*****

38. spacer 5.7|3481611|27|NC_016779|CRT matches to position: 3482709-3482735, mismatch: 1, identity: 0.963

taccggtgccactggacctcaaggtat	CRISPR spacer
tactggtgccactggacctcaaggtat	Protospacer
***.***********************

39. spacer 5.9|3481701|27|NC_016779|CRT matches to position: 3482313-3482339, mismatch: 1, identity: 0.963

tactggtgccactggacctcaaggtgt	CRISPR spacer
taccggtgccactggacctcaaggtgt	Protospacer
***.***********************

40. spacer 5.10|3481746|27|NC_016779|CRT matches to position: 3482178-3482204, mismatch: 1, identity: 0.963

taccggtgccactggacctcaaggtgt	CRISPR spacer
taccggtgctactggacctcaaggtgt	Protospacer
*********.*****************

41. spacer 5.10|3481746|27|NC_016779|CRT matches to position: 3482268-3482294, mismatch: 1, identity: 0.963

taccggtgccactggacctcaaggtgt	CRISPR spacer
taccggtgctactggacctcaaggtgt	Protospacer
*********.*****************

42. spacer 5.11|3481791|27|NC_016779|CRT matches to position: 3482133-3482159, mismatch: 1, identity: 0.963

taccggtgctactggacctcaaggtgt	CRISPR spacer
taccggtgctactggacctcaaggcgt	Protospacer
************************.**

43. spacer 5.11|3481791|27|NC_016779|CRT matches to position: 3482223-3482249, mismatch: 1, identity: 0.963

taccggtgctactggacctcaaggtgt	CRISPR spacer
taccggtgctactggacctcaaggcgt	Protospacer
************************.**

44. spacer 5.11|3481791|27|NC_016779|CRT matches to position: 3482313-3482339, mismatch: 1, identity: 0.963

taccggtgctactggacctcaaggtgt	CRISPR spacer
taccggtgccactggacctcaaggtgt	Protospacer
*********.*****************

45. spacer 5.11|3481791|27|NC_016779|CRT matches to position: 3482529-3482555, mismatch: 1, identity: 0.963

taccggtgctactggacctcaaggtgt	CRISPR spacer
taccggtgctactggacctcaaggcgt	Protospacer
************************.**

46. spacer 5.11|3481791|27|NC_016779|CRT matches to position: 3482970-3482996, mismatch: 1, identity: 0.963

taccggtgctactggacctcaaggtgt	CRISPR spacer
taccggcgctactggacctcaaggtgt	Protospacer
******.********************

47. spacer 5.12|3481836|27|NC_016779|CRT matches to position: 3482133-3482159, mismatch: 1, identity: 0.963

taccggtgctactggacctcaaggtgt	CRISPR spacer
taccggtgctactggacctcaaggcgt	Protospacer
************************.**

48. spacer 5.12|3481836|27|NC_016779|CRT matches to position: 3482223-3482249, mismatch: 1, identity: 0.963

taccggtgctactggacctcaaggtgt	CRISPR spacer
taccggtgctactggacctcaaggcgt	Protospacer
************************.**

49. spacer 5.12|3481836|27|NC_016779|CRT matches to position: 3482313-3482339, mismatch: 1, identity: 0.963

taccggtgctactggacctcaaggtgt	CRISPR spacer
taccggtgccactggacctcaaggtgt	Protospacer
*********.*****************

50. spacer 5.12|3481836|27|NC_016779|CRT matches to position: 3482529-3482555, mismatch: 1, identity: 0.963

taccggtgctactggacctcaaggtgt	CRISPR spacer
taccggtgctactggacctcaaggcgt	Protospacer
************************.**

51. spacer 5.12|3481836|27|NC_016779|CRT matches to position: 3482970-3482996, mismatch: 1, identity: 0.963

taccggtgctactggacctcaaggtgt	CRISPR spacer
taccggcgctactggacctcaaggtgt	Protospacer
******.********************

52. spacer 5.13|3481881|27|NC_016779|CRT matches to position: 3482178-3482204, mismatch: 1, identity: 0.963

taccggtgccactggacctcaaggtgt	CRISPR spacer
taccggtgctactggacctcaaggtgt	Protospacer
*********.*****************

53. spacer 5.13|3481881|27|NC_016779|CRT matches to position: 3482268-3482294, mismatch: 1, identity: 0.963

taccggtgccactggacctcaaggtgt	CRISPR spacer
taccggtgctactggacctcaaggtgt	Protospacer
*********.*****************

54. spacer 5.14|3481926|27|NC_016779|CRT matches to position: 3482052-3482078, mismatch: 1, identity: 0.963

tactggtgccactggacctcaaggtgc	CRISPR spacer
taccggtgccactggacctcaaggtgc	Protospacer
***.***********************

55. spacer 5.14|3481926|27|NC_016779|CRT matches to position: 3482619-3482645, mismatch: 1, identity: 0.963

tactggtgccactggacctcaaggtgc	CRISPR spacer
taccggtgccactggacctcaaggtgc	Protospacer
***.***********************

56. spacer 5.15|3481971|18|NC_016779|CRT matches to position: 3482142-3482159, mismatch: 1, identity: 0.944

tactggacctcaaggtgt	CRISPR spacer
tactggacctcaaggcgt	Protospacer
***************.**

57. spacer 5.15|3481971|18|NC_016779|CRT matches to position: 3482232-3482249, mismatch: 1, identity: 0.944

tactggacctcaaggtgt	CRISPR spacer
tactggacctcaaggcgt	Protospacer
***************.**

58. spacer 5.15|3481971|18|NC_016779|CRT matches to position: 3482538-3482555, mismatch: 1, identity: 0.944

tactggacctcaaggtgt	CRISPR spacer
tactggacctcaaggcgt	Protospacer
***************.**

59. spacer 2.1|1382779|27|NC_016779|CRT matches to position: 1382725-1382751, mismatch: 2, identity: 0.926

gtccttgagcccccgtagcgccagtag	CRISPR spacer
gtcctgtagcccccgtagcgccagtag	Protospacer
*****  ********************

60. spacer 2.2|1382833|27|NC_016779|CRT matches to position: 1382725-1382751, mismatch: 2, identity: 0.926

gtccttgagcccccgtagcgccagtag	CRISPR spacer
gtcctgtagcccccgtagcgccagtag	Protospacer
*****  ********************

61. spacer 2.3|1382887|27|NC_016779|CRT matches to position: 1382725-1382751, mismatch: 2, identity: 0.926

gtccttgagcccccgtagcgccagtag	CRISPR spacer
gtcctgtagcccccgtagcgccagtag	Protospacer
*****  ********************

62. spacer 2.4|1382941|27|NC_016779|CRT matches to position: 1383904-1383930, mismatch: 2, identity: 0.926

gtccttgagcccccgtagcaccagtag	CRISPR spacer
gtccttgaggcccagtagcaccagtag	Protospacer
********* *** *************

63. spacer 2.12|1383355|27|NC_016779|CRT matches to position: 1383904-1383930, mismatch: 2, identity: 0.926

gtccttgagcccccgtagcaccagtag	CRISPR spacer
gtccttgaggcccagtagcaccagtag	Protospacer
********* *** *************

64. spacer 2.14|1383472|27|NC_016779|CRT matches to position: 1383733-1383759, mismatch: 2, identity: 0.926

cacctgtagcacccgccggtccttgaa	CRISPR spacer
caccagtagcacccgctggtccttgaa	Protospacer
**** ***********.**********

65. spacer 4.2|3480789|27|NC_016779|CRT matches to position: 3482076-3482102, mismatch: 2, identity: 0.926

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgctcaaggtaacacgggcgctactgg	Protospacer
***************.**.********

66. spacer 4.2|3480789|27|NC_016779|CRT matches to position: 3482337-3482363, mismatch: 2, identity: 0.926

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgttcaaggtaacaccggtgctactgg	Protospacer
**.************ ***********

67. spacer 4.2|3480789|27|NC_016779|CRT matches to position: 3482382-3482408, mismatch: 2, identity: 0.926

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgctcaaggtaacacgggcgctactgg	Protospacer
***************.**.********

68. spacer 4.3|3480834|27|NC_016779|CRT matches to position: 3482076-3482102, mismatch: 2, identity: 0.926

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgctcaaggtaacacgggcgctactgg	Protospacer
***************.**.********

69. spacer 4.3|3480834|27|NC_016779|CRT matches to position: 3482337-3482363, mismatch: 2, identity: 0.926

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgttcaaggtaacaccggtgctactgg	Protospacer
**.************ ***********

70. spacer 4.3|3480834|27|NC_016779|CRT matches to position: 3482382-3482408, mismatch: 2, identity: 0.926

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgctcaaggtaacacgggcgctactgg	Protospacer
***************.**.********

71. spacer 4.6|3480951|27|NC_016779|CRT matches to position: 3482337-3482363, mismatch: 2, identity: 0.926

tgttcaaggtaacacgggcgctactgg	CRISPR spacer
tgttcaaggtaacaccggtgctactgg	Protospacer
*************** **.********

72. spacer 4.7|3480996|27|NC_016779|CRT matches to position: 3482076-3482102, mismatch: 2, identity: 0.926

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgctcaaggtaacacgggcgctactgg	Protospacer
***************.**.********

73. spacer 4.7|3480996|27|NC_016779|CRT matches to position: 3482337-3482363, mismatch: 2, identity: 0.926

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgttcaaggtaacaccggtgctactgg	Protospacer
**.************ ***********

74. spacer 4.7|3480996|27|NC_016779|CRT matches to position: 3482382-3482408, mismatch: 2, identity: 0.926

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgctcaaggtaacacgggcgctactgg	Protospacer
***************.**.********

75. spacer 4.9|3481077|27|NC_016779|CRT matches to position: 3482598-3482624, mismatch: 2, identity: 0.926

cgctcaaggaccagcgggtgctactgg	CRISPR spacer
cgctcaaggaccagcaggtgctaccgg	Protospacer
***************.********.**

76. spacer 4.11|3481158|27|NC_016779|CRT matches to position: 3482598-3482624, mismatch: 2, identity: 0.926

cgctcaaggaccagcgggtgctactgg	CRISPR spacer
cgctcaaggaccagcaggtgctaccgg	Protospacer
***************.********.**

77. spacer 5.1|3481350|27|NC_016779|CRT matches to position: 3482052-3482078, mismatch: 2, identity: 0.926

tactggtgccactggacctcaaggcgc	CRISPR spacer
taccggtgccactggacctcaaggtgc	Protospacer
***.********************.**

78. spacer 5.1|3481350|27|NC_016779|CRT matches to position: 3482574-3482600, mismatch: 2, identity: 0.926

tactggtgccactggacctcaaggcgc	CRISPR spacer
taccggtgctactggacctcaaggcgc	Protospacer
***.*****.*****************

79. spacer 5.1|3481350|27|NC_016779|CRT matches to position: 3482619-3482645, mismatch: 2, identity: 0.926

tactggtgccactggacctcaaggcgc	CRISPR spacer
taccggtgccactggacctcaaggtgc	Protospacer
***.********************.**

80. spacer 5.2|3481395|27|NC_016779|CRT matches to position: 3482133-3482159, mismatch: 2, identity: 0.926

tactggcgctactggacctcaaggcgt	CRISPR spacer
taccggtgctactggacctcaaggcgt	Protospacer
***.**.********************

81. spacer 5.2|3481395|27|NC_016779|CRT matches to position: 3482223-3482249, mismatch: 2, identity: 0.926

tactggcgctactggacctcaaggcgt	CRISPR spacer
taccggtgctactggacctcaaggcgt	Protospacer
***.**.********************

82. spacer 5.2|3481395|27|NC_016779|CRT matches to position: 3482529-3482555, mismatch: 2, identity: 0.926

tactggcgctactggacctcaaggcgt	CRISPR spacer
taccggtgctactggacctcaaggcgt	Protospacer
***.**.********************

83. spacer 5.2|3481395|27|NC_016779|CRT matches to position: 3482970-3482996, mismatch: 2, identity: 0.926

tactggcgctactggacctcaaggcgt	CRISPR spacer
taccggcgctactggacctcaaggtgt	Protospacer
***.********************.**

84. spacer 5.3|3481440|27|NC_016779|CRT matches to position: 3482133-3482159, mismatch: 2, identity: 0.926

tactggcgctactggacctcaaggcgt	CRISPR spacer
taccggtgctactggacctcaaggcgt	Protospacer
***.**.********************

85. spacer 5.3|3481440|27|NC_016779|CRT matches to position: 3482223-3482249, mismatch: 2, identity: 0.926

tactggcgctactggacctcaaggcgt	CRISPR spacer
taccggtgctactggacctcaaggcgt	Protospacer
***.**.********************

86. spacer 5.3|3481440|27|NC_016779|CRT matches to position: 3482529-3482555, mismatch: 2, identity: 0.926

tactggcgctactggacctcaaggcgt	CRISPR spacer
taccggtgctactggacctcaaggcgt	Protospacer
***.**.********************

87. spacer 5.3|3481440|27|NC_016779|CRT matches to position: 3482970-3482996, mismatch: 2, identity: 0.926

tactggcgctactggacctcaaggcgt	CRISPR spacer
taccggcgctactggacctcaaggtgt	Protospacer
***.********************.**

88. spacer 5.5|3481521|27|NC_016779|CRT matches to position: 3482133-3482159, mismatch: 2, identity: 0.926

tactggcgctactggacctcaaggcgt	CRISPR spacer
taccggtgctactggacctcaaggcgt	Protospacer
***.**.********************

89. spacer 5.5|3481521|27|NC_016779|CRT matches to position: 3482223-3482249, mismatch: 2, identity: 0.926

tactggcgctactggacctcaaggcgt	CRISPR spacer
taccggtgctactggacctcaaggcgt	Protospacer
***.**.********************

90. spacer 5.5|3481521|27|NC_016779|CRT matches to position: 3482529-3482555, mismatch: 2, identity: 0.926

tactggcgctactggacctcaaggcgt	CRISPR spacer
taccggtgctactggacctcaaggcgt	Protospacer
***.**.********************

91. spacer 5.5|3481521|27|NC_016779|CRT matches to position: 3482970-3482996, mismatch: 2, identity: 0.926

tactggcgctactggacctcaaggcgt	CRISPR spacer
taccggcgctactggacctcaaggtgt	Protospacer
***.********************.**

92. spacer 5.6|3481566|27|NC_016779|CRT matches to position: 3482970-3482996, mismatch: 2, identity: 0.926

tactggcgctactggacctcagggtgt	CRISPR spacer
taccggcgctactggacctcaaggtgt	Protospacer
***.*****************.*****

93. spacer 5.7|3481611|27|NC_016779|CRT matches to position: 3482880-3482906, mismatch: 2, identity: 0.926

taccggtgccactggacctcaaggtat	CRISPR spacer
tacaggtgctactggacctcaaggtat	Protospacer
*** *****.*****************

94. spacer 5.8|3481656|27|NC_016779|CRT matches to position: 3482133-3482159, mismatch: 2, identity: 0.926

tactggcgctactggacctcaaggcgt	CRISPR spacer
taccggtgctactggacctcaaggcgt	Protospacer
***.**.********************

95. spacer 5.8|3481656|27|NC_016779|CRT matches to position: 3482223-3482249, mismatch: 2, identity: 0.926

tactggcgctactggacctcaaggcgt	CRISPR spacer
taccggtgctactggacctcaaggcgt	Protospacer
***.**.********************

96. spacer 5.8|3481656|27|NC_016779|CRT matches to position: 3482529-3482555, mismatch: 2, identity: 0.926

tactggcgctactggacctcaaggcgt	CRISPR spacer
taccggtgctactggacctcaaggcgt	Protospacer
***.**.********************

97. spacer 5.8|3481656|27|NC_016779|CRT matches to position: 3482970-3482996, mismatch: 2, identity: 0.926

tactggcgctactggacctcaaggcgt	CRISPR spacer
taccggcgctactggacctcaaggtgt	Protospacer
***.********************.**

98. spacer 5.9|3481701|27|NC_016779|CRT matches to position: 3482178-3482204, mismatch: 2, identity: 0.926

tactggtgccactggacctcaaggtgt	CRISPR spacer
taccggtgctactggacctcaaggtgt	Protospacer
***.*****.*****************

99. spacer 5.9|3481701|27|NC_016779|CRT matches to position: 3482268-3482294, mismatch: 2, identity: 0.926

tactggtgccactggacctcaaggtgt	CRISPR spacer
taccggtgctactggacctcaaggtgt	Protospacer
***.*****.*****************

100. spacer 5.10|3481746|27|NC_016779|CRT matches to position: 3482133-3482159, mismatch: 2, identity: 0.926

taccggtgccactggacctcaaggtgt	CRISPR spacer
taccggtgctactggacctcaaggcgt	Protospacer
*********.**************.**

101. spacer 5.10|3481746|27|NC_016779|CRT matches to position: 3482223-3482249, mismatch: 2, identity: 0.926

taccggtgccactggacctcaaggtgt	CRISPR spacer
taccggtgctactggacctcaaggcgt	Protospacer
*********.**************.**

102. spacer 5.10|3481746|27|NC_016779|CRT matches to position: 3482529-3482555, mismatch: 2, identity: 0.926

taccggtgccactggacctcaaggtgt	CRISPR spacer
taccggtgctactggacctcaaggcgt	Protospacer
*********.**************.**

103. spacer 5.10|3481746|27|NC_016779|CRT matches to position: 3482970-3482996, mismatch: 2, identity: 0.926

taccggtgccactggacctcaaggtgt	CRISPR spacer
taccggcgctactggacctcaaggtgt	Protospacer
******.**.*****************

104. spacer 5.13|3481881|27|NC_016779|CRT matches to position: 3482133-3482159, mismatch: 2, identity: 0.926

taccggtgccactggacctcaaggtgt	CRISPR spacer
taccggtgctactggacctcaaggcgt	Protospacer
*********.**************.**

105. spacer 5.13|3481881|27|NC_016779|CRT matches to position: 3482223-3482249, mismatch: 2, identity: 0.926

taccggtgccactggacctcaaggtgt	CRISPR spacer
taccggtgctactggacctcaaggcgt	Protospacer
*********.**************.**

106. spacer 5.13|3481881|27|NC_016779|CRT matches to position: 3482529-3482555, mismatch: 2, identity: 0.926

taccggtgccactggacctcaaggtgt	CRISPR spacer
taccggtgctactggacctcaaggcgt	Protospacer
*********.**************.**

107. spacer 5.13|3481881|27|NC_016779|CRT matches to position: 3482970-3482996, mismatch: 2, identity: 0.926

taccggtgccactggacctcaaggtgt	CRISPR spacer
taccggcgctactggacctcaaggtgt	Protospacer
******.**.*****************

108. spacer 5.14|3481926|27|NC_016779|CRT matches to position: 3482439-3482465, mismatch: 2, identity: 0.926

tactggtgccactggacctcaaggtgc	CRISPR spacer
taccggtgctactggacctcaaggtgc	Protospacer
***.*****.*****************

109. spacer 5.14|3481926|27|NC_016779|CRT matches to position: 3482484-3482510, mismatch: 2, identity: 0.926

tactggtgccactggacctcaaggtgc	CRISPR spacer
taccggtgctactggacctcaaggtgc	Protospacer
***.*****.*****************

110. spacer 5.14|3481926|27|NC_016779|CRT matches to position: 3482664-3482690, mismatch: 2, identity: 0.926

tactggtgccactggacctcaaggtgc	CRISPR spacer
taccggtgctactggacctcaaggtgc	Protospacer
***.*****.*****************

111. spacer 5.16|3482007|27|NC_016779|CRT matches to position: 3482358-3482384, mismatch: 2, identity: 0.926

tactggcgctactggacctcaaggtgc	CRISPR spacer
tactggtgccactggacctcaaggtgc	Protospacer
******.**.*****************

112. spacer 5.16|3482007|27|NC_016779|CRT matches to position: 3482439-3482465, mismatch: 2, identity: 0.926

tactggcgctactggacctcaaggtgc	CRISPR spacer
taccggtgctactggacctcaaggtgc	Protospacer
***.**.********************

113. spacer 5.16|3482007|27|NC_016779|CRT matches to position: 3482484-3482510, mismatch: 2, identity: 0.926

tactggcgctactggacctcaaggtgc	CRISPR spacer
taccggtgctactggacctcaaggtgc	Protospacer
***.**.********************

114. spacer 5.16|3482007|27|NC_016779|CRT matches to position: 3482664-3482690, mismatch: 2, identity: 0.926

tactggcgctactggacctcaaggtgc	CRISPR spacer
taccggtgctactggacctcaaggtgc	Protospacer
***.**.********************

115. spacer 5.16|3482007|27|NC_016779|CRT matches to position: 3482925-3482951, mismatch: 2, identity: 0.926

tactggcgctactggacctcaaggtgc	CRISPR spacer
tactggtgccactggacctcaaggtgc	Protospacer
******.**.*****************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	KU847400	UNVERIFIED: Bacillus phage Crookii, complete genome	29766-29792	2	0.926
NC_016779_5	5.14\|3481926\|27\|NC_016779\|CRT	3481926-3481952	27	MN693092	Marine virus AFVG_25M37, complete genome	19114-19140	2	0.926
NC_016779_5	5.14\|3481926\|27\|NC_016779\|CRT	3481926-3481952	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3672-3698	2	0.926
NC_016779_5	5.14\|3481926\|27\|NC_016779\|CRT	3481926-3481952	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29807-29833	2	0.926
NC_016779_5	5.16\|3482007\|27\|NC_016779\|CRT	3482007-3482033	27	MN693092	Marine virus AFVG_25M37, complete genome	19114-19140	2	0.926
NC_016779_5	5.16\|3482007\|27\|NC_016779\|CRT	3482007-3482033	27	MN693405	Marine virus AFVG_25M416, complete genome	18976-19002	2	0.926
NC_016779_5	5.16\|3482007\|27\|NC_016779\|CRT	3482007-3482033	27	MN693333	Marine virus AFVG_25M417, complete genome	18976-19002	2	0.926
NC_016779_2	2.5\|1382995\|27\|NC_016779\|CRT	1382995-1383021	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	15069-15095	3	0.889
NC_016779_2	2.5\|1382995\|27\|NC_016779\|CRT	1382995-1383021	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	15072-15098	3	0.889
NC_016779_2	2.5\|1382995\|27\|NC_016779\|CRT	1382995-1383021	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	15069-15095	3	0.889
NC_016779_2	2.5\|1382995\|27\|NC_016779\|CRT	1382995-1383021	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	81616-81642	3	0.889
NC_016779_2	2.5\|1382995\|27\|NC_016779\|CRT	1382995-1383021	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	86121-86147	3	0.889
NC_016779_2	2.10\|1383247\|27\|NC_016779\|CRT	1383247-1383273	27	MN693099	Marine virus AFVG_25M184, complete genome	13868-13894	3	0.889
NC_016779_2	2.10\|1383247\|27\|NC_016779\|CRT	1383247-1383273	27	AP014301	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S28-C84, * SEQUENCING IN PROGRESS *	798-824	3	0.889
NC_016779_2	2.10\|1383247\|27\|NC_016779\|CRT	1383247-1383273	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29499-29525	3	0.889
NC_016779_2	2.10\|1383247\|27\|NC_016779\|CRT	1383247-1383273	27	MK521907	Klebsiella phage vB_KpnS_FZ41, complete genome	71429-71455	3	0.889
NC_016779_2	2.10\|1383247\|27\|NC_016779\|CRT	1383247-1383273	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3980-4006	3	0.889
NC_016779_2	2.11\|1383301\|27\|NC_016779\|CRT	1383301-1383327	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	15069-15095	3	0.889
NC_016779_2	2.11\|1383301\|27\|NC_016779\|CRT	1383301-1383327	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	15072-15098	3	0.889
NC_016779_2	2.11\|1383301\|27\|NC_016779\|CRT	1383301-1383327	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	15069-15095	3	0.889
NC_016779_2	2.11\|1383301\|27\|NC_016779\|CRT	1383301-1383327	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	81616-81642	3	0.889
NC_016779_2	2.11\|1383301\|27\|NC_016779\|CRT	1383301-1383327	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	86121-86147	3	0.889
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	13509-13535	3	0.889
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	13512-13538	3	0.889
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	13509-13535	3	0.889
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	MT682065	Klebsiella virus KpV2883, complete genome	14502-14528	3	0.889
NC_016779_4	4.2\|3480789\|27\|NC_016779\|CRT	3480789-3480815	27	JQ691611	Cronobacter phage CR9, complete genome	9702-9728	3	0.889
NC_016779_4	4.2\|3480789\|27\|NC_016779\|CRT	3480789-3480815	27	MN101228	Klebsiella phage KPN4, complete genome	27720-27746	3	0.889
NC_016779_4	4.2\|3480789\|27\|NC_016779\|CRT	3480789-3480815	27	MN163280	Klebsiella phage KpGranit, complete genome	83373-83399	3	0.889
NC_016779_4	4.2\|3480789\|27\|NC_016779\|CRT	3480789-3480815	27	MN163280	Klebsiella phage KpGranit, complete genome	84576-84602	3	0.889
NC_016779_4	4.3\|3480834\|27\|NC_016779\|CRT	3480834-3480860	27	JQ691611	Cronobacter phage CR9, complete genome	9702-9728	3	0.889
NC_016779_4	4.3\|3480834\|27\|NC_016779\|CRT	3480834-3480860	27	MN101228	Klebsiella phage KPN4, complete genome	27720-27746	3	0.889
NC_016779_4	4.3\|3480834\|27\|NC_016779\|CRT	3480834-3480860	27	MN163280	Klebsiella phage KpGranit, complete genome	83373-83399	3	0.889
NC_016779_4	4.3\|3480834\|27\|NC_016779\|CRT	3480834-3480860	27	MN163280	Klebsiella phage KpGranit, complete genome	84576-84602	3	0.889
NC_016779_4	4.7\|3480996\|27\|NC_016779\|CRT	3480996-3481022	27	JQ691611	Cronobacter phage CR9, complete genome	9702-9728	3	0.889
NC_016779_4	4.7\|3480996\|27\|NC_016779\|CRT	3480996-3481022	27	MN101228	Klebsiella phage KPN4, complete genome	27720-27746	3	0.889
NC_016779_4	4.7\|3480996\|27\|NC_016779\|CRT	3480996-3481022	27	MN163280	Klebsiella phage KpGranit, complete genome	83373-83399	3	0.889
NC_016779_4	4.7\|3480996\|27\|NC_016779\|CRT	3480996-3481022	27	MN163280	Klebsiella phage KpGranit, complete genome	84576-84602	3	0.889
NC_016779_4	4.9\|3481077\|27\|NC_016779\|CRT	3481077-3481103	27	KU716094	Mycobacterium phage Eidsmoe, complete genome	5025-5051	3	0.889
NC_016779_4	4.9\|3481077\|27\|NC_016779\|CRT	3481077-3481103	27	MH371122	Mycobacterium phage Priya, complete genome	5026-5052	3	0.889
NC_016779_4	4.9\|3481077\|27\|NC_016779\|CRT	3481077-3481103	27	NC_023716	Mycobacterium virus Alma, complete genome	5026-5052	3	0.889
NC_016779_4	4.9\|3481077\|27\|NC_016779\|CRT	3481077-3481103	27	MG872835	Mycobacterium phage Conquerage, complete genome	5025-5051	3	0.889
NC_016779_4	4.11\|3481158\|27\|NC_016779\|CRT	3481158-3481184	27	KU716094	Mycobacterium phage Eidsmoe, complete genome	5025-5051	3	0.889
NC_016779_4	4.11\|3481158\|27\|NC_016779\|CRT	3481158-3481184	27	MH371122	Mycobacterium phage Priya, complete genome	5026-5052	3	0.889
NC_016779_4	4.11\|3481158\|27\|NC_016779\|CRT	3481158-3481184	27	NC_023716	Mycobacterium virus Alma, complete genome	5026-5052	3	0.889
NC_016779_4	4.11\|3481158\|27\|NC_016779\|CRT	3481158-3481184	27	MG872835	Mycobacterium phage Conquerage, complete genome	5025-5051	3	0.889
NC_016779_5	5.1\|3481350\|27\|NC_016779\|CRT	3481350-3481376	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29807-29833	3	0.889
NC_016779_5	5.1\|3481350\|27\|NC_016779\|CRT	3481350-3481376	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3672-3698	3	0.889
NC_016779_5	5.1\|3481350\|27\|NC_016779\|CRT	3481350-3481376	27	MN693092	Marine virus AFVG_25M37, complete genome	19114-19140	3	0.889
NC_016779_5	5.1\|3481350\|27\|NC_016779\|CRT	3481350-3481376	27	AP014301	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S28-C84, * SEQUENCING IN PROGRESS *	797-823	3	0.889
NC_016779_5	5.9\|3481701\|27\|NC_016779\|CRT	3481701-3481727	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29807-29833	3	0.889
NC_016779_5	5.9\|3481701\|27\|NC_016779\|CRT	3481701-3481727	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3672-3698	3	0.889
NC_016779_5	5.9\|3481701\|27\|NC_016779\|CRT	3481701-3481727	27	MN693092	Marine virus AFVG_25M37, complete genome	19114-19140	3	0.889
NC_016779_5	5.11\|3481791\|27\|NC_016779\|CRT	3481791-3481817	27	MN693092	Marine virus AFVG_25M37, complete genome	19114-19140	3	0.889
NC_016779_5	5.12\|3481836\|27\|NC_016779\|CRT	3481836-3481862	27	MN693092	Marine virus AFVG_25M37, complete genome	19114-19140	3	0.889
NC_016779_5	5.14\|3481926\|27\|NC_016779\|CRT	3481926-3481952	27	MN163280	Klebsiella phage KpGranit, complete genome	83325-83351	3	0.889
NC_016779_5	5.14\|3481926\|27\|NC_016779\|CRT	3481926-3481952	27	MN163280	Klebsiella phage KpGranit, complete genome	84528-84554	3	0.889
NC_016779_5	5.14\|3481926\|27\|NC_016779\|CRT	3481926-3481952	27	MK521907	Klebsiella phage vB_KpnS_FZ41, complete genome	71428-71454	3	0.889
NC_016779_5	5.16\|3482007\|27\|NC_016779\|CRT	3482007-3482033	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	15070-15096	3	0.889
NC_016779_5	5.16\|3482007\|27\|NC_016779\|CRT	3482007-3482033	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	15073-15099	3	0.889
NC_016779_5	5.16\|3482007\|27\|NC_016779\|CRT	3482007-3482033	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	15070-15096	3	0.889
NC_016779_5	5.16\|3482007\|27\|NC_016779\|CRT	3482007-3482033	27	MH884513	Bacillus phage vB_BpsS-36, complete genome	21756-21782	3	0.889
NC_016779_5	5.16\|3482007\|27\|NC_016779\|CRT	3482007-3482033	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3672-3698	3	0.889
NC_016779_5	5.16\|3482007\|27\|NC_016779\|CRT	3482007-3482033	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29807-29833	3	0.889
NC_016779_5	5.16\|3482007\|27\|NC_016779\|CRT	3482007-3482033	27	MK521907	Klebsiella phage vB_KpnS_FZ41, complete genome	71428-71454	3	0.889
NC_016779_2	2.5\|1382995\|27\|NC_016779\|CRT	1382995-1383021	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	13518-13544	4	0.852
NC_016779_2	2.5\|1382995\|27\|NC_016779\|CRT	1382995-1383021	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	13521-13547	4	0.852
NC_016779_2	2.5\|1382995\|27\|NC_016779\|CRT	1382995-1383021	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	13518-13544	4	0.852
NC_016779_2	2.5\|1382995\|27\|NC_016779\|CRT	1382995-1383021	27	AP013564	Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5-MedDCM-OCT-S33-C6, * SEQUENCING IN PROGRESS *, 4 ordered pieces	9397-9423	4	0.852
NC_016779_2	2.5\|1382995\|27\|NC_016779\|CRT	1382995-1383021	27	AP013944	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, * SEQUENCING IN PROGRESS *	9227-9253	4	0.852
NC_016779_2	2.5\|1382995\|27\|NC_016779\|CRT	1382995-1383021	27	AP013943	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S40-C165, * SEQUENCING IN PROGRESS *	9999-10025	4	0.852
NC_016779_2	2.5\|1382995\|27\|NC_016779\|CRT	1382995-1383021	27	AP013945	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, * SEQUENCING IN PROGRESS *	4696-4722	4	0.852
NC_016779_2	2.5\|1382995\|27\|NC_016779\|CRT	1382995-1383021	27	AP014476	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, * SEQUENCING IN PROGRESS *, 2 ordered pieces	17105-17131	4	0.852
NC_016779_2	2.5\|1382995\|27\|NC_016779\|CRT	1382995-1383021	27	AP013942	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, * SEQUENCING IN PROGRESS *	14705-14731	4	0.852
NC_016779_2	2.10\|1383247\|27\|NC_016779\|CRT	1383247-1383273	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29808-29834	4	0.852
NC_016779_2	2.10\|1383247\|27\|NC_016779\|CRT	1383247-1383273	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	15069-15095	4	0.852
NC_016779_2	2.10\|1383247\|27\|NC_016779\|CRT	1383247-1383273	27	MN693405	Marine virus AFVG_25M416, complete genome	18975-19001	4	0.852
NC_016779_2	2.10\|1383247\|27\|NC_016779\|CRT	1383247-1383273	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	15072-15098	4	0.852
NC_016779_2	2.10\|1383247\|27\|NC_016779\|CRT	1383247-1383273	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	15069-15095	4	0.852
NC_016779_2	2.10\|1383247\|27\|NC_016779\|CRT	1383247-1383273	27	GU943042	Uncultured phage MedDCM-OCT-S09-C399 genomic sequence	13187-13213	4	0.852
NC_016779_2	2.10\|1383247\|27\|NC_016779\|CRT	1383247-1383273	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3671-3697	4	0.852
NC_016779_2	2.10\|1383247\|27\|NC_016779\|CRT	1383247-1383273	27	MN693333	Marine virus AFVG_25M417, complete genome	18975-19001	4	0.852
NC_016779_2	2.10\|1383247\|27\|NC_016779\|CRT	1383247-1383273	27	MN693092	Marine virus AFVG_25M37, complete genome	19113-19139	4	0.852
NC_016779_2	2.10\|1383247\|27\|NC_016779\|CRT	1383247-1383273	27	MH884513	Bacillus phage vB_BpsS-36, complete genome	21755-21781	4	0.852
NC_016779_2	2.10\|1383247\|27\|NC_016779\|CRT	1383247-1383273	27	AP013944	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, * SEQUENCING IN PROGRESS *	8162-8188	4	0.852
NC_016779_2	2.10\|1383247\|27\|NC_016779\|CRT	1383247-1383273	27	AP013956	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S27-C232, * SEQUENCING IN PROGRESS *	1354-1380	4	0.852
NC_016779_2	2.10\|1383247\|27\|NC_016779\|CRT	1383247-1383273	27	AP013963	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S38-C146, * SEQUENCING IN PROGRESS *	1354-1380	4	0.852
NC_016779_2	2.10\|1383247\|27\|NC_016779\|CRT	1383247-1383273	27	AP013945	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, * SEQUENCING IN PROGRESS *	3631-3657	4	0.852
NC_016779_2	2.10\|1383247\|27\|NC_016779\|CRT	1383247-1383273	27	AP013961	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S34-C156, * SEQUENCING IN PROGRESS *	1326-1352	4	0.852
NC_016779_2	2.10\|1383247\|27\|NC_016779\|CRT	1383247-1383273	27	AP014476	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, * SEQUENCING IN PROGRESS *, 2 ordered pieces	18170-18196	4	0.852
NC_016779_2	2.10\|1383247\|27\|NC_016779\|CRT	1383247-1383273	27	AP013959	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S31-C107, * SEQUENCING IN PROGRESS *	11103-11129	4	0.852
NC_016779_2	2.10\|1383247\|27\|NC_016779\|CRT	1383247-1383273	27	AP013942	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, * SEQUENCING IN PROGRESS *	15770-15796	4	0.852
NC_016779_2	2.10\|1383247\|27\|NC_016779\|CRT	1383247-1383273	27	AP013565	Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5F-MedDCM-OCT-S40-C10, * SEQUENCING IN PROGRESS *, 2 ordered pieces	40162-40188	4	0.852
NC_016779_2	2.11\|1383301\|27\|NC_016779\|CRT	1383301-1383327	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	13518-13544	4	0.852
NC_016779_2	2.11\|1383301\|27\|NC_016779\|CRT	1383301-1383327	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	13521-13547	4	0.852
NC_016779_2	2.11\|1383301\|27\|NC_016779\|CRT	1383301-1383327	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	13518-13544	4	0.852
NC_016779_2	2.11\|1383301\|27\|NC_016779\|CRT	1383301-1383327	27	AP013564	Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5-MedDCM-OCT-S33-C6, * SEQUENCING IN PROGRESS *, 4 ordered pieces	9397-9423	4	0.852
NC_016779_2	2.11\|1383301\|27\|NC_016779\|CRT	1383301-1383327	27	AP013944	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, * SEQUENCING IN PROGRESS *	9227-9253	4	0.852
NC_016779_2	2.11\|1383301\|27\|NC_016779\|CRT	1383301-1383327	27	AP013943	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S40-C165, * SEQUENCING IN PROGRESS *	9999-10025	4	0.852
NC_016779_2	2.11\|1383301\|27\|NC_016779\|CRT	1383301-1383327	27	AP013945	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, * SEQUENCING IN PROGRESS *	4696-4722	4	0.852
NC_016779_2	2.11\|1383301\|27\|NC_016779\|CRT	1383301-1383327	27	AP014476	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, * SEQUENCING IN PROGRESS *, 2 ordered pieces	17105-17131	4	0.852
NC_016779_2	2.11\|1383301\|27\|NC_016779\|CRT	1383301-1383327	27	AP013942	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, * SEQUENCING IN PROGRESS *	14705-14731	4	0.852
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	181046-181072	4	0.852
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	14775-14801	4	0.852
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	16623-16649	4	0.852
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	14778-14804	4	0.852
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	182051-182077	4	0.852
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	182147-182173	4	0.852
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	14775-14801	4	0.852
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	KM236245	Bacillus phage Mater, complete genome	53337-53363	4	0.852
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	81625-81651	4	0.852
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	86130-86156	4	0.852
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1939-1965	4	0.852
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	2376747-2376773	4	0.852
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	1250562-1250588	4	0.852
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	MN692989	Marine virus AFVG_117M66, complete genome	17820-17846	4	0.852
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	MN478377	Bacteriophage Eos, complete genome	54548-54574	4	0.852
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	KJ019159	Synechococcus phage ACG-2014f isolate Syn7803C34, complete genome	14604-14630	4	0.852
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	KJ019090	Synechococcus phage ACG-2014f isolate Syn7803US24, complete genome	14592-14618	4	0.852
NC_016779_4	4.2\|3480789\|27\|NC_016779\|CRT	3480789-3480815	27	MN434096	Klebsiella phage JIPh_Kp127, complete genome	81955-81981	4	0.852
NC_016779_4	4.2\|3480789\|27\|NC_016779\|CRT	3480789-3480815	27	MN434096	Klebsiella phage JIPh_Kp127, complete genome	85222-85248	4	0.852
NC_016779_4	4.2\|3480789\|27\|NC_016779\|CRT	3480789-3480815	27	MN163280	Klebsiella phage KpGranit, complete genome	81270-81296	4	0.852
NC_016779_4	4.2\|3480789\|27\|NC_016779\|CRT	3480789-3480815	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	76467-76493	4	0.852
NC_016779_4	4.2\|3480789\|27\|NC_016779\|CRT	3480789-3480815	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	78603-78629	4	0.852
NC_016779_4	4.2\|3480789\|27\|NC_016779\|CRT	3480789-3480815	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	79815-79841	4	0.852
NC_016779_4	4.2\|3480789\|27\|NC_016779\|CRT	3480789-3480815	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	80972-80998	4	0.852
NC_016779_4	4.2\|3480789\|27\|NC_016779\|CRT	3480789-3480815	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	83108-83134	4	0.852
NC_016779_4	4.2\|3480789\|27\|NC_016779\|CRT	3480789-3480815	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	84320-84346	4	0.852
NC_016779_4	4.3\|3480834\|27\|NC_016779\|CRT	3480834-3480860	27	MN434096	Klebsiella phage JIPh_Kp127, complete genome	81955-81981	4	0.852
NC_016779_4	4.3\|3480834\|27\|NC_016779\|CRT	3480834-3480860	27	MN434096	Klebsiella phage JIPh_Kp127, complete genome	85222-85248	4	0.852
NC_016779_4	4.3\|3480834\|27\|NC_016779\|CRT	3480834-3480860	27	MN163280	Klebsiella phage KpGranit, complete genome	81270-81296	4	0.852
NC_016779_4	4.3\|3480834\|27\|NC_016779\|CRT	3480834-3480860	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	76467-76493	4	0.852
NC_016779_4	4.3\|3480834\|27\|NC_016779\|CRT	3480834-3480860	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	78603-78629	4	0.852
NC_016779_4	4.3\|3480834\|27\|NC_016779\|CRT	3480834-3480860	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	79815-79841	4	0.852
NC_016779_4	4.3\|3480834\|27\|NC_016779\|CRT	3480834-3480860	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	80972-80998	4	0.852
NC_016779_4	4.3\|3480834\|27\|NC_016779\|CRT	3480834-3480860	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	83108-83134	4	0.852
NC_016779_4	4.3\|3480834\|27\|NC_016779\|CRT	3480834-3480860	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	84320-84346	4	0.852
NC_016779_4	4.7\|3480996\|27\|NC_016779\|CRT	3480996-3481022	27	MN434096	Klebsiella phage JIPh_Kp127, complete genome	81955-81981	4	0.852
NC_016779_4	4.7\|3480996\|27\|NC_016779\|CRT	3480996-3481022	27	MN434096	Klebsiella phage JIPh_Kp127, complete genome	85222-85248	4	0.852
NC_016779_4	4.7\|3480996\|27\|NC_016779\|CRT	3480996-3481022	27	MN163280	Klebsiella phage KpGranit, complete genome	81270-81296	4	0.852
NC_016779_4	4.7\|3480996\|27\|NC_016779\|CRT	3480996-3481022	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	76467-76493	4	0.852
NC_016779_4	4.7\|3480996\|27\|NC_016779\|CRT	3480996-3481022	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	78603-78629	4	0.852
NC_016779_4	4.7\|3480996\|27\|NC_016779\|CRT	3480996-3481022	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	79815-79841	4	0.852
NC_016779_4	4.7\|3480996\|27\|NC_016779\|CRT	3480996-3481022	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	80972-80998	4	0.852
NC_016779_4	4.7\|3480996\|27\|NC_016779\|CRT	3480996-3481022	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	83108-83134	4	0.852
NC_016779_4	4.7\|3480996\|27\|NC_016779\|CRT	3480996-3481022	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	84320-84346	4	0.852
NC_016779_4	4.9\|3481077\|27\|NC_016779\|CRT	3481077-3481103	27	NZ_CP023408	Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence	650048-650074	4	0.852
NC_016779_4	4.9\|3481077\|27\|NC_016779\|CRT	3481077-3481103	27	AP014476	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, * SEQUENCING IN PROGRESS *, 2 ordered pieces	17319-17345	4	0.852
NC_016779_4	4.9\|3481077\|27\|NC_016779\|CRT	3481077-3481103	27	AP013564	Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5-MedDCM-OCT-S33-C6, * SEQUENCING IN PROGRESS *, 4 ordered pieces	9183-9209	4	0.852
NC_016779_4	4.9\|3481077\|27\|NC_016779\|CRT	3481077-3481103	27	AP013944	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, * SEQUENCING IN PROGRESS *	9013-9039	4	0.852
NC_016779_4	4.9\|3481077\|27\|NC_016779\|CRT	3481077-3481103	27	AP013943	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S40-C165, * SEQUENCING IN PROGRESS *	9785-9811	4	0.852
NC_016779_4	4.9\|3481077\|27\|NC_016779\|CRT	3481077-3481103	27	AP013942	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, * SEQUENCING IN PROGRESS *	14919-14945	4	0.852
NC_016779_4	4.9\|3481077\|27\|NC_016779\|CRT	3481077-3481103	27	AP013945	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, * SEQUENCING IN PROGRESS *	4482-4508	4	0.852
NC_016779_4	4.11\|3481158\|27\|NC_016779\|CRT	3481158-3481184	27	NZ_CP023408	Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence	650048-650074	4	0.852
NC_016779_4	4.11\|3481158\|27\|NC_016779\|CRT	3481158-3481184	27	AP014476	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, * SEQUENCING IN PROGRESS *, 2 ordered pieces	17319-17345	4	0.852
NC_016779_4	4.11\|3481158\|27\|NC_016779\|CRT	3481158-3481184	27	AP013564	Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5-MedDCM-OCT-S33-C6, * SEQUENCING IN PROGRESS *, 4 ordered pieces	9183-9209	4	0.852
NC_016779_4	4.11\|3481158\|27\|NC_016779\|CRT	3481158-3481184	27	AP013944	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, * SEQUENCING IN PROGRESS *	9013-9039	4	0.852
NC_016779_4	4.11\|3481158\|27\|NC_016779\|CRT	3481158-3481184	27	AP013943	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S40-C165, * SEQUENCING IN PROGRESS *	9785-9811	4	0.852
NC_016779_4	4.11\|3481158\|27\|NC_016779\|CRT	3481158-3481184	27	AP013942	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, * SEQUENCING IN PROGRESS *	14919-14945	4	0.852
NC_016779_4	4.11\|3481158\|27\|NC_016779\|CRT	3481158-3481184	27	AP013945	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, * SEQUENCING IN PROGRESS *	4482-4508	4	0.852
NC_016779_5	5.1\|3481350\|27\|NC_016779\|CRT	3481350-3481376	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29498-29524	4	0.852
NC_016779_5	5.1\|3481350\|27\|NC_016779\|CRT	3481350-3481376	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3981-4007	4	0.852
NC_016779_5	5.1\|3481350\|27\|NC_016779\|CRT	3481350-3481376	27	MN693099	Marine virus AFVG_25M184, complete genome	13867-13893	4	0.852
NC_016779_5	5.1\|3481350\|27\|NC_016779\|CRT	3481350-3481376	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	14989-15015	4	0.852
NC_016779_5	5.1\|3481350\|27\|NC_016779\|CRT	3481350-3481376	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	14992-15018	4	0.852
NC_016779_5	5.1\|3481350\|27\|NC_016779\|CRT	3481350-3481376	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	14989-15015	4	0.852
NC_016779_5	5.1\|3481350\|27\|NC_016779\|CRT	3481350-3481376	27	MN163280	Klebsiella phage KpGranit, complete genome	83325-83351	4	0.852
NC_016779_5	5.1\|3481350\|27\|NC_016779\|CRT	3481350-3481376	27	MN163280	Klebsiella phage KpGranit, complete genome	84528-84554	4	0.852
NC_016779_5	5.1\|3481350\|27\|NC_016779\|CRT	3481350-3481376	27	MK521907	Klebsiella phage vB_KpnS_FZ41, complete genome	71428-71454	4	0.852
NC_016779_5	5.1\|3481350\|27\|NC_016779\|CRT	3481350-3481376	27	MN234235	Mycobacterium phage BogosyJay, complete genome	4777-4803	4	0.852
NC_016779_5	5.1\|3481350\|27\|NC_016779\|CRT	3481350-3481376	27	MT724048	Staphylococcus phage SAP3, partial genome	27094-27120	4	0.852
NC_016779_5	5.2\|3481395\|27\|NC_016779\|CRT	3481395-3481421	27	MN693092	Marine virus AFVG_25M37, complete genome	19114-19140	4	0.852
NC_016779_5	5.2\|3481395\|27\|NC_016779\|CRT	3481395-3481421	27	AP014301	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S28-C84, * SEQUENCING IN PROGRESS *	797-823	4	0.852
NC_016779_5	5.2\|3481395\|27\|NC_016779\|CRT	3481395-3481421	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	15070-15096	4	0.852
NC_016779_5	5.2\|3481395\|27\|NC_016779\|CRT	3481395-3481421	27	MN693405	Marine virus AFVG_25M416, complete genome	18976-19002	4	0.852
NC_016779_5	5.2\|3481395\|27\|NC_016779\|CRT	3481395-3481421	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	15073-15099	4	0.852
NC_016779_5	5.2\|3481395\|27\|NC_016779\|CRT	3481395-3481421	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	15070-15096	4	0.852
NC_016779_5	5.2\|3481395\|27\|NC_016779\|CRT	3481395-3481421	27	MN693333	Marine virus AFVG_25M417, complete genome	18976-19002	4	0.852
NC_016779_5	5.2\|3481395\|27\|NC_016779\|CRT	3481395-3481421	27	NC_024210	Escherichia phage e4/1c, complete genome	7865-7891	4	0.852
NC_016779_5	5.3\|3481440\|27\|NC_016779\|CRT	3481440-3481466	27	MN693092	Marine virus AFVG_25M37, complete genome	19114-19140	4	0.852
NC_016779_5	5.3\|3481440\|27\|NC_016779\|CRT	3481440-3481466	27	AP014301	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S28-C84, * SEQUENCING IN PROGRESS *	797-823	4	0.852
NC_016779_5	5.3\|3481440\|27\|NC_016779\|CRT	3481440-3481466	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	15070-15096	4	0.852
NC_016779_5	5.3\|3481440\|27\|NC_016779\|CRT	3481440-3481466	27	MN693405	Marine virus AFVG_25M416, complete genome	18976-19002	4	0.852
NC_016779_5	5.3\|3481440\|27\|NC_016779\|CRT	3481440-3481466	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	15073-15099	4	0.852
NC_016779_5	5.3\|3481440\|27\|NC_016779\|CRT	3481440-3481466	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	15070-15096	4	0.852
NC_016779_5	5.3\|3481440\|27\|NC_016779\|CRT	3481440-3481466	27	MN693333	Marine virus AFVG_25M417, complete genome	18976-19002	4	0.852
NC_016779_5	5.3\|3481440\|27\|NC_016779\|CRT	3481440-3481466	27	NC_024210	Escherichia phage e4/1c, complete genome	7865-7891	4	0.852
NC_016779_5	5.5\|3481521\|27\|NC_016779\|CRT	3481521-3481547	27	MN693092	Marine virus AFVG_25M37, complete genome	19114-19140	4	0.852
NC_016779_5	5.5\|3481521\|27\|NC_016779\|CRT	3481521-3481547	27	AP014301	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S28-C84, * SEQUENCING IN PROGRESS *	797-823	4	0.852
NC_016779_5	5.5\|3481521\|27\|NC_016779\|CRT	3481521-3481547	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	15070-15096	4	0.852
NC_016779_5	5.5\|3481521\|27\|NC_016779\|CRT	3481521-3481547	27	MN693405	Marine virus AFVG_25M416, complete genome	18976-19002	4	0.852
NC_016779_5	5.5\|3481521\|27\|NC_016779\|CRT	3481521-3481547	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	15073-15099	4	0.852
NC_016779_5	5.5\|3481521\|27\|NC_016779\|CRT	3481521-3481547	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	15070-15096	4	0.852
NC_016779_5	5.5\|3481521\|27\|NC_016779\|CRT	3481521-3481547	27	MN693333	Marine virus AFVG_25M417, complete genome	18976-19002	4	0.852
NC_016779_5	5.5\|3481521\|27\|NC_016779\|CRT	3481521-3481547	27	NC_024210	Escherichia phage e4/1c, complete genome	7865-7891	4	0.852
NC_016779_5	5.6\|3481566\|27\|NC_016779\|CRT	3481566-3481592	27	MN693092	Marine virus AFVG_25M37, complete genome	19114-19140	4	0.852
NC_016779_5	5.7\|3481611\|27\|NC_016779\|CRT	3481611-3481637	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29807-29833	4	0.852
NC_016779_5	5.7\|3481611\|27\|NC_016779\|CRT	3481611-3481637	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3672-3698	4	0.852
NC_016779_5	5.8\|3481656\|27\|NC_016779\|CRT	3481656-3481682	27	MN693092	Marine virus AFVG_25M37, complete genome	19114-19140	4	0.852
NC_016779_5	5.8\|3481656\|27\|NC_016779\|CRT	3481656-3481682	27	AP014301	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S28-C84, * SEQUENCING IN PROGRESS *	797-823	4	0.852
NC_016779_5	5.8\|3481656\|27\|NC_016779\|CRT	3481656-3481682	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	15070-15096	4	0.852
NC_016779_5	5.8\|3481656\|27\|NC_016779\|CRT	3481656-3481682	27	MN693405	Marine virus AFVG_25M416, complete genome	18976-19002	4	0.852
NC_016779_5	5.8\|3481656\|27\|NC_016779\|CRT	3481656-3481682	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	15073-15099	4	0.852
NC_016779_5	5.8\|3481656\|27\|NC_016779\|CRT	3481656-3481682	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	15070-15096	4	0.852
NC_016779_5	5.8\|3481656\|27\|NC_016779\|CRT	3481656-3481682	27	MN693333	Marine virus AFVG_25M417, complete genome	18976-19002	4	0.852
NC_016779_5	5.8\|3481656\|27\|NC_016779\|CRT	3481656-3481682	27	NC_024210	Escherichia phage e4/1c, complete genome	7865-7891	4	0.852
NC_016779_5	5.9\|3481701\|27\|NC_016779\|CRT	3481701-3481727	27	MN163280	Klebsiella phage KpGranit, complete genome	83325-83351	4	0.852
NC_016779_5	5.9\|3481701\|27\|NC_016779\|CRT	3481701-3481727	27	MN163280	Klebsiella phage KpGranit, complete genome	84528-84554	4	0.852
NC_016779_5	5.9\|3481701\|27\|NC_016779\|CRT	3481701-3481727	27	MK521907	Klebsiella phage vB_KpnS_FZ41, complete genome	71428-71454	4	0.852
NC_016779_5	5.9\|3481701\|27\|NC_016779\|CRT	3481701-3481727	27	MT724048	Staphylococcus phage SAP3, partial genome	27094-27120	4	0.852
NC_016779_5	5.10\|3481746\|27\|NC_016779\|CRT	3481746-3481772	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3672-3698	4	0.852
NC_016779_5	5.10\|3481746\|27\|NC_016779\|CRT	3481746-3481772	27	MN693092	Marine virus AFVG_25M37, complete genome	19114-19140	4	0.852
NC_016779_5	5.10\|3481746\|27\|NC_016779\|CRT	3481746-3481772	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29807-29833	4	0.852
NC_016779_5	5.11\|3481791\|27\|NC_016779\|CRT	3481791-3481817	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29807-29833	4	0.852
NC_016779_5	5.11\|3481791\|27\|NC_016779\|CRT	3481791-3481817	27	HQ615693	Synechococcus phage S-CRM01, complete genome	25956-25982	4	0.852
NC_016779_5	5.11\|3481791\|27\|NC_016779\|CRT	3481791-3481817	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3672-3698	4	0.852
NC_016779_5	5.11\|3481791\|27\|NC_016779\|CRT	3481791-3481817	27	MK521907	Klebsiella phage vB_KpnS_FZ41, complete genome	71428-71454	4	0.852
NC_016779_5	5.12\|3481836\|27\|NC_016779\|CRT	3481836-3481862	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29807-29833	4	0.852
NC_016779_5	5.12\|3481836\|27\|NC_016779\|CRT	3481836-3481862	27	HQ615693	Synechococcus phage S-CRM01, complete genome	25956-25982	4	0.852
NC_016779_5	5.12\|3481836\|27\|NC_016779\|CRT	3481836-3481862	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3672-3698	4	0.852
NC_016779_5	5.12\|3481836\|27\|NC_016779\|CRT	3481836-3481862	27	MK521907	Klebsiella phage vB_KpnS_FZ41, complete genome	71428-71454	4	0.852
NC_016779_5	5.13\|3481881\|27\|NC_016779\|CRT	3481881-3481907	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3672-3698	4	0.852
NC_016779_5	5.13\|3481881\|27\|NC_016779\|CRT	3481881-3481907	27	MN693092	Marine virus AFVG_25M37, complete genome	19114-19140	4	0.852
NC_016779_5	5.13\|3481881\|27\|NC_016779\|CRT	3481881-3481907	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29807-29833	4	0.852
NC_016779_5	5.14\|3481926\|27\|NC_016779\|CRT	3481926-3481952	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3981-4007	4	0.852
NC_016779_5	5.14\|3481926\|27\|NC_016779\|CRT	3481926-3481952	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29498-29524	4	0.852
NC_016779_5	5.14\|3481926\|27\|NC_016779\|CRT	3481926-3481952	27	MN693099	Marine virus AFVG_25M184, complete genome	13867-13893	4	0.852
NC_016779_5	5.14\|3481926\|27\|NC_016779\|CRT	3481926-3481952	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	15805-15831	4	0.852
NC_016779_5	5.14\|3481926\|27\|NC_016779\|CRT	3481926-3481952	27	AP013959	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S31-C107, * SEQUENCING IN PROGRESS *	11104-11130	4	0.852
NC_016779_5	5.14\|3481926\|27\|NC_016779\|CRT	3481926-3481952	27	AP013565	Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5F-MedDCM-OCT-S40-C10, * SEQUENCING IN PROGRESS *, 2 ordered pieces	40163-40189	4	0.852
NC_016779_5	5.14\|3481926\|27\|NC_016779\|CRT	3481926-3481952	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	16966-16992	4	0.852
NC_016779_5	5.14\|3481926\|27\|NC_016779\|CRT	3481926-3481952	27	MT724048	Staphylococcus phage SAP3, partial genome	27094-27120	4	0.852
NC_016779_5	5.14\|3481926\|27\|NC_016779\|CRT	3481926-3481952	27	AP013956	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S27-C232, * SEQUENCING IN PROGRESS *	1353-1379	4	0.852
NC_016779_5	5.14\|3481926\|27\|NC_016779\|CRT	3481926-3481952	27	AP014301	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S28-C84, * SEQUENCING IN PROGRESS *	797-823	4	0.852
NC_016779_5	5.14\|3481926\|27\|NC_016779\|CRT	3481926-3481952	27	AP013963	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S38-C146, * SEQUENCING IN PROGRESS *	1353-1379	4	0.852
NC_016779_5	5.14\|3481926\|27\|NC_016779\|CRT	3481926-3481952	27	AP013961	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S34-C156, * SEQUENCING IN PROGRESS *	1325-1351	4	0.852
NC_016779_5	5.16\|3482007\|27\|NC_016779\|CRT	3482007-3482033	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	15805-15831	4	0.852
NC_016779_5	5.16\|3482007\|27\|NC_016779\|CRT	3482007-3482033	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	16966-16992	4	0.852
NC_016779_5	5.16\|3482007\|27\|NC_016779\|CRT	3482007-3482033	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3981-4007	4	0.852
NC_016779_5	5.16\|3482007\|27\|NC_016779\|CRT	3482007-3482033	27	MN693099	Marine virus AFVG_25M184, complete genome	13867-13893	4	0.852
NC_016779_5	5.16\|3482007\|27\|NC_016779\|CRT	3482007-3482033	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29498-29524	4	0.852
NC_016779_5	5.16\|3482007\|27\|NC_016779\|CRT	3482007-3482033	27	AP013959	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S31-C107, * SEQUENCING IN PROGRESS *	11104-11130	4	0.852
NC_016779_5	5.16\|3482007\|27\|NC_016779\|CRT	3482007-3482033	27	AP013565	Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5F-MedDCM-OCT-S40-C10, * SEQUENCING IN PROGRESS *, 2 ordered pieces	40163-40189	4	0.852
NC_016779_5	5.16\|3482007\|27\|NC_016779\|CRT	3482007-3482033	27	AP013956	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S27-C232, * SEQUENCING IN PROGRESS *	1353-1379	4	0.852
NC_016779_5	5.16\|3482007\|27\|NC_016779\|CRT	3482007-3482033	27	AP014301	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S28-C84, * SEQUENCING IN PROGRESS *	797-823	4	0.852
NC_016779_5	5.16\|3482007\|27\|NC_016779\|CRT	3482007-3482033	27	AP013963	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S38-C146, * SEQUENCING IN PROGRESS *	1353-1379	4	0.852
NC_016779_5	5.16\|3482007\|27\|NC_016779\|CRT	3482007-3482033	27	AP013961	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S34-C156, * SEQUENCING IN PROGRESS *	1325-1351	4	0.852
NC_016779_2	2.4\|1382941\|27\|NC_016779\|CRT	1382941-1382967	27	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	2376747-2376773	5	0.815
NC_016779_2	2.4\|1382941\|27\|NC_016779\|CRT	1382941-1382967	27	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	1250562-1250588	5	0.815
NC_016779_2	2.4\|1382941\|27\|NC_016779\|CRT	1382941-1382967	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	14775-14801	5	0.815
NC_016779_2	2.4\|1382941\|27\|NC_016779\|CRT	1382941-1382967	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	16623-16649	5	0.815
NC_016779_2	2.4\|1382941\|27\|NC_016779\|CRT	1382941-1382967	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	14778-14804	5	0.815
NC_016779_2	2.4\|1382941\|27\|NC_016779\|CRT	1382941-1382967	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	14775-14801	5	0.815
NC_016779_2	2.5\|1382995\|27\|NC_016779\|CRT	1382995-1383021	27	MN692989	Marine virus AFVG_117M66, complete genome	17811-17837	5	0.815
NC_016779_2	2.5\|1382995\|27\|NC_016779\|CRT	1382995-1383021	27	MK514281	Erwinia phage Rebecca, complete genome	256104-256130	5	0.815
NC_016779_2	2.5\|1382995\|27\|NC_016779\|CRT	1382995-1383021	27	NZ_CP046295	Acinetobacter lwoffii strain FDAARGOS_552 plasmid unnamed1, complete sequence	154919-154945	5	0.815
NC_016779_2	2.10\|1383247\|27\|NC_016779\|CRT	1383247-1383273	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	15804-15830	5	0.815
NC_016779_2	2.10\|1383247\|27\|NC_016779\|CRT	1383247-1383273	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	16965-16991	5	0.815
NC_016779_2	2.10\|1383247\|27\|NC_016779\|CRT	1383247-1383273	27	NC_019958	Mycobacterium sp. JS623 plasmid pMYCSM02, complete sequence	74267-74293	5	0.815
NC_016779_2	2.11\|1383301\|27\|NC_016779\|CRT	1383301-1383327	27	MN692989	Marine virus AFVG_117M66, complete genome	17811-17837	5	0.815
NC_016779_2	2.11\|1383301\|27\|NC_016779\|CRT	1383301-1383327	27	MK514281	Erwinia phage Rebecca, complete genome	256104-256130	5	0.815
NC_016779_2	2.11\|1383301\|27\|NC_016779\|CRT	1383301-1383327	27	NZ_CP046295	Acinetobacter lwoffii strain FDAARGOS_552 plasmid unnamed1, complete sequence	154919-154945	5	0.815
NC_016779_2	2.12\|1383355\|27\|NC_016779\|CRT	1383355-1383381	27	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	2376747-2376773	5	0.815
NC_016779_2	2.12\|1383355\|27\|NC_016779\|CRT	1383355-1383381	27	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	1250562-1250588	5	0.815
NC_016779_2	2.12\|1383355\|27\|NC_016779\|CRT	1383355-1383381	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	14775-14801	5	0.815
NC_016779_2	2.12\|1383355\|27\|NC_016779\|CRT	1383355-1383381	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	16623-16649	5	0.815
NC_016779_2	2.12\|1383355\|27\|NC_016779\|CRT	1383355-1383381	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	14778-14804	5	0.815
NC_016779_2	2.12\|1383355\|27\|NC_016779\|CRT	1383355-1383381	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	14775-14801	5	0.815
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	15060-15086	5	0.815
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	180950-180976	5	0.815
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	15276-15302	5	0.815
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	16758-16784	5	0.815
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	15063-15089	5	0.815
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	15279-15305	5	0.815
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	17007-17033	5	0.815
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	179632-179658	5	0.815
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	179728-179754	5	0.815
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	15060-15086	5	0.815
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	15276-15302	5	0.815
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	17925-17951	5	0.815
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	NZ_CP011513	Paenibacillus peoriae strain HS311 plasmid unnamed, complete sequence	10695-10721	5	0.815
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	KJ019095	Synechococcus phage ACG-2014f isolate Syn7803US34, complete genome	15655-15681	5	0.815
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	KJ019086	Synechococcus phage ACG-2014f isolate Syn7803US17, complete genome	15654-15680	5	0.815
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	KJ019106	Synechococcus phage ACG-2014f isolate Syn7803US50, complete genome	15436-15462	5	0.815
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	KJ019107	Synechococcus phage ACG-2014f isolate Syn7803US52, complete genome	15423-15449	5	0.815
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	KJ019143	Synechococcus phage ACG-2014f isolate Syn7803C12, complete genome	15426-15452	5	0.815
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	KJ019103	Synechococcus phage ACG-2014f isolate Syn7803US44, complete genome	15960-15986	5	0.815
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	KJ019102	Synechococcus phage ACG-2014f isolate Syn7803US43, complete genome	15435-15461	5	0.815
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	KJ019066	Synechococcus phage ACG-2014f isolate Syn7803C9, complete genome	15423-15449	5	0.815
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	KJ019142	Synechococcus phage ACG-2014f isolate Syn7803C11, complete genome	15423-15449	5	0.815
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	KJ019149	Synechococcus phage ACG-2014f isolate Syn7803C21, complete genome	15436-15462	5	0.815
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	KJ019105	Synechococcus phage ACG-2014f isolate Syn7803US4, complete genome	15423-15449	5	0.815
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	KJ019098	Synechococcus phage ACG-2014f isolate Syn7803US39, complete genome	15426-15452	5	0.815
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	KJ019159	Synechococcus phage ACG-2014f isolate Syn7803C34, complete genome	15654-15680	5	0.815
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	KJ019123	Synechococcus phage ACG-2014f isolate Syn7803US7, complete genome	15433-15459	5	0.815
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	KJ019111	Synechococcus phage ACG-2014f isolate Syn7803US57, complete genome	15423-15449	5	0.815
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	KJ019148	Synechococcus phage ACG-2014f isolate Syn7803C19, complete genome	15436-15462	5	0.815
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	NC_047712	Synechococcus phage ACG-2014f isolate Syn7803C7, complete genome	15435-15461	5	0.815
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	KJ019090	Synechococcus phage ACG-2014f isolate Syn7803US24, complete genome	15642-15668	5	0.815
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	KJ019146	Synechococcus phage ACG-2014f isolate Syn7803C16, complete genome	15419-15445	5	0.815
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	KJ019152	Synechococcus phage ACG-2014f isolate Syn7803C25, complete genome	15435-15461	5	0.815
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	KJ019093	Synechococcus phage ACG-2014f isolate Syn7803US30, complete genome	15436-15462	5	0.815
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	KJ019151	Synechococcus phage ACG-2014f isolate Syn7803C24, complete genome	15422-15448	5	0.815
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	KJ019150	Synechococcus phage ACG-2014f isolate Syn7803C22, complete genome	15423-15449	5	0.815
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	NC_026927	Synechococcus phage ACG-2014f isolate Syn7803C90, complete genome	15423-15449	5	0.815
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	KJ019097	Synechococcus phage ACG-2014f isolate Syn7803US37, complete genome	15423-15449	5	0.815
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	KJ019045	Synechococcus phage ACG-2014f isolate Syn7803C6, complete genome	15423-15449	5	0.815
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	KJ019037	Synechococcus phage ACG-2014f isolate Syn7803C58, complete genome	15423-15449	5	0.815
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	KJ019099	Synechococcus phage ACG-2014f isolate Syn7803US3, complete genome	15426-15452	5	0.815
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	KJ019155	Synechococcus phage ACG-2014f isolate Syn7803C29, complete genome	15423-15449	5	0.815
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	KJ019141	Synechococcus phage ACG-2014f isolate Syn7803C10, complete genome	15361-15387	5	0.815
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	KJ019053	Synechococcus phage ACG-2014f isolate Syn7803C80, complete genome	15426-15452	5	0.815
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	KJ019147	Synechococcus phage ACG-2014f isolate Syn7803C17, complete genome	15421-15447	5	0.815
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	KJ019100	Synechococcus phage ACG-2014f isolate Syn7803US40, complete genome	15436-15462	5	0.815
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	KJ019101	Synechococcus phage ACG-2014f isolate Syn7803US42, complete genome	16519-16545	5	0.815
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	KJ019085	Synechococcus phage ACG-2014f isolate Syn7803US13, complete genome	15423-15449	5	0.815
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	KJ019096	Synechococcus phage ACG-2014f isolate Syn7803US36, complete genome	16076-16102	5	0.815
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	KJ019091	Synechococcus phage ACG-2014f isolate Syn7803US26, complete genome	15423-15449	5	0.815
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	KJ019144	Synechococcus phage ACG-2014f isolate Syn7803C14, complete genome	15423-15449	5	0.815
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	KJ019145	Synechococcus phage ACG-2014f isolate Syn7803C15, complete genome	15384-15410	5	0.815
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	KJ019058	Synechococcus phage ACG-2014f isolate Syn7803C8, complete genome	15779-15805	5	0.815
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	KJ019092	Synechococcus phage ACG-2014f isolate Syn7803US2, complete genome	15426-15452	5	0.815
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	MT219824	Escherichia coli strain RT18-1 plasmid pRT18-1_294k_tetX, complete sequence	246900-246926	5	0.815
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	MN163280	Klebsiella phage KpGranit, complete genome	86386-86412	5	0.815
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	KF800937	Vibrio phage AS51, complete genome	28883-28909	5	0.815
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	NC_047815	Erwinia phage vB_EamM_Yoloswag, complete genome	67729-67755	5	0.815
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	KY290756	Vibrio phage Vp670, complete genome	39174-39200	5	0.815
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	MN694312	Marine virus AFVG_250M269, complete genome	21428-21454	5	0.815
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	KF322026	Vibrio phage phi-A318, complete genome	28885-28911	5	0.815
NC_016779_4	4.2\|3480789\|27\|NC_016779\|CRT	3480789-3480815	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3951-3977	5	0.815
NC_016779_4	4.2\|3480789\|27\|NC_016779\|CRT	3480789-3480815	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29528-29554	5	0.815
NC_016779_4	4.3\|3480834\|27\|NC_016779\|CRT	3480834-3480860	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3951-3977	5	0.815
NC_016779_4	4.3\|3480834\|27\|NC_016779\|CRT	3480834-3480860	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29528-29554	5	0.815
NC_016779_4	4.7\|3480996\|27\|NC_016779\|CRT	3480996-3481022	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3951-3977	5	0.815
NC_016779_4	4.7\|3480996\|27\|NC_016779\|CRT	3480996-3481022	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29528-29554	5	0.815
NC_016779_5	5.1\|3481350\|27\|NC_016779\|CRT	3481350-3481376	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	15805-15831	5	0.815
NC_016779_5	5.1\|3481350\|27\|NC_016779\|CRT	3481350-3481376	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	16966-16992	5	0.815
NC_016779_5	5.1\|3481350\|27\|NC_016779\|CRT	3481350-3481376	27	AP013956	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S27-C232, * SEQUENCING IN PROGRESS *	1353-1379	5	0.815
NC_016779_5	5.1\|3481350\|27\|NC_016779\|CRT	3481350-3481376	27	AP013963	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S38-C146, * SEQUENCING IN PROGRESS *	1353-1379	5	0.815
NC_016779_5	5.1\|3481350\|27\|NC_016779\|CRT	3481350-3481376	27	AP013961	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S34-C156, * SEQUENCING IN PROGRESS *	1325-1351	5	0.815
NC_016779_5	5.1\|3481350\|27\|NC_016779\|CRT	3481350-3481376	27	AP013959	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S31-C107, * SEQUENCING IN PROGRESS *	11104-11130	5	0.815
NC_016779_5	5.1\|3481350\|27\|NC_016779\|CRT	3481350-3481376	27	AP013565	Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5F-MedDCM-OCT-S40-C10, * SEQUENCING IN PROGRESS *, 2 ordered pieces	40163-40189	5	0.815
NC_016779_5	5.2\|3481395\|27\|NC_016779\|CRT	3481395-3481421	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3981-4007	5	0.815
NC_016779_5	5.2\|3481395\|27\|NC_016779\|CRT	3481395-3481421	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3672-3698	5	0.815
NC_016779_5	5.2\|3481395\|27\|NC_016779\|CRT	3481395-3481421	27	MN693099	Marine virus AFVG_25M184, complete genome	13867-13893	5	0.815
NC_016779_5	5.2\|3481395\|27\|NC_016779\|CRT	3481395-3481421	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29498-29524	5	0.815
NC_016779_5	5.2\|3481395\|27\|NC_016779\|CRT	3481395-3481421	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29807-29833	5	0.815
NC_016779_5	5.2\|3481395\|27\|NC_016779\|CRT	3481395-3481421	27	MH884513	Bacillus phage vB_BpsS-36, complete genome	21756-21782	5	0.815
NC_016779_5	5.2\|3481395\|27\|NC_016779\|CRT	3481395-3481421	27	NZ_CP022543	Antarctobacter heliothermus strain SMS3 plasmid pSMS3-3, complete sequence	32226-32252	5	0.815
NC_016779_5	5.2\|3481395\|27\|NC_016779\|CRT	3481395-3481421	27	MK521907	Klebsiella phage vB_KpnS_FZ41, complete genome	71428-71454	5	0.815
NC_016779_5	5.2\|3481395\|27\|NC_016779\|CRT	3481395-3481421	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	102-128	5	0.815
NC_016779_5	5.2\|3481395\|27\|NC_016779\|CRT	3481395-3481421	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	129-155	5	0.815
NC_016779_5	5.2\|3481395\|27\|NC_016779\|CRT	3481395-3481421	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	255-281	5	0.815
NC_016779_5	5.2\|3481395\|27\|NC_016779\|CRT	3481395-3481421	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	993-1019	5	0.815
NC_016779_5	5.2\|3481395\|27\|NC_016779\|CRT	3481395-3481421	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1182-1208	5	0.815
NC_016779_5	5.2\|3481395\|27\|NC_016779\|CRT	3481395-3481421	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1632-1658	5	0.815
NC_016779_5	5.2\|3481395\|27\|NC_016779\|CRT	3481395-3481421	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1686-1712	5	0.815
NC_016779_5	5.2\|3481395\|27\|NC_016779\|CRT	3481395-3481421	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1740-1766	5	0.815
NC_016779_5	5.2\|3481395\|27\|NC_016779\|CRT	3481395-3481421	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1767-1793	5	0.815
NC_016779_5	5.2\|3481395\|27\|NC_016779\|CRT	3481395-3481421	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1848-1874	5	0.815
NC_016779_5	5.2\|3481395\|27\|NC_016779\|CRT	3481395-3481421	27	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733022-733048	5	0.815
NC_016779_5	5.2\|3481395\|27\|NC_016779\|CRT	3481395-3481421	27	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733175-733201	5	0.815
NC_016779_5	5.2\|3481395\|27\|NC_016779\|CRT	3481395-3481421	27	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733373-733399	5	0.815
NC_016779_5	5.2\|3481395\|27\|NC_016779\|CRT	3481395-3481421	27	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733400-733426	5	0.815
NC_016779_5	5.3\|3481440\|27\|NC_016779\|CRT	3481440-3481466	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3981-4007	5	0.815
NC_016779_5	5.3\|3481440\|27\|NC_016779\|CRT	3481440-3481466	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3672-3698	5	0.815
NC_016779_5	5.3\|3481440\|27\|NC_016779\|CRT	3481440-3481466	27	MN693099	Marine virus AFVG_25M184, complete genome	13867-13893	5	0.815
NC_016779_5	5.3\|3481440\|27\|NC_016779\|CRT	3481440-3481466	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29498-29524	5	0.815
NC_016779_5	5.3\|3481440\|27\|NC_016779\|CRT	3481440-3481466	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29807-29833	5	0.815
NC_016779_5	5.3\|3481440\|27\|NC_016779\|CRT	3481440-3481466	27	MH884513	Bacillus phage vB_BpsS-36, complete genome	21756-21782	5	0.815
NC_016779_5	5.3\|3481440\|27\|NC_016779\|CRT	3481440-3481466	27	NZ_CP022543	Antarctobacter heliothermus strain SMS3 plasmid pSMS3-3, complete sequence	32226-32252	5	0.815
NC_016779_5	5.3\|3481440\|27\|NC_016779\|CRT	3481440-3481466	27	MK521907	Klebsiella phage vB_KpnS_FZ41, complete genome	71428-71454	5	0.815
NC_016779_5	5.3\|3481440\|27\|NC_016779\|CRT	3481440-3481466	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	102-128	5	0.815
NC_016779_5	5.3\|3481440\|27\|NC_016779\|CRT	3481440-3481466	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	129-155	5	0.815
NC_016779_5	5.3\|3481440\|27\|NC_016779\|CRT	3481440-3481466	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	255-281	5	0.815
NC_016779_5	5.3\|3481440\|27\|NC_016779\|CRT	3481440-3481466	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	993-1019	5	0.815
NC_016779_5	5.3\|3481440\|27\|NC_016779\|CRT	3481440-3481466	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1182-1208	5	0.815
NC_016779_5	5.3\|3481440\|27\|NC_016779\|CRT	3481440-3481466	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1632-1658	5	0.815
NC_016779_5	5.3\|3481440\|27\|NC_016779\|CRT	3481440-3481466	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1686-1712	5	0.815
NC_016779_5	5.3\|3481440\|27\|NC_016779\|CRT	3481440-3481466	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1740-1766	5	0.815
NC_016779_5	5.3\|3481440\|27\|NC_016779\|CRT	3481440-3481466	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1767-1793	5	0.815
NC_016779_5	5.3\|3481440\|27\|NC_016779\|CRT	3481440-3481466	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1848-1874	5	0.815
NC_016779_5	5.3\|3481440\|27\|NC_016779\|CRT	3481440-3481466	27	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733022-733048	5	0.815
NC_016779_5	5.3\|3481440\|27\|NC_016779\|CRT	3481440-3481466	27	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733175-733201	5	0.815
NC_016779_5	5.3\|3481440\|27\|NC_016779\|CRT	3481440-3481466	27	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733373-733399	5	0.815
NC_016779_5	5.3\|3481440\|27\|NC_016779\|CRT	3481440-3481466	27	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733400-733426	5	0.815
NC_016779_5	5.5\|3481521\|27\|NC_016779\|CRT	3481521-3481547	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3981-4007	5	0.815
NC_016779_5	5.5\|3481521\|27\|NC_016779\|CRT	3481521-3481547	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3672-3698	5	0.815
NC_016779_5	5.5\|3481521\|27\|NC_016779\|CRT	3481521-3481547	27	MN693099	Marine virus AFVG_25M184, complete genome	13867-13893	5	0.815
NC_016779_5	5.5\|3481521\|27\|NC_016779\|CRT	3481521-3481547	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29498-29524	5	0.815
NC_016779_5	5.5\|3481521\|27\|NC_016779\|CRT	3481521-3481547	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29807-29833	5	0.815
NC_016779_5	5.5\|3481521\|27\|NC_016779\|CRT	3481521-3481547	27	MH884513	Bacillus phage vB_BpsS-36, complete genome	21756-21782	5	0.815
NC_016779_5	5.5\|3481521\|27\|NC_016779\|CRT	3481521-3481547	27	NZ_CP022543	Antarctobacter heliothermus strain SMS3 plasmid pSMS3-3, complete sequence	32226-32252	5	0.815
NC_016779_5	5.5\|3481521\|27\|NC_016779\|CRT	3481521-3481547	27	MK521907	Klebsiella phage vB_KpnS_FZ41, complete genome	71428-71454	5	0.815
NC_016779_5	5.5\|3481521\|27\|NC_016779\|CRT	3481521-3481547	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	102-128	5	0.815
NC_016779_5	5.5\|3481521\|27\|NC_016779\|CRT	3481521-3481547	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	129-155	5	0.815
NC_016779_5	5.5\|3481521\|27\|NC_016779\|CRT	3481521-3481547	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	255-281	5	0.815
NC_016779_5	5.5\|3481521\|27\|NC_016779\|CRT	3481521-3481547	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	993-1019	5	0.815
NC_016779_5	5.5\|3481521\|27\|NC_016779\|CRT	3481521-3481547	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1182-1208	5	0.815
NC_016779_5	5.5\|3481521\|27\|NC_016779\|CRT	3481521-3481547	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1632-1658	5	0.815
NC_016779_5	5.5\|3481521\|27\|NC_016779\|CRT	3481521-3481547	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1686-1712	5	0.815
NC_016779_5	5.5\|3481521\|27\|NC_016779\|CRT	3481521-3481547	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1740-1766	5	0.815
NC_016779_5	5.5\|3481521\|27\|NC_016779\|CRT	3481521-3481547	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1767-1793	5	0.815
NC_016779_5	5.5\|3481521\|27\|NC_016779\|CRT	3481521-3481547	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1848-1874	5	0.815
NC_016779_5	5.5\|3481521\|27\|NC_016779\|CRT	3481521-3481547	27	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733022-733048	5	0.815
NC_016779_5	5.5\|3481521\|27\|NC_016779\|CRT	3481521-3481547	27	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733175-733201	5	0.815
NC_016779_5	5.5\|3481521\|27\|NC_016779\|CRT	3481521-3481547	27	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733373-733399	5	0.815
NC_016779_5	5.5\|3481521\|27\|NC_016779\|CRT	3481521-3481547	27	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733400-733426	5	0.815
NC_016779_5	5.6\|3481566\|27\|NC_016779\|CRT	3481566-3481592	27	MN586053	Arthrobacter phage BeatusComedenti, complete genome	29809-29835	5	0.815
NC_016779_5	5.6\|3481566\|27\|NC_016779\|CRT	3481566-3481592	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	76455-76481	5	0.815
NC_016779_5	5.6\|3481566\|27\|NC_016779\|CRT	3481566-3481592	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	83703-83729	5	0.815
NC_016779_5	5.6\|3481566\|27\|NC_016779\|CRT	3481566-3481592	27	GU323708	Lactobacillus phage phiPYB5, complete genome	19363-19389	5	0.815
NC_016779_5	5.6\|3481566\|27\|NC_016779\|CRT	3481566-3481592	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	80960-80986	5	0.815
NC_016779_5	5.6\|3481566\|27\|NC_016779\|CRT	3481566-3481592	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	88208-88234	5	0.815
NC_016779_5	5.6\|3481566\|27\|NC_016779\|CRT	3481566-3481592	27	MN101228	Klebsiella phage KPN4, complete genome	23862-23888	5	0.815
NC_016779_5	5.6\|3481566\|27\|NC_016779\|CRT	3481566-3481592	27	NC_031231	Arthrobacter phage KellEzio, complete genome	29811-29837	5	0.815
NC_016779_5	5.6\|3481566\|27\|NC_016779\|CRT	3481566-3481592	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	102-128	5	0.815
NC_016779_5	5.6\|3481566\|27\|NC_016779\|CRT	3481566-3481592	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	129-155	5	0.815
NC_016779_5	5.6\|3481566\|27\|NC_016779\|CRT	3481566-3481592	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	255-281	5	0.815
NC_016779_5	5.6\|3481566\|27\|NC_016779\|CRT	3481566-3481592	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	993-1019	5	0.815
NC_016779_5	5.6\|3481566\|27\|NC_016779\|CRT	3481566-3481592	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1182-1208	5	0.815
NC_016779_5	5.6\|3481566\|27\|NC_016779\|CRT	3481566-3481592	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1632-1658	5	0.815
NC_016779_5	5.6\|3481566\|27\|NC_016779\|CRT	3481566-3481592	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1686-1712	5	0.815
NC_016779_5	5.6\|3481566\|27\|NC_016779\|CRT	3481566-3481592	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1740-1766	5	0.815
NC_016779_5	5.6\|3481566\|27\|NC_016779\|CRT	3481566-3481592	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1767-1793	5	0.815
NC_016779_5	5.6\|3481566\|27\|NC_016779\|CRT	3481566-3481592	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1848-1874	5	0.815
NC_016779_5	5.6\|3481566\|27\|NC_016779\|CRT	3481566-3481592	27	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733022-733048	5	0.815
NC_016779_5	5.6\|3481566\|27\|NC_016779\|CRT	3481566-3481592	27	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733175-733201	5	0.815
NC_016779_5	5.6\|3481566\|27\|NC_016779\|CRT	3481566-3481592	27	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733373-733399	5	0.815
NC_016779_5	5.6\|3481566\|27\|NC_016779\|CRT	3481566-3481592	27	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733400-733426	5	0.815
NC_016779_5	5.7\|3481611\|27\|NC_016779\|CRT	3481611-3481637	27	MN497953	Mycobacterium phage GtownJaz, complete genome	2466-2492	5	0.815
NC_016779_5	5.7\|3481611\|27\|NC_016779\|CRT	3481611-3481637	27	MN586053	Arthrobacter phage BeatusComedenti, complete genome	29809-29835	5	0.815
NC_016779_5	5.7\|3481611\|27\|NC_016779\|CRT	3481611-3481637	27	MH020238	Mycobacterium phage Lilith, complete genome	2467-2493	5	0.815
NC_016779_5	5.7\|3481611\|27\|NC_016779\|CRT	3481611-3481637	27	MH077583	Mycobacterium phage PGHhamlin, complete genome	2466-2492	5	0.815
NC_016779_5	5.7\|3481611\|27\|NC_016779\|CRT	3481611-3481637	27	MH727554	Mycobacterium phage MuchMore, complete genome	2466-2492	5	0.815
NC_016779_5	5.7\|3481611\|27\|NC_016779\|CRT	3481611-3481637	27	MH338240	Mycobacterium phage Sabia, complete genome	2467-2493	5	0.815
NC_016779_5	5.7\|3481611\|27\|NC_016779\|CRT	3481611-3481637	27	KM233455	Mycobacterium phage Farber, complete genome	2467-2493	5	0.815
NC_016779_5	5.7\|3481611\|27\|NC_016779\|CRT	3481611-3481637	27	KX664448	Mycobacterium phage Watson, complete genome	2466-2492	5	0.815
NC_016779_5	5.7\|3481611\|27\|NC_016779\|CRT	3481611-3481637	27	KX507362	Mycobacterium phage Aglet, complete genome	2466-2492	5	0.815
NC_016779_5	5.7\|3481611\|27\|NC_016779\|CRT	3481611-3481637	27	MN693092	Marine virus AFVG_25M37, complete genome	19114-19140	5	0.815
NC_016779_5	5.7\|3481611\|27\|NC_016779\|CRT	3481611-3481637	27	MH576949	Mycobacterium phage BreSam8, complete genome	2467-2493	5	0.815
NC_016779_5	5.7\|3481611\|27\|NC_016779\|CRT	3481611-3481637	27	MN585969	Mycobacterium phage Dieselweasel, complete genome	2466-2492	5	0.815
NC_016779_5	5.7\|3481611\|27\|NC_016779\|CRT	3481611-3481637	27	MH536813	Mycobacterium phage AugsMagnumOpus, complete genome	2466-2492	5	0.815
NC_016779_5	5.7\|3481611\|27\|NC_016779\|CRT	3481611-3481637	27	MF185733	Mycobacterium phage StepMih, complete genome	2467-2493	5	0.815
NC_016779_5	5.7\|3481611\|27\|NC_016779\|CRT	3481611-3481637	27	MF185732	Mycobacterium phage Stagni, complete genome	2467-2493	5	0.815
NC_016779_5	5.7\|3481611\|27\|NC_016779\|CRT	3481611-3481637	27	MK494096	Mycobacterium phage Mainiac, complete genome	2467-2493	5	0.815
NC_016779_5	5.7\|3481611\|27\|NC_016779\|CRT	3481611-3481637	27	KU984914	Mycobacterium phage Malinsilva, complete genome	2466-2492	5	0.815
NC_016779_5	5.7\|3481611\|27\|NC_016779\|CRT	3481611-3481637	27	JF704101	Mycobacterium virus Microwolf, complete genome	2466-2492	5	0.815
NC_016779_5	5.7\|3481611\|27\|NC_016779\|CRT	3481611-3481637	27	KT359365	Mycobacterium phage DaHudson, complete genome	2466-2492	5	0.815
NC_016779_5	5.7\|3481611\|27\|NC_016779\|CRT	3481611-3481637	27	MH651179	Mycobacterium phage MadMarie, complete genome	2467-2493	5	0.815
NC_016779_5	5.7\|3481611\|27\|NC_016779\|CRT	3481611-3481637	27	NC_028798	Mycobacterium phage MarQuardt, complete genome	2466-2492	5	0.815
NC_016779_5	5.7\|3481611\|27\|NC_016779\|CRT	3481611-3481637	27	NC_031231	Arthrobacter phage KellEzio, complete genome	29811-29837	5	0.815
NC_016779_5	5.7\|3481611\|27\|NC_016779\|CRT	3481611-3481637	27	MK373793	Escherichia phage vB_EcoS_MM01, complete genome	10517-10543	5	0.815
NC_016779_5	5.8\|3481656\|27\|NC_016779\|CRT	3481656-3481682	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3981-4007	5	0.815
NC_016779_5	5.8\|3481656\|27\|NC_016779\|CRT	3481656-3481682	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3672-3698	5	0.815
NC_016779_5	5.8\|3481656\|27\|NC_016779\|CRT	3481656-3481682	27	MN693099	Marine virus AFVG_25M184, complete genome	13867-13893	5	0.815
NC_016779_5	5.8\|3481656\|27\|NC_016779\|CRT	3481656-3481682	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29498-29524	5	0.815
NC_016779_5	5.8\|3481656\|27\|NC_016779\|CRT	3481656-3481682	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29807-29833	5	0.815
NC_016779_5	5.8\|3481656\|27\|NC_016779\|CRT	3481656-3481682	27	MH884513	Bacillus phage vB_BpsS-36, complete genome	21756-21782	5	0.815
NC_016779_5	5.8\|3481656\|27\|NC_016779\|CRT	3481656-3481682	27	NZ_CP022543	Antarctobacter heliothermus strain SMS3 plasmid pSMS3-3, complete sequence	32226-32252	5	0.815
NC_016779_5	5.8\|3481656\|27\|NC_016779\|CRT	3481656-3481682	27	MK521907	Klebsiella phage vB_KpnS_FZ41, complete genome	71428-71454	5	0.815
NC_016779_5	5.8\|3481656\|27\|NC_016779\|CRT	3481656-3481682	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	102-128	5	0.815
NC_016779_5	5.8\|3481656\|27\|NC_016779\|CRT	3481656-3481682	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	129-155	5	0.815
NC_016779_5	5.8\|3481656\|27\|NC_016779\|CRT	3481656-3481682	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	255-281	5	0.815
NC_016779_5	5.8\|3481656\|27\|NC_016779\|CRT	3481656-3481682	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	993-1019	5	0.815
NC_016779_5	5.8\|3481656\|27\|NC_016779\|CRT	3481656-3481682	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1182-1208	5	0.815
NC_016779_5	5.8\|3481656\|27\|NC_016779\|CRT	3481656-3481682	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1632-1658	5	0.815
NC_016779_5	5.8\|3481656\|27\|NC_016779\|CRT	3481656-3481682	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1686-1712	5	0.815
NC_016779_5	5.8\|3481656\|27\|NC_016779\|CRT	3481656-3481682	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1740-1766	5	0.815
NC_016779_5	5.8\|3481656\|27\|NC_016779\|CRT	3481656-3481682	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1767-1793	5	0.815
NC_016779_5	5.8\|3481656\|27\|NC_016779\|CRT	3481656-3481682	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1848-1874	5	0.815
NC_016779_5	5.8\|3481656\|27\|NC_016779\|CRT	3481656-3481682	27	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733022-733048	5	0.815
NC_016779_5	5.8\|3481656\|27\|NC_016779\|CRT	3481656-3481682	27	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733175-733201	5	0.815
NC_016779_5	5.8\|3481656\|27\|NC_016779\|CRT	3481656-3481682	27	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733373-733399	5	0.815
NC_016779_5	5.8\|3481656\|27\|NC_016779\|CRT	3481656-3481682	27	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733400-733426	5	0.815
NC_016779_5	5.9\|3481701\|27\|NC_016779\|CRT	3481701-3481727	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29498-29524	5	0.815
NC_016779_5	5.9\|3481701\|27\|NC_016779\|CRT	3481701-3481727	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3981-4007	5	0.815
NC_016779_5	5.9\|3481701\|27\|NC_016779\|CRT	3481701-3481727	27	MN693099	Marine virus AFVG_25M184, complete genome	13867-13893	5	0.815
NC_016779_5	5.9\|3481701\|27\|NC_016779\|CRT	3481701-3481727	27	AP013956	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S27-C232, * SEQUENCING IN PROGRESS *	1353-1379	5	0.815
NC_016779_5	5.9\|3481701\|27\|NC_016779\|CRT	3481701-3481727	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	15805-15831	5	0.815
NC_016779_5	5.9\|3481701\|27\|NC_016779\|CRT	3481701-3481727	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	181179-181205	5	0.815
NC_016779_5	5.9\|3481701\|27\|NC_016779\|CRT	3481701-3481727	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	13198-13224	5	0.815
NC_016779_5	5.9\|3481701\|27\|NC_016779\|CRT	3481701-3481727	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	14989-15015	5	0.815
NC_016779_5	5.9\|3481701\|27\|NC_016779\|CRT	3481701-3481727	27	AP014301	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S28-C84, * SEQUENCING IN PROGRESS *	797-823	5	0.815
NC_016779_5	5.9\|3481701\|27\|NC_016779\|CRT	3481701-3481727	27	AP013963	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S38-C146, * SEQUENCING IN PROGRESS *	1353-1379	5	0.815
NC_016779_5	5.9\|3481701\|27\|NC_016779\|CRT	3481701-3481727	27	AP013959	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S31-C107, * SEQUENCING IN PROGRESS *	11104-11130	5	0.815
NC_016779_5	5.9\|3481701\|27\|NC_016779\|CRT	3481701-3481727	27	AP013565	Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5F-MedDCM-OCT-S40-C10, * SEQUENCING IN PROGRESS *, 2 ordered pieces	40163-40189	5	0.815
NC_016779_5	5.9\|3481701\|27\|NC_016779\|CRT	3481701-3481727	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	179861-179887	5	0.815
NC_016779_5	5.9\|3481701\|27\|NC_016779\|CRT	3481701-3481727	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	13201-13227	5	0.815
NC_016779_5	5.9\|3481701\|27\|NC_016779\|CRT	3481701-3481727	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	14992-15018	5	0.815
NC_016779_5	5.9\|3481701\|27\|NC_016779\|CRT	3481701-3481727	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	16966-16992	5	0.815
NC_016779_5	5.9\|3481701\|27\|NC_016779\|CRT	3481701-3481727	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	182280-182306	5	0.815
NC_016779_5	5.9\|3481701\|27\|NC_016779\|CRT	3481701-3481727	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	13198-13224	5	0.815
NC_016779_5	5.9\|3481701\|27\|NC_016779\|CRT	3481701-3481727	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	14989-15015	5	0.815
NC_016779_5	5.9\|3481701\|27\|NC_016779\|CRT	3481701-3481727	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	78591-78617	5	0.815
NC_016779_5	5.9\|3481701\|27\|NC_016779\|CRT	3481701-3481727	27	AP013961	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S34-C156, * SEQUENCING IN PROGRESS *	1325-1351	5	0.815
NC_016779_5	5.9\|3481701\|27\|NC_016779\|CRT	3481701-3481727	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	83096-83122	5	0.815
NC_016779_5	5.9\|3481701\|27\|NC_016779\|CRT	3481701-3481727	27	HQ615693	Synechococcus phage S-CRM01, complete genome	25956-25982	5	0.815
NC_016779_5	5.10\|3481746\|27\|NC_016779\|CRT	3481746-3481772	27	MN497953	Mycobacterium phage GtownJaz, complete genome	2466-2492	5	0.815
NC_016779_5	5.10\|3481746\|27\|NC_016779\|CRT	3481746-3481772	27	MN586053	Arthrobacter phage BeatusComedenti, complete genome	29809-29835	5	0.815
NC_016779_5	5.10\|3481746\|27\|NC_016779\|CRT	3481746-3481772	27	MH020238	Mycobacterium phage Lilith, complete genome	2467-2493	5	0.815
NC_016779_5	5.10\|3481746\|27\|NC_016779\|CRT	3481746-3481772	27	MH077583	Mycobacterium phage PGHhamlin, complete genome	2466-2492	5	0.815
NC_016779_5	5.10\|3481746\|27\|NC_016779\|CRT	3481746-3481772	27	MH727554	Mycobacterium phage MuchMore, complete genome	2466-2492	5	0.815
NC_016779_5	5.10\|3481746\|27\|NC_016779\|CRT	3481746-3481772	27	MH338240	Mycobacterium phage Sabia, complete genome	2467-2493	5	0.815
NC_016779_5	5.10\|3481746\|27\|NC_016779\|CRT	3481746-3481772	27	KM233455	Mycobacterium phage Farber, complete genome	2467-2493	5	0.815
NC_016779_5	5.10\|3481746\|27\|NC_016779\|CRT	3481746-3481772	27	KX664448	Mycobacterium phage Watson, complete genome	2466-2492	5	0.815
NC_016779_5	5.10\|3481746\|27\|NC_016779\|CRT	3481746-3481772	27	KX507362	Mycobacterium phage Aglet, complete genome	2466-2492	5	0.815
NC_016779_5	5.10\|3481746\|27\|NC_016779\|CRT	3481746-3481772	27	MH576949	Mycobacterium phage BreSam8, complete genome	2467-2493	5	0.815
NC_016779_5	5.10\|3481746\|27\|NC_016779\|CRT	3481746-3481772	27	MN585969	Mycobacterium phage Dieselweasel, complete genome	2466-2492	5	0.815
NC_016779_5	5.10\|3481746\|27\|NC_016779\|CRT	3481746-3481772	27	MH536813	Mycobacterium phage AugsMagnumOpus, complete genome	2466-2492	5	0.815
NC_016779_5	5.10\|3481746\|27\|NC_016779\|CRT	3481746-3481772	27	MF185733	Mycobacterium phage StepMih, complete genome	2467-2493	5	0.815
NC_016779_5	5.10\|3481746\|27\|NC_016779\|CRT	3481746-3481772	27	MF185732	Mycobacterium phage Stagni, complete genome	2467-2493	5	0.815
NC_016779_5	5.10\|3481746\|27\|NC_016779\|CRT	3481746-3481772	27	MK494096	Mycobacterium phage Mainiac, complete genome	2467-2493	5	0.815
NC_016779_5	5.10\|3481746\|27\|NC_016779\|CRT	3481746-3481772	27	KU984914	Mycobacterium phage Malinsilva, complete genome	2466-2492	5	0.815
NC_016779_5	5.10\|3481746\|27\|NC_016779\|CRT	3481746-3481772	27	JF704101	Mycobacterium virus Microwolf, complete genome	2466-2492	5	0.815
NC_016779_5	5.10\|3481746\|27\|NC_016779\|CRT	3481746-3481772	27	KT359365	Mycobacterium phage DaHudson, complete genome	2466-2492	5	0.815
NC_016779_5	5.10\|3481746\|27\|NC_016779\|CRT	3481746-3481772	27	MH651179	Mycobacterium phage MadMarie, complete genome	2467-2493	5	0.815
NC_016779_5	5.10\|3481746\|27\|NC_016779\|CRT	3481746-3481772	27	NC_028798	Mycobacterium phage MarQuardt, complete genome	2466-2492	5	0.815
NC_016779_5	5.10\|3481746\|27\|NC_016779\|CRT	3481746-3481772	27	NC_031231	Arthrobacter phage KellEzio, complete genome	29811-29837	5	0.815
NC_016779_5	5.10\|3481746\|27\|NC_016779\|CRT	3481746-3481772	27	HQ615693	Synechococcus phage S-CRM01, complete genome	25956-25982	5	0.815
NC_016779_5	5.11\|3481791\|27\|NC_016779\|CRT	3481791-3481817	27	MN693099	Marine virus AFVG_25M184, complete genome	13867-13893	5	0.815
NC_016779_5	5.11\|3481791\|27\|NC_016779\|CRT	3481791-3481817	27	MN693189	Marine virus AFVG_25M326, complete genome	18915-18941	5	0.815
NC_016779_5	5.11\|3481791\|27\|NC_016779\|CRT	3481791-3481817	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29498-29524	5	0.815
NC_016779_5	5.11\|3481791\|27\|NC_016779\|CRT	3481791-3481817	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3981-4007	5	0.815
NC_016779_5	5.11\|3481791\|27\|NC_016779\|CRT	3481791-3481817	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	2019-2045	5	0.815
NC_016779_5	5.11\|3481791\|27\|NC_016779\|CRT	3481791-3481817	27	AP013956	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S27-C232, * SEQUENCING IN PROGRESS *	1353-1379	5	0.815
NC_016779_5	5.11\|3481791\|27\|NC_016779\|CRT	3481791-3481817	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	13198-13224	5	0.815
NC_016779_5	5.11\|3481791\|27\|NC_016779\|CRT	3481791-3481817	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	15805-15831	5	0.815
NC_016779_5	5.11\|3481791\|27\|NC_016779\|CRT	3481791-3481817	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	15100-15126	5	0.815
NC_016779_5	5.11\|3481791\|27\|NC_016779\|CRT	3481791-3481817	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	181143-181169	5	0.815
NC_016779_5	5.11\|3481791\|27\|NC_016779\|CRT	3481791-3481817	27	AP014301	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S28-C84, * SEQUENCING IN PROGRESS *	797-823	5	0.815
NC_016779_5	5.11\|3481791\|27\|NC_016779\|CRT	3481791-3481817	27	AP013963	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S38-C146, * SEQUENCING IN PROGRESS *	1353-1379	5	0.815
NC_016779_5	5.11\|3481791\|27\|NC_016779\|CRT	3481791-3481817	27	AP013959	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S31-C107, * SEQUENCING IN PROGRESS *	11104-11130	5	0.815
NC_016779_5	5.11\|3481791\|27\|NC_016779\|CRT	3481791-3481817	27	AP013565	Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5F-MedDCM-OCT-S40-C10, * SEQUENCING IN PROGRESS *, 2 ordered pieces	40163-40189	5	0.815
NC_016779_5	5.11\|3481791\|27\|NC_016779\|CRT	3481791-3481817	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	13201-13227	5	0.815
NC_016779_5	5.11\|3481791\|27\|NC_016779\|CRT	3481791-3481817	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	15103-15129	5	0.815
NC_016779_5	5.11\|3481791\|27\|NC_016779\|CRT	3481791-3481817	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	179825-179851	5	0.815
NC_016779_5	5.11\|3481791\|27\|NC_016779\|CRT	3481791-3481817	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	13198-13224	5	0.815
NC_016779_5	5.11\|3481791\|27\|NC_016779\|CRT	3481791-3481817	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	16966-16992	5	0.815
NC_016779_5	5.11\|3481791\|27\|NC_016779\|CRT	3481791-3481817	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	15100-15126	5	0.815
NC_016779_5	5.11\|3481791\|27\|NC_016779\|CRT	3481791-3481817	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	182244-182270	5	0.815
NC_016779_5	5.11\|3481791\|27\|NC_016779\|CRT	3481791-3481817	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	78591-78617	5	0.815
NC_016779_5	5.11\|3481791\|27\|NC_016779\|CRT	3481791-3481817	27	AP013961	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S34-C156, * SEQUENCING IN PROGRESS *	1325-1351	5	0.815
NC_016779_5	5.11\|3481791\|27\|NC_016779\|CRT	3481791-3481817	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	83096-83122	5	0.815
NC_016779_5	5.11\|3481791\|27\|NC_016779\|CRT	3481791-3481817	27	KX160207	Lactococcus phage 53801, complete genome	33294-33320	5	0.815
NC_016779_5	5.11\|3481791\|27\|NC_016779\|CRT	3481791-3481817	27	MN694321	Marine virus AFVG_250M307, complete genome	14002-14028	5	0.815
NC_016779_5	5.11\|3481791\|27\|NC_016779\|CRT	3481791-3481817	27	AP017924	Ralstonia phage RP12 DNA, complete genome	152338-152364	5	0.815
NC_016779_5	5.11\|3481791\|27\|NC_016779\|CRT	3481791-3481817	27	AP017925	Ralstonia phage RP31 DNA, complete genome	149084-149110	5	0.815
NC_016779_5	5.12\|3481836\|27\|NC_016779\|CRT	3481836-3481862	27	MN693099	Marine virus AFVG_25M184, complete genome	13867-13893	5	0.815
NC_016779_5	5.12\|3481836\|27\|NC_016779\|CRT	3481836-3481862	27	MN693189	Marine virus AFVG_25M326, complete genome	18915-18941	5	0.815
NC_016779_5	5.12\|3481836\|27\|NC_016779\|CRT	3481836-3481862	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29498-29524	5	0.815
NC_016779_5	5.12\|3481836\|27\|NC_016779\|CRT	3481836-3481862	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3981-4007	5	0.815
NC_016779_5	5.12\|3481836\|27\|NC_016779\|CRT	3481836-3481862	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	2019-2045	5	0.815
NC_016779_5	5.12\|3481836\|27\|NC_016779\|CRT	3481836-3481862	27	AP013956	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S27-C232, * SEQUENCING IN PROGRESS *	1353-1379	5	0.815
NC_016779_5	5.12\|3481836\|27\|NC_016779\|CRT	3481836-3481862	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	13198-13224	5	0.815
NC_016779_5	5.12\|3481836\|27\|NC_016779\|CRT	3481836-3481862	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	15805-15831	5	0.815
NC_016779_5	5.12\|3481836\|27\|NC_016779\|CRT	3481836-3481862	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	15100-15126	5	0.815
NC_016779_5	5.12\|3481836\|27\|NC_016779\|CRT	3481836-3481862	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	181143-181169	5	0.815
NC_016779_5	5.12\|3481836\|27\|NC_016779\|CRT	3481836-3481862	27	AP014301	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S28-C84, * SEQUENCING IN PROGRESS *	797-823	5	0.815
NC_016779_5	5.12\|3481836\|27\|NC_016779\|CRT	3481836-3481862	27	AP013963	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S38-C146, * SEQUENCING IN PROGRESS *	1353-1379	5	0.815
NC_016779_5	5.12\|3481836\|27\|NC_016779\|CRT	3481836-3481862	27	AP013959	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S31-C107, * SEQUENCING IN PROGRESS *	11104-11130	5	0.815
NC_016779_5	5.12\|3481836\|27\|NC_016779\|CRT	3481836-3481862	27	AP013565	Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5F-MedDCM-OCT-S40-C10, * SEQUENCING IN PROGRESS *, 2 ordered pieces	40163-40189	5	0.815
NC_016779_5	5.12\|3481836\|27\|NC_016779\|CRT	3481836-3481862	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	13201-13227	5	0.815
NC_016779_5	5.12\|3481836\|27\|NC_016779\|CRT	3481836-3481862	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	15103-15129	5	0.815
NC_016779_5	5.12\|3481836\|27\|NC_016779\|CRT	3481836-3481862	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	179825-179851	5	0.815
NC_016779_5	5.12\|3481836\|27\|NC_016779\|CRT	3481836-3481862	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	13198-13224	5	0.815
NC_016779_5	5.12\|3481836\|27\|NC_016779\|CRT	3481836-3481862	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	16966-16992	5	0.815
NC_016779_5	5.12\|3481836\|27\|NC_016779\|CRT	3481836-3481862	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	15100-15126	5	0.815
NC_016779_5	5.12\|3481836\|27\|NC_016779\|CRT	3481836-3481862	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	182244-182270	5	0.815
NC_016779_5	5.12\|3481836\|27\|NC_016779\|CRT	3481836-3481862	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	78591-78617	5	0.815
NC_016779_5	5.12\|3481836\|27\|NC_016779\|CRT	3481836-3481862	27	AP013961	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S34-C156, * SEQUENCING IN PROGRESS *	1325-1351	5	0.815
NC_016779_5	5.12\|3481836\|27\|NC_016779\|CRT	3481836-3481862	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	83096-83122	5	0.815
NC_016779_5	5.12\|3481836\|27\|NC_016779\|CRT	3481836-3481862	27	KX160207	Lactococcus phage 53801, complete genome	33294-33320	5	0.815
NC_016779_5	5.12\|3481836\|27\|NC_016779\|CRT	3481836-3481862	27	MN694321	Marine virus AFVG_250M307, complete genome	14002-14028	5	0.815
NC_016779_5	5.12\|3481836\|27\|NC_016779\|CRT	3481836-3481862	27	AP017924	Ralstonia phage RP12 DNA, complete genome	152338-152364	5	0.815
NC_016779_5	5.12\|3481836\|27\|NC_016779\|CRT	3481836-3481862	27	AP017925	Ralstonia phage RP31 DNA, complete genome	149084-149110	5	0.815
NC_016779_5	5.13\|3481881\|27\|NC_016779\|CRT	3481881-3481907	27	MN497953	Mycobacterium phage GtownJaz, complete genome	2466-2492	5	0.815
NC_016779_5	5.13\|3481881\|27\|NC_016779\|CRT	3481881-3481907	27	MN586053	Arthrobacter phage BeatusComedenti, complete genome	29809-29835	5	0.815
NC_016779_5	5.13\|3481881\|27\|NC_016779\|CRT	3481881-3481907	27	MH020238	Mycobacterium phage Lilith, complete genome	2467-2493	5	0.815
NC_016779_5	5.13\|3481881\|27\|NC_016779\|CRT	3481881-3481907	27	MH077583	Mycobacterium phage PGHhamlin, complete genome	2466-2492	5	0.815
NC_016779_5	5.13\|3481881\|27\|NC_016779\|CRT	3481881-3481907	27	MH727554	Mycobacterium phage MuchMore, complete genome	2466-2492	5	0.815
NC_016779_5	5.13\|3481881\|27\|NC_016779\|CRT	3481881-3481907	27	MH338240	Mycobacterium phage Sabia, complete genome	2467-2493	5	0.815
NC_016779_5	5.13\|3481881\|27\|NC_016779\|CRT	3481881-3481907	27	KM233455	Mycobacterium phage Farber, complete genome	2467-2493	5	0.815
NC_016779_5	5.13\|3481881\|27\|NC_016779\|CRT	3481881-3481907	27	KX664448	Mycobacterium phage Watson, complete genome	2466-2492	5	0.815
NC_016779_5	5.13\|3481881\|27\|NC_016779\|CRT	3481881-3481907	27	KX507362	Mycobacterium phage Aglet, complete genome	2466-2492	5	0.815
NC_016779_5	5.13\|3481881\|27\|NC_016779\|CRT	3481881-3481907	27	MH576949	Mycobacterium phage BreSam8, complete genome	2467-2493	5	0.815
NC_016779_5	5.13\|3481881\|27\|NC_016779\|CRT	3481881-3481907	27	MN585969	Mycobacterium phage Dieselweasel, complete genome	2466-2492	5	0.815
NC_016779_5	5.13\|3481881\|27\|NC_016779\|CRT	3481881-3481907	27	MH536813	Mycobacterium phage AugsMagnumOpus, complete genome	2466-2492	5	0.815
NC_016779_5	5.13\|3481881\|27\|NC_016779\|CRT	3481881-3481907	27	MF185733	Mycobacterium phage StepMih, complete genome	2467-2493	5	0.815
NC_016779_5	5.13\|3481881\|27\|NC_016779\|CRT	3481881-3481907	27	MF185732	Mycobacterium phage Stagni, complete genome	2467-2493	5	0.815
NC_016779_5	5.13\|3481881\|27\|NC_016779\|CRT	3481881-3481907	27	MK494096	Mycobacterium phage Mainiac, complete genome	2467-2493	5	0.815
NC_016779_5	5.13\|3481881\|27\|NC_016779\|CRT	3481881-3481907	27	KU984914	Mycobacterium phage Malinsilva, complete genome	2466-2492	5	0.815
NC_016779_5	5.13\|3481881\|27\|NC_016779\|CRT	3481881-3481907	27	JF704101	Mycobacterium virus Microwolf, complete genome	2466-2492	5	0.815
NC_016779_5	5.13\|3481881\|27\|NC_016779\|CRT	3481881-3481907	27	KT359365	Mycobacterium phage DaHudson, complete genome	2466-2492	5	0.815
NC_016779_5	5.13\|3481881\|27\|NC_016779\|CRT	3481881-3481907	27	MH651179	Mycobacterium phage MadMarie, complete genome	2467-2493	5	0.815
NC_016779_5	5.13\|3481881\|27\|NC_016779\|CRT	3481881-3481907	27	NC_028798	Mycobacterium phage MarQuardt, complete genome	2466-2492	5	0.815
NC_016779_5	5.13\|3481881\|27\|NC_016779\|CRT	3481881-3481907	27	NC_031231	Arthrobacter phage KellEzio, complete genome	29811-29837	5	0.815
NC_016779_5	5.13\|3481881\|27\|NC_016779\|CRT	3481881-3481907	27	HQ615693	Synechococcus phage S-CRM01, complete genome	25956-25982	5	0.815
NC_016779_5	5.14\|3481926\|27\|NC_016779\|CRT	3481926-3481952	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	181179-181205	5	0.815
NC_016779_5	5.14\|3481926\|27\|NC_016779\|CRT	3481926-3481952	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	13198-13224	5	0.815
NC_016779_5	5.14\|3481926\|27\|NC_016779\|CRT	3481926-3481952	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	14989-15015	5	0.815
NC_016779_5	5.14\|3481926\|27\|NC_016779\|CRT	3481926-3481952	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	179861-179887	5	0.815
NC_016779_5	5.14\|3481926\|27\|NC_016779\|CRT	3481926-3481952	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	13201-13227	5	0.815
NC_016779_5	5.14\|3481926\|27\|NC_016779\|CRT	3481926-3481952	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	14992-15018	5	0.815
NC_016779_5	5.14\|3481926\|27\|NC_016779\|CRT	3481926-3481952	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	182280-182306	5	0.815
NC_016779_5	5.14\|3481926\|27\|NC_016779\|CRT	3481926-3481952	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	13198-13224	5	0.815
NC_016779_5	5.14\|3481926\|27\|NC_016779\|CRT	3481926-3481952	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	14989-15015	5	0.815
NC_016779_5	5.14\|3481926\|27\|NC_016779\|CRT	3481926-3481952	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	78591-78617	5	0.815
NC_016779_5	5.14\|3481926\|27\|NC_016779\|CRT	3481926-3481952	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	83096-83122	5	0.815
NC_016779_5	5.14\|3481926\|27\|NC_016779\|CRT	3481926-3481952	27	MN693189	Marine virus AFVG_25M326, complete genome	18915-18941	5	0.815
NC_016779_5	5.14\|3481926\|27\|NC_016779\|CRT	3481926-3481952	27	MN234235	Mycobacterium phage BogosyJay, complete genome	4777-4803	5	0.815
NC_016779_5	5.14\|3481926\|27\|NC_016779\|CRT	3481926-3481952	27	NZ_CP054613	Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence	963384-963410	5	0.815
NC_016779_5	5.14\|3481926\|27\|NC_016779\|CRT	3481926-3481952	27	NZ_CP054613	Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence	963420-963446	5	0.815
NC_016779_5	5.16\|3482007\|27\|NC_016779\|CRT	3482007-3482033	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	13198-13224	5	0.815
NC_016779_5	5.16\|3482007\|27\|NC_016779\|CRT	3482007-3482033	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	13201-13227	5	0.815
NC_016779_5	5.16\|3482007\|27\|NC_016779\|CRT	3482007-3482033	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	13198-13224	5	0.815
NC_016779_5	5.16\|3482007\|27\|NC_016779\|CRT	3482007-3482033	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	78591-78617	5	0.815
NC_016779_5	5.16\|3482007\|27\|NC_016779\|CRT	3482007-3482033	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	83096-83122	5	0.815
NC_016779_5	5.16\|3482007\|27\|NC_016779\|CRT	3482007-3482033	27	MN693189	Marine virus AFVG_25M326, complete genome	18915-18941	5	0.815
NC_016779_5	5.16\|3482007\|27\|NC_016779\|CRT	3482007-3482033	27	AP014476	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, * SEQUENCING IN PROGRESS *, 2 ordered pieces	18171-18197	5	0.815
NC_016779_5	5.16\|3482007\|27\|NC_016779\|CRT	3482007-3482033	27	AP013942	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, * SEQUENCING IN PROGRESS *	15771-15797	5	0.815
NC_016779_5	5.16\|3482007\|27\|NC_016779\|CRT	3482007-3482033	27	MN694321	Marine virus AFVG_250M307, complete genome	14002-14028	5	0.815
NC_016779_5	5.16\|3482007\|27\|NC_016779\|CRT	3482007-3482033	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	102-128	5	0.815
NC_016779_5	5.16\|3482007\|27\|NC_016779\|CRT	3482007-3482033	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	129-155	5	0.815
NC_016779_5	5.16\|3482007\|27\|NC_016779\|CRT	3482007-3482033	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	255-281	5	0.815
NC_016779_5	5.16\|3482007\|27\|NC_016779\|CRT	3482007-3482033	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	993-1019	5	0.815
NC_016779_5	5.16\|3482007\|27\|NC_016779\|CRT	3482007-3482033	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1182-1208	5	0.815
NC_016779_5	5.16\|3482007\|27\|NC_016779\|CRT	3482007-3482033	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1632-1658	5	0.815
NC_016779_5	5.16\|3482007\|27\|NC_016779\|CRT	3482007-3482033	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1686-1712	5	0.815
NC_016779_5	5.16\|3482007\|27\|NC_016779\|CRT	3482007-3482033	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1740-1766	5	0.815
NC_016779_5	5.16\|3482007\|27\|NC_016779\|CRT	3482007-3482033	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1767-1793	5	0.815
NC_016779_5	5.16\|3482007\|27\|NC_016779\|CRT	3482007-3482033	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1848-1874	5	0.815
NC_016779_5	5.16\|3482007\|27\|NC_016779\|CRT	3482007-3482033	27	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733022-733048	5	0.815
NC_016779_5	5.16\|3482007\|27\|NC_016779\|CRT	3482007-3482033	27	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733175-733201	5	0.815
NC_016779_5	5.16\|3482007\|27\|NC_016779\|CRT	3482007-3482033	27	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733373-733399	5	0.815
NC_016779_5	5.16\|3482007\|27\|NC_016779\|CRT	3482007-3482033	27	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733400-733426	5	0.815
NC_016779_5	5.16\|3482007\|27\|NC_016779\|CRT	3482007-3482033	27	AP013944	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, * SEQUENCING IN PROGRESS *	8161-8187	5	0.815
NC_016779_5	5.16\|3482007\|27\|NC_016779\|CRT	3482007-3482033	27	AP013945	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, * SEQUENCING IN PROGRESS *	3630-3656	5	0.815
NC_016779_2	2.1\|1382779\|27\|NC_016779\|CRT	1382779-1382805	27	NZ_CP040452	Halomonas sp. PA16-9 plasmid p_unnamed1, complete sequence	293534-293560	6	0.778
NC_016779_2	2.2\|1382833\|27\|NC_016779\|CRT	1382833-1382859	27	NZ_CP040452	Halomonas sp. PA16-9 plasmid p_unnamed1, complete sequence	293534-293560	6	0.778
NC_016779_2	2.3\|1382887\|27\|NC_016779\|CRT	1382887-1382913	27	NZ_CP040452	Halomonas sp. PA16-9 plasmid p_unnamed1, complete sequence	293534-293560	6	0.778
NC_016779_2	2.5\|1382995\|27\|NC_016779\|CRT	1382995-1383021	27	KY984068	Erwinia phage vB_EamM_Y3, complete genome	74475-74501	6	0.778
NC_016779_2	2.5\|1382995\|27\|NC_016779\|CRT	1382995-1383021	27	AP014351	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S39-C3, * SEQUENCING IN PROGRESS *	10866-10892	6	0.778
NC_016779_2	2.10\|1383247\|27\|NC_016779\|CRT	1383247-1383273	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	103-129	6	0.778
NC_016779_2	2.10\|1383247\|27\|NC_016779\|CRT	1383247-1383273	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	130-156	6	0.778
NC_016779_2	2.10\|1383247\|27\|NC_016779\|CRT	1383247-1383273	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	256-282	6	0.778
NC_016779_2	2.10\|1383247\|27\|NC_016779\|CRT	1383247-1383273	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	994-1020	6	0.778
NC_016779_2	2.10\|1383247\|27\|NC_016779\|CRT	1383247-1383273	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1183-1209	6	0.778
NC_016779_2	2.10\|1383247\|27\|NC_016779\|CRT	1383247-1383273	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1633-1659	6	0.778
NC_016779_2	2.10\|1383247\|27\|NC_016779\|CRT	1383247-1383273	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1687-1713	6	0.778
NC_016779_2	2.10\|1383247\|27\|NC_016779\|CRT	1383247-1383273	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1741-1767	6	0.778
NC_016779_2	2.10\|1383247\|27\|NC_016779\|CRT	1383247-1383273	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1768-1794	6	0.778
NC_016779_2	2.10\|1383247\|27\|NC_016779\|CRT	1383247-1383273	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1849-1875	6	0.778
NC_016779_2	2.10\|1383247\|27\|NC_016779\|CRT	1383247-1383273	27	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733023-733049	6	0.778
NC_016779_2	2.10\|1383247\|27\|NC_016779\|CRT	1383247-1383273	27	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733176-733202	6	0.778
NC_016779_2	2.10\|1383247\|27\|NC_016779\|CRT	1383247-1383273	27	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733374-733400	6	0.778
NC_016779_2	2.10\|1383247\|27\|NC_016779\|CRT	1383247-1383273	27	CP011075	Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence	733401-733427	6	0.778
NC_016779_2	2.10\|1383247\|27\|NC_016779\|CRT	1383247-1383273	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	78592-78618	6	0.778
NC_016779_2	2.10\|1383247\|27\|NC_016779\|CRT	1383247-1383273	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	83097-83123	6	0.778
NC_016779_2	2.11\|1383301\|27\|NC_016779\|CRT	1383301-1383327	27	KY984068	Erwinia phage vB_EamM_Y3, complete genome	74475-74501	6	0.778
NC_016779_2	2.11\|1383301\|27\|NC_016779\|CRT	1383301-1383327	27	AP014351	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S39-C3, * SEQUENCING IN PROGRESS *	10866-10892	6	0.778
NC_016779_2	2.14\|1383472\|27\|NC_016779\|CRT	1383472-1383498	27	MN013077	Klebsiella phage vB_KaeM_KaOmega, complete genome	7844-7870	6	0.778
NC_016779_2	2.14\|1383472\|27\|NC_016779\|CRT	1383472-1383498	27	NZ_CP026268	Aminobacter sp. MSH1 plasmid pBAM1, complete sequence	34358-34384	6	0.778
NC_016779_2	2.14\|1383472\|27\|NC_016779\|CRT	1383472-1383498	27	NZ_CP011665	Streptomyces sp. Mg1 plasmid pSMg1-1, complete sequence	526774-526800	6	0.778
NC_016779_2	2.14\|1383472\|27\|NC_016779\|CRT	1383472-1383498	27	KR296684	UNVERIFIED: Salmonella phage 19, complete genome	10702-10728	6	0.778
NC_016779_2	2.14\|1383472\|27\|NC_016779\|CRT	1383472-1383498	27	NC_029072	Salmonella phage 19, complete genome	10702-10728	6	0.778
NC_016779_2	2.14\|1383472\|27\|NC_016779\|CRT	1383472-1383498	27	KR296695	UNVERIFIED: Salmonella phage 41, complete genome	10710-10736	6	0.778
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	181964-181990	6	0.778
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	79804-79830	6	0.778
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	84309-84335	6	0.778
NC_016779_2	2.15\|1383526\|27\|NC_016779\|CRT	1383526-1383552	27	MH617049	Microviridae sp. isolate ctba755, complete genome	1040-1066	6	0.778
NC_016779_5	5.1\|3481350\|27\|NC_016779\|CRT	3481350-3481376	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	78591-78617	6	0.778
NC_016779_5	5.1\|3481350\|27\|NC_016779\|CRT	3481350-3481376	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	83096-83122	6	0.778
NC_016779_5	5.1\|3481350\|27\|NC_016779\|CRT	3481350-3481376	27	CP000662	Rhodobacter sphaeroides ATCC 17025 plasmid pRSPA01, complete sequence	37630-37656	6	0.778
NC_016779_5	5.2\|3481395\|27\|NC_016779\|CRT	3481395-3481421	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	15805-15831	6	0.778
NC_016779_5	5.2\|3481395\|27\|NC_016779\|CRT	3481395-3481421	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	16966-16992	6	0.778
NC_016779_5	5.2\|3481395\|27\|NC_016779\|CRT	3481395-3481421	27	AP014476	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, * SEQUENCING IN PROGRESS *, 2 ordered pieces	18171-18197	6	0.778
NC_016779_5	5.2\|3481395\|27\|NC_016779\|CRT	3481395-3481421	27	AP013959	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S31-C107, * SEQUENCING IN PROGRESS *	11104-11130	6	0.778
NC_016779_5	5.2\|3481395\|27\|NC_016779\|CRT	3481395-3481421	27	AP013942	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, * SEQUENCING IN PROGRESS *	15771-15797	6	0.778
NC_016779_5	5.2\|3481395\|27\|NC_016779\|CRT	3481395-3481421	27	AP013565	Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5F-MedDCM-OCT-S40-C10, * SEQUENCING IN PROGRESS *, 2 ordered pieces	40163-40189	6	0.778
NC_016779_5	5.2\|3481395\|27\|NC_016779\|CRT	3481395-3481421	27	AP013944	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, * SEQUENCING IN PROGRESS *	8161-8187	6	0.778
NC_016779_5	5.2\|3481395\|27\|NC_016779\|CRT	3481395-3481421	27	AP013956	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S27-C232, * SEQUENCING IN PROGRESS *	1353-1379	6	0.778
NC_016779_5	5.2\|3481395\|27\|NC_016779\|CRT	3481395-3481421	27	AP013963	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S38-C146, * SEQUENCING IN PROGRESS *	1353-1379	6	0.778
NC_016779_5	5.2\|3481395\|27\|NC_016779\|CRT	3481395-3481421	27	AP013945	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, * SEQUENCING IN PROGRESS *	3630-3656	6	0.778
NC_016779_5	5.2\|3481395\|27\|NC_016779\|CRT	3481395-3481421	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	78591-78617	6	0.778
NC_016779_5	5.2\|3481395\|27\|NC_016779\|CRT	3481395-3481421	27	AP013961	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S34-C156, * SEQUENCING IN PROGRESS *	1325-1351	6	0.778
NC_016779_5	5.2\|3481395\|27\|NC_016779\|CRT	3481395-3481421	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	83096-83122	6	0.778
NC_016779_5	5.3\|3481440\|27\|NC_016779\|CRT	3481440-3481466	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	15805-15831	6	0.778
NC_016779_5	5.3\|3481440\|27\|NC_016779\|CRT	3481440-3481466	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	16966-16992	6	0.778
NC_016779_5	5.3\|3481440\|27\|NC_016779\|CRT	3481440-3481466	27	AP014476	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, * SEQUENCING IN PROGRESS *, 2 ordered pieces	18171-18197	6	0.778
NC_016779_5	5.3\|3481440\|27\|NC_016779\|CRT	3481440-3481466	27	AP013959	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S31-C107, * SEQUENCING IN PROGRESS *	11104-11130	6	0.778
NC_016779_5	5.3\|3481440\|27\|NC_016779\|CRT	3481440-3481466	27	AP013942	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, * SEQUENCING IN PROGRESS *	15771-15797	6	0.778
NC_016779_5	5.3\|3481440\|27\|NC_016779\|CRT	3481440-3481466	27	AP013565	Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5F-MedDCM-OCT-S40-C10, * SEQUENCING IN PROGRESS *, 2 ordered pieces	40163-40189	6	0.778
NC_016779_5	5.3\|3481440\|27\|NC_016779\|CRT	3481440-3481466	27	AP013944	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, * SEQUENCING IN PROGRESS *	8161-8187	6	0.778
NC_016779_5	5.3\|3481440\|27\|NC_016779\|CRT	3481440-3481466	27	AP013956	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S27-C232, * SEQUENCING IN PROGRESS *	1353-1379	6	0.778
NC_016779_5	5.3\|3481440\|27\|NC_016779\|CRT	3481440-3481466	27	AP013963	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S38-C146, * SEQUENCING IN PROGRESS *	1353-1379	6	0.778
NC_016779_5	5.3\|3481440\|27\|NC_016779\|CRT	3481440-3481466	27	AP013945	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, * SEQUENCING IN PROGRESS *	3630-3656	6	0.778
NC_016779_5	5.3\|3481440\|27\|NC_016779\|CRT	3481440-3481466	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	78591-78617	6	0.778
NC_016779_5	5.3\|3481440\|27\|NC_016779\|CRT	3481440-3481466	27	AP013961	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S34-C156, * SEQUENCING IN PROGRESS *	1325-1351	6	0.778
NC_016779_5	5.3\|3481440\|27\|NC_016779\|CRT	3481440-3481466	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	83096-83122	6	0.778
NC_016779_5	5.5\|3481521\|27\|NC_016779\|CRT	3481521-3481547	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	15805-15831	6	0.778
NC_016779_5	5.5\|3481521\|27\|NC_016779\|CRT	3481521-3481547	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	16966-16992	6	0.778
NC_016779_5	5.5\|3481521\|27\|NC_016779\|CRT	3481521-3481547	27	AP014476	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, * SEQUENCING IN PROGRESS *, 2 ordered pieces	18171-18197	6	0.778
NC_016779_5	5.5\|3481521\|27\|NC_016779\|CRT	3481521-3481547	27	AP013959	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S31-C107, * SEQUENCING IN PROGRESS *	11104-11130	6	0.778
NC_016779_5	5.5\|3481521\|27\|NC_016779\|CRT	3481521-3481547	27	AP013942	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, * SEQUENCING IN PROGRESS *	15771-15797	6	0.778
NC_016779_5	5.5\|3481521\|27\|NC_016779\|CRT	3481521-3481547	27	AP013565	Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5F-MedDCM-OCT-S40-C10, * SEQUENCING IN PROGRESS *, 2 ordered pieces	40163-40189	6	0.778
NC_016779_5	5.5\|3481521\|27\|NC_016779\|CRT	3481521-3481547	27	AP013944	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, * SEQUENCING IN PROGRESS *	8161-8187	6	0.778
NC_016779_5	5.5\|3481521\|27\|NC_016779\|CRT	3481521-3481547	27	AP013956	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S27-C232, * SEQUENCING IN PROGRESS *	1353-1379	6	0.778
NC_016779_5	5.5\|3481521\|27\|NC_016779\|CRT	3481521-3481547	27	AP013963	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S38-C146, * SEQUENCING IN PROGRESS *	1353-1379	6	0.778
NC_016779_5	5.5\|3481521\|27\|NC_016779\|CRT	3481521-3481547	27	AP013945	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, * SEQUENCING IN PROGRESS *	3630-3656	6	0.778
NC_016779_5	5.5\|3481521\|27\|NC_016779\|CRT	3481521-3481547	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	78591-78617	6	0.778
NC_016779_5	5.5\|3481521\|27\|NC_016779\|CRT	3481521-3481547	27	AP013961	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S34-C156, * SEQUENCING IN PROGRESS *	1325-1351	6	0.778
NC_016779_5	5.5\|3481521\|27\|NC_016779\|CRT	3481521-3481547	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	83096-83122	6	0.778
NC_016779_5	5.6\|3481566\|27\|NC_016779\|CRT	3481566-3481592	27	NZ_AP018204	Leptolyngbya boryana NIES-2135 plasmid plasmid1 DNA, complete genome	167819-167845	6	0.778
NC_016779_5	5.6\|3481566\|27\|NC_016779\|CRT	3481566-3481592	27	MN693099	Marine virus AFVG_25M184, complete genome	13867-13893	6	0.778
NC_016779_5	5.6\|3481566\|27\|NC_016779\|CRT	3481566-3481592	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29498-29524	6	0.778
NC_016779_5	5.6\|3481566\|27\|NC_016779\|CRT	3481566-3481592	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3981-4007	6	0.778
NC_016779_5	5.7\|3481611\|27\|NC_016779\|CRT	3481611-3481637	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29498-29524	6	0.778
NC_016779_5	5.7\|3481611\|27\|NC_016779\|CRT	3481611-3481637	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3981-4007	6	0.778
NC_016779_5	5.7\|3481611\|27\|NC_016779\|CRT	3481611-3481637	27	MN693099	Marine virus AFVG_25M184, complete genome	13867-13893	6	0.778
NC_016779_5	5.7\|3481611\|27\|NC_016779\|CRT	3481611-3481637	27	MN693189	Marine virus AFVG_25M326, complete genome	18915-18941	6	0.778
NC_016779_5	5.7\|3481611\|27\|NC_016779\|CRT	3481611-3481637	27	NC_021795	Cellulophaga phage phi17:1, complete genome	26447-26473	6	0.778
NC_016779_5	5.8\|3481656\|27\|NC_016779\|CRT	3481656-3481682	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	15805-15831	6	0.778
NC_016779_5	5.8\|3481656\|27\|NC_016779\|CRT	3481656-3481682	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	16966-16992	6	0.778
NC_016779_5	5.8\|3481656\|27\|NC_016779\|CRT	3481656-3481682	27	AP014476	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, * SEQUENCING IN PROGRESS *, 2 ordered pieces	18171-18197	6	0.778
NC_016779_5	5.8\|3481656\|27\|NC_016779\|CRT	3481656-3481682	27	AP013959	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S31-C107, * SEQUENCING IN PROGRESS *	11104-11130	6	0.778
NC_016779_5	5.8\|3481656\|27\|NC_016779\|CRT	3481656-3481682	27	AP013942	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, * SEQUENCING IN PROGRESS *	15771-15797	6	0.778
NC_016779_5	5.8\|3481656\|27\|NC_016779\|CRT	3481656-3481682	27	AP013565	Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5F-MedDCM-OCT-S40-C10, * SEQUENCING IN PROGRESS *, 2 ordered pieces	40163-40189	6	0.778
NC_016779_5	5.8\|3481656\|27\|NC_016779\|CRT	3481656-3481682	27	AP013944	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, * SEQUENCING IN PROGRESS *	8161-8187	6	0.778
NC_016779_5	5.8\|3481656\|27\|NC_016779\|CRT	3481656-3481682	27	AP013956	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S27-C232, * SEQUENCING IN PROGRESS *	1353-1379	6	0.778
NC_016779_5	5.8\|3481656\|27\|NC_016779\|CRT	3481656-3481682	27	AP013963	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S38-C146, * SEQUENCING IN PROGRESS *	1353-1379	6	0.778
NC_016779_5	5.8\|3481656\|27\|NC_016779\|CRT	3481656-3481682	27	AP013945	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, * SEQUENCING IN PROGRESS *	3630-3656	6	0.778
NC_016779_5	5.8\|3481656\|27\|NC_016779\|CRT	3481656-3481682	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	78591-78617	6	0.778
NC_016779_5	5.8\|3481656\|27\|NC_016779\|CRT	3481656-3481682	27	AP013961	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S34-C156, * SEQUENCING IN PROGRESS *	1325-1351	6	0.778
NC_016779_5	5.8\|3481656\|27\|NC_016779\|CRT	3481656-3481682	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	83096-83122	6	0.778
NC_016779_5	5.9\|3481701\|27\|NC_016779\|CRT	3481701-3481727	27	NZ_CP054613	Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence	963384-963410	6	0.778
NC_016779_5	5.9\|3481701\|27\|NC_016779\|CRT	3481701-3481727	27	NZ_CP054613	Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence	963420-963446	6	0.778
NC_016779_5	5.9\|3481701\|27\|NC_016779\|CRT	3481701-3481727	27	MN693189	Marine virus AFVG_25M326, complete genome	18915-18941	6	0.778
NC_016779_5	5.9\|3481701\|27\|NC_016779\|CRT	3481701-3481727	27	MN234235	Mycobacterium phage BogosyJay, complete genome	4777-4803	6	0.778
NC_016779_5	5.10\|3481746\|27\|NC_016779\|CRT	3481746-3481772	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3981-4007	6	0.778
NC_016779_5	5.10\|3481746\|27\|NC_016779\|CRT	3481746-3481772	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29498-29524	6	0.778
NC_016779_5	5.10\|3481746\|27\|NC_016779\|CRT	3481746-3481772	27	MN693189	Marine virus AFVG_25M326, complete genome	18915-18941	6	0.778
NC_016779_5	5.10\|3481746\|27\|NC_016779\|CRT	3481746-3481772	27	MN693099	Marine virus AFVG_25M184, complete genome	13867-13893	6	0.778
NC_016779_5	5.13\|3481881\|27\|NC_016779\|CRT	3481881-3481907	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3981-4007	6	0.778
NC_016779_5	5.13\|3481881\|27\|NC_016779\|CRT	3481881-3481907	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29498-29524	6	0.778
NC_016779_5	5.13\|3481881\|27\|NC_016779\|CRT	3481881-3481907	27	MN693189	Marine virus AFVG_25M326, complete genome	18915-18941	6	0.778
NC_016779_5	5.13\|3481881\|27\|NC_016779\|CRT	3481881-3481907	27	MN693099	Marine virus AFVG_25M184, complete genome	13867-13893	6	0.778
NC_016779_5	5.16\|3482007\|27\|NC_016779\|CRT	3482007-3482033	27	MN693189	Marine virus AFVG_25M326, complete genome	18897-18923	6	0.778
NC_016779_5	5.16\|3482007\|27\|NC_016779\|CRT	3482007-3482033	27	GU943042	Uncultured phage MedDCM-OCT-S09-C399 genomic sequence	13188-13214	6	0.778
NC_016779_2	2.5\|1382995\|27\|NC_016779\|CRT	1382995-1383021	27	AB276040	Ralstonia phage RSA1 DNA, complete genome	36639-36665	7	0.741
NC_016779_2	2.5\|1382995\|27\|NC_016779\|CRT	1382995-1383021	27	NC_009382	Ralstonia phage phiRSA1, complete genome	36639-36665	7	0.741
NC_016779_2	2.11\|1383301\|27\|NC_016779\|CRT	1383301-1383327	27	AB276040	Ralstonia phage RSA1 DNA, complete genome	36639-36665	7	0.741
NC_016779_2	2.11\|1383301\|27\|NC_016779\|CRT	1383301-1383327	27	NC_009382	Ralstonia phage phiRSA1, complete genome	36639-36665	7	0.741
NC_016779_5	5.2\|3481395\|27\|NC_016779\|CRT	3481395-3481421	27	GU943042	Uncultured phage MedDCM-OCT-S09-C399 genomic sequence	13188-13214	7	0.741
NC_016779_5	5.3\|3481440\|27\|NC_016779\|CRT	3481440-3481466	27	GU943042	Uncultured phage MedDCM-OCT-S09-C399 genomic sequence	13188-13214	7	0.741
NC_016779_5	5.5\|3481521\|27\|NC_016779\|CRT	3481521-3481547	27	GU943042	Uncultured phage MedDCM-OCT-S09-C399 genomic sequence	13188-13214	7	0.741
NC_016779_5	5.8\|3481656\|27\|NC_016779\|CRT	3481656-3481682	27	GU943042	Uncultured phage MedDCM-OCT-S09-C399 genomic sequence	13188-13214	7	0.741
NC_016779_5	5.11\|3481791\|27\|NC_016779\|CRT	3481791-3481817	27	MK448998	Streptococcus phage Javan636, complete genome	35466-35492	7	0.741
NC_016779_5	5.11\|3481791\|27\|NC_016779\|CRT	3481791-3481817	27	MK448821	Streptococcus phage Javan623, complete genome	30480-30506	7	0.741
NC_016779_5	5.12\|3481836\|27\|NC_016779\|CRT	3481836-3481862	27	MK448998	Streptococcus phage Javan636, complete genome	35466-35492	7	0.741
NC_016779_5	5.12\|3481836\|27\|NC_016779\|CRT	3481836-3481862	27	MK448821	Streptococcus phage Javan623, complete genome	30480-30506	7	0.741

1. spacer 2.15|1383526|27|NC_016779|CRT matches to KU847400 (UNVERIFIED: Bacillus phage Crookii, complete genome) position: , mismatch: 2, identity: 0.926

cacctgtagcgccagtagcaccagcag	CRISPR spacer
cacctgtaccgcctgtagcaccagcag	Protospacer
******** **** *************

2. spacer 5.14|3481926|27|NC_016779|CRT matches to MN693092 (Marine virus AFVG_25M37, complete genome) position: , mismatch: 2, identity: 0.926

tactggtgccactggacctcaaggtgc	CRISPR spacer
aactggtgctactggacctcaaggtgc	Protospacer
 ********.*****************

3. spacer 5.14|3481926|27|NC_016779|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 2, identity: 0.926

tactggtgccactggacctcaaggtgc	CRISPR spacer
tactggtgcaactggacctcaaggttc	Protospacer
********* *************** *

4. spacer 5.14|3481926|27|NC_016779|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 2, identity: 0.926

tactggtgccactggacctcaaggtgc	CRISPR spacer
tactggtgcaactggacctcaaggttc	Protospacer
********* *************** *

5. spacer 5.16|3482007|27|NC_016779|CRT matches to MN693092 (Marine virus AFVG_25M37, complete genome) position: , mismatch: 2, identity: 0.926

tactggcgctactggacctcaaggtgc	CRISPR spacer
aactggtgctactggacctcaaggtgc	Protospacer
 *****.********************

6. spacer 5.16|3482007|27|NC_016779|CRT matches to MN693405 (Marine virus AFVG_25M416, complete genome) position: , mismatch: 2, identity: 0.926

tactggcgctactggacctcaaggtgc	CRISPR spacer
tactggagctactggccctcaaggtgc	Protospacer
****** ******** ***********

7. spacer 5.16|3482007|27|NC_016779|CRT matches to MN693333 (Marine virus AFVG_25M417, complete genome) position: , mismatch: 2, identity: 0.926

tactggcgctactggacctcaaggtgc	CRISPR spacer
tactggagctactggccctcaaggtgc	Protospacer
****** ******** ***********

8. spacer 2.5|1382995|27|NC_016779|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 3, identity: 0.889

gtccttgagcacctgtagcgccagtag	CRISPR spacer
caccttgaggacctgtagcgccagtag	Protospacer
  ******* *****************

9. spacer 2.5|1382995|27|NC_016779|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 3, identity: 0.889

gtccttgagcacctgtagcgccagtag	CRISPR spacer
caccttgaggacctgtagcgccagtag	Protospacer
  ******* *****************

10. spacer 2.5|1382995|27|NC_016779|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 3, identity: 0.889

gtccttgagcacctgtagcgccagtag	CRISPR spacer
caccttgaggacctgtagcgccagtag	Protospacer
  ******* *****************

11. spacer 2.5|1382995|27|NC_016779|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 3, identity: 0.889

gtccttgagcacctgtagcgccagtag	CRISPR spacer
ggccttgagaacctgtagcaccagtag	Protospacer
* ******* *********.*******

12. spacer 2.5|1382995|27|NC_016779|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 3, identity: 0.889

gtccttgagcacctgtagcgccagtag	CRISPR spacer
ggccttgagaacctgtagcaccagtag	Protospacer
* ******* *********.*******

13. spacer 2.10|1383247|27|NC_016779|CRT matches to MN693099 (Marine virus AFVG_25M184, complete genome) position: , mismatch: 3, identity: 0.889

gcccttgaggtccagtagcgccagtag	CRISPR spacer
gtccttgaggtccagtagcaccagttg	Protospacer
*.*****************.***** *

14. spacer 2.10|1383247|27|NC_016779|CRT matches to AP014301 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S28-C84, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 3, identity: 0.889

gcccttgaggtccagtagcgccagtag	CRISPR spacer
ggccttgagggccagtagcaccagtag	Protospacer
* ******** ********.*******

15. spacer 2.10|1383247|27|NC_016779|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 3, identity: 0.889

gcccttgaggtccagtagcgccagtag	CRISPR spacer
gtccttgaggtccagtagcaccagttg	Protospacer
*.*****************.***** *

16. spacer 2.10|1383247|27|NC_016779|CRT matches to MK521907 (Klebsiella phage vB_KpnS_FZ41, complete genome) position: , mismatch: 3, identity: 0.889

gcccttgaggtccagtagcgccagtag	CRISPR spacer
gaccttgaggaccagtagcaccagtag	Protospacer
* ******** ********.*******

17. spacer 2.10|1383247|27|NC_016779|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 3, identity: 0.889

gcccttgaggtccagtagcgccagtag	CRISPR spacer
gtccttgaggtccagtagcaccagttg	Protospacer
*.*****************.***** *

18. spacer 2.11|1383301|27|NC_016779|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 3, identity: 0.889

gtccttgagcacctgtagcgccagtag	CRISPR spacer
caccttgaggacctgtagcgccagtag	Protospacer
  ******* *****************

19. spacer 2.11|1383301|27|NC_016779|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 3, identity: 0.889

gtccttgagcacctgtagcgccagtag	CRISPR spacer
caccttgaggacctgtagcgccagtag	Protospacer
  ******* *****************

20. spacer 2.11|1383301|27|NC_016779|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 3, identity: 0.889

gtccttgagcacctgtagcgccagtag	CRISPR spacer
caccttgaggacctgtagcgccagtag	Protospacer
  ******* *****************

21. spacer 2.11|1383301|27|NC_016779|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 3, identity: 0.889

gtccttgagcacctgtagcgccagtag	CRISPR spacer
ggccttgagaacctgtagcaccagtag	Protospacer
* ******* *********.*******

22. spacer 2.11|1383301|27|NC_016779|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 3, identity: 0.889

gtccttgagcacctgtagcgccagtag	CRISPR spacer
ggccttgagaacctgtagcaccagtag	Protospacer
* ******* *********.*******

23. spacer 2.15|1383526|27|NC_016779|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 3, identity: 0.889

cacctgtagcgccagtagcaccagcag	CRISPR spacer
gacctgtagcaccagtagcaccaccag	Protospacer
 *********.************ ***

24. spacer 2.15|1383526|27|NC_016779|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 3, identity: 0.889

cacctgtagcgccagtagcaccagcag	CRISPR spacer
gacctgtagcaccagtagcaccaccag	Protospacer
 *********.************ ***

25. spacer 2.15|1383526|27|NC_016779|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 3, identity: 0.889

cacctgtagcgccagtagcaccagcag	CRISPR spacer
gacctgtagcaccagtagcaccaccag	Protospacer
 *********.************ ***

26. spacer 2.15|1383526|27|NC_016779|CRT matches to MT682065 (Klebsiella virus KpV2883, complete genome) position: , mismatch: 3, identity: 0.889

cacctgtagcgccagtagcaccagcag	CRISPR spacer
ctcctgtagcgccagtagcgcccgcag	Protospacer
* *****************.** ****

27. spacer 4.2|3480789|27|NC_016779|CRT matches to JQ691611 (Cronobacter phage CR9, complete genome) position: , mismatch: 3, identity: 0.889

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tcctcaaggtaacacaggtcctaccgg	Protospacer
* ***************** ****.**

28. spacer 4.2|3480789|27|NC_016779|CRT matches to MN101228 (Klebsiella phage KPN4, complete genome) position: , mismatch: 3, identity: 0.889

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tcctcagggtaacactggtgctactgg	Protospacer
* ****.******** ***********

29. spacer 4.2|3480789|27|NC_016779|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 3, identity: 0.889

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacacaggtgctactgg	Protospacer
* * **.********************

30. spacer 4.2|3480789|27|NC_016779|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 3, identity: 0.889

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacacaggtgctactgg	Protospacer
* * **.********************

31. spacer 4.3|3480834|27|NC_016779|CRT matches to JQ691611 (Cronobacter phage CR9, complete genome) position: , mismatch: 3, identity: 0.889

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tcctcaaggtaacacaggtcctaccgg	Protospacer
* ***************** ****.**

32. spacer 4.3|3480834|27|NC_016779|CRT matches to MN101228 (Klebsiella phage KPN4, complete genome) position: , mismatch: 3, identity: 0.889

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tcctcagggtaacactggtgctactgg	Protospacer
* ****.******** ***********

33. spacer 4.3|3480834|27|NC_016779|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 3, identity: 0.889

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacacaggtgctactgg	Protospacer
* * **.********************

34. spacer 4.3|3480834|27|NC_016779|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 3, identity: 0.889

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacacaggtgctactgg	Protospacer
* * **.********************

35. spacer 4.7|3480996|27|NC_016779|CRT matches to JQ691611 (Cronobacter phage CR9, complete genome) position: , mismatch: 3, identity: 0.889

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tcctcaaggtaacacaggtcctaccgg	Protospacer
* ***************** ****.**

36. spacer 4.7|3480996|27|NC_016779|CRT matches to MN101228 (Klebsiella phage KPN4, complete genome) position: , mismatch: 3, identity: 0.889

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tcctcagggtaacactggtgctactgg	Protospacer
* ****.******** ***********

37. spacer 4.7|3480996|27|NC_016779|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 3, identity: 0.889

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacacaggtgctactgg	Protospacer
* * **.********************

38. spacer 4.7|3480996|27|NC_016779|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 3, identity: 0.889

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacacaggtgctactgg	Protospacer
* * **.********************

39. spacer 4.9|3481077|27|NC_016779|CRT matches to KU716094 (Mycobacterium phage Eidsmoe, complete genome) position: , mismatch: 3, identity: 0.889

cgctcaaggaccagcgggtgctactgg	CRISPR spacer
ggctcagggaccagcgggcgctactgg	Protospacer
 *****.***********.********

40. spacer 4.9|3481077|27|NC_016779|CRT matches to MH371122 (Mycobacterium phage Priya, complete genome) position: , mismatch: 3, identity: 0.889

cgctcaaggaccagcgggtgctactgg	CRISPR spacer
ggctcagggaccagcgggcgctactgg	Protospacer
 *****.***********.********

41. spacer 4.9|3481077|27|NC_016779|CRT matches to NC_023716 (Mycobacterium virus Alma, complete genome) position: , mismatch: 3, identity: 0.889

cgctcaaggaccagcgggtgctactgg	CRISPR spacer
ggctcagggaccagcgggcgctactgg	Protospacer
 *****.***********.********

42. spacer 4.9|3481077|27|NC_016779|CRT matches to MG872835 (Mycobacterium phage Conquerage, complete genome) position: , mismatch: 3, identity: 0.889

cgctcaaggaccagcgggtgctactgg	CRISPR spacer
ggctcagggaccagcgggcgctactgg	Protospacer
 *****.***********.********

43. spacer 4.11|3481158|27|NC_016779|CRT matches to KU716094 (Mycobacterium phage Eidsmoe, complete genome) position: , mismatch: 3, identity: 0.889

cgctcaaggaccagcgggtgctactgg	CRISPR spacer
ggctcagggaccagcgggcgctactgg	Protospacer
 *****.***********.********

44. spacer 4.11|3481158|27|NC_016779|CRT matches to MH371122 (Mycobacterium phage Priya, complete genome) position: , mismatch: 3, identity: 0.889

cgctcaaggaccagcgggtgctactgg	CRISPR spacer
ggctcagggaccagcgggcgctactgg	Protospacer
 *****.***********.********

45. spacer 4.11|3481158|27|NC_016779|CRT matches to NC_023716 (Mycobacterium virus Alma, complete genome) position: , mismatch: 3, identity: 0.889

cgctcaaggaccagcgggtgctactgg	CRISPR spacer
ggctcagggaccagcgggcgctactgg	Protospacer
 *****.***********.********

46. spacer 4.11|3481158|27|NC_016779|CRT matches to MG872835 (Mycobacterium phage Conquerage, complete genome) position: , mismatch: 3, identity: 0.889

cgctcaaggaccagcgggtgctactgg	CRISPR spacer
ggctcagggaccagcgggcgctactgg	Protospacer
 *****.***********.********

47. spacer 5.1|3481350|27|NC_016779|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 3, identity: 0.889

tactggtgccactggacctcaaggcgc	CRISPR spacer
tactggtgcaactggacctcaaggttc	Protospacer
********* **************. *

48. spacer 5.1|3481350|27|NC_016779|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 3, identity: 0.889

tactggtgccactggacctcaaggcgc	CRISPR spacer
tactggtgcaactggacctcaaggttc	Protospacer
********* **************. *

49. spacer 5.1|3481350|27|NC_016779|CRT matches to MN693092 (Marine virus AFVG_25M37, complete genome) position: , mismatch: 3, identity: 0.889

tactggtgccactggacctcaaggcgc	CRISPR spacer
aactggtgctactggacctcaaggtgc	Protospacer
 ********.**************.**

50. spacer 5.1|3481350|27|NC_016779|CRT matches to AP014301 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S28-C84, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 3, identity: 0.889

tactggtgccactggacctcaaggcgc	CRISPR spacer
tactggtgctactggccctcaaggccc	Protospacer
*********.***** ********* *

51. spacer 5.9|3481701|27|NC_016779|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 3, identity: 0.889

tactggtgccactggacctcaaggtgt	CRISPR spacer
tactggtgcaactggacctcaaggttc	Protospacer
********* *************** .

52. spacer 5.9|3481701|27|NC_016779|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 3, identity: 0.889

tactggtgccactggacctcaaggtgt	CRISPR spacer
tactggtgcaactggacctcaaggttc	Protospacer
********* *************** .

53. spacer 5.9|3481701|27|NC_016779|CRT matches to MN693092 (Marine virus AFVG_25M37, complete genome) position: , mismatch: 3, identity: 0.889

tactggtgccactggacctcaaggtgt	CRISPR spacer
aactggtgctactggacctcaaggtgc	Protospacer
 ********.****************.

54. spacer 5.11|3481791|27|NC_016779|CRT matches to MN693092 (Marine virus AFVG_25M37, complete genome) position: , mismatch: 3, identity: 0.889

taccggtgctactggacctcaaggtgt	CRISPR spacer
aactggtgctactggacctcaaggtgc	Protospacer
 **.**********************.

55. spacer 5.12|3481836|27|NC_016779|CRT matches to MN693092 (Marine virus AFVG_25M37, complete genome) position: , mismatch: 3, identity: 0.889

taccggtgctactggacctcaaggtgt	CRISPR spacer
aactggtgctactggacctcaaggtgc	Protospacer
 **.**********************.

56. spacer 5.14|3481926|27|NC_016779|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 3, identity: 0.889

tactggtgccactggacctcaaggtgc	CRISPR spacer
tactggtgccaccggtcctcaaggtcc	Protospacer
************.** ********* *

57. spacer 5.14|3481926|27|NC_016779|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 3, identity: 0.889

tactggtgccactggacctcaaggtgc	CRISPR spacer
tactggtgccaccggtcctcaaggtcc	Protospacer
************.** ********* *

58. spacer 5.14|3481926|27|NC_016779|CRT matches to MK521907 (Klebsiella phage vB_KpnS_FZ41, complete genome) position: , mismatch: 3, identity: 0.889

tactggtgccactggacctcaaggtgc	CRISPR spacer
tactggtgctactggtcctcaaggtcc	Protospacer
*********.***** ********* *

59. spacer 5.16|3482007|27|NC_016779|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 3, identity: 0.889

tactggcgctactggacctcaaggtgc	CRISPR spacer
tactggcgctacaggtcctcaaggtga	Protospacer
************ ** **********

60. spacer 5.16|3482007|27|NC_016779|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 3, identity: 0.889

tactggcgctactggacctcaaggtgc	CRISPR spacer
tactggcgctacaggtcctcaaggtga	Protospacer
************ ** **********

61. spacer 5.16|3482007|27|NC_016779|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 3, identity: 0.889

tactggcgctactggacctcaaggtgc	CRISPR spacer
tactggcgctacaggtcctcaaggtga	Protospacer
************ ** **********

62. spacer 5.16|3482007|27|NC_016779|CRT matches to MH884513 (Bacillus phage vB_BpsS-36, complete genome) position: , mismatch: 3, identity: 0.889

tactggcgctactggacctcaaggtgc	CRISPR spacer
tactggagctactggtcctcaaggtcc	Protospacer
****** ******** ********* *

63. spacer 5.16|3482007|27|NC_016779|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 3, identity: 0.889

tactggcgctactggacctcaaggtgc	CRISPR spacer
tactggtgcaactggacctcaaggttc	Protospacer
******.** *************** *

64. spacer 5.16|3482007|27|NC_016779|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 3, identity: 0.889

tactggcgctactggacctcaaggtgc	CRISPR spacer
tactggtgcaactggacctcaaggttc	Protospacer
******.** *************** *

65. spacer 5.16|3482007|27|NC_016779|CRT matches to MK521907 (Klebsiella phage vB_KpnS_FZ41, complete genome) position: , mismatch: 3, identity: 0.889

tactggcgctactggacctcaaggtgc	CRISPR spacer
tactggtgctactggtcctcaaggtcc	Protospacer
******.******** ********* *

66. spacer 2.5|1382995|27|NC_016779|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 4, identity: 0.852

gtccttgagcacctgtagcgccagtag	CRISPR spacer
aaccttgaggacctgtagcaccagtag	Protospacer
. ******* *********.*******

67. spacer 2.5|1382995|27|NC_016779|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 4, identity: 0.852

gtccttgagcacctgtagcgccagtag	CRISPR spacer
aaccttgaggacctgtagcaccagtag	Protospacer
. ******* *********.*******

68. spacer 2.5|1382995|27|NC_016779|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 4, identity: 0.852

gtccttgagcacctgtagcgccagtag	CRISPR spacer
aaccttgaggacctgtagcaccagtag	Protospacer
. ******* *********.*******

69. spacer 2.5|1382995|27|NC_016779|CRT matches to AP013564 (Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5-MedDCM-OCT-S33-C6, *** SEQUENCING IN PROGRESS ***, 4 ordered pieces) position: , mismatch: 4, identity: 0.852

gtccttgagcacctgtagcgccagtag	CRISPR spacer
gcccttgagcaccagtagcgccggttg	Protospacer
*.*********** ********.** *

70. spacer 2.5|1382995|27|NC_016779|CRT matches to AP013944 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

gtccttgagcacctgtagcgccagtag	CRISPR spacer
gcccttgagcaccagtagcgccggttg	Protospacer
*.*********** ********.** *

71. spacer 2.5|1382995|27|NC_016779|CRT matches to AP013943 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S40-C165, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

gtccttgagcacctgtagcgccagtag	CRISPR spacer
gcccttgagcaccagtagcgccggttg	Protospacer
*.*********** ********.** *

72. spacer 2.5|1382995|27|NC_016779|CRT matches to AP013945 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

gtccttgagcacctgtagcgccagtag	CRISPR spacer
gcccttgagcaccagtagcgccggttg	Protospacer
*.*********** ********.** *

73. spacer 2.5|1382995|27|NC_016779|CRT matches to AP014476 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, *** SEQUENCING IN PROGRESS ***, 2 ordered pieces) position: , mismatch: 4, identity: 0.852

gtccttgagcacctgtagcgccagtag	CRISPR spacer
gcccttgagcaccagtagcgccggttg	Protospacer
*.*********** ********.** *

74. spacer 2.5|1382995|27|NC_016779|CRT matches to AP013942 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

gtccttgagcacctgtagcgccagtag	CRISPR spacer
gcccttgagcaccagtagcgccggttg	Protospacer
*.*********** ********.** *

75. spacer 2.10|1383247|27|NC_016779|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 4, identity: 0.852

gcccttgaggtccagtagcgccagtag	CRISPR spacer
aaccttgaggtccagttgcaccagtag	Protospacer
. ************** **.*******

76. spacer 2.10|1383247|27|NC_016779|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 4, identity: 0.852

gcccttgaggtccagtagcgccagtag	CRISPR spacer
caccttgaggacctgtagcgccagtag	Protospacer
  ******** ** *************

77. spacer 2.10|1383247|27|NC_016779|CRT matches to MN693405 (Marine virus AFVG_25M416, complete genome) position: , mismatch: 4, identity: 0.852

gcccttgaggtccagtagcgccagtag	CRISPR spacer
caccttgagggccagtagctccagtag	Protospacer
  ******** ******** *******

78. spacer 2.10|1383247|27|NC_016779|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 4, identity: 0.852

gcccttgaggtccagtagcgccagtag	CRISPR spacer
caccttgaggacctgtagcgccagtag	Protospacer
  ******** ** *************

79. spacer 2.10|1383247|27|NC_016779|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 4, identity: 0.852

gcccttgaggtccagtagcgccagtag	CRISPR spacer
caccttgaggacctgtagcgccagtag	Protospacer
  ******** ** *************

80. spacer 2.10|1383247|27|NC_016779|CRT matches to GU943042 (Uncultured phage MedDCM-OCT-S09-C399 genomic sequence) position: , mismatch: 4, identity: 0.852

gcccttgaggtccagtagcgccagtag	CRISPR spacer
gcccttgaggtccagtagctccatccg	Protospacer
******************* *** . *

81. spacer 2.10|1383247|27|NC_016779|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

gcccttgaggtccagtagcgccagtag	CRISPR spacer
aaccttgaggtccagttgcaccagtag	Protospacer
. ************** **.*******

82. spacer 2.10|1383247|27|NC_016779|CRT matches to MN693333 (Marine virus AFVG_25M417, complete genome) position: , mismatch: 4, identity: 0.852

gcccttgaggtccagtagcgccagtag	CRISPR spacer
caccttgagggccagtagctccagtag	Protospacer
  ******** ******** *******

83. spacer 2.10|1383247|27|NC_016779|CRT matches to MN693092 (Marine virus AFVG_25M37, complete genome) position: , mismatch: 4, identity: 0.852

gcccttgaggtccagtagcgccagtag	CRISPR spacer
caccttgaggtccagtagcaccagttg	Protospacer
  *****************.***** *

84. spacer 2.10|1383247|27|NC_016779|CRT matches to MH884513 (Bacillus phage vB_BpsS-36, complete genome) position: , mismatch: 4, identity: 0.852

gcccttgaggtccagtagcgccagtag	CRISPR spacer
gaccttgaggaccagtagctccagtat	Protospacer
* ******** ******** ******

85. spacer 2.10|1383247|27|NC_016779|CRT matches to AP013944 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

gcccttgaggtccagtagcgccagtag	CRISPR spacer
gtccttgaggaccagtagcgcctgttg	Protospacer
*.******** *********** ** *

86. spacer 2.10|1383247|27|NC_016779|CRT matches to AP013956 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S27-C232, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

gcccttgaggtccagtagcgccagtag	CRISPR spacer
gaccttgagggccagtagcaccagttg	Protospacer
* ******** ********.***** *

87. spacer 2.10|1383247|27|NC_016779|CRT matches to AP013963 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S38-C146, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

gcccttgaggtccagtagcgccagtag	CRISPR spacer
gaccttgagggccagtagcaccagttg	Protospacer
* ******** ********.***** *

88. spacer 2.10|1383247|27|NC_016779|CRT matches to AP013945 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

gcccttgaggtccagtagcgccagtag	CRISPR spacer
gtccttgaggaccagtagcgcctgttg	Protospacer
*.******** *********** ** *

89. spacer 2.10|1383247|27|NC_016779|CRT matches to AP013961 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S34-C156, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

gcccttgaggtccagtagcgccagtag	CRISPR spacer
gaccttgagggccagtagcaccagttg	Protospacer
* ******** ********.***** *

90. spacer 2.10|1383247|27|NC_016779|CRT matches to AP014476 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, *** SEQUENCING IN PROGRESS ***, 2 ordered pieces) position: , mismatch: 4, identity: 0.852

gcccttgaggtccagtagcgccagtag	CRISPR spacer
gtccttgaggaccagtagcgcctgttg	Protospacer
*.******** *********** ** *

91. spacer 2.10|1383247|27|NC_016779|CRT matches to AP013959 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S31-C107, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

gcccttgaggtccagtagcgccagtag	CRISPR spacer
gaccttgagggccagtagcaccagttg	Protospacer
* ******** ********.***** *

92. spacer 2.10|1383247|27|NC_016779|CRT matches to AP013942 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

gcccttgaggtccagtagcgccagtag	CRISPR spacer
gtccttgaggaccagtagcgcctgttg	Protospacer
*.******** *********** ** *

93. spacer 2.10|1383247|27|NC_016779|CRT matches to AP013565 (Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5F-MedDCM-OCT-S40-C10, *** SEQUENCING IN PROGRESS ***, 2 ordered pieces) position: , mismatch: 4, identity: 0.852

gcccttgaggtccagtagcgccagtag	CRISPR spacer
gaccttgagggccagtagcaccagttg	Protospacer
* ******** ********.***** *

94. spacer 2.11|1383301|27|NC_016779|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 4, identity: 0.852

gtccttgagcacctgtagcgccagtag	CRISPR spacer
aaccttgaggacctgtagcaccagtag	Protospacer
. ******* *********.*******

95. spacer 2.11|1383301|27|NC_016779|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 4, identity: 0.852

gtccttgagcacctgtagcgccagtag	CRISPR spacer
aaccttgaggacctgtagcaccagtag	Protospacer
. ******* *********.*******

96. spacer 2.11|1383301|27|NC_016779|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 4, identity: 0.852

gtccttgagcacctgtagcgccagtag	CRISPR spacer
aaccttgaggacctgtagcaccagtag	Protospacer
. ******* *********.*******

97. spacer 2.11|1383301|27|NC_016779|CRT matches to AP013564 (Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5-MedDCM-OCT-S33-C6, *** SEQUENCING IN PROGRESS ***, 4 ordered pieces) position: , mismatch: 4, identity: 0.852

gtccttgagcacctgtagcgccagtag	CRISPR spacer
gcccttgagcaccagtagcgccggttg	Protospacer
*.*********** ********.** *

98. spacer 2.11|1383301|27|NC_016779|CRT matches to AP013944 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

gtccttgagcacctgtagcgccagtag	CRISPR spacer
gcccttgagcaccagtagcgccggttg	Protospacer
*.*********** ********.** *

99. spacer 2.11|1383301|27|NC_016779|CRT matches to AP013943 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S40-C165, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

gtccttgagcacctgtagcgccagtag	CRISPR spacer
gcccttgagcaccagtagcgccggttg	Protospacer
*.*********** ********.** *

100. spacer 2.11|1383301|27|NC_016779|CRT matches to AP013945 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

gtccttgagcacctgtagcgccagtag	CRISPR spacer
gcccttgagcaccagtagcgccggttg	Protospacer
*.*********** ********.** *

101. spacer 2.11|1383301|27|NC_016779|CRT matches to AP014476 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, *** SEQUENCING IN PROGRESS ***, 2 ordered pieces) position: , mismatch: 4, identity: 0.852

gtccttgagcacctgtagcgccagtag	CRISPR spacer
gcccttgagcaccagtagcgccggttg	Protospacer
*.*********** ********.** *

102. spacer 2.11|1383301|27|NC_016779|CRT matches to AP013942 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

gtccttgagcacctgtagcgccagtag	CRISPR spacer
gcccttgagcaccagtagcgccggttg	Protospacer
*.*********** ********.** *

103. spacer 2.15|1383526|27|NC_016779|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 4, identity: 0.852

cacctgtagcgccagtagcaccagcag	CRISPR spacer
caccagtagcgccagtagcaccaataa	Protospacer
**** ******************..*.

104. spacer 2.15|1383526|27|NC_016779|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 4, identity: 0.852

cacctgtagcgccagtagcaccagcag	CRISPR spacer
caccttgagcgccagtagcaccagtgg	Protospacer
*****  *****************..*

105. spacer 2.15|1383526|27|NC_016779|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 4, identity: 0.852

cacctgtagcgccagtagcaccagcag	CRISPR spacer
caccttgagcgccagtagcaccagtgg	Protospacer
*****  *****************..*

106. spacer 2.15|1383526|27|NC_016779|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 4, identity: 0.852

cacctgtagcgccagtagcaccagcag	CRISPR spacer
caccttgagcgccagtagcaccagtgg	Protospacer
*****  *****************..*

107. spacer 2.15|1383526|27|NC_016779|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 4, identity: 0.852

cacctgtagcgccagtagcaccagcag	CRISPR spacer
caccagtagcgccagtagcaccaataa	Protospacer
**** ******************..*.

108. spacer 2.15|1383526|27|NC_016779|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 4, identity: 0.852

cacctgtagcgccagtagcaccagcag	CRISPR spacer
caccagtagcgccagtagcaccaataa	Protospacer
**** ******************..*.

109. spacer 2.15|1383526|27|NC_016779|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 4, identity: 0.852

cacctgtagcgccagtagcaccagcag	CRISPR spacer
caccttgagcgccagtagcaccagtgg	Protospacer
*****  *****************..*

110. spacer 2.15|1383526|27|NC_016779|CRT matches to KM236245 (Bacillus phage Mater, complete genome) position: , mismatch: 4, identity: 0.852

cacctgtagcgccagtagcaccagcag	CRISPR spacer
cacctgtagcgccagcagcaccacaac	Protospacer
***************.*******  *

111. spacer 2.15|1383526|27|NC_016779|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 4, identity: 0.852

cacctgtagcgccagtagcaccagcag	CRISPR spacer
aacctgtagcaccagtagcaccagtat	Protospacer
 *********.*************.*

112. spacer 2.15|1383526|27|NC_016779|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 4, identity: 0.852

cacctgtagcgccagtagcaccagcag	CRISPR spacer
aacctgtagcaccagtagcaccagtat	Protospacer
 *********.*************.*

113. spacer 2.15|1383526|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.852

cacctgtagcgccagtagcaccagcag	CRISPR spacer
cgccagtagcgccagtagcaccagtat	Protospacer
*.** *******************.*

114. spacer 2.15|1383526|27|NC_016779|CRT matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 4, identity: 0.852

cacctgtagcgccagtagcaccagcag	CRISPR spacer
cacctgtagcccccgtagcaccagtcg	Protospacer
********** ** **********. *

115. spacer 2.15|1383526|27|NC_016779|CRT matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 4, identity: 0.852

cacctgtagcgccagtagcaccagcag	CRISPR spacer
cacctgtagcccccgtagcaccagtcg	Protospacer
********** ** **********. *

116. spacer 2.15|1383526|27|NC_016779|CRT matches to MN692989 (Marine virus AFVG_117M66, complete genome) position: , mismatch: 4, identity: 0.852

cacctgtagcgccagtagcaccagcag	CRISPR spacer
cacctgtagcgccagtagctcctgtgg	Protospacer
******************* ** *..*

117. spacer 2.15|1383526|27|NC_016779|CRT matches to MN478377 (Bacteriophage Eos, complete genome) position: , mismatch: 4, identity: 0.852

cacctgtagcgccagtagcaccagcag	CRISPR spacer
cacctgtagcacctgtagcaccagttg	Protospacer
**********.** **********. *

118. spacer 2.15|1383526|27|NC_016779|CRT matches to KJ019159 (Synechococcus phage ACG-2014f isolate Syn7803C34, complete genome) position: , mismatch: 4, identity: 0.852

cacctgtagcgccagtagcaccagcag	CRISPR spacer
caccagtagcaccagtagcaccacctg	Protospacer
**** *****.************ * *

119. spacer 2.15|1383526|27|NC_016779|CRT matches to KJ019090 (Synechococcus phage ACG-2014f isolate Syn7803US24, complete genome) position: , mismatch: 4, identity: 0.852

cacctgtagcgccagtagcaccagcag	CRISPR spacer
caccagtagcaccagtagcaccacctg	Protospacer
**** *****.************ * *

120. spacer 4.2|3480789|27|NC_016779|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
ccctcagggtaacactggtgctactgg	Protospacer
. ****.******** ***********

121. spacer 4.2|3480789|27|NC_016779|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacaaggtaacaaaggtgatactgg	Protospacer
* * ********** ***** ******

122. spacer 4.2|3480789|27|NC_016779|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacaccggtgctactgg	Protospacer
* * **.******** ***********

123. spacer 4.2|3480789|27|NC_016779|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacactggtgctactgg	Protospacer
* * **.******** ***********

124. spacer 4.2|3480789|27|NC_016779|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacactggtgctactgg	Protospacer
* * **.******** ***********

125. spacer 4.2|3480789|27|NC_016779|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccgcagggtaacactggtgctactgg	Protospacer
* * **.******** ***********

126. spacer 4.2|3480789|27|NC_016779|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacactggtgctactgg	Protospacer
* * **.******** ***********

127. spacer 4.2|3480789|27|NC_016779|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacactggtgctactgg	Protospacer
* * **.******** ***********

128. spacer 4.2|3480789|27|NC_016779|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccgcagggtaacactggtgctactgg	Protospacer
* * **.******** ***********

129. spacer 4.3|3480834|27|NC_016779|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
ccctcagggtaacactggtgctactgg	Protospacer
. ****.******** ***********

130. spacer 4.3|3480834|27|NC_016779|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacaaggtaacaaaggtgatactgg	Protospacer
* * ********** ***** ******

131. spacer 4.3|3480834|27|NC_016779|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacaccggtgctactgg	Protospacer
* * **.******** ***********

132. spacer 4.3|3480834|27|NC_016779|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacactggtgctactgg	Protospacer
* * **.******** ***********

133. spacer 4.3|3480834|27|NC_016779|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacactggtgctactgg	Protospacer
* * **.******** ***********

134. spacer 4.3|3480834|27|NC_016779|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccgcagggtaacactggtgctactgg	Protospacer
* * **.******** ***********

135. spacer 4.3|3480834|27|NC_016779|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacactggtgctactgg	Protospacer
* * **.******** ***********

136. spacer 4.3|3480834|27|NC_016779|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacactggtgctactgg	Protospacer
* * **.******** ***********

137. spacer 4.3|3480834|27|NC_016779|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccgcagggtaacactggtgctactgg	Protospacer
* * **.******** ***********

138. spacer 4.7|3480996|27|NC_016779|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
ccctcagggtaacactggtgctactgg	Protospacer
. ****.******** ***********

139. spacer 4.7|3480996|27|NC_016779|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacaaggtaacaaaggtgatactgg	Protospacer
* * ********** ***** ******

140. spacer 4.7|3480996|27|NC_016779|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacaccggtgctactgg	Protospacer
* * **.******** ***********

141. spacer 4.7|3480996|27|NC_016779|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacactggtgctactgg	Protospacer
* * **.******** ***********

142. spacer 4.7|3480996|27|NC_016779|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacactggtgctactgg	Protospacer
* * **.******** ***********

143. spacer 4.7|3480996|27|NC_016779|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccgcagggtaacactggtgctactgg	Protospacer
* * **.******** ***********

144. spacer 4.7|3480996|27|NC_016779|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacactggtgctactgg	Protospacer
* * **.******** ***********

145. spacer 4.7|3480996|27|NC_016779|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacactggtgctactgg	Protospacer
* * **.******** ***********

146. spacer 4.7|3480996|27|NC_016779|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccgcagggtaacactggtgctactgg	Protospacer
* * **.******** ***********

147. spacer 4.9|3481077|27|NC_016779|CRT matches to NZ_CP023408 (Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence) position: , mismatch: 4, identity: 0.852

cgctcaaggaccagcgggtgctactgg	CRISPR spacer
agctcaaggaccagctggtgctgctga	Protospacer
 ************** ******.***.

148. spacer 4.9|3481077|27|NC_016779|CRT matches to AP014476 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, *** SEQUENCING IN PROGRESS ***, 2 ordered pieces) position: , mismatch: 4, identity: 0.852

cgctcaaggaccagcgggtgctactgg	CRISPR spacer
gcctcaaggaccagcaggtgcaactgg	Protospacer
  *************.***** *****

149. spacer 4.9|3481077|27|NC_016779|CRT matches to AP013564 (Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5-MedDCM-OCT-S33-C6, *** SEQUENCING IN PROGRESS ***, 4 ordered pieces) position: , mismatch: 4, identity: 0.852

cgctcaaggaccagcgggtgctactgg	CRISPR spacer
gcctcaaggaccagcaggtgcaactgg	Protospacer
  *************.***** *****

150. spacer 4.9|3481077|27|NC_016779|CRT matches to AP013944 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

cgctcaaggaccagcgggtgctactgg	CRISPR spacer
gcctcaaggaccagcaggtgcaactgg	Protospacer
  *************.***** *****

151. spacer 4.9|3481077|27|NC_016779|CRT matches to AP013943 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S40-C165, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

cgctcaaggaccagcgggtgctactgg	CRISPR spacer
gcctcaaggaccagcaggtgcaactgg	Protospacer
  *************.***** *****

152. spacer 4.9|3481077|27|NC_016779|CRT matches to AP013942 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

cgctcaaggaccagcgggtgctactgg	CRISPR spacer
gcctcaaggaccagcaggtgcaactgg	Protospacer
  *************.***** *****

153. spacer 4.9|3481077|27|NC_016779|CRT matches to AP013945 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

cgctcaaggaccagcgggtgctactgg	CRISPR spacer
gcctcaaggaccagcaggtgcaactgg	Protospacer
  *************.***** *****

154. spacer 4.11|3481158|27|NC_016779|CRT matches to NZ_CP023408 (Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence) position: , mismatch: 4, identity: 0.852

cgctcaaggaccagcgggtgctactgg	CRISPR spacer
agctcaaggaccagctggtgctgctga	Protospacer
 ************** ******.***.

155. spacer 4.11|3481158|27|NC_016779|CRT matches to AP014476 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, *** SEQUENCING IN PROGRESS ***, 2 ordered pieces) position: , mismatch: 4, identity: 0.852

cgctcaaggaccagcgggtgctactgg	CRISPR spacer
gcctcaaggaccagcaggtgcaactgg	Protospacer
  *************.***** *****

156. spacer 4.11|3481158|27|NC_016779|CRT matches to AP013564 (Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5-MedDCM-OCT-S33-C6, *** SEQUENCING IN PROGRESS ***, 4 ordered pieces) position: , mismatch: 4, identity: 0.852

cgctcaaggaccagcgggtgctactgg	CRISPR spacer
gcctcaaggaccagcaggtgcaactgg	Protospacer
  *************.***** *****

157. spacer 4.11|3481158|27|NC_016779|CRT matches to AP013944 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

cgctcaaggaccagcgggtgctactgg	CRISPR spacer
gcctcaaggaccagcaggtgcaactgg	Protospacer
  *************.***** *****

158. spacer 4.11|3481158|27|NC_016779|CRT matches to AP013943 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S40-C165, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

cgctcaaggaccagcgggtgctactgg	CRISPR spacer
gcctcaaggaccagcaggtgcaactgg	Protospacer
  *************.***** *****

159. spacer 4.11|3481158|27|NC_016779|CRT matches to AP013942 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

cgctcaaggaccagcgggtgctactgg	CRISPR spacer
gcctcaaggaccagcaggtgcaactgg	Protospacer
  *************.***** *****

160. spacer 4.11|3481158|27|NC_016779|CRT matches to AP013945 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

cgctcaaggaccagcgggtgctactgg	CRISPR spacer
gcctcaaggaccagcaggtgcaactgg	Protospacer
  *************.***** *****

161. spacer 5.1|3481350|27|NC_016779|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 4, identity: 0.852

tactggtgccactggacctcaaggcgc	CRISPR spacer
aactggtgctactggacctcaaggacc	Protospacer
 ********.**************  *

162. spacer 5.1|3481350|27|NC_016779|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

tactggtgccactggacctcaaggcgc	CRISPR spacer
aactggtgctactggacctcaaggacc	Protospacer
 ********.**************  *

163. spacer 5.1|3481350|27|NC_016779|CRT matches to MN693099 (Marine virus AFVG_25M184, complete genome) position: , mismatch: 4, identity: 0.852

tactggtgccactggacctcaaggcgc	CRISPR spacer
aactggtgctactggacctcaaggacc	Protospacer
 ********.**************  *

164. spacer 5.1|3481350|27|NC_016779|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 4, identity: 0.852

tactggtgccactggacctcaaggcgc	CRISPR spacer
aactggagccactggtcctcaaggcga	Protospacer
 ***** ******** **********

165. spacer 5.1|3481350|27|NC_016779|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 4, identity: 0.852

tactggtgccactggacctcaaggcgc	CRISPR spacer
aactggagccactggtcctcaaggcga	Protospacer
 ***** ******** **********

166. spacer 5.1|3481350|27|NC_016779|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 4, identity: 0.852

tactggtgccactggacctcaaggcgc	CRISPR spacer
aactggagccactggtcctcaaggcga	Protospacer
 ***** ******** **********

167. spacer 5.1|3481350|27|NC_016779|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 4, identity: 0.852

tactggtgccactggacctcaaggcgc	CRISPR spacer
tactggtgccaccggtcctcaaggtcc	Protospacer
************.** ********. *

168. spacer 5.1|3481350|27|NC_016779|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 4, identity: 0.852

tactggtgccactggacctcaaggcgc	CRISPR spacer
tactggtgccaccggtcctcaaggtcc	Protospacer
************.** ********. *

169. spacer 5.1|3481350|27|NC_016779|CRT matches to MK521907 (Klebsiella phage vB_KpnS_FZ41, complete genome) position: , mismatch: 4, identity: 0.852

tactggtgccactggacctcaaggcgc	CRISPR spacer
tactggtgctactggtcctcaaggtcc	Protospacer
*********.***** ********. *

170. spacer 5.1|3481350|27|NC_016779|CRT matches to MN234235 (Mycobacterium phage BogosyJay, complete genome) position: , mismatch: 4, identity: 0.852

tactggtgccactggacctcaaggcgc	CRISPR spacer
gactggtgccactggcgctcaaggccc	Protospacer
 **************  ******** *

171. spacer 5.1|3481350|27|NC_016779|CRT matches to MT724048 (Staphylococcus phage SAP3, partial genome) position: , mismatch: 4, identity: 0.852

tactggtgccactggacctcaaggcgc	CRISPR spacer
tactggagccactggacctaaaggaga	Protospacer
****** ************ **** *

172. spacer 5.2|3481395|27|NC_016779|CRT matches to MN693092 (Marine virus AFVG_25M37, complete genome) position: , mismatch: 4, identity: 0.852

tactggcgctactggacctcaaggcgt	CRISPR spacer
aactggtgctactggacctcaaggtgc	Protospacer
 *****.*****************.*.

173. spacer 5.2|3481395|27|NC_016779|CRT matches to AP014301 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S28-C84, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggtgctactggccctcaaggccc	Protospacer
******.******** ********* .

174. spacer 5.2|3481395|27|NC_016779|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 4, identity: 0.852

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggcgctacaggtcctcaaggtga	Protospacer
************ ** ********.*

175. spacer 5.2|3481395|27|NC_016779|CRT matches to MN693405 (Marine virus AFVG_25M416, complete genome) position: , mismatch: 4, identity: 0.852

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggagctactggccctcaaggtgc	Protospacer
****** ******** ********.*.

176. spacer 5.2|3481395|27|NC_016779|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 4, identity: 0.852

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggcgctacaggtcctcaaggtga	Protospacer
************ ** ********.*

177. spacer 5.2|3481395|27|NC_016779|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 4, identity: 0.852

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggcgctacaggtcctcaaggtga	Protospacer
************ ** ********.*

178. spacer 5.2|3481395|27|NC_016779|CRT matches to MN693333 (Marine virus AFVG_25M417, complete genome) position: , mismatch: 4, identity: 0.852

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggagctactggccctcaaggtgc	Protospacer
****** ******** ********.*.

179. spacer 5.2|3481395|27|NC_016779|CRT matches to NC_024210 (Escherichia phage e4/1c, complete genome) position: , mismatch: 4, identity: 0.852

tactggcgctactggacctcaaggcgt	CRISPR spacer
tcctggcgatactgggcctcaaggcga	Protospacer
* ****** ******.**********

180. spacer 5.3|3481440|27|NC_016779|CRT matches to MN693092 (Marine virus AFVG_25M37, complete genome) position: , mismatch: 4, identity: 0.852

tactggcgctactggacctcaaggcgt	CRISPR spacer
aactggtgctactggacctcaaggtgc	Protospacer
 *****.*****************.*.

181. spacer 5.3|3481440|27|NC_016779|CRT matches to AP014301 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S28-C84, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggtgctactggccctcaaggccc	Protospacer
******.******** ********* .

182. spacer 5.3|3481440|27|NC_016779|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 4, identity: 0.852

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggcgctacaggtcctcaaggtga	Protospacer
************ ** ********.*

183. spacer 5.3|3481440|27|NC_016779|CRT matches to MN693405 (Marine virus AFVG_25M416, complete genome) position: , mismatch: 4, identity: 0.852

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggagctactggccctcaaggtgc	Protospacer
****** ******** ********.*.

184. spacer 5.3|3481440|27|NC_016779|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 4, identity: 0.852

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggcgctacaggtcctcaaggtga	Protospacer
************ ** ********.*

185. spacer 5.3|3481440|27|NC_016779|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 4, identity: 0.852

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggcgctacaggtcctcaaggtga	Protospacer
************ ** ********.*

186. spacer 5.3|3481440|27|NC_016779|CRT matches to MN693333 (Marine virus AFVG_25M417, complete genome) position: , mismatch: 4, identity: 0.852

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggagctactggccctcaaggtgc	Protospacer
****** ******** ********.*.

187. spacer 5.3|3481440|27|NC_016779|CRT matches to NC_024210 (Escherichia phage e4/1c, complete genome) position: , mismatch: 4, identity: 0.852

tactggcgctactggacctcaaggcgt	CRISPR spacer
tcctggcgatactgggcctcaaggcga	Protospacer
* ****** ******.**********

188. spacer 5.5|3481521|27|NC_016779|CRT matches to MN693092 (Marine virus AFVG_25M37, complete genome) position: , mismatch: 4, identity: 0.852

tactggcgctactggacctcaaggcgt	CRISPR spacer
aactggtgctactggacctcaaggtgc	Protospacer
 *****.*****************.*.

189. spacer 5.5|3481521|27|NC_016779|CRT matches to AP014301 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S28-C84, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggtgctactggccctcaaggccc	Protospacer
******.******** ********* .

190. spacer 5.5|3481521|27|NC_016779|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 4, identity: 0.852

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggcgctacaggtcctcaaggtga	Protospacer
************ ** ********.*

191. spacer 5.5|3481521|27|NC_016779|CRT matches to MN693405 (Marine virus AFVG_25M416, complete genome) position: , mismatch: 4, identity: 0.852

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggagctactggccctcaaggtgc	Protospacer
****** ******** ********.*.

192. spacer 5.5|3481521|27|NC_016779|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 4, identity: 0.852

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggcgctacaggtcctcaaggtga	Protospacer
************ ** ********.*

193. spacer 5.5|3481521|27|NC_016779|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 4, identity: 0.852

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggcgctacaggtcctcaaggtga	Protospacer
************ ** ********.*

194. spacer 5.5|3481521|27|NC_016779|CRT matches to MN693333 (Marine virus AFVG_25M417, complete genome) position: , mismatch: 4, identity: 0.852

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggagctactggccctcaaggtgc	Protospacer
****** ******** ********.*.

195. spacer 5.5|3481521|27|NC_016779|CRT matches to NC_024210 (Escherichia phage e4/1c, complete genome) position: , mismatch: 4, identity: 0.852

tactggcgctactggacctcaaggcgt	CRISPR spacer
tcctggcgatactgggcctcaaggcga	Protospacer
* ****** ******.**********

196. spacer 5.6|3481566|27|NC_016779|CRT matches to MN693092 (Marine virus AFVG_25M37, complete genome) position: , mismatch: 4, identity: 0.852

tactggcgctactggacctcagggtgt	CRISPR spacer
aactggtgctactggacctcaaggtgc	Protospacer
 *****.**************.****.

197. spacer 5.7|3481611|27|NC_016779|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 4, identity: 0.852

taccggtgccactggacctcaaggtat	CRISPR spacer
tactggtgcaactggacctcaaggttc	Protospacer
***.***** *************** .

198. spacer 5.7|3481611|27|NC_016779|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

taccggtgccactggacctcaaggtat	CRISPR spacer
tactggtgcaactggacctcaaggttc	Protospacer
***.***** *************** .

199. spacer 5.8|3481656|27|NC_016779|CRT matches to MN693092 (Marine virus AFVG_25M37, complete genome) position: , mismatch: 4, identity: 0.852

tactggcgctactggacctcaaggcgt	CRISPR spacer
aactggtgctactggacctcaaggtgc	Protospacer
 *****.*****************.*.

200. spacer 5.8|3481656|27|NC_016779|CRT matches to AP014301 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S28-C84, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggtgctactggccctcaaggccc	Protospacer
******.******** ********* .

201. spacer 5.8|3481656|27|NC_016779|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 4, identity: 0.852

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggcgctacaggtcctcaaggtga	Protospacer
************ ** ********.*

202. spacer 5.8|3481656|27|NC_016779|CRT matches to MN693405 (Marine virus AFVG_25M416, complete genome) position: , mismatch: 4, identity: 0.852

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggagctactggccctcaaggtgc	Protospacer
****** ******** ********.*.

203. spacer 5.8|3481656|27|NC_016779|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 4, identity: 0.852

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggcgctacaggtcctcaaggtga	Protospacer
************ ** ********.*

204. spacer 5.8|3481656|27|NC_016779|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 4, identity: 0.852

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggcgctacaggtcctcaaggtga	Protospacer
************ ** ********.*

205. spacer 5.8|3481656|27|NC_016779|CRT matches to MN693333 (Marine virus AFVG_25M417, complete genome) position: , mismatch: 4, identity: 0.852

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggagctactggccctcaaggtgc	Protospacer
****** ******** ********.*.

206. spacer 5.8|3481656|27|NC_016779|CRT matches to NC_024210 (Escherichia phage e4/1c, complete genome) position: , mismatch: 4, identity: 0.852

tactggcgctactggacctcaaggcgt	CRISPR spacer
tcctggcgatactgggcctcaaggcga	Protospacer
* ****** ******.**********

207. spacer 5.9|3481701|27|NC_016779|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 4, identity: 0.852

tactggtgccactggacctcaaggtgt	CRISPR spacer
tactggtgccaccggtcctcaaggtcc	Protospacer
************.** ********* .

208. spacer 5.9|3481701|27|NC_016779|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 4, identity: 0.852

tactggtgccactggacctcaaggtgt	CRISPR spacer
tactggtgccaccggtcctcaaggtcc	Protospacer
************.** ********* .

209. spacer 5.9|3481701|27|NC_016779|CRT matches to MK521907 (Klebsiella phage vB_KpnS_FZ41, complete genome) position: , mismatch: 4, identity: 0.852

tactggtgccactggacctcaaggtgt	CRISPR spacer
tactggtgctactggtcctcaaggtcc	Protospacer
*********.***** ********* .

210. spacer 5.9|3481701|27|NC_016779|CRT matches to MT724048 (Staphylococcus phage SAP3, partial genome) position: , mismatch: 4, identity: 0.852

tactggtgccactggacctcaaggtgt	CRISPR spacer
tactggagccactggacctaaaggaga	Protospacer
****** ************ **** *

211. spacer 5.10|3481746|27|NC_016779|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

taccggtgccactggacctcaaggtgt	CRISPR spacer
tactggtgcaactggacctcaaggttc	Protospacer
***.***** *************** .

212. spacer 5.10|3481746|27|NC_016779|CRT matches to MN693092 (Marine virus AFVG_25M37, complete genome) position: , mismatch: 4, identity: 0.852

taccggtgccactggacctcaaggtgt	CRISPR spacer
aactggtgctactggacctcaaggtgc	Protospacer
 **.*****.****************.

213. spacer 5.10|3481746|27|NC_016779|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 4, identity: 0.852

taccggtgccactggacctcaaggtgt	CRISPR spacer
tactggtgcaactggacctcaaggttc	Protospacer
***.***** *************** .

214. spacer 5.11|3481791|27|NC_016779|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 4, identity: 0.852

taccggtgctactggacctcaaggtgt	CRISPR spacer
tactggtgcaactggacctcaaggttc	Protospacer
***.***** *************** .

215. spacer 5.11|3481791|27|NC_016779|CRT matches to HQ615693 (Synechococcus phage S-CRM01, complete genome) position: , mismatch: 4, identity: 0.852

taccggtgctactggacctcaaggtgt	CRISPR spacer
tcaaggtgatactggacctcaaggtgt	Protospacer
*   **** ******************

216. spacer 5.11|3481791|27|NC_016779|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

taccggtgctactggacctcaaggtgt	CRISPR spacer
tactggtgcaactggacctcaaggttc	Protospacer
***.***** *************** .

217. spacer 5.11|3481791|27|NC_016779|CRT matches to MK521907 (Klebsiella phage vB_KpnS_FZ41, complete genome) position: , mismatch: 4, identity: 0.852

taccggtgctactggacctcaaggtgt	CRISPR spacer
tactggtgctactggtcctcaaggtcc	Protospacer
***.*********** ********* .

218. spacer 5.12|3481836|27|NC_016779|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 4, identity: 0.852

taccggtgctactggacctcaaggtgt	CRISPR spacer
tactggtgcaactggacctcaaggttc	Protospacer
***.***** *************** .

219. spacer 5.12|3481836|27|NC_016779|CRT matches to HQ615693 (Synechococcus phage S-CRM01, complete genome) position: , mismatch: 4, identity: 0.852

taccggtgctactggacctcaaggtgt	CRISPR spacer
tcaaggtgatactggacctcaaggtgt	Protospacer
*   **** ******************

220. spacer 5.12|3481836|27|NC_016779|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

taccggtgctactggacctcaaggtgt	CRISPR spacer
tactggtgcaactggacctcaaggttc	Protospacer
***.***** *************** .

221. spacer 5.12|3481836|27|NC_016779|CRT matches to MK521907 (Klebsiella phage vB_KpnS_FZ41, complete genome) position: , mismatch: 4, identity: 0.852

taccggtgctactggacctcaaggtgt	CRISPR spacer
tactggtgctactggtcctcaaggtcc	Protospacer
***.*********** ********* .

222. spacer 5.13|3481881|27|NC_016779|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

taccggtgccactggacctcaaggtgt	CRISPR spacer
tactggtgcaactggacctcaaggttc	Protospacer
***.***** *************** .

223. spacer 5.13|3481881|27|NC_016779|CRT matches to MN693092 (Marine virus AFVG_25M37, complete genome) position: , mismatch: 4, identity: 0.852

taccggtgccactggacctcaaggtgt	CRISPR spacer
aactggtgctactggacctcaaggtgc	Protospacer
 **.*****.****************.

224. spacer 5.13|3481881|27|NC_016779|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 4, identity: 0.852

taccggtgccactggacctcaaggtgt	CRISPR spacer
tactggtgcaactggacctcaaggttc	Protospacer
***.***** *************** .

225. spacer 5.14|3481926|27|NC_016779|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

tactggtgccactggacctcaaggtgc	CRISPR spacer
aactggtgctactggacctcaaggacc	Protospacer
 ********.**************  *

226. spacer 5.14|3481926|27|NC_016779|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 4, identity: 0.852

tactggtgccactggacctcaaggtgc	CRISPR spacer
aactggtgctactggacctcaaggacc	Protospacer
 ********.**************  *

227. spacer 5.14|3481926|27|NC_016779|CRT matches to MN693099 (Marine virus AFVG_25M184, complete genome) position: , mismatch: 4, identity: 0.852

tactggtgccactggacctcaaggtgc	CRISPR spacer
aactggtgctactggacctcaaggacc	Protospacer
 ********.**************  *

228. spacer 5.14|3481926|27|NC_016779|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 4, identity: 0.852

tactggtgccactggacctcaaggtgc	CRISPR spacer
aactggtgctactggaccccaaggttc	Protospacer
 ********.********.****** *

229. spacer 5.14|3481926|27|NC_016779|CRT matches to AP013959 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S31-C107, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

tactggtgccactggacctcaaggtgc	CRISPR spacer
aactggtgctactggccctcaaggtcc	Protospacer
 ********.***** ********* *

230. spacer 5.14|3481926|27|NC_016779|CRT matches to AP013565 (Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5F-MedDCM-OCT-S40-C10, *** SEQUENCING IN PROGRESS ***, 2 ordered pieces) position: , mismatch: 4, identity: 0.852

tactggtgccactggacctcaaggtgc	CRISPR spacer
aactggtgctactggccctcaaggtcc	Protospacer
 ********.***** ********* *

231. spacer 5.14|3481926|27|NC_016779|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 4, identity: 0.852

tactggtgccactggacctcaaggtgc	CRISPR spacer
aactggtgctactggaccccaaggttc	Protospacer
 ********.********.****** *

232. spacer 5.14|3481926|27|NC_016779|CRT matches to MT724048 (Staphylococcus phage SAP3, partial genome) position: , mismatch: 4, identity: 0.852

tactggtgccactggacctcaaggtgc	CRISPR spacer
tactggagccactggacctaaaggaga	Protospacer
****** ************ **** *

233. spacer 5.14|3481926|27|NC_016779|CRT matches to AP013956 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S27-C232, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

tactggtgccactggacctcaaggtgc	CRISPR spacer
aactggtgctactggccctcaaggtcc	Protospacer
 ********.***** ********* *

234. spacer 5.14|3481926|27|NC_016779|CRT matches to AP014301 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S28-C84, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

tactggtgccactggacctcaaggtgc	CRISPR spacer
tactggtgctactggccctcaaggccc	Protospacer
*********.***** ********. *

235. spacer 5.14|3481926|27|NC_016779|CRT matches to AP013963 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S38-C146, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

tactggtgccactggacctcaaggtgc	CRISPR spacer
aactggtgctactggccctcaaggtcc	Protospacer
 ********.***** ********* *

236. spacer 5.14|3481926|27|NC_016779|CRT matches to AP013961 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S34-C156, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

tactggtgccactggacctcaaggtgc	CRISPR spacer
aactggtgctactggccctcaaggtcc	Protospacer
 ********.***** ********* *

237. spacer 5.16|3482007|27|NC_016779|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 4, identity: 0.852

tactggcgctactggacctcaaggtgc	CRISPR spacer
aactggtgctactggaccccaaggttc	Protospacer
 *****.***********.****** *

238. spacer 5.16|3482007|27|NC_016779|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 4, identity: 0.852

tactggcgctactggacctcaaggtgc	CRISPR spacer
aactggtgctactggaccccaaggttc	Protospacer
 *****.***********.****** *

239. spacer 5.16|3482007|27|NC_016779|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

tactggcgctactggacctcaaggtgc	CRISPR spacer
aactggtgctactggacctcaaggacc	Protospacer
 *****.*****************  *

240. spacer 5.16|3482007|27|NC_016779|CRT matches to MN693099 (Marine virus AFVG_25M184, complete genome) position: , mismatch: 4, identity: 0.852

tactggcgctactggacctcaaggtgc	CRISPR spacer
aactggtgctactggacctcaaggacc	Protospacer
 *****.*****************  *

241. spacer 5.16|3482007|27|NC_016779|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 4, identity: 0.852

tactggcgctactggacctcaaggtgc	CRISPR spacer
aactggtgctactggacctcaaggacc	Protospacer
 *****.*****************  *

242. spacer 5.16|3482007|27|NC_016779|CRT matches to AP013959 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S31-C107, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

tactggcgctactggacctcaaggtgc	CRISPR spacer
aactggtgctactggccctcaaggtcc	Protospacer
 *****.******** ********* *

243. spacer 5.16|3482007|27|NC_016779|CRT matches to AP013565 (Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5F-MedDCM-OCT-S40-C10, *** SEQUENCING IN PROGRESS ***, 2 ordered pieces) position: , mismatch: 4, identity: 0.852

tactggcgctactggacctcaaggtgc	CRISPR spacer
aactggtgctactggccctcaaggtcc	Protospacer
 *****.******** ********* *

244. spacer 5.16|3482007|27|NC_016779|CRT matches to AP013956 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S27-C232, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

tactggcgctactggacctcaaggtgc	CRISPR spacer
aactggtgctactggccctcaaggtcc	Protospacer
 *****.******** ********* *

245. spacer 5.16|3482007|27|NC_016779|CRT matches to AP014301 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S28-C84, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

tactggcgctactggacctcaaggtgc	CRISPR spacer
tactggtgctactggccctcaaggccc	Protospacer
******.******** ********. *

246. spacer 5.16|3482007|27|NC_016779|CRT matches to AP013963 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S38-C146, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

tactggcgctactggacctcaaggtgc	CRISPR spacer
aactggtgctactggccctcaaggtcc	Protospacer
 *****.******** ********* *

247. spacer 5.16|3482007|27|NC_016779|CRT matches to AP013961 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S34-C156, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

tactggcgctactggacctcaaggtgc	CRISPR spacer
aactggtgctactggccctcaaggtcc	Protospacer
 *****.******** ********* *

248. spacer 2.4|1382941|27|NC_016779|CRT matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 5, identity: 0.815

gtccttgagcccccgtagcaccagtag	CRISPR spacer
cacctgtagcccccgtagcaccagtcg	Protospacer
  ***  ****************** *

249. spacer 2.4|1382941|27|NC_016779|CRT matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 5, identity: 0.815

gtccttgagcccccgtagcaccagtag	CRISPR spacer
cacctgtagcccccgtagcaccagtcg	Protospacer
  ***  ****************** *

250. spacer 2.4|1382941|27|NC_016779|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 5, identity: 0.815

gtccttgagcccccgtagcaccagtag	CRISPR spacer
caccttgagcgccagtagcaccagtgg	Protospacer
  ******** ** ***********.*

251. spacer 2.4|1382941|27|NC_016779|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 5, identity: 0.815

gtccttgagcccccgtagcaccagtag	CRISPR spacer
caccttgagcgccagtagcaccagtgg	Protospacer
  ******** ** ***********.*

252. spacer 2.4|1382941|27|NC_016779|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 5, identity: 0.815

gtccttgagcccccgtagcaccagtag	CRISPR spacer
caccttgagcgccagtagcaccagtgg	Protospacer
  ******** ** ***********.*

253. spacer 2.4|1382941|27|NC_016779|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 5, identity: 0.815

gtccttgagcccccgtagcaccagtag	CRISPR spacer
caccttgagcgccagtagcaccagtgg	Protospacer
  ******** ** ***********.*

254. spacer 2.5|1382995|27|NC_016779|CRT matches to MN692989 (Marine virus AFVG_117M66, complete genome) position: , mismatch: 5, identity: 0.815

gtccttgagcacctgtagcgccagtag	CRISPR spacer
cgccagcagcacctgtagcgccagtag	Protospacer
  **   ********************

255. spacer 2.5|1382995|27|NC_016779|CRT matches to MK514281 (Erwinia phage Rebecca, complete genome) position: , mismatch: 5, identity: 0.815

gtccttgagcacctgtagcgccagtag	CRISPR spacer
cacctttagcacctgttgcgccagtat	Protospacer
  **** ********* *********

256. spacer 2.5|1382995|27|NC_016779|CRT matches to NZ_CP046295 (Acinetobacter lwoffii strain FDAARGOS_552 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

gtccttgagcacctgtagcgccagtag	CRISPR spacer
tagcttgagcaccagtagcgccagcag	Protospacer
   ********** **********.**

257. spacer 2.10|1383247|27|NC_016779|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 5, identity: 0.815

gcccttgaggtccagtagcgccagtag	CRISPR spacer
aaccttggggtccagtagcaccagttg	Protospacer
. *****.***********.***** *

258. spacer 2.10|1383247|27|NC_016779|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 5, identity: 0.815

gcccttgaggtccagtagcgccagtag	CRISPR spacer
aaccttggggtccagtagcaccagttg	Protospacer
. *****.***********.***** *

259. spacer 2.10|1383247|27|NC_016779|CRT matches to NC_019958 (Mycobacterium sp. JS623 plasmid pMYCSM02, complete sequence) position: , mismatch: 5, identity: 0.815

gcccttgaggtccagtagcgccagtag	CRISPR spacer
gcccttgaggtcgaggagcgccagctt	Protospacer
************ ** ********.

260. spacer 2.11|1383301|27|NC_016779|CRT matches to MN692989 (Marine virus AFVG_117M66, complete genome) position: , mismatch: 5, identity: 0.815

gtccttgagcacctgtagcgccagtag	CRISPR spacer
cgccagcagcacctgtagcgccagtag	Protospacer
  **   ********************

261. spacer 2.11|1383301|27|NC_016779|CRT matches to MK514281 (Erwinia phage Rebecca, complete genome) position: , mismatch: 5, identity: 0.815

gtccttgagcacctgtagcgccagtag	CRISPR spacer
cacctttagcacctgttgcgccagtat	Protospacer
  **** ********* *********

262. spacer 2.11|1383301|27|NC_016779|CRT matches to NZ_CP046295 (Acinetobacter lwoffii strain FDAARGOS_552 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

gtccttgagcacctgtagcgccagtag	CRISPR spacer
tagcttgagcaccagtagcgccagcag	Protospacer
   ********** **********.**

263. spacer 2.12|1383355|27|NC_016779|CRT matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 5, identity: 0.815

gtccttgagcccccgtagcaccagtag	CRISPR spacer
cacctgtagcccccgtagcaccagtcg	Protospacer
  ***  ****************** *

264. spacer 2.12|1383355|27|NC_016779|CRT matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 5, identity: 0.815

gtccttgagcccccgtagcaccagtag	CRISPR spacer
cacctgtagcccccgtagcaccagtcg	Protospacer
  ***  ****************** *

265. spacer 2.12|1383355|27|NC_016779|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 5, identity: 0.815

gtccttgagcccccgtagcaccagtag	CRISPR spacer
caccttgagcgccagtagcaccagtgg	Protospacer
  ******** ** ***********.*

266. spacer 2.12|1383355|27|NC_016779|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 5, identity: 0.815

gtccttgagcccccgtagcaccagtag	CRISPR spacer
caccttgagcgccagtagcaccagtgg	Protospacer
  ******** ** ***********.*

267. spacer 2.12|1383355|27|NC_016779|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 5, identity: 0.815

gtccttgagcccccgtagcaccagtag	CRISPR spacer
caccttgagcgccagtagcaccagtgg	Protospacer
  ******** ** ***********.*

268. spacer 2.12|1383355|27|NC_016779|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 5, identity: 0.815

gtccttgagcccccgtagcaccagtag	CRISPR spacer
caccttgagcgccagtagcaccagtgg	Protospacer
  ******** ** ***********.*

269. spacer 2.15|1383526|27|NC_016779|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 5, identity: 0.815

cacctgtagcgccagtagcaccagcag	CRISPR spacer
gacctgtagcgccagtagcacctaaac	Protospacer
 ********************* . *

270. spacer 2.15|1383526|27|NC_016779|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 5, identity: 0.815

cacctgtagcgccagtagcaccagcag	CRISPR spacer
caccagtagcgccagtagcaccaatta	Protospacer
**** ******************.. .

271. spacer 2.15|1383526|27|NC_016779|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 5, identity: 0.815

cacctgtagcgccagtagcaccagcag	CRISPR spacer
gacctgtagcaccagtagcacctgtac	Protospacer
 *********.*********** *.*

272. spacer 2.15|1383526|27|NC_016779|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 5, identity: 0.815

cacctgtagcgccagtagcaccagcag	CRISPR spacer
gacctgtagcaccagtagcaccgccac	Protospacer
 *********.***********. **

273. spacer 2.15|1383526|27|NC_016779|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 5, identity: 0.815

cacctgtagcgccagtagcaccagcag	CRISPR spacer
gacctgtagcgccagtagcacctaaac	Protospacer
 ********************* . *

274. spacer 2.15|1383526|27|NC_016779|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 5, identity: 0.815

cacctgtagcgccagtagcaccagcag	CRISPR spacer
gacctgtagcaccagtagcacctgtac	Protospacer
 *********.*********** *.*

275. spacer 2.15|1383526|27|NC_016779|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 5, identity: 0.815

cacctgtagcgccagtagcaccagcag	CRISPR spacer
gacctgtagcaccagtagcaccgccac	Protospacer
 *********.***********. **

276. spacer 2.15|1383526|27|NC_016779|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 5, identity: 0.815

cacctgtagcgccagtagcaccagcag	CRISPR spacer
caccagtagcgcctgtagcaccaataa	Protospacer
**** ******** *********..*.

277. spacer 2.15|1383526|27|NC_016779|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 5, identity: 0.815

cacctgtagcgccagtagcaccagcag	CRISPR spacer
caccagtagcgcctgtagcaccaataa	Protospacer
**** ******** *********..*.

278. spacer 2.15|1383526|27|NC_016779|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 5, identity: 0.815

cacctgtagcgccagtagcaccagcag	CRISPR spacer
gacctgtagcgccagtagcacctaaac	Protospacer
 ********************* . *

279. spacer 2.15|1383526|27|NC_016779|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 5, identity: 0.815

cacctgtagcgccagtagcaccagcag	CRISPR spacer
gacctgtagcaccagtagcacctgtac	Protospacer
 *********.*********** *.*

280. spacer 2.15|1383526|27|NC_016779|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 5, identity: 0.815

cacctgtagcgccagtagcaccagcag	CRISPR spacer
gacctgtagcaccagtagcaccgccac	Protospacer
 *********.***********. **

281. spacer 2.15|1383526|27|NC_016779|CRT matches to NZ_CP011513 (Paenibacillus peoriae strain HS311 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.815

cacctgtagcgccagtagcaccagcag	CRISPR spacer
cacctgtagctccagtggcaccagtca	Protospacer
********** *****.*******. .

282. spacer 2.15|1383526|27|NC_016779|CRT matches to KJ019095 (Synechococcus phage ACG-2014f isolate Syn7803US34, complete genome) position: , mismatch: 5, identity: 0.815

cacctgtagcgccagtagcaccagcag	CRISPR spacer
cacctgtagcaccagttgcaccacttg	Protospacer
**********.***** ****** . *

283. spacer 2.15|1383526|27|NC_016779|CRT matches to KJ019086 (Synechococcus phage ACG-2014f isolate Syn7803US17, complete genome) position: , mismatch: 5, identity: 0.815

cacctgtagcgccagtagcaccagcag	CRISPR spacer
cacctgtagcaccagttgcaccacttg	Protospacer
**********.***** ****** . *

284. spacer 2.15|1383526|27|NC_016779|CRT matches to KJ019106 (Synechococcus phage ACG-2014f isolate Syn7803US50, complete genome) position: , mismatch: 5, identity: 0.815

cacctgtagcgccagtagcaccagcag	CRISPR spacer
cacctgtagcaccagttgcaccacttg	Protospacer
**********.***** ****** . *

285. spacer 2.15|1383526|27|NC_016779|CRT matches to KJ019107 (Synechococcus phage ACG-2014f isolate Syn7803US52, complete genome) position: , mismatch: 5, identity: 0.815

cacctgtagcgccagtagcaccagcag	CRISPR spacer
cacctgtagcaccagttgcaccacttg	Protospacer
**********.***** ****** . *

286. spacer 2.15|1383526|27|NC_016779|CRT matches to KJ019143 (Synechococcus phage ACG-2014f isolate Syn7803C12, complete genome) position: , mismatch: 5, identity: 0.815

cacctgtagcgccagtagcaccagcag	CRISPR spacer
cacctgtagcaccagttgcaccacttg	Protospacer
**********.***** ****** . *

287. spacer 2.15|1383526|27|NC_016779|CRT matches to KJ019103 (Synechococcus phage ACG-2014f isolate Syn7803US44, complete genome) position: , mismatch: 5, identity: 0.815

cacctgtagcgccagtagcaccagcag	CRISPR spacer
cacctgtagcaccagttgcaccacttg	Protospacer
**********.***** ****** . *

288. spacer 2.15|1383526|27|NC_016779|CRT matches to KJ019102 (Synechococcus phage ACG-2014f isolate Syn7803US43, complete genome) position: , mismatch: 5, identity: 0.815

cacctgtagcgccagtagcaccagcag	CRISPR spacer
cacctgtagcaccagttgcaccacttg	Protospacer
**********.***** ****** . *

289. spacer 2.15|1383526|27|NC_016779|CRT matches to KJ019066 (Synechococcus phage ACG-2014f isolate Syn7803C9, complete genome) position: , mismatch: 5, identity: 0.815

cacctgtagcgccagtagcaccagcag	CRISPR spacer
cacctgtagcaccagttgcaccacttg	Protospacer
**********.***** ****** . *

290. spacer 2.15|1383526|27|NC_016779|CRT matches to KJ019142 (Synechococcus phage ACG-2014f isolate Syn7803C11, complete genome) position: , mismatch: 5, identity: 0.815

cacctgtagcgccagtagcaccagcag	CRISPR spacer
cacctgtagcaccagttgcaccacttg	Protospacer
**********.***** ****** . *

291. spacer 2.15|1383526|27|NC_016779|CRT matches to KJ019149 (Synechococcus phage ACG-2014f isolate Syn7803C21, complete genome) position: , mismatch: 5, identity: 0.815

cacctgtagcgccagtagcaccagcag	CRISPR spacer
cacctgtagcaccagttgcaccacttg	Protospacer
**********.***** ****** . *

292. spacer 2.15|1383526|27|NC_016779|CRT matches to KJ019105 (Synechococcus phage ACG-2014f isolate Syn7803US4, complete genome) position: , mismatch: 5, identity: 0.815

cacctgtagcgccagtagcaccagcag	CRISPR spacer
cacctgtagcaccagttgcaccacttg	Protospacer
**********.***** ****** . *

293. spacer 2.15|1383526|27|NC_016779|CRT matches to KJ019098 (Synechococcus phage ACG-2014f isolate Syn7803US39, complete genome) position: , mismatch: 5, identity: 0.815

cacctgtagcgccagtagcaccagcag	CRISPR spacer
cacctgtagcaccagttgcaccacttg	Protospacer
**********.***** ****** . *

294. spacer 2.15|1383526|27|NC_016779|CRT matches to KJ019159 (Synechococcus phage ACG-2014f isolate Syn7803C34, complete genome) position: , mismatch: 5, identity: 0.815

cacctgtagcgccagtagcaccagcag	CRISPR spacer
cacctgtagcaccagttgcaccacttg	Protospacer
**********.***** ****** . *

295. spacer 2.15|1383526|27|NC_016779|CRT matches to KJ019123 (Synechococcus phage ACG-2014f isolate Syn7803US7, complete genome) position: , mismatch: 5, identity: 0.815

cacctgtagcgccagtagcaccagcag	CRISPR spacer
cacctgtagcaccagttgcaccacttg	Protospacer
**********.***** ****** . *

296. spacer 2.15|1383526|27|NC_016779|CRT matches to KJ019111 (Synechococcus phage ACG-2014f isolate Syn7803US57, complete genome) position: , mismatch: 5, identity: 0.815

cacctgtagcgccagtagcaccagcag	CRISPR spacer
cacctgtagcaccagttgcaccacttg	Protospacer
**********.***** ****** . *

297. spacer 2.15|1383526|27|NC_016779|CRT matches to KJ019148 (Synechococcus phage ACG-2014f isolate Syn7803C19, complete genome) position: , mismatch: 5, identity: 0.815

cacctgtagcgccagtagcaccagcag	CRISPR spacer
cacctgtagcaccagttgcaccacttg	Protospacer
**********.***** ****** . *

298. spacer 2.15|1383526|27|NC_016779|CRT matches to NC_047712 (Synechococcus phage ACG-2014f isolate Syn7803C7, complete genome) position: , mismatch: 5, identity: 0.815

cacctgtagcgccagtagcaccagcag	CRISPR spacer
cacctgtagcaccagttgcaccacttg	Protospacer
**********.***** ****** . *

299. spacer 2.15|1383526|27|NC_016779|CRT matches to KJ019090 (Synechococcus phage ACG-2014f isolate Syn7803US24, complete genome) position: , mismatch: 5, identity: 0.815

cacctgtagcgccagtagcaccagcag	CRISPR spacer
cacctgtagcaccagttgcaccacttg	Protospacer
**********.***** ****** . *

300. spacer 2.15|1383526|27|NC_016779|CRT matches to KJ019146 (Synechococcus phage ACG-2014f isolate Syn7803C16, complete genome) position: , mismatch: 5, identity: 0.815

cacctgtagcgccagtagcaccagcag	CRISPR spacer
cacctgtagcaccagttgcaccacttg	Protospacer
**********.***** ****** . *

301. spacer 2.15|1383526|27|NC_016779|CRT matches to KJ019152 (Synechococcus phage ACG-2014f isolate Syn7803C25, complete genome) position: , mismatch: 5, identity: 0.815

cacctgtagcgccagtagcaccagcag	CRISPR spacer
cacctgtagcaccagttgcaccacttg	Protospacer
**********.***** ****** . *

302. spacer 2.15|1383526|27|NC_016779|CRT matches to KJ019093 (Synechococcus phage ACG-2014f isolate Syn7803US30, complete genome) position: , mismatch: 5, identity: 0.815

cacctgtagcgccagtagcaccagcag	CRISPR spacer
cacctgtagcaccagttgcaccacttg	Protospacer
**********.***** ****** . *

303. spacer 2.15|1383526|27|NC_016779|CRT matches to KJ019151 (Synechococcus phage ACG-2014f isolate Syn7803C24, complete genome) position: , mismatch: 5, identity: 0.815

cacctgtagcgccagtagcaccagcag	CRISPR spacer
cacctgtagcaccagttgcaccacttg	Protospacer
**********.***** ****** . *

304. spacer 2.15|1383526|27|NC_016779|CRT matches to KJ019150 (Synechococcus phage ACG-2014f isolate Syn7803C22, complete genome) position: , mismatch: 5, identity: 0.815

cacctgtagcgccagtagcaccagcag	CRISPR spacer
cacctgtagcaccagttgcaccacttg	Protospacer
**********.***** ****** . *

305. spacer 2.15|1383526|27|NC_016779|CRT matches to NC_026927 (Synechococcus phage ACG-2014f isolate Syn7803C90, complete genome) position: , mismatch: 5, identity: 0.815

cacctgtagcgccagtagcaccagcag	CRISPR spacer
cacctgtagcaccagttgcaccacttg	Protospacer
**********.***** ****** . *

306. spacer 2.15|1383526|27|NC_016779|CRT matches to KJ019097 (Synechococcus phage ACG-2014f isolate Syn7803US37, complete genome) position: , mismatch: 5, identity: 0.815

cacctgtagcgccagtagcaccagcag	CRISPR spacer
cacctgtagcaccagttgcaccacttg	Protospacer
**********.***** ****** . *

307. spacer 2.15|1383526|27|NC_016779|CRT matches to KJ019045 (Synechococcus phage ACG-2014f isolate Syn7803C6, complete genome) position: , mismatch: 5, identity: 0.815

cacctgtagcgccagtagcaccagcag	CRISPR spacer
cacctgtagcaccagttgcaccacttg	Protospacer
**********.***** ****** . *

308. spacer 2.15|1383526|27|NC_016779|CRT matches to KJ019037 (Synechococcus phage ACG-2014f isolate Syn7803C58, complete genome) position: , mismatch: 5, identity: 0.815

cacctgtagcgccagtagcaccagcag	CRISPR spacer
cacctgtagcaccagttgcaccacttg	Protospacer
**********.***** ****** . *

309. spacer 2.15|1383526|27|NC_016779|CRT matches to KJ019099 (Synechococcus phage ACG-2014f isolate Syn7803US3, complete genome) position: , mismatch: 5, identity: 0.815

cacctgtagcgccagtagcaccagcag	CRISPR spacer
cacctgtagcaccagttgcaccacttg	Protospacer
**********.***** ****** . *

310. spacer 2.15|1383526|27|NC_016779|CRT matches to KJ019155 (Synechococcus phage ACG-2014f isolate Syn7803C29, complete genome) position: , mismatch: 5, identity: 0.815

cacctgtagcgccagtagcaccagcag	CRISPR spacer
cacctgtagcaccagttgcaccacttg	Protospacer
**********.***** ****** . *

311. spacer 2.15|1383526|27|NC_016779|CRT matches to KJ019141 (Synechococcus phage ACG-2014f isolate Syn7803C10, complete genome) position: , mismatch: 5, identity: 0.815

cacctgtagcgccagtagcaccagcag	CRISPR spacer
cacctgtagcaccagttgcaccacttg	Protospacer
**********.***** ****** . *

312. spacer 2.15|1383526|27|NC_016779|CRT matches to KJ019053 (Synechococcus phage ACG-2014f isolate Syn7803C80, complete genome) position: , mismatch: 5, identity: 0.815

cacctgtagcgccagtagcaccagcag	CRISPR spacer
cacctgtagcaccagttgcaccacttg	Protospacer
**********.***** ****** . *

313. spacer 2.15|1383526|27|NC_016779|CRT matches to KJ019147 (Synechococcus phage ACG-2014f isolate Syn7803C17, complete genome) position: , mismatch: 5, identity: 0.815

cacctgtagcgccagtagcaccagcag	CRISPR spacer
cacctgtagcaccagttgcaccacttg	Protospacer
**********.***** ****** . *

314. spacer 2.15|1383526|27|NC_016779|CRT matches to KJ019100 (Synechococcus phage ACG-2014f isolate Syn7803US40, complete genome) position: , mismatch: 5, identity: 0.815

cacctgtagcgccagtagcaccagcag	CRISPR spacer
cacctgtagcaccagttgcaccacttg	Protospacer
**********.***** ****** . *

315. spacer 2.15|1383526|27|NC_016779|CRT matches to KJ019101 (Synechococcus phage ACG-2014f isolate Syn7803US42, complete genome) position: , mismatch: 5, identity: 0.815

cacctgtagcgccagtagcaccagcag	CRISPR spacer
cacctgtagcaccagttgcaccacttg	Protospacer
**********.***** ****** . *

316. spacer 2.15|1383526|27|NC_016779|CRT matches to KJ019085 (Synechococcus phage ACG-2014f isolate Syn7803US13, complete genome) position: , mismatch: 5, identity: 0.815

cacctgtagcgccagtagcaccagcag	CRISPR spacer
cacctgtagcaccagttgcaccacttg	Protospacer
**********.***** ****** . *

317. spacer 2.15|1383526|27|NC_016779|CRT matches to KJ019096 (Synechococcus phage ACG-2014f isolate Syn7803US36, complete genome) position: , mismatch: 5, identity: 0.815

cacctgtagcgccagtagcaccagcag	CRISPR spacer
cacctgtagcaccagttgcaccacttg	Protospacer
**********.***** ****** . *

318. spacer 2.15|1383526|27|NC_016779|CRT matches to KJ019091 (Synechococcus phage ACG-2014f isolate Syn7803US26, complete genome) position: , mismatch: 5, identity: 0.815

cacctgtagcgccagtagcaccagcag	CRISPR spacer
cacctgtagcaccagttgcaccacttg	Protospacer
**********.***** ****** . *

319. spacer 2.15|1383526|27|NC_016779|CRT matches to KJ019144 (Synechococcus phage ACG-2014f isolate Syn7803C14, complete genome) position: , mismatch: 5, identity: 0.815

cacctgtagcgccagtagcaccagcag	CRISPR spacer
cacctgtagcaccagttgcaccacttg	Protospacer
**********.***** ****** . *

320. spacer 2.15|1383526|27|NC_016779|CRT matches to KJ019145 (Synechococcus phage ACG-2014f isolate Syn7803C15, complete genome) position: , mismatch: 5, identity: 0.815

cacctgtagcgccagtagcaccagcag	CRISPR spacer
cacctgtagcaccagttgcaccacttg	Protospacer
**********.***** ****** . *

321. spacer 2.15|1383526|27|NC_016779|CRT matches to KJ019058 (Synechococcus phage ACG-2014f isolate Syn7803C8, complete genome) position: , mismatch: 5, identity: 0.815

cacctgtagcgccagtagcaccagcag	CRISPR spacer
cacctgtagcaccagttgcaccacttg	Protospacer
**********.***** ****** . *

322. spacer 2.15|1383526|27|NC_016779|CRT matches to KJ019092 (Synechococcus phage ACG-2014f isolate Syn7803US2, complete genome) position: , mismatch: 5, identity: 0.815

cacctgtagcgccagtagcaccagcag	CRISPR spacer
cacctgtagcaccagttgcaccacttg	Protospacer
**********.***** ****** . *

323. spacer 2.15|1383526|27|NC_016779|CRT matches to MT219824 (Escherichia coli strain RT18-1 plasmid pRT18-1_294k_tetX, complete sequence) position: , mismatch: 5, identity: 0.815

cacctgtagcgccagtagcaccagcag	CRISPR spacer
gacctgttgcgccagtaggaccagtcg	Protospacer
 ****** ********** *****. *

324. spacer 2.15|1383526|27|NC_016779|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 5, identity: 0.815

cacctgtagcgccagtagcaccagcag	CRISPR spacer
aaccagtagcaccagtagcaccagtat	Protospacer
 *** *****.*************.*

325. spacer 2.15|1383526|27|NC_016779|CRT matches to KF800937 (Vibrio phage AS51, complete genome) position: , mismatch: 5, identity: 0.815

cacctgtagcgccagtagcaccagcag	CRISPR spacer
cagaagtagcgccagcagcaccagcac	Protospacer
**   **********.**********

326. spacer 2.15|1383526|27|NC_016779|CRT matches to NC_047815 (Erwinia phage vB_EamM_Yoloswag, complete genome) position: , mismatch: 5, identity: 0.815

cacctgtagcgccagtagcaccagcag	CRISPR spacer
gaccagtagtgccagtagcaccagtcg	Protospacer
 *** ****.**************. *

327. spacer 2.15|1383526|27|NC_016779|CRT matches to KY290756 (Vibrio phage Vp670, complete genome) position: , mismatch: 5, identity: 0.815

cacctgtagcgccagtagcaccagcag	CRISPR spacer
cagaagtagcgccagcagcaccagcac	Protospacer
**   **********.**********

328. spacer 2.15|1383526|27|NC_016779|CRT matches to MN694312 (Marine virus AFVG_250M269, complete genome) position: , mismatch: 5, identity: 0.815

cacctgtagcgccagtagcaccagcag	CRISPR spacer
cccctgtagcaccagtagcaccaagat	Protospacer
* ********.************. *

329. spacer 2.15|1383526|27|NC_016779|CRT matches to KF322026 (Vibrio phage phi-A318, complete genome) position: , mismatch: 5, identity: 0.815

cacctgtagcgccagtagcaccagcag	CRISPR spacer
cagaagtagcgccagcagcaccagcac	Protospacer
**   **********.**********

330. spacer 4.2|3480789|27|NC_016779|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
accacaaggtaatacaggagctactgg	Protospacer
  * ********.***** ********

331. spacer 4.2|3480789|27|NC_016779|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 5, identity: 0.815

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
accacaaggtaatacaggagctactgg	Protospacer
  * ********.***** ********

332. spacer 4.3|3480834|27|NC_016779|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
accacaaggtaatacaggagctactgg	Protospacer
  * ********.***** ********

333. spacer 4.3|3480834|27|NC_016779|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 5, identity: 0.815

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
accacaaggtaatacaggagctactgg	Protospacer
  * ********.***** ********

334. spacer 4.7|3480996|27|NC_016779|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
accacaaggtaatacaggagctactgg	Protospacer
  * ********.***** ********

335. spacer 4.7|3480996|27|NC_016779|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 5, identity: 0.815

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
accacaaggtaatacaggagctactgg	Protospacer
  * ********.***** ********

336. spacer 5.1|3481350|27|NC_016779|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 5, identity: 0.815

tactggtgccactggacctcaaggcgc	CRISPR spacer
aactggtgctactggaccccaaggttc	Protospacer
 ********.********.*****. *

337. spacer 5.1|3481350|27|NC_016779|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 5, identity: 0.815

tactggtgccactggacctcaaggcgc	CRISPR spacer
aactggtgctactggaccccaaggttc	Protospacer
 ********.********.*****. *

338. spacer 5.1|3481350|27|NC_016779|CRT matches to AP013956 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S27-C232, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

tactggtgccactggacctcaaggcgc	CRISPR spacer
aactggtgctactggccctcaaggtcc	Protospacer
 ********.***** ********. *

339. spacer 5.1|3481350|27|NC_016779|CRT matches to AP013963 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S38-C146, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

tactggtgccactggacctcaaggcgc	CRISPR spacer
aactggtgctactggccctcaaggtcc	Protospacer
 ********.***** ********. *

340. spacer 5.1|3481350|27|NC_016779|CRT matches to AP013961 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S34-C156, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

tactggtgccactggacctcaaggcgc	CRISPR spacer
aactggtgctactggccctcaaggtcc	Protospacer
 ********.***** ********. *

341. spacer 5.1|3481350|27|NC_016779|CRT matches to AP013959 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S31-C107, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

tactggtgccactggacctcaaggcgc	CRISPR spacer
aactggtgctactggccctcaaggtcc	Protospacer
 ********.***** ********. *

342. spacer 5.1|3481350|27|NC_016779|CRT matches to AP013565 (Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5F-MedDCM-OCT-S40-C10, *** SEQUENCING IN PROGRESS ***, 2 ordered pieces) position: , mismatch: 5, identity: 0.815

tactggtgccactggacctcaaggcgc	CRISPR spacer
aactggtgctactggccctcaaggtcc	Protospacer
 ********.***** ********. *

343. spacer 5.2|3481395|27|NC_016779|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
aactggtgctactggacctcaaggacc	Protospacer
 *****.*****************  .

344. spacer 5.2|3481395|27|NC_016779|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggtgcaactggacctcaaggttc	Protospacer
******.** **************. .

345. spacer 5.2|3481395|27|NC_016779|CRT matches to MN693099 (Marine virus AFVG_25M184, complete genome) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
aactggtgctactggacctcaaggacc	Protospacer
 *****.*****************  .

346. spacer 5.2|3481395|27|NC_016779|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
aactggtgctactggacctcaaggacc	Protospacer
 *****.*****************  .

347. spacer 5.2|3481395|27|NC_016779|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggtgcaactggacctcaaggttc	Protospacer
******.** **************. .

348. spacer 5.2|3481395|27|NC_016779|CRT matches to MH884513 (Bacillus phage vB_BpsS-36, complete genome) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggagctactggtcctcaaggtcc	Protospacer
****** ******** ********. .

349. spacer 5.2|3481395|27|NC_016779|CRT matches to NZ_CP022543 (Antarctobacter heliothermus strain SMS3 plasmid pSMS3-3, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
cgctggcgctgctggacctcgaggcgc	Protospacer
..********.*********.*****.

350. spacer 5.2|3481395|27|NC_016779|CRT matches to MK521907 (Klebsiella phage vB_KpnS_FZ41, complete genome) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggtgctactggtcctcaaggtcc	Protospacer
******.******** ********. .

351. spacer 5.2|3481395|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

352. spacer 5.2|3481395|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

353. spacer 5.2|3481395|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

354. spacer 5.2|3481395|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

355. spacer 5.2|3481395|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

356. spacer 5.2|3481395|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

357. spacer 5.2|3481395|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

358. spacer 5.2|3481395|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

359. spacer 5.2|3481395|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

360. spacer 5.2|3481395|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

361. spacer 5.2|3481395|27|NC_016779|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

362. spacer 5.2|3481395|27|NC_016779|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

363. spacer 5.2|3481395|27|NC_016779|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

364. spacer 5.2|3481395|27|NC_016779|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

365. spacer 5.3|3481440|27|NC_016779|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
aactggtgctactggacctcaaggacc	Protospacer
 *****.*****************  .

366. spacer 5.3|3481440|27|NC_016779|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggtgcaactggacctcaaggttc	Protospacer
******.** **************. .

367. spacer 5.3|3481440|27|NC_016779|CRT matches to MN693099 (Marine virus AFVG_25M184, complete genome) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
aactggtgctactggacctcaaggacc	Protospacer
 *****.*****************  .

368. spacer 5.3|3481440|27|NC_016779|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
aactggtgctactggacctcaaggacc	Protospacer
 *****.*****************  .

369. spacer 5.3|3481440|27|NC_016779|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggtgcaactggacctcaaggttc	Protospacer
******.** **************. .

370. spacer 5.3|3481440|27|NC_016779|CRT matches to MH884513 (Bacillus phage vB_BpsS-36, complete genome) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggagctactggtcctcaaggtcc	Protospacer
****** ******** ********. .

371. spacer 5.3|3481440|27|NC_016779|CRT matches to NZ_CP022543 (Antarctobacter heliothermus strain SMS3 plasmid pSMS3-3, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
cgctggcgctgctggacctcgaggcgc	Protospacer
..********.*********.*****.

372. spacer 5.3|3481440|27|NC_016779|CRT matches to MK521907 (Klebsiella phage vB_KpnS_FZ41, complete genome) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggtgctactggtcctcaaggtcc	Protospacer
******.******** ********. .

373. spacer 5.3|3481440|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

374. spacer 5.3|3481440|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

375. spacer 5.3|3481440|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

376. spacer 5.3|3481440|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

377. spacer 5.3|3481440|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

378. spacer 5.3|3481440|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

379. spacer 5.3|3481440|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

380. spacer 5.3|3481440|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

381. spacer 5.3|3481440|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

382. spacer 5.3|3481440|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

383. spacer 5.3|3481440|27|NC_016779|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

384. spacer 5.3|3481440|27|NC_016779|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

385. spacer 5.3|3481440|27|NC_016779|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

386. spacer 5.3|3481440|27|NC_016779|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

387. spacer 5.5|3481521|27|NC_016779|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
aactggtgctactggacctcaaggacc	Protospacer
 *****.*****************  .

388. spacer 5.5|3481521|27|NC_016779|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggtgcaactggacctcaaggttc	Protospacer
******.** **************. .

389. spacer 5.5|3481521|27|NC_016779|CRT matches to MN693099 (Marine virus AFVG_25M184, complete genome) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
aactggtgctactggacctcaaggacc	Protospacer
 *****.*****************  .

390. spacer 5.5|3481521|27|NC_016779|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
aactggtgctactggacctcaaggacc	Protospacer
 *****.*****************  .

391. spacer 5.5|3481521|27|NC_016779|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggtgcaactggacctcaaggttc	Protospacer
******.** **************. .

392. spacer 5.5|3481521|27|NC_016779|CRT matches to MH884513 (Bacillus phage vB_BpsS-36, complete genome) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggagctactggtcctcaaggtcc	Protospacer
****** ******** ********. .

393. spacer 5.5|3481521|27|NC_016779|CRT matches to NZ_CP022543 (Antarctobacter heliothermus strain SMS3 plasmid pSMS3-3, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
cgctggcgctgctggacctcgaggcgc	Protospacer
..********.*********.*****.

394. spacer 5.5|3481521|27|NC_016779|CRT matches to MK521907 (Klebsiella phage vB_KpnS_FZ41, complete genome) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggtgctactggtcctcaaggtcc	Protospacer
******.******** ********. .

395. spacer 5.5|3481521|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

396. spacer 5.5|3481521|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

397. spacer 5.5|3481521|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

398. spacer 5.5|3481521|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

399. spacer 5.5|3481521|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

400. spacer 5.5|3481521|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

401. spacer 5.5|3481521|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

402. spacer 5.5|3481521|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

403. spacer 5.5|3481521|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

404. spacer 5.5|3481521|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

405. spacer 5.5|3481521|27|NC_016779|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

406. spacer 5.5|3481521|27|NC_016779|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

407. spacer 5.5|3481521|27|NC_016779|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

408. spacer 5.5|3481521|27|NC_016779|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

409. spacer 5.6|3481566|27|NC_016779|CRT matches to MN586053 (Arthrobacter phage BeatusComedenti, complete genome) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcagggtgt	CRISPR spacer
gaccggcgccactggacctcagggtcc	Protospacer
 **.*****.*************** .

410. spacer 5.6|3481566|27|NC_016779|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcagggtgt	CRISPR spacer
cactggtgctactggtcctcagggtaa	Protospacer
.*****.******** *********.

411. spacer 5.6|3481566|27|NC_016779|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcagggtgt	CRISPR spacer
tactggtgctactggaccgcagggacc	Protospacer
******.*********** *****  .

412. spacer 5.6|3481566|27|NC_016779|CRT matches to GU323708 (Lactobacillus phage phiPYB5, complete genome) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcagggtgt	CRISPR spacer
tactggtgctactggaccacaggggcc	Protospacer
******.*********** *****  .

413. spacer 5.6|3481566|27|NC_016779|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcagggtgt	CRISPR spacer
cactggtgctactggtcctcagggtaa	Protospacer
.*****.******** *********.

414. spacer 5.6|3481566|27|NC_016779|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcagggtgt	CRISPR spacer
tactggtgctactggaccgcagggacc	Protospacer
******.*********** *****  .

415. spacer 5.6|3481566|27|NC_016779|CRT matches to MN101228 (Klebsiella phage KPN4, complete genome) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcagggtgt	CRISPR spacer
aactggtgctactggtcctcagggtcc	Protospacer
 *****.******** ********* .

416. spacer 5.6|3481566|27|NC_016779|CRT matches to NC_031231 (Arthrobacter phage KellEzio, complete genome) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcagggtgt	CRISPR spacer
gaccggcgccactggacctcagggtcc	Protospacer
 **.*****.*************** .

417. spacer 5.6|3481566|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcagggtgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

418. spacer 5.6|3481566|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcagggtgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

419. spacer 5.6|3481566|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcagggtgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

420. spacer 5.6|3481566|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcagggtgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

421. spacer 5.6|3481566|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcagggtgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

422. spacer 5.6|3481566|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcagggtgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

423. spacer 5.6|3481566|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcagggtgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

424. spacer 5.6|3481566|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcagggtgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

425. spacer 5.6|3481566|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcagggtgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

426. spacer 5.6|3481566|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcagggtgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

427. spacer 5.6|3481566|27|NC_016779|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcagggtgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

428. spacer 5.6|3481566|27|NC_016779|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcagggtgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

429. spacer 5.6|3481566|27|NC_016779|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcagggtgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

430. spacer 5.6|3481566|27|NC_016779|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcagggtgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

431. spacer 5.7|3481611|27|NC_016779|CRT matches to MN497953 (Mycobacterium phage GtownJaz, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgccactggacctcaaggtat	CRISPR spacer
taccggtgccactggtgctcaaggccc	Protospacer
***************  *******. .

432. spacer 5.7|3481611|27|NC_016779|CRT matches to MN586053 (Arthrobacter phage BeatusComedenti, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgccactggacctcaaggtat	CRISPR spacer
gaccggcgccactggacctcagggtcc	Protospacer
 *****.**************.*** .

433. spacer 5.7|3481611|27|NC_016779|CRT matches to MH020238 (Mycobacterium phage Lilith, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgccactggacctcaaggtat	CRISPR spacer
taccggtgccactggtgctcaaggccc	Protospacer
***************  *******. .

434. spacer 5.7|3481611|27|NC_016779|CRT matches to MH077583 (Mycobacterium phage PGHhamlin, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgccactggacctcaaggtat	CRISPR spacer
taccggtgccactggtgctcaaggccc	Protospacer
***************  *******. .

435. spacer 5.7|3481611|27|NC_016779|CRT matches to MH727554 (Mycobacterium phage MuchMore, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgccactggacctcaaggtat	CRISPR spacer
taccggtgccactggtgctcaaggccc	Protospacer
***************  *******. .

436. spacer 5.7|3481611|27|NC_016779|CRT matches to MH338240 (Mycobacterium phage Sabia, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgccactggacctcaaggtat	CRISPR spacer
taccggtgccactggtgctcaaggccc	Protospacer
***************  *******. .

437. spacer 5.7|3481611|27|NC_016779|CRT matches to KM233455 (Mycobacterium phage Farber, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgccactggacctcaaggtat	CRISPR spacer
taccggtgccactggtgctcaaggccc	Protospacer
***************  *******. .

438. spacer 5.7|3481611|27|NC_016779|CRT matches to KX664448 (Mycobacterium phage Watson, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgccactggacctcaaggtat	CRISPR spacer
taccggtgccactggtgctcaaggccc	Protospacer
***************  *******. .

439. spacer 5.7|3481611|27|NC_016779|CRT matches to KX507362 (Mycobacterium phage Aglet, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgccactggacctcaaggtat	CRISPR spacer
taccggtgccactggtgctcaaggccc	Protospacer
***************  *******. .

440. spacer 5.7|3481611|27|NC_016779|CRT matches to MN693092 (Marine virus AFVG_25M37, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgccactggacctcaaggtat	CRISPR spacer
aactggtgctactggacctcaaggtgc	Protospacer
 **.*****.***************..

441. spacer 5.7|3481611|27|NC_016779|CRT matches to MH576949 (Mycobacterium phage BreSam8, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgccactggacctcaaggtat	CRISPR spacer
taccggtgccactggtgctcaaggccc	Protospacer
***************  *******. .

442. spacer 5.7|3481611|27|NC_016779|CRT matches to MN585969 (Mycobacterium phage Dieselweasel, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgccactggacctcaaggtat	CRISPR spacer
taccggtgccactggtgctcaaggccc	Protospacer
***************  *******. .

443. spacer 5.7|3481611|27|NC_016779|CRT matches to MH536813 (Mycobacterium phage AugsMagnumOpus, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgccactggacctcaaggtat	CRISPR spacer
taccggtgccactggtgctcaaggccc	Protospacer
***************  *******. .

444. spacer 5.7|3481611|27|NC_016779|CRT matches to MF185733 (Mycobacterium phage StepMih, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgccactggacctcaaggtat	CRISPR spacer
taccggtgccactggtgctcaaggccc	Protospacer
***************  *******. .

445. spacer 5.7|3481611|27|NC_016779|CRT matches to MF185732 (Mycobacterium phage Stagni, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgccactggacctcaaggtat	CRISPR spacer
taccggtgccactggtgctcaaggccc	Protospacer
***************  *******. .

446. spacer 5.7|3481611|27|NC_016779|CRT matches to MK494096 (Mycobacterium phage Mainiac, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgccactggacctcaaggtat	CRISPR spacer
taccggtgccactggtgctcaaggccc	Protospacer
***************  *******. .

447. spacer 5.7|3481611|27|NC_016779|CRT matches to KU984914 (Mycobacterium phage Malinsilva, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgccactggacctcaaggtat	CRISPR spacer
taccggtgccactggtgctcaaggccc	Protospacer
***************  *******. .

448. spacer 5.7|3481611|27|NC_016779|CRT matches to JF704101 (Mycobacterium virus Microwolf, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgccactggacctcaaggtat	CRISPR spacer
taccggtgccactggtgctcaaggccc	Protospacer
***************  *******. .

449. spacer 5.7|3481611|27|NC_016779|CRT matches to KT359365 (Mycobacterium phage DaHudson, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgccactggacctcaaggtat	CRISPR spacer
taccggtgccactggtgctcaaggccc	Protospacer
***************  *******. .

450. spacer 5.7|3481611|27|NC_016779|CRT matches to MH651179 (Mycobacterium phage MadMarie, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgccactggacctcaaggtat	CRISPR spacer
taccggtgccactggtgctcaaggccc	Protospacer
***************  *******. .

451. spacer 5.7|3481611|27|NC_016779|CRT matches to NC_028798 (Mycobacterium phage MarQuardt, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgccactggacctcaaggtat	CRISPR spacer
taccggtgccactggtgctcaaggccc	Protospacer
***************  *******. .

452. spacer 5.7|3481611|27|NC_016779|CRT matches to NC_031231 (Arthrobacter phage KellEzio, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgccactggacctcaaggtat	CRISPR spacer
gaccggcgccactggacctcagggtcc	Protospacer
 *****.**************.*** .

453. spacer 5.7|3481611|27|NC_016779|CRT matches to MK373793 (Escherichia phage vB_EcoS_MM01, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgccactggacctcaaggtat	CRISPR spacer
aaaaggtgacactggacctcagggtat	Protospacer
 *  **** ************.*****

454. spacer 5.8|3481656|27|NC_016779|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
aactggtgctactggacctcaaggacc	Protospacer
 *****.*****************  .

455. spacer 5.8|3481656|27|NC_016779|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggtgcaactggacctcaaggttc	Protospacer
******.** **************. .

456. spacer 5.8|3481656|27|NC_016779|CRT matches to MN693099 (Marine virus AFVG_25M184, complete genome) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
aactggtgctactggacctcaaggacc	Protospacer
 *****.*****************  .

457. spacer 5.8|3481656|27|NC_016779|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
aactggtgctactggacctcaaggacc	Protospacer
 *****.*****************  .

458. spacer 5.8|3481656|27|NC_016779|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggtgcaactggacctcaaggttc	Protospacer
******.** **************. .

459. spacer 5.8|3481656|27|NC_016779|CRT matches to MH884513 (Bacillus phage vB_BpsS-36, complete genome) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggagctactggtcctcaaggtcc	Protospacer
****** ******** ********. .

460. spacer 5.8|3481656|27|NC_016779|CRT matches to NZ_CP022543 (Antarctobacter heliothermus strain SMS3 plasmid pSMS3-3, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
cgctggcgctgctggacctcgaggcgc	Protospacer
..********.*********.*****.

461. spacer 5.8|3481656|27|NC_016779|CRT matches to MK521907 (Klebsiella phage vB_KpnS_FZ41, complete genome) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggtgctactggtcctcaaggtcc	Protospacer
******.******** ********. .

462. spacer 5.8|3481656|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

463. spacer 5.8|3481656|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

464. spacer 5.8|3481656|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

465. spacer 5.8|3481656|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

466. spacer 5.8|3481656|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

467. spacer 5.8|3481656|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

468. spacer 5.8|3481656|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

469. spacer 5.8|3481656|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

470. spacer 5.8|3481656|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

471. spacer 5.8|3481656|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

472. spacer 5.8|3481656|27|NC_016779|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

473. spacer 5.8|3481656|27|NC_016779|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

474. spacer 5.8|3481656|27|NC_016779|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

475. spacer 5.8|3481656|27|NC_016779|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggcgt	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

476. spacer 5.9|3481701|27|NC_016779|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 5, identity: 0.815

tactggtgccactggacctcaaggtgt	CRISPR spacer
aactggtgctactggacctcaaggacc	Protospacer
 ********.**************  .

477. spacer 5.9|3481701|27|NC_016779|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

tactggtgccactggacctcaaggtgt	CRISPR spacer
aactggtgctactggacctcaaggacc	Protospacer
 ********.**************  .

478. spacer 5.9|3481701|27|NC_016779|CRT matches to MN693099 (Marine virus AFVG_25M184, complete genome) position: , mismatch: 5, identity: 0.815

tactggtgccactggacctcaaggtgt	CRISPR spacer
aactggtgctactggacctcaaggacc	Protospacer
 ********.**************  .

479. spacer 5.9|3481701|27|NC_016779|CRT matches to AP013956 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S27-C232, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

tactggtgccactggacctcaaggtgt	CRISPR spacer
aactggtgctactggccctcaaggtcc	Protospacer
 ********.***** ********* .

480. spacer 5.9|3481701|27|NC_016779|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 5, identity: 0.815

tactggtgccactggacctcaaggtgt	CRISPR spacer
aactggtgctactggaccccaaggttc	Protospacer
 ********.********.****** .

481. spacer 5.9|3481701|27|NC_016779|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 5, identity: 0.815

tactggtgccactggacctcaaggtgt	CRISPR spacer
ctctggtgcaactggtcctcaaggtga	Protospacer
. ******* ***** **********

482. spacer 5.9|3481701|27|NC_016779|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 5, identity: 0.815

tactggtgccactggacctcaaggtgt	CRISPR spacer
tggtggtgctactggtcctcaaggtga	Protospacer
*. ******.***** **********

483. spacer 5.9|3481701|27|NC_016779|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 5, identity: 0.815

tactggtgccactggacctcaaggtgt	CRISPR spacer
aactggagccactggtcctcaaggcga	Protospacer
 ***** ******** ********.*

484. spacer 5.9|3481701|27|NC_016779|CRT matches to AP014301 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S28-C84, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

tactggtgccactggacctcaaggtgt	CRISPR spacer
tactggtgctactggccctcaaggccc	Protospacer
*********.***** ********. .

485. spacer 5.9|3481701|27|NC_016779|CRT matches to AP013963 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S38-C146, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

tactggtgccactggacctcaaggtgt	CRISPR spacer
aactggtgctactggccctcaaggtcc	Protospacer
 ********.***** ********* .

486. spacer 5.9|3481701|27|NC_016779|CRT matches to AP013959 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S31-C107, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

tactggtgccactggacctcaaggtgt	CRISPR spacer
aactggtgctactggccctcaaggtcc	Protospacer
 ********.***** ********* .

487. spacer 5.9|3481701|27|NC_016779|CRT matches to AP013565 (Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5F-MedDCM-OCT-S40-C10, *** SEQUENCING IN PROGRESS ***, 2 ordered pieces) position: , mismatch: 5, identity: 0.815

tactggtgccactggacctcaaggtgt	CRISPR spacer
aactggtgctactggccctcaaggtcc	Protospacer
 ********.***** ********* .

488. spacer 5.9|3481701|27|NC_016779|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 5, identity: 0.815

tactggtgccactggacctcaaggtgt	CRISPR spacer
ctctggtgcaactggtcctcaaggtga	Protospacer
. ******* ***** **********

489. spacer 5.9|3481701|27|NC_016779|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 5, identity: 0.815

tactggtgccactggacctcaaggtgt	CRISPR spacer
tggtggtgctactggtcctcaaggtga	Protospacer
*. ******.***** **********

490. spacer 5.9|3481701|27|NC_016779|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 5, identity: 0.815

tactggtgccactggacctcaaggtgt	CRISPR spacer
aactggagccactggtcctcaaggcga	Protospacer
 ***** ******** ********.*

491. spacer 5.9|3481701|27|NC_016779|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 5, identity: 0.815

tactggtgccactggacctcaaggtgt	CRISPR spacer
aactggtgctactggaccccaaggttc	Protospacer
 ********.********.****** .

492. spacer 5.9|3481701|27|NC_016779|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 5, identity: 0.815

tactggtgccactggacctcaaggtgt	CRISPR spacer
ctctggtgcaactggtcctcaaggtga	Protospacer
. ******* ***** **********

493. spacer 5.9|3481701|27|NC_016779|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 5, identity: 0.815

tactggtgccactggacctcaaggtgt	CRISPR spacer
tggtggtgctactggtcctcaaggtga	Protospacer
*. ******.***** **********

494. spacer 5.9|3481701|27|NC_016779|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 5, identity: 0.815

tactggtgccactggacctcaaggtgt	CRISPR spacer
aactggagccactggtcctcaaggcga	Protospacer
 ***** ******** ********.*

495. spacer 5.9|3481701|27|NC_016779|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 5, identity: 0.815

tactggtgccactggacctcaaggtgt	CRISPR spacer
cactggtgctactggtcctcaaggtaa	Protospacer
.********.***** *********.

496. spacer 5.9|3481701|27|NC_016779|CRT matches to AP013961 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S34-C156, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

tactggtgccactggacctcaaggtgt	CRISPR spacer
aactggtgctactggccctcaaggtcc	Protospacer
 ********.***** ********* .

497. spacer 5.9|3481701|27|NC_016779|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 5, identity: 0.815

tactggtgccactggacctcaaggtgt	CRISPR spacer
cactggtgctactggtcctcaaggtaa	Protospacer
.********.***** *********.

498. spacer 5.9|3481701|27|NC_016779|CRT matches to HQ615693 (Synechococcus phage S-CRM01, complete genome) position: , mismatch: 5, identity: 0.815

tactggtgccactggacctcaaggtgt	CRISPR spacer
tcaaggtgatactggacctcaaggtgt	Protospacer
*   **** .*****************

499. spacer 5.10|3481746|27|NC_016779|CRT matches to MN497953 (Mycobacterium phage GtownJaz, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgccactggacctcaaggtgt	CRISPR spacer
taccggtgccactggtgctcaaggccc	Protospacer
***************  *******. .

500. spacer 5.10|3481746|27|NC_016779|CRT matches to MN586053 (Arthrobacter phage BeatusComedenti, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgccactggacctcaaggtgt	CRISPR spacer
gaccggcgccactggacctcagggtcc	Protospacer
 *****.**************.*** .

501. spacer 5.10|3481746|27|NC_016779|CRT matches to MH020238 (Mycobacterium phage Lilith, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgccactggacctcaaggtgt	CRISPR spacer
taccggtgccactggtgctcaaggccc	Protospacer
***************  *******. .

502. spacer 5.10|3481746|27|NC_016779|CRT matches to MH077583 (Mycobacterium phage PGHhamlin, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgccactggacctcaaggtgt	CRISPR spacer
taccggtgccactggtgctcaaggccc	Protospacer
***************  *******. .

503. spacer 5.10|3481746|27|NC_016779|CRT matches to MH727554 (Mycobacterium phage MuchMore, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgccactggacctcaaggtgt	CRISPR spacer
taccggtgccactggtgctcaaggccc	Protospacer
***************  *******. .

504. spacer 5.10|3481746|27|NC_016779|CRT matches to MH338240 (Mycobacterium phage Sabia, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgccactggacctcaaggtgt	CRISPR spacer
taccggtgccactggtgctcaaggccc	Protospacer
***************  *******. .

505. spacer 5.10|3481746|27|NC_016779|CRT matches to KM233455 (Mycobacterium phage Farber, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgccactggacctcaaggtgt	CRISPR spacer
taccggtgccactggtgctcaaggccc	Protospacer
***************  *******. .

506. spacer 5.10|3481746|27|NC_016779|CRT matches to KX664448 (Mycobacterium phage Watson, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgccactggacctcaaggtgt	CRISPR spacer
taccggtgccactggtgctcaaggccc	Protospacer
***************  *******. .

507. spacer 5.10|3481746|27|NC_016779|CRT matches to KX507362 (Mycobacterium phage Aglet, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgccactggacctcaaggtgt	CRISPR spacer
taccggtgccactggtgctcaaggccc	Protospacer
***************  *******. .

508. spacer 5.10|3481746|27|NC_016779|CRT matches to MH576949 (Mycobacterium phage BreSam8, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgccactggacctcaaggtgt	CRISPR spacer
taccggtgccactggtgctcaaggccc	Protospacer
***************  *******. .

509. spacer 5.10|3481746|27|NC_016779|CRT matches to MN585969 (Mycobacterium phage Dieselweasel, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgccactggacctcaaggtgt	CRISPR spacer
taccggtgccactggtgctcaaggccc	Protospacer
***************  *******. .

510. spacer 5.10|3481746|27|NC_016779|CRT matches to MH536813 (Mycobacterium phage AugsMagnumOpus, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgccactggacctcaaggtgt	CRISPR spacer
taccggtgccactggtgctcaaggccc	Protospacer
***************  *******. .

511. spacer 5.10|3481746|27|NC_016779|CRT matches to MF185733 (Mycobacterium phage StepMih, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgccactggacctcaaggtgt	CRISPR spacer
taccggtgccactggtgctcaaggccc	Protospacer
***************  *******. .

512. spacer 5.10|3481746|27|NC_016779|CRT matches to MF185732 (Mycobacterium phage Stagni, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgccactggacctcaaggtgt	CRISPR spacer
taccggtgccactggtgctcaaggccc	Protospacer
***************  *******. .

513. spacer 5.10|3481746|27|NC_016779|CRT matches to MK494096 (Mycobacterium phage Mainiac, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgccactggacctcaaggtgt	CRISPR spacer
taccggtgccactggtgctcaaggccc	Protospacer
***************  *******. .

514. spacer 5.10|3481746|27|NC_016779|CRT matches to KU984914 (Mycobacterium phage Malinsilva, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgccactggacctcaaggtgt	CRISPR spacer
taccggtgccactggtgctcaaggccc	Protospacer
***************  *******. .

515. spacer 5.10|3481746|27|NC_016779|CRT matches to JF704101 (Mycobacterium virus Microwolf, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgccactggacctcaaggtgt	CRISPR spacer
taccggtgccactggtgctcaaggccc	Protospacer
***************  *******. .

516. spacer 5.10|3481746|27|NC_016779|CRT matches to KT359365 (Mycobacterium phage DaHudson, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgccactggacctcaaggtgt	CRISPR spacer
taccggtgccactggtgctcaaggccc	Protospacer
***************  *******. .

517. spacer 5.10|3481746|27|NC_016779|CRT matches to MH651179 (Mycobacterium phage MadMarie, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgccactggacctcaaggtgt	CRISPR spacer
taccggtgccactggtgctcaaggccc	Protospacer
***************  *******. .

518. spacer 5.10|3481746|27|NC_016779|CRT matches to NC_028798 (Mycobacterium phage MarQuardt, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgccactggacctcaaggtgt	CRISPR spacer
taccggtgccactggtgctcaaggccc	Protospacer
***************  *******. .

519. spacer 5.10|3481746|27|NC_016779|CRT matches to NC_031231 (Arthrobacter phage KellEzio, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgccactggacctcaaggtgt	CRISPR spacer
gaccggcgccactggacctcagggtcc	Protospacer
 *****.**************.*** .

520. spacer 5.10|3481746|27|NC_016779|CRT matches to HQ615693 (Synechococcus phage S-CRM01, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgccactggacctcaaggtgt	CRISPR spacer
tcaaggtgatactggacctcaaggtgt	Protospacer
*   **** .*****************

521. spacer 5.11|3481791|27|NC_016779|CRT matches to MN693099 (Marine virus AFVG_25M184, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgctactggacctcaaggtgt	CRISPR spacer
aactggtgctactggacctcaaggacc	Protospacer
 **.********************  .

522. spacer 5.11|3481791|27|NC_016779|CRT matches to MN693189 (Marine virus AFVG_25M326, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgctactggacctcaaggtgt	CRISPR spacer
tcaaggtgctactggacctcaaggtcc	Protospacer
*   ********************* .

523. spacer 5.11|3481791|27|NC_016779|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 5, identity: 0.815

taccggtgctactggacctcaaggtgt	CRISPR spacer
aactggtgctactggacctcaaggacc	Protospacer
 **.********************  .

524. spacer 5.11|3481791|27|NC_016779|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

taccggtgctactggacctcaaggtgt	CRISPR spacer
aactggtgctactggacctcaaggacc	Protospacer
 **.********************  .

525. spacer 5.11|3481791|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

taccggtgctactggacctcaaggtgt	CRISPR spacer
taccggtgctactggacctaccggcgc	Protospacer
*******************   **.*.

526. spacer 5.11|3481791|27|NC_016779|CRT matches to AP013956 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S27-C232, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

taccggtgctactggacctcaaggtgt	CRISPR spacer
aactggtgctactggccctcaaggtcc	Protospacer
 **.*********** ********* .

527. spacer 5.11|3481791|27|NC_016779|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgctactggacctcaaggtgt	CRISPR spacer
tggtggtgctactggtcctcaaggtga	Protospacer
*. .*********** **********

528. spacer 5.11|3481791|27|NC_016779|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgctactggacctcaaggtgt	CRISPR spacer
aactggtgctactggaccccaaggttc	Protospacer
 **.**************.****** .

529. spacer 5.11|3481791|27|NC_016779|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgctactggacctcaaggtgt	CRISPR spacer
tggtggtgctactggtcctcaaggtct	Protospacer
*. .*********** ********* *

530. spacer 5.11|3481791|27|NC_016779|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgctactggacctcaaggtgt	CRISPR spacer
aatcggtgctaccggtcctcaaggtga	Protospacer
 *.*********.** **********

531. spacer 5.11|3481791|27|NC_016779|CRT matches to AP014301 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S28-C84, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

taccggtgctactggacctcaaggtgt	CRISPR spacer
tactggtgctactggccctcaaggccc	Protospacer
***.*********** ********. .

532. spacer 5.11|3481791|27|NC_016779|CRT matches to AP013963 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S38-C146, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

taccggtgctactggacctcaaggtgt	CRISPR spacer
aactggtgctactggccctcaaggtcc	Protospacer
 **.*********** ********* .

533. spacer 5.11|3481791|27|NC_016779|CRT matches to AP013959 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S31-C107, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

taccggtgctactggacctcaaggtgt	CRISPR spacer
aactggtgctactggccctcaaggtcc	Protospacer
 **.*********** ********* .

534. spacer 5.11|3481791|27|NC_016779|CRT matches to AP013565 (Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5F-MedDCM-OCT-S40-C10, *** SEQUENCING IN PROGRESS ***, 2 ordered pieces) position: , mismatch: 5, identity: 0.815

taccggtgctactggacctcaaggtgt	CRISPR spacer
aactggtgctactggccctcaaggtcc	Protospacer
 **.*********** ********* .

535. spacer 5.11|3481791|27|NC_016779|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgctactggacctcaaggtgt	CRISPR spacer
tggtggtgctactggtcctcaaggtga	Protospacer
*. .*********** **********

536. spacer 5.11|3481791|27|NC_016779|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgctactggacctcaaggtgt	CRISPR spacer
tggtggtgctactggtcctcaaggtct	Protospacer
*. .*********** ********* *

537. spacer 5.11|3481791|27|NC_016779|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgctactggacctcaaggtgt	CRISPR spacer
aatcggtgctaccggtcctcaaggtga	Protospacer
 *.*********.** **********

538. spacer 5.11|3481791|27|NC_016779|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgctactggacctcaaggtgt	CRISPR spacer
tggtggtgctactggtcctcaaggtga	Protospacer
*. .*********** **********

539. spacer 5.11|3481791|27|NC_016779|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgctactggacctcaaggtgt	CRISPR spacer
aactggtgctactggaccccaaggttc	Protospacer
 **.**************.****** .

540. spacer 5.11|3481791|27|NC_016779|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgctactggacctcaaggtgt	CRISPR spacer
tggtggtgctactggtcctcaaggtct	Protospacer
*. .*********** ********* *

541. spacer 5.11|3481791|27|NC_016779|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgctactggacctcaaggtgt	CRISPR spacer
aatcggtgctaccggtcctcaaggtga	Protospacer
 *.*********.** **********

542. spacer 5.11|3481791|27|NC_016779|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgctactggacctcaaggtgt	CRISPR spacer
cactggtgctactggtcctcaaggtaa	Protospacer
.**.*********** *********.

543. spacer 5.11|3481791|27|NC_016779|CRT matches to AP013961 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S34-C156, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

taccggtgctactggacctcaaggtgt	CRISPR spacer
aactggtgctactggccctcaaggtcc	Protospacer
 **.*********** ********* .

544. spacer 5.11|3481791|27|NC_016779|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgctactggacctcaaggtgt	CRISPR spacer
cactggtgctactggtcctcaaggtaa	Protospacer
.**.*********** *********.

545. spacer 5.11|3481791|27|NC_016779|CRT matches to KX160207 (Lactococcus phage 53801, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgctactggacctcaaggtgt	CRISPR spacer
caacggtgctactggtcctaaaggtga	Protospacer
.* ************ *** ******

546. spacer 5.11|3481791|27|NC_016779|CRT matches to MN694321 (Marine virus AFVG_250M307, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgctactggacctcaaggtgt	CRISPR spacer
tgacggagctactggaactcaaggtgc	Protospacer
*. *** ********* *********.

547. spacer 5.11|3481791|27|NC_016779|CRT matches to AP017924 (Ralstonia phage RP12 DNA, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgctactggacctcaaggtgt	CRISPR spacer
gaaaggtgatactggacctcaaggtct	Protospacer
 *  **** **************** *

548. spacer 5.11|3481791|27|NC_016779|CRT matches to AP017925 (Ralstonia phage RP31 DNA, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgctactggacctcaaggtgt	CRISPR spacer
gaaaggtgatactggacctcaaggtct	Protospacer
 *  **** **************** *

549. spacer 5.12|3481836|27|NC_016779|CRT matches to MN693099 (Marine virus AFVG_25M184, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgctactggacctcaaggtgt	CRISPR spacer
aactggtgctactggacctcaaggacc	Protospacer
 **.********************  .

550. spacer 5.12|3481836|27|NC_016779|CRT matches to MN693189 (Marine virus AFVG_25M326, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgctactggacctcaaggtgt	CRISPR spacer
tcaaggtgctactggacctcaaggtcc	Protospacer
*   ********************* .

551. spacer 5.12|3481836|27|NC_016779|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 5, identity: 0.815

taccggtgctactggacctcaaggtgt	CRISPR spacer
aactggtgctactggacctcaaggacc	Protospacer
 **.********************  .

552. spacer 5.12|3481836|27|NC_016779|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

taccggtgctactggacctcaaggtgt	CRISPR spacer
aactggtgctactggacctcaaggacc	Protospacer
 **.********************  .

553. spacer 5.12|3481836|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

taccggtgctactggacctcaaggtgt	CRISPR spacer
taccggtgctactggacctaccggcgc	Protospacer
*******************   **.*.

554. spacer 5.12|3481836|27|NC_016779|CRT matches to AP013956 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S27-C232, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

taccggtgctactggacctcaaggtgt	CRISPR spacer
aactggtgctactggccctcaaggtcc	Protospacer
 **.*********** ********* .

555. spacer 5.12|3481836|27|NC_016779|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgctactggacctcaaggtgt	CRISPR spacer
tggtggtgctactggtcctcaaggtga	Protospacer
*. .*********** **********

556. spacer 5.12|3481836|27|NC_016779|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgctactggacctcaaggtgt	CRISPR spacer
aactggtgctactggaccccaaggttc	Protospacer
 **.**************.****** .

557. spacer 5.12|3481836|27|NC_016779|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgctactggacctcaaggtgt	CRISPR spacer
tggtggtgctactggtcctcaaggtct	Protospacer
*. .*********** ********* *

558. spacer 5.12|3481836|27|NC_016779|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgctactggacctcaaggtgt	CRISPR spacer
aatcggtgctaccggtcctcaaggtga	Protospacer
 *.*********.** **********

559. spacer 5.12|3481836|27|NC_016779|CRT matches to AP014301 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S28-C84, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

taccggtgctactggacctcaaggtgt	CRISPR spacer
tactggtgctactggccctcaaggccc	Protospacer
***.*********** ********. .

560. spacer 5.12|3481836|27|NC_016779|CRT matches to AP013963 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S38-C146, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

taccggtgctactggacctcaaggtgt	CRISPR spacer
aactggtgctactggccctcaaggtcc	Protospacer
 **.*********** ********* .

561. spacer 5.12|3481836|27|NC_016779|CRT matches to AP013959 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S31-C107, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

taccggtgctactggacctcaaggtgt	CRISPR spacer
aactggtgctactggccctcaaggtcc	Protospacer
 **.*********** ********* .

562. spacer 5.12|3481836|27|NC_016779|CRT matches to AP013565 (Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5F-MedDCM-OCT-S40-C10, *** SEQUENCING IN PROGRESS ***, 2 ordered pieces) position: , mismatch: 5, identity: 0.815

taccggtgctactggacctcaaggtgt	CRISPR spacer
aactggtgctactggccctcaaggtcc	Protospacer
 **.*********** ********* .

563. spacer 5.12|3481836|27|NC_016779|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgctactggacctcaaggtgt	CRISPR spacer
tggtggtgctactggtcctcaaggtga	Protospacer
*. .*********** **********

564. spacer 5.12|3481836|27|NC_016779|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgctactggacctcaaggtgt	CRISPR spacer
tggtggtgctactggtcctcaaggtct	Protospacer
*. .*********** ********* *

565. spacer 5.12|3481836|27|NC_016779|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgctactggacctcaaggtgt	CRISPR spacer
aatcggtgctaccggtcctcaaggtga	Protospacer
 *.*********.** **********

566. spacer 5.12|3481836|27|NC_016779|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgctactggacctcaaggtgt	CRISPR spacer
tggtggtgctactggtcctcaaggtga	Protospacer
*. .*********** **********

567. spacer 5.12|3481836|27|NC_016779|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgctactggacctcaaggtgt	CRISPR spacer
aactggtgctactggaccccaaggttc	Protospacer
 **.**************.****** .

568. spacer 5.12|3481836|27|NC_016779|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgctactggacctcaaggtgt	CRISPR spacer
tggtggtgctactggtcctcaaggtct	Protospacer
*. .*********** ********* *

569. spacer 5.12|3481836|27|NC_016779|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgctactggacctcaaggtgt	CRISPR spacer
aatcggtgctaccggtcctcaaggtga	Protospacer
 *.*********.** **********

570. spacer 5.12|3481836|27|NC_016779|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgctactggacctcaaggtgt	CRISPR spacer
cactggtgctactggtcctcaaggtaa	Protospacer
.**.*********** *********.

571. spacer 5.12|3481836|27|NC_016779|CRT matches to AP013961 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S34-C156, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

taccggtgctactggacctcaaggtgt	CRISPR spacer
aactggtgctactggccctcaaggtcc	Protospacer
 **.*********** ********* .

572. spacer 5.12|3481836|27|NC_016779|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgctactggacctcaaggtgt	CRISPR spacer
cactggtgctactggtcctcaaggtaa	Protospacer
.**.*********** *********.

573. spacer 5.12|3481836|27|NC_016779|CRT matches to KX160207 (Lactococcus phage 53801, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgctactggacctcaaggtgt	CRISPR spacer
caacggtgctactggtcctaaaggtga	Protospacer
.* ************ *** ******

574. spacer 5.12|3481836|27|NC_016779|CRT matches to MN694321 (Marine virus AFVG_250M307, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgctactggacctcaaggtgt	CRISPR spacer
tgacggagctactggaactcaaggtgc	Protospacer
*. *** ********* *********.

575. spacer 5.12|3481836|27|NC_016779|CRT matches to AP017924 (Ralstonia phage RP12 DNA, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgctactggacctcaaggtgt	CRISPR spacer
gaaaggtgatactggacctcaaggtct	Protospacer
 *  **** **************** *

576. spacer 5.12|3481836|27|NC_016779|CRT matches to AP017925 (Ralstonia phage RP31 DNA, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgctactggacctcaaggtgt	CRISPR spacer
gaaaggtgatactggacctcaaggtct	Protospacer
 *  **** **************** *

577. spacer 5.13|3481881|27|NC_016779|CRT matches to MN497953 (Mycobacterium phage GtownJaz, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgccactggacctcaaggtgt	CRISPR spacer
taccggtgccactggtgctcaaggccc	Protospacer
***************  *******. .

578. spacer 5.13|3481881|27|NC_016779|CRT matches to MN586053 (Arthrobacter phage BeatusComedenti, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgccactggacctcaaggtgt	CRISPR spacer
gaccggcgccactggacctcagggtcc	Protospacer
 *****.**************.*** .

579. spacer 5.13|3481881|27|NC_016779|CRT matches to MH020238 (Mycobacterium phage Lilith, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgccactggacctcaaggtgt	CRISPR spacer
taccggtgccactggtgctcaaggccc	Protospacer
***************  *******. .

580. spacer 5.13|3481881|27|NC_016779|CRT matches to MH077583 (Mycobacterium phage PGHhamlin, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgccactggacctcaaggtgt	CRISPR spacer
taccggtgccactggtgctcaaggccc	Protospacer
***************  *******. .

581. spacer 5.13|3481881|27|NC_016779|CRT matches to MH727554 (Mycobacterium phage MuchMore, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgccactggacctcaaggtgt	CRISPR spacer
taccggtgccactggtgctcaaggccc	Protospacer
***************  *******. .

582. spacer 5.13|3481881|27|NC_016779|CRT matches to MH338240 (Mycobacterium phage Sabia, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgccactggacctcaaggtgt	CRISPR spacer
taccggtgccactggtgctcaaggccc	Protospacer
***************  *******. .

583. spacer 5.13|3481881|27|NC_016779|CRT matches to KM233455 (Mycobacterium phage Farber, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgccactggacctcaaggtgt	CRISPR spacer
taccggtgccactggtgctcaaggccc	Protospacer
***************  *******. .

584. spacer 5.13|3481881|27|NC_016779|CRT matches to KX664448 (Mycobacterium phage Watson, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgccactggacctcaaggtgt	CRISPR spacer
taccggtgccactggtgctcaaggccc	Protospacer
***************  *******. .

585. spacer 5.13|3481881|27|NC_016779|CRT matches to KX507362 (Mycobacterium phage Aglet, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgccactggacctcaaggtgt	CRISPR spacer
taccggtgccactggtgctcaaggccc	Protospacer
***************  *******. .

586. spacer 5.13|3481881|27|NC_016779|CRT matches to MH576949 (Mycobacterium phage BreSam8, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgccactggacctcaaggtgt	CRISPR spacer
taccggtgccactggtgctcaaggccc	Protospacer
***************  *******. .

587. spacer 5.13|3481881|27|NC_016779|CRT matches to MN585969 (Mycobacterium phage Dieselweasel, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgccactggacctcaaggtgt	CRISPR spacer
taccggtgccactggtgctcaaggccc	Protospacer
***************  *******. .

588. spacer 5.13|3481881|27|NC_016779|CRT matches to MH536813 (Mycobacterium phage AugsMagnumOpus, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgccactggacctcaaggtgt	CRISPR spacer
taccggtgccactggtgctcaaggccc	Protospacer
***************  *******. .

589. spacer 5.13|3481881|27|NC_016779|CRT matches to MF185733 (Mycobacterium phage StepMih, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgccactggacctcaaggtgt	CRISPR spacer
taccggtgccactggtgctcaaggccc	Protospacer
***************  *******. .

590. spacer 5.13|3481881|27|NC_016779|CRT matches to MF185732 (Mycobacterium phage Stagni, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgccactggacctcaaggtgt	CRISPR spacer
taccggtgccactggtgctcaaggccc	Protospacer
***************  *******. .

591. spacer 5.13|3481881|27|NC_016779|CRT matches to MK494096 (Mycobacterium phage Mainiac, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgccactggacctcaaggtgt	CRISPR spacer
taccggtgccactggtgctcaaggccc	Protospacer
***************  *******. .

592. spacer 5.13|3481881|27|NC_016779|CRT matches to KU984914 (Mycobacterium phage Malinsilva, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgccactggacctcaaggtgt	CRISPR spacer
taccggtgccactggtgctcaaggccc	Protospacer
***************  *******. .

593. spacer 5.13|3481881|27|NC_016779|CRT matches to JF704101 (Mycobacterium virus Microwolf, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgccactggacctcaaggtgt	CRISPR spacer
taccggtgccactggtgctcaaggccc	Protospacer
***************  *******. .

594. spacer 5.13|3481881|27|NC_016779|CRT matches to KT359365 (Mycobacterium phage DaHudson, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgccactggacctcaaggtgt	CRISPR spacer
taccggtgccactggtgctcaaggccc	Protospacer
***************  *******. .

595. spacer 5.13|3481881|27|NC_016779|CRT matches to MH651179 (Mycobacterium phage MadMarie, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgccactggacctcaaggtgt	CRISPR spacer
taccggtgccactggtgctcaaggccc	Protospacer
***************  *******. .

596. spacer 5.13|3481881|27|NC_016779|CRT matches to NC_028798 (Mycobacterium phage MarQuardt, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgccactggacctcaaggtgt	CRISPR spacer
taccggtgccactggtgctcaaggccc	Protospacer
***************  *******. .

597. spacer 5.13|3481881|27|NC_016779|CRT matches to NC_031231 (Arthrobacter phage KellEzio, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgccactggacctcaaggtgt	CRISPR spacer
gaccggcgccactggacctcagggtcc	Protospacer
 *****.**************.*** .

598. spacer 5.13|3481881|27|NC_016779|CRT matches to HQ615693 (Synechococcus phage S-CRM01, complete genome) position: , mismatch: 5, identity: 0.815

taccggtgccactggacctcaaggtgt	CRISPR spacer
tcaaggtgatactggacctcaaggtgt	Protospacer
*   **** .*****************

599. spacer 5.14|3481926|27|NC_016779|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 5, identity: 0.815

tactggtgccactggacctcaaggtgc	CRISPR spacer
ctctggtgcaactggtcctcaaggtga	Protospacer
. ******* ***** **********

600. spacer 5.14|3481926|27|NC_016779|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 5, identity: 0.815

tactggtgccactggacctcaaggtgc	CRISPR spacer
tggtggtgctactggtcctcaaggtga	Protospacer
*. ******.***** **********

601. spacer 5.14|3481926|27|NC_016779|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 5, identity: 0.815

tactggtgccactggacctcaaggtgc	CRISPR spacer
aactggagccactggtcctcaaggcga	Protospacer
 ***** ******** ********.*

602. spacer 5.14|3481926|27|NC_016779|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 5, identity: 0.815

tactggtgccactggacctcaaggtgc	CRISPR spacer
ctctggtgcaactggtcctcaaggtga	Protospacer
. ******* ***** **********

603. spacer 5.14|3481926|27|NC_016779|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 5, identity: 0.815

tactggtgccactggacctcaaggtgc	CRISPR spacer
tggtggtgctactggtcctcaaggtga	Protospacer
*. ******.***** **********

604. spacer 5.14|3481926|27|NC_016779|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 5, identity: 0.815

tactggtgccactggacctcaaggtgc	CRISPR spacer
aactggagccactggtcctcaaggcga	Protospacer
 ***** ******** ********.*

605. spacer 5.14|3481926|27|NC_016779|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 5, identity: 0.815

tactggtgccactggacctcaaggtgc	CRISPR spacer
ctctggtgcaactggtcctcaaggtga	Protospacer
. ******* ***** **********

606. spacer 5.14|3481926|27|NC_016779|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 5, identity: 0.815

tactggtgccactggacctcaaggtgc	CRISPR spacer
tggtggtgctactggtcctcaaggtga	Protospacer
*. ******.***** **********

607. spacer 5.14|3481926|27|NC_016779|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 5, identity: 0.815

tactggtgccactggacctcaaggtgc	CRISPR spacer
aactggagccactggtcctcaaggcga	Protospacer
 ***** ******** ********.*

608. spacer 5.14|3481926|27|NC_016779|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 5, identity: 0.815

tactggtgccactggacctcaaggtgc	CRISPR spacer
cactggtgctactggtcctcaaggtaa	Protospacer
.********.***** *********.

609. spacer 5.14|3481926|27|NC_016779|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 5, identity: 0.815

tactggtgccactggacctcaaggtgc	CRISPR spacer
cactggtgctactggtcctcaaggtaa	Protospacer
.********.***** *********.

610. spacer 5.14|3481926|27|NC_016779|CRT matches to MN693189 (Marine virus AFVG_25M326, complete genome) position: , mismatch: 5, identity: 0.815

tactggtgccactggacctcaaggtgc	CRISPR spacer
tcaaggtgctactggacctcaaggtcc	Protospacer
*   *****.*************** *

611. spacer 5.14|3481926|27|NC_016779|CRT matches to MN234235 (Mycobacterium phage BogosyJay, complete genome) position: , mismatch: 5, identity: 0.815

tactggtgccactggacctcaaggtgc	CRISPR spacer
gactggtgccactggcgctcaaggccc	Protospacer
 **************  *******. *

612. spacer 5.14|3481926|27|NC_016779|CRT matches to NZ_CP054613 (Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence) position: , mismatch: 5, identity: 0.815

tactggtgccactggacctcaaggtgc	CRISPR spacer
agctggtgcaactggaccgcaaggtcc	Protospacer
 .******* ******** ****** *

613. spacer 5.14|3481926|27|NC_016779|CRT matches to NZ_CP054613 (Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence) position: , mismatch: 5, identity: 0.815

tactggtgccactggacctcaaggtgc	CRISPR spacer
agctggtgcaactggaccgcaaggtcc	Protospacer
 .******* ******** ****** *

614. spacer 5.16|3482007|27|NC_016779|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggtgc	CRISPR spacer
tggtggtgctactggtcctcaaggtga	Protospacer
*. ***.******** **********

615. spacer 5.16|3482007|27|NC_016779|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggtgc	CRISPR spacer
tggtggtgctactggtcctcaaggtga	Protospacer
*. ***.******** **********

616. spacer 5.16|3482007|27|NC_016779|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggtgc	CRISPR spacer
tggtggtgctactggtcctcaaggtga	Protospacer
*. ***.******** **********

617. spacer 5.16|3482007|27|NC_016779|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggtgc	CRISPR spacer
cactggtgctactggtcctcaaggtaa	Protospacer
.*****.******** *********.

618. spacer 5.16|3482007|27|NC_016779|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggtgc	CRISPR spacer
cactggtgctactggtcctcaaggtaa	Protospacer
.*****.******** *********.

619. spacer 5.16|3482007|27|NC_016779|CRT matches to MN693189 (Marine virus AFVG_25M326, complete genome) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggtgc	CRISPR spacer
tcaaggtgctactggacctcaaggtcc	Protospacer
*   **.****************** *

620. spacer 5.16|3482007|27|NC_016779|CRT matches to AP014476 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, *** SEQUENCING IN PROGRESS ***, 2 ordered pieces) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggtgc	CRISPR spacer
aacaggcgctactggtcctcaaggacc	Protospacer
 ** *********** ********  *

621. spacer 5.16|3482007|27|NC_016779|CRT matches to AP013942 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggtgc	CRISPR spacer
aacaggcgctactggtcctcaaggacc	Protospacer
 ** *********** ********  *

622. spacer 5.16|3482007|27|NC_016779|CRT matches to MN694321 (Marine virus AFVG_250M307, complete genome) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggtgc	CRISPR spacer
tgacggagctactggaactcaaggtgc	Protospacer
*. .** ********* **********

623. spacer 5.16|3482007|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggtgc	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

624. spacer 5.16|3482007|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggtgc	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

625. spacer 5.16|3482007|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggtgc	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

626. spacer 5.16|3482007|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggtgc	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

627. spacer 5.16|3482007|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggtgc	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

628. spacer 5.16|3482007|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggtgc	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

629. spacer 5.16|3482007|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggtgc	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

630. spacer 5.16|3482007|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggtgc	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

631. spacer 5.16|3482007|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggtgc	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

632. spacer 5.16|3482007|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggtgc	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

633. spacer 5.16|3482007|27|NC_016779|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggtgc	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

634. spacer 5.16|3482007|27|NC_016779|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggtgc	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

635. spacer 5.16|3482007|27|NC_016779|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggtgc	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

636. spacer 5.16|3482007|27|NC_016779|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggtgc	CRISPR spacer
tactggcgctactggacctaccggaga	Protospacer
*******************   ** *

637. spacer 5.16|3482007|27|NC_016779|CRT matches to AP013944 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggtgc	CRISPR spacer
aacaggcgctactggtcctcaaggacc	Protospacer
 ** *********** ********  *

638. spacer 5.16|3482007|27|NC_016779|CRT matches to AP013945 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

tactggcgctactggacctcaaggtgc	CRISPR spacer
aacaggcgctactggtcctcaaggacc	Protospacer
 ** *********** ********  *

639. spacer 2.1|1382779|27|NC_016779|CRT matches to NZ_CP040452 (Halomonas sp. PA16-9 plasmid p_unnamed1, complete sequence) position: , mismatch: 6, identity: 0.778

gtccttgagcccccgtagcgccagtag	CRISPR spacer
cgccagcagcccccgtagcgccagtat	Protospacer
  **   *******************

640. spacer 2.2|1382833|27|NC_016779|CRT matches to NZ_CP040452 (Halomonas sp. PA16-9 plasmid p_unnamed1, complete sequence) position: , mismatch: 6, identity: 0.778

gtccttgagcccccgtagcgccagtag	CRISPR spacer
cgccagcagcccccgtagcgccagtat	Protospacer
  **   *******************

641. spacer 2.3|1382887|27|NC_016779|CRT matches to NZ_CP040452 (Halomonas sp. PA16-9 plasmid p_unnamed1, complete sequence) position: , mismatch: 6, identity: 0.778

gtccttgagcccccgtagcgccagtag	CRISPR spacer
cgccagcagcccccgtagcgccagtat	Protospacer
  **   *******************

642. spacer 2.5|1382995|27|NC_016779|CRT matches to KY984068 (Erwinia phage vB_EamM_Y3, complete genome) position: , mismatch: 6, identity: 0.778

gtccttgagcacctgtagcgccagtag	CRISPR spacer
ggccttgagcaccagtagcgccacgca	Protospacer
* *********** *********   .

643. spacer 2.5|1382995|27|NC_016779|CRT matches to AP014351 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S39-C3, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.778

gtccttgagcacctgtagcgccagtag	CRISPR spacer
atccttcagcacctgcagcgccagata	Protospacer
.***** ********.********  .

644. spacer 2.10|1383247|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.778

gcccttgaggtccagtagcgccagtag	CRISPR spacer
ctccggtaggtccagtagcgccagtat	Protospacer
 .**   *******************

645. spacer 2.10|1383247|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.778

gcccttgaggtccagtagcgccagtag	CRISPR spacer
ctccggtaggtccagtagcgccagtat	Protospacer
 .**   *******************

646. spacer 2.10|1383247|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.778

gcccttgaggtccagtagcgccagtag	CRISPR spacer
ctccggtaggtccagtagcgccagtat	Protospacer
 .**   *******************

647. spacer 2.10|1383247|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.778

gcccttgaggtccagtagcgccagtag	CRISPR spacer
ctccggtaggtccagtagcgccagtat	Protospacer
 .**   *******************

648. spacer 2.10|1383247|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.778

gcccttgaggtccagtagcgccagtag	CRISPR spacer
ctccggtaggtccagtagcgccagtat	Protospacer
 .**   *******************

649. spacer 2.10|1383247|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.778

gcccttgaggtccagtagcgccagtag	CRISPR spacer
ctccggtaggtccagtagcgccagtat	Protospacer
 .**   *******************

650. spacer 2.10|1383247|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.778

gcccttgaggtccagtagcgccagtag	CRISPR spacer
ctccggtaggtccagtagcgccagtat	Protospacer
 .**   *******************

651. spacer 2.10|1383247|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.778

gcccttgaggtccagtagcgccagtag	CRISPR spacer
ctccggtaggtccagtagcgccagtat	Protospacer
 .**   *******************

652. spacer 2.10|1383247|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.778

gcccttgaggtccagtagcgccagtag	CRISPR spacer
ctccggtaggtccagtagcgccagtat	Protospacer
 .**   *******************

653. spacer 2.10|1383247|27|NC_016779|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.778

gcccttgaggtccagtagcgccagtag	CRISPR spacer
ctccggtaggtccagtagcgccagtat	Protospacer
 .**   *******************

654. spacer 2.10|1383247|27|NC_016779|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.778

gcccttgaggtccagtagcgccagtag	CRISPR spacer
ctccggtaggtccagtagcgccagtat	Protospacer
 .**   *******************

655. spacer 2.10|1383247|27|NC_016779|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.778

gcccttgaggtccagtagcgccagtag	CRISPR spacer
ctccggtaggtccagtagcgccagtat	Protospacer
 .**   *******************

656. spacer 2.10|1383247|27|NC_016779|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.778

gcccttgaggtccagtagcgccagtag	CRISPR spacer
ctccggtaggtccagtagcgccagtat	Protospacer
 .**   *******************

657. spacer 2.10|1383247|27|NC_016779|CRT matches to CP011075 (Brevibacillus laterosporus strain B9 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.778

gcccttgaggtccagtagcgccagtag	CRISPR spacer
ctccggtaggtccagtagcgccagtac	Protospacer
 .**   *******************

658. spacer 2.10|1383247|27|NC_016779|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 6, identity: 0.778

gcccttgaggtccagtagcgccagtag	CRISPR spacer
taccttgaggaccagtagcaccagtgt	Protospacer
  ******** ********.*****.

659. spacer 2.10|1383247|27|NC_016779|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 6, identity: 0.778

gcccttgaggtccagtagcgccagtag	CRISPR spacer
taccttgaggaccagtagcaccagtgt	Protospacer
  ******** ********.*****.

660. spacer 2.11|1383301|27|NC_016779|CRT matches to KY984068 (Erwinia phage vB_EamM_Y3, complete genome) position: , mismatch: 6, identity: 0.778

gtccttgagcacctgtagcgccagtag	CRISPR spacer
ggccttgagcaccagtagcgccacgca	Protospacer
* *********** *********   .

661. spacer 2.11|1383301|27|NC_016779|CRT matches to AP014351 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S39-C3, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.778

gtccttgagcacctgtagcgccagtag	CRISPR spacer
atccttcagcacctgcagcgccagata	Protospacer
.***** ********.********  .

662. spacer 2.14|1383472|27|NC_016779|CRT matches to MN013077 (Klebsiella phage vB_KaeM_KaOmega, complete genome) position: , mismatch: 6, identity: 0.778

cacctgtagcacccgccggtccttgaa	CRISPR spacer
cacctgtagcacccgccgggccagtcg	Protospacer
******************* **    .

663. spacer 2.14|1383472|27|NC_016779|CRT matches to NZ_CP026268 (Aminobacter sp. MSH1 plasmid pBAM1, complete sequence) position: , mismatch: 6, identity: 0.778

cacctgtagcacccgccggtccttgaa	CRISPR spacer
ggcctgaagcgcccgccggtccttgtc	Protospacer
 .**** ***.**************

664. spacer 2.14|1383472|27|NC_016779|CRT matches to NZ_CP011665 (Streptomyces sp. Mg1 plasmid pSMg1-1, complete sequence) position: , mismatch: 6, identity: 0.778

cacctgtagcacccgccggtccttgaa	CRISPR spacer
ggcctgttgcacccgccggtcctcgcc	Protospacer
 .***** ***************.*

665. spacer 2.14|1383472|27|NC_016779|CRT matches to KR296684 (UNVERIFIED: Salmonella phage 19, complete genome) position: , mismatch: 6, identity: 0.778

cacctgtagcacccgccggtccttgaa	CRISPR spacer
gtcctgtagcacctgccggaccttgtg	Protospacer
  ***********.***** ***** .

666. spacer 2.14|1383472|27|NC_016779|CRT matches to NC_029072 (Salmonella phage 19, complete genome) position: , mismatch: 6, identity: 0.778

cacctgtagcacccgccggtccttgaa	CRISPR spacer
gtcctgtagcacctgccggaccttgtg	Protospacer
  ***********.***** ***** .

667. spacer 2.14|1383472|27|NC_016779|CRT matches to KR296695 (UNVERIFIED: Salmonella phage 41, complete genome) position: , mismatch: 6, identity: 0.778

cacctgtagcacccgccggtccttgaa	CRISPR spacer
gtcctgtagcacctgccggaccttgtg	Protospacer
  ***********.***** ***** .

668. spacer 2.15|1383526|27|NC_016779|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 6, identity: 0.778

cacctgtagcgccagtagcaccagcag	CRISPR spacer
ctccagtagcgccagtagcaccaatta	Protospacer
* ** ******************.. .

669. spacer 2.15|1383526|27|NC_016779|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 6, identity: 0.778

cacctgtagcgccagtagcaccagcag	CRISPR spacer
ggcctgtagcaccagtagcaccagtgt	Protospacer
 .********.*************..

670. spacer 2.15|1383526|27|NC_016779|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 6, identity: 0.778

cacctgtagcgccagtagcaccagcag	CRISPR spacer
ggcctgtagcaccagtagcaccagtgt	Protospacer
 .********.*************..

671. spacer 2.15|1383526|27|NC_016779|CRT matches to MH617049 (Microviridae sp. isolate ctba755, complete genome) position: , mismatch: 6, identity: 0.778

cacctgtagcgccagtagcaccagcag	CRISPR spacer
taccagtagcgccagtagcgccagttt	Protospacer
.*** **************.****.

672. spacer 5.1|3481350|27|NC_016779|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 6, identity: 0.778

tactggtgccactggacctcaaggcgc	CRISPR spacer
cactggtgctactggtcctcaaggtaa	Protospacer
.********.***** ********..

673. spacer 5.1|3481350|27|NC_016779|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 6, identity: 0.778

tactggtgccactggacctcaaggcgc	CRISPR spacer
cactggtgctactggtcctcaaggtaa	Protospacer
.********.***** ********..

674. spacer 5.1|3481350|27|NC_016779|CRT matches to CP000662 (Rhodobacter sphaeroides ATCC 17025 plasmid pRSPA01, complete sequence) position: , mismatch: 6, identity: 0.778

tactggtgccactggacctcaaggcgc	CRISPR spacer
cgctggtgccgctggacctcgaggccg	Protospacer
..********.*********.****

675. spacer 5.2|3481395|27|NC_016779|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 6, identity: 0.778

tactggcgctactggacctcaaggcgt	CRISPR spacer
aactggtgctactggaccccaaggttc	Protospacer
 *****.***********.*****. .

676. spacer 5.2|3481395|27|NC_016779|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 6, identity: 0.778

tactggcgctactggacctcaaggcgt	CRISPR spacer
aactggtgctactggaccccaaggttc	Protospacer
 *****.***********.*****. .

677. spacer 5.2|3481395|27|NC_016779|CRT matches to AP014476 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, *** SEQUENCING IN PROGRESS ***, 2 ordered pieces) position: , mismatch: 6, identity: 0.778

tactggcgctactggacctcaaggcgt	CRISPR spacer
aacaggcgctactggtcctcaaggacc	Protospacer
 ** *********** ********  .

678. spacer 5.2|3481395|27|NC_016779|CRT matches to AP013959 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S31-C107, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.778

tactggcgctactggacctcaaggcgt	CRISPR spacer
aactggtgctactggccctcaaggtcc	Protospacer
 *****.******** ********. .

679. spacer 5.2|3481395|27|NC_016779|CRT matches to AP013942 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.778

tactggcgctactggacctcaaggcgt	CRISPR spacer
aacaggcgctactggtcctcaaggacc	Protospacer
 ** *********** ********  .

680. spacer 5.2|3481395|27|NC_016779|CRT matches to AP013565 (Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5F-MedDCM-OCT-S40-C10, *** SEQUENCING IN PROGRESS ***, 2 ordered pieces) position: , mismatch: 6, identity: 0.778

tactggcgctactggacctcaaggcgt	CRISPR spacer
aactggtgctactggccctcaaggtcc	Protospacer
 *****.******** ********. .

681. spacer 5.2|3481395|27|NC_016779|CRT matches to AP013944 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.778

tactggcgctactggacctcaaggcgt	CRISPR spacer
aacaggcgctactggtcctcaaggacc	Protospacer
 ** *********** ********  .

682. spacer 5.2|3481395|27|NC_016779|CRT matches to AP013956 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S27-C232, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.778

tactggcgctactggacctcaaggcgt	CRISPR spacer
aactggtgctactggccctcaaggtcc	Protospacer
 *****.******** ********. .

683. spacer 5.2|3481395|27|NC_016779|CRT matches to AP013963 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S38-C146, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.778

tactggcgctactggacctcaaggcgt	CRISPR spacer
aactggtgctactggccctcaaggtcc	Protospacer
 *****.******** ********. .

684. spacer 5.2|3481395|27|NC_016779|CRT matches to AP013945 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.778

tactggcgctactggacctcaaggcgt	CRISPR spacer
aacaggcgctactggtcctcaaggacc	Protospacer
 ** *********** ********  .

685. spacer 5.2|3481395|27|NC_016779|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 6, identity: 0.778

tactggcgctactggacctcaaggcgt	CRISPR spacer
cactggtgctactggtcctcaaggtaa	Protospacer
.*****.******** ********..

686. spacer 5.2|3481395|27|NC_016779|CRT matches to AP013961 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S34-C156, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.778

tactggcgctactggacctcaaggcgt	CRISPR spacer
aactggtgctactggccctcaaggtcc	Protospacer
 *****.******** ********. .

687. spacer 5.2|3481395|27|NC_016779|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 6, identity: 0.778

tactggcgctactggacctcaaggcgt	CRISPR spacer
cactggtgctactggtcctcaaggtaa	Protospacer
.*****.******** ********..

688. spacer 5.3|3481440|27|NC_016779|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 6, identity: 0.778

tactggcgctactggacctcaaggcgt	CRISPR spacer
aactggtgctactggaccccaaggttc	Protospacer
 *****.***********.*****. .

689. spacer 5.3|3481440|27|NC_016779|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 6, identity: 0.778

tactggcgctactggacctcaaggcgt	CRISPR spacer
aactggtgctactggaccccaaggttc	Protospacer
 *****.***********.*****. .

690. spacer 5.3|3481440|27|NC_016779|CRT matches to AP014476 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, *** SEQUENCING IN PROGRESS ***, 2 ordered pieces) position: , mismatch: 6, identity: 0.778

tactggcgctactggacctcaaggcgt	CRISPR spacer
aacaggcgctactggtcctcaaggacc	Protospacer
 ** *********** ********  .

691. spacer 5.3|3481440|27|NC_016779|CRT matches to AP013959 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S31-C107, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.778

tactggcgctactggacctcaaggcgt	CRISPR spacer
aactggtgctactggccctcaaggtcc	Protospacer
 *****.******** ********. .

692. spacer 5.3|3481440|27|NC_016779|CRT matches to AP013942 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.778

tactggcgctactggacctcaaggcgt	CRISPR spacer
aacaggcgctactggtcctcaaggacc	Protospacer
 ** *********** ********  .

693. spacer 5.3|3481440|27|NC_016779|CRT matches to AP013565 (Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5F-MedDCM-OCT-S40-C10, *** SEQUENCING IN PROGRESS ***, 2 ordered pieces) position: , mismatch: 6, identity: 0.778

tactggcgctactggacctcaaggcgt	CRISPR spacer
aactggtgctactggccctcaaggtcc	Protospacer
 *****.******** ********. .

694. spacer 5.3|3481440|27|NC_016779|CRT matches to AP013944 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.778

tactggcgctactggacctcaaggcgt	CRISPR spacer
aacaggcgctactggtcctcaaggacc	Protospacer
 ** *********** ********  .

695. spacer 5.3|3481440|27|NC_016779|CRT matches to AP013956 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S27-C232, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.778

tactggcgctactggacctcaaggcgt	CRISPR spacer
aactggtgctactggccctcaaggtcc	Protospacer
 *****.******** ********. .

696. spacer 5.3|3481440|27|NC_016779|CRT matches to AP013963 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S38-C146, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.778

tactggcgctactggacctcaaggcgt	CRISPR spacer
aactggtgctactggccctcaaggtcc	Protospacer
 *****.******** ********. .

697. spacer 5.3|3481440|27|NC_016779|CRT matches to AP013945 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.778

tactggcgctactggacctcaaggcgt	CRISPR spacer
aacaggcgctactggtcctcaaggacc	Protospacer
 ** *********** ********  .

698. spacer 5.3|3481440|27|NC_016779|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 6, identity: 0.778

tactggcgctactggacctcaaggcgt	CRISPR spacer
cactggtgctactggtcctcaaggtaa	Protospacer
.*****.******** ********..

699. spacer 5.3|3481440|27|NC_016779|CRT matches to AP013961 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S34-C156, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.778

tactggcgctactggacctcaaggcgt	CRISPR spacer
aactggtgctactggccctcaaggtcc	Protospacer
 *****.******** ********. .

700. spacer 5.3|3481440|27|NC_016779|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 6, identity: 0.778

tactggcgctactggacctcaaggcgt	CRISPR spacer
cactggtgctactggtcctcaaggtaa	Protospacer
.*****.******** ********..

701. spacer 5.5|3481521|27|NC_016779|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 6, identity: 0.778

tactggcgctactggacctcaaggcgt	CRISPR spacer
aactggtgctactggaccccaaggttc	Protospacer
 *****.***********.*****. .

702. spacer 5.5|3481521|27|NC_016779|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 6, identity: 0.778

tactggcgctactggacctcaaggcgt	CRISPR spacer
aactggtgctactggaccccaaggttc	Protospacer
 *****.***********.*****. .

703. spacer 5.5|3481521|27|NC_016779|CRT matches to AP014476 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, *** SEQUENCING IN PROGRESS ***, 2 ordered pieces) position: , mismatch: 6, identity: 0.778

tactggcgctactggacctcaaggcgt	CRISPR spacer
aacaggcgctactggtcctcaaggacc	Protospacer
 ** *********** ********  .

704. spacer 5.5|3481521|27|NC_016779|CRT matches to AP013959 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S31-C107, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.778

tactggcgctactggacctcaaggcgt	CRISPR spacer
aactggtgctactggccctcaaggtcc	Protospacer
 *****.******** ********. .

705. spacer 5.5|3481521|27|NC_016779|CRT matches to AP013942 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.778

tactggcgctactggacctcaaggcgt	CRISPR spacer
aacaggcgctactggtcctcaaggacc	Protospacer
 ** *********** ********  .

706. spacer 5.5|3481521|27|NC_016779|CRT matches to AP013565 (Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5F-MedDCM-OCT-S40-C10, *** SEQUENCING IN PROGRESS ***, 2 ordered pieces) position: , mismatch: 6, identity: 0.778

tactggcgctactggacctcaaggcgt	CRISPR spacer
aactggtgctactggccctcaaggtcc	Protospacer
 *****.******** ********. .

707. spacer 5.5|3481521|27|NC_016779|CRT matches to AP013944 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.778

tactggcgctactggacctcaaggcgt	CRISPR spacer
aacaggcgctactggtcctcaaggacc	Protospacer
 ** *********** ********  .

708. spacer 5.5|3481521|27|NC_016779|CRT matches to AP013956 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S27-C232, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.778

tactggcgctactggacctcaaggcgt	CRISPR spacer
aactggtgctactggccctcaaggtcc	Protospacer
 *****.******** ********. .

709. spacer 5.5|3481521|27|NC_016779|CRT matches to AP013963 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S38-C146, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.778

tactggcgctactggacctcaaggcgt	CRISPR spacer
aactggtgctactggccctcaaggtcc	Protospacer
 *****.******** ********. .

710. spacer 5.5|3481521|27|NC_016779|CRT matches to AP013945 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.778

tactggcgctactggacctcaaggcgt	CRISPR spacer
aacaggcgctactggtcctcaaggacc	Protospacer
 ** *********** ********  .

711. spacer 5.5|3481521|27|NC_016779|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 6, identity: 0.778

tactggcgctactggacctcaaggcgt	CRISPR spacer
cactggtgctactggtcctcaaggtaa	Protospacer
.*****.******** ********..

712. spacer 5.5|3481521|27|NC_016779|CRT matches to AP013961 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S34-C156, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.778

tactggcgctactggacctcaaggcgt	CRISPR spacer
aactggtgctactggccctcaaggtcc	Protospacer
 *****.******** ********. .

713. spacer 5.5|3481521|27|NC_016779|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 6, identity: 0.778

tactggcgctactggacctcaaggcgt	CRISPR spacer
cactggtgctactggtcctcaaggtaa	Protospacer
.*****.******** ********..

714. spacer 5.6|3481566|27|NC_016779|CRT matches to NZ_AP018204 (Leptolyngbya boryana NIES-2135 plasmid plasmid1 DNA, complete genome) position: , mismatch: 6, identity: 0.778

tactggcgctactggacctcagggtgt	CRISPR spacer
gactggcactactggatctcagggcta	Protospacer
 ******.********.*******.

715. spacer 5.6|3481566|27|NC_016779|CRT matches to MN693099 (Marine virus AFVG_25M184, complete genome) position: , mismatch: 6, identity: 0.778

tactggcgctactggacctcagggtgt	CRISPR spacer
aactggtgctactggacctcaaggacc	Protospacer
 *****.**************.**  .

716. spacer 5.6|3481566|27|NC_016779|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 6, identity: 0.778

tactggcgctactggacctcagggtgt	CRISPR spacer
aactggtgctactggacctcaaggacc	Protospacer
 *****.**************.**  .

717. spacer 5.6|3481566|27|NC_016779|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.778

tactggcgctactggacctcagggtgt	CRISPR spacer
aactggtgctactggacctcaaggacc	Protospacer
 *****.**************.**  .

718. spacer 5.7|3481611|27|NC_016779|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 6, identity: 0.778

taccggtgccactggacctcaaggtat	CRISPR spacer
aactggtgctactggacctcaaggacc	Protospacer
 **.*****.**************  .

719. spacer 5.7|3481611|27|NC_016779|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.778

taccggtgccactggacctcaaggtat	CRISPR spacer
aactggtgctactggacctcaaggacc	Protospacer
 **.*****.**************  .

720. spacer 5.7|3481611|27|NC_016779|CRT matches to MN693099 (Marine virus AFVG_25M184, complete genome) position: , mismatch: 6, identity: 0.778

taccggtgccactggacctcaaggtat	CRISPR spacer
aactggtgctactggacctcaaggacc	Protospacer
 **.*****.**************  .

721. spacer 5.7|3481611|27|NC_016779|CRT matches to MN693189 (Marine virus AFVG_25M326, complete genome) position: , mismatch: 6, identity: 0.778

taccggtgccactggacctcaaggtat	CRISPR spacer
tcaaggtgctactggacctcaaggtcc	Protospacer
*   *****.*************** .

722. spacer 5.7|3481611|27|NC_016779|CRT matches to NC_021795 (Cellulophaga phage phi17:1, complete genome) position: , mismatch: 6, identity: 0.778

taccggtgccactggacctcaaggtat	CRISPR spacer
acaaggtgagactggacctcaaggtat	Protospacer
    ****  *****************

723. spacer 5.8|3481656|27|NC_016779|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 6, identity: 0.778

tactggcgctactggacctcaaggcgt	CRISPR spacer
aactggtgctactggaccccaaggttc	Protospacer
 *****.***********.*****. .

724. spacer 5.8|3481656|27|NC_016779|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 6, identity: 0.778

tactggcgctactggacctcaaggcgt	CRISPR spacer
aactggtgctactggaccccaaggttc	Protospacer
 *****.***********.*****. .

725. spacer 5.8|3481656|27|NC_016779|CRT matches to AP014476 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, *** SEQUENCING IN PROGRESS ***, 2 ordered pieces) position: , mismatch: 6, identity: 0.778

tactggcgctactggacctcaaggcgt	CRISPR spacer
aacaggcgctactggtcctcaaggacc	Protospacer
 ** *********** ********  .

726. spacer 5.8|3481656|27|NC_016779|CRT matches to AP013959 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S31-C107, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.778

tactggcgctactggacctcaaggcgt	CRISPR spacer
aactggtgctactggccctcaaggtcc	Protospacer
 *****.******** ********. .

727. spacer 5.8|3481656|27|NC_016779|CRT matches to AP013942 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.778

tactggcgctactggacctcaaggcgt	CRISPR spacer
aacaggcgctactggtcctcaaggacc	Protospacer
 ** *********** ********  .

728. spacer 5.8|3481656|27|NC_016779|CRT matches to AP013565 (Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5F-MedDCM-OCT-S40-C10, *** SEQUENCING IN PROGRESS ***, 2 ordered pieces) position: , mismatch: 6, identity: 0.778

tactggcgctactggacctcaaggcgt	CRISPR spacer
aactggtgctactggccctcaaggtcc	Protospacer
 *****.******** ********. .

729. spacer 5.8|3481656|27|NC_016779|CRT matches to AP013944 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.778

tactggcgctactggacctcaaggcgt	CRISPR spacer
aacaggcgctactggtcctcaaggacc	Protospacer
 ** *********** ********  .

730. spacer 5.8|3481656|27|NC_016779|CRT matches to AP013956 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S27-C232, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.778

tactggcgctactggacctcaaggcgt	CRISPR spacer
aactggtgctactggccctcaaggtcc	Protospacer
 *****.******** ********. .

731. spacer 5.8|3481656|27|NC_016779|CRT matches to AP013963 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S38-C146, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.778

tactggcgctactggacctcaaggcgt	CRISPR spacer
aactggtgctactggccctcaaggtcc	Protospacer
 *****.******** ********. .

732. spacer 5.8|3481656|27|NC_016779|CRT matches to AP013945 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.778

tactggcgctactggacctcaaggcgt	CRISPR spacer
aacaggcgctactggtcctcaaggacc	Protospacer
 ** *********** ********  .

733. spacer 5.8|3481656|27|NC_016779|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 6, identity: 0.778

tactggcgctactggacctcaaggcgt	CRISPR spacer
cactggtgctactggtcctcaaggtaa	Protospacer
.*****.******** ********..

734. spacer 5.8|3481656|27|NC_016779|CRT matches to AP013961 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5F-MedDCM-OCT-S34-C156, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.778

tactggcgctactggacctcaaggcgt	CRISPR spacer
aactggtgctactggccctcaaggtcc	Protospacer
 *****.******** ********. .

735. spacer 5.8|3481656|27|NC_016779|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 6, identity: 0.778

tactggcgctactggacctcaaggcgt	CRISPR spacer
cactggtgctactggtcctcaaggtaa	Protospacer
.*****.******** ********..

736. spacer 5.9|3481701|27|NC_016779|CRT matches to NZ_CP054613 (Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence) position: , mismatch: 6, identity: 0.778

tactggtgccactggacctcaaggtgt	CRISPR spacer
agctggtgcaactggaccgcaaggtcc	Protospacer
 .******* ******** ****** .

737. spacer 5.9|3481701|27|NC_016779|CRT matches to NZ_CP054613 (Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence) position: , mismatch: 6, identity: 0.778

tactggtgccactggacctcaaggtgt	CRISPR spacer
agctggtgcaactggaccgcaaggtcc	Protospacer
 .******* ******** ****** .

738. spacer 5.9|3481701|27|NC_016779|CRT matches to MN693189 (Marine virus AFVG_25M326, complete genome) position: , mismatch: 6, identity: 0.778

tactggtgccactggacctcaaggtgt	CRISPR spacer
tcaaggtgctactggacctcaaggtcc	Protospacer
*   *****.*************** .

739. spacer 5.9|3481701|27|NC_016779|CRT matches to MN234235 (Mycobacterium phage BogosyJay, complete genome) position: , mismatch: 6, identity: 0.778

tactggtgccactggacctcaaggtgt	CRISPR spacer
gactggtgccactggcgctcaaggccc	Protospacer
 **************  *******. .

740. spacer 5.10|3481746|27|NC_016779|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.778

taccggtgccactggacctcaaggtgt	CRISPR spacer
aactggtgctactggacctcaaggacc	Protospacer
 **.*****.**************  .

741. spacer 5.10|3481746|27|NC_016779|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 6, identity: 0.778

taccggtgccactggacctcaaggtgt	CRISPR spacer
aactggtgctactggacctcaaggacc	Protospacer
 **.*****.**************  .

742. spacer 5.10|3481746|27|NC_016779|CRT matches to MN693189 (Marine virus AFVG_25M326, complete genome) position: , mismatch: 6, identity: 0.778

taccggtgccactggacctcaaggtgt	CRISPR spacer
tcaaggtgctactggacctcaaggtcc	Protospacer
*   *****.*************** .

743. spacer 5.10|3481746|27|NC_016779|CRT matches to MN693099 (Marine virus AFVG_25M184, complete genome) position: , mismatch: 6, identity: 0.778

taccggtgccactggacctcaaggtgt	CRISPR spacer
aactggtgctactggacctcaaggacc	Protospacer
 **.*****.**************  .

744. spacer 5.13|3481881|27|NC_016779|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.778

taccggtgccactggacctcaaggtgt	CRISPR spacer
aactggtgctactggacctcaaggacc	Protospacer
 **.*****.**************  .

745. spacer 5.13|3481881|27|NC_016779|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 6, identity: 0.778

taccggtgccactggacctcaaggtgt	CRISPR spacer
aactggtgctactggacctcaaggacc	Protospacer
 **.*****.**************  .

746. spacer 5.13|3481881|27|NC_016779|CRT matches to MN693189 (Marine virus AFVG_25M326, complete genome) position: , mismatch: 6, identity: 0.778

taccggtgccactggacctcaaggtgt	CRISPR spacer
tcaaggtgctactggacctcaaggtcc	Protospacer
*   *****.*************** .

747. spacer 5.13|3481881|27|NC_016779|CRT matches to MN693099 (Marine virus AFVG_25M184, complete genome) position: , mismatch: 6, identity: 0.778

taccggtgccactggacctcaaggtgt	CRISPR spacer
aactggtgctactggacctcaaggacc	Protospacer
 **.*****.**************  .

748. spacer 5.16|3482007|27|NC_016779|CRT matches to MN693189 (Marine virus AFVG_25M326, complete genome) position: , mismatch: 6, identity: 0.778

tactggcgctactggacctcaaggtgc	CRISPR spacer
acaaggacctactggacctcaaggtgc	Protospacer
    **  *******************

749. spacer 5.16|3482007|27|NC_016779|CRT matches to GU943042 (Uncultured phage MedDCM-OCT-S09-C399 genomic sequence) position: , mismatch: 6, identity: 0.778

tactggcgctactggacctcaaggtgc	CRISPR spacer
ggatggagctactggacctcaagggcc	Protospacer
 . *** *****************  *

750. spacer 2.5|1382995|27|NC_016779|CRT matches to AB276040 (Ralstonia phage RSA1 DNA, complete genome) position: , mismatch: 7, identity: 0.741

gtccttgagcacctgtagcgccagtag	CRISPR spacer
ttccttgagcacctgtagcggcgtgcc	Protospacer
 ******************* *.

751. spacer 2.5|1382995|27|NC_016779|CRT matches to NC_009382 (Ralstonia phage phiRSA1, complete genome) position: , mismatch: 7, identity: 0.741

gtccttgagcacctgtagcgccagtag	CRISPR spacer
ttccttgagcacctgtagcggcgtgcc	Protospacer
 ******************* *.

752. spacer 2.11|1383301|27|NC_016779|CRT matches to AB276040 (Ralstonia phage RSA1 DNA, complete genome) position: , mismatch: 7, identity: 0.741

gtccttgagcacctgtagcgccagtag	CRISPR spacer
ttccttgagcacctgtagcggcgtgcc	Protospacer
 ******************* *.

753. spacer 2.11|1383301|27|NC_016779|CRT matches to NC_009382 (Ralstonia phage phiRSA1, complete genome) position: , mismatch: 7, identity: 0.741

gtccttgagcacctgtagcgccagtag	CRISPR spacer
ttccttgagcacctgtagcggcgtgcc	Protospacer
 ******************* *.

754. spacer 5.2|3481395|27|NC_016779|CRT matches to GU943042 (Uncultured phage MedDCM-OCT-S09-C399 genomic sequence) position: , mismatch: 7, identity: 0.741

tactggcgctactggacctcaaggcgt	CRISPR spacer
ggatggagctactggacctcaagggcc	Protospacer
 . *** *****************  .

755. spacer 5.3|3481440|27|NC_016779|CRT matches to GU943042 (Uncultured phage MedDCM-OCT-S09-C399 genomic sequence) position: , mismatch: 7, identity: 0.741

tactggcgctactggacctcaaggcgt	CRISPR spacer
ggatggagctactggacctcaagggcc	Protospacer
 . *** *****************  .

756. spacer 5.5|3481521|27|NC_016779|CRT matches to GU943042 (Uncultured phage MedDCM-OCT-S09-C399 genomic sequence) position: , mismatch: 7, identity: 0.741

tactggcgctactggacctcaaggcgt	CRISPR spacer
ggatggagctactggacctcaagggcc	Protospacer
 . *** *****************  .

757. spacer 5.8|3481656|27|NC_016779|CRT matches to GU943042 (Uncultured phage MedDCM-OCT-S09-C399 genomic sequence) position: , mismatch: 7, identity: 0.741

tactggcgctactggacctcaaggcgt	CRISPR spacer
ggatggagctactggacctcaagggcc	Protospacer
 . *** *****************  .

758. spacer 5.11|3481791|27|NC_016779|CRT matches to MK448998 (Streptococcus phage Javan636, complete genome) position: , mismatch: 7, identity: 0.741

taccggtgctactggacctcaaggtgt	CRISPR spacer
acaaggtgctactggacctcaaggacc	Protospacer
    ********************  .

759. spacer 5.11|3481791|27|NC_016779|CRT matches to MK448821 (Streptococcus phage Javan623, complete genome) position: , mismatch: 7, identity: 0.741

taccggtgctactggacctcaaggtgt	CRISPR spacer
acaaggtgctactggacctcaaggacc	Protospacer
    ********************  .

760. spacer 5.12|3481836|27|NC_016779|CRT matches to MK448998 (Streptococcus phage Javan636, complete genome) position: , mismatch: 7, identity: 0.741

taccggtgctactggacctcaaggtgt	CRISPR spacer
acaaggtgctactggacctcaaggacc	Protospacer
    ********************  .

761. spacer 5.12|3481836|27|NC_016779|CRT matches to MK448821 (Streptococcus phage Javan623, complete genome) position: , mismatch: 7, identity: 0.741

taccggtgctactggacctcaaggtgt	CRISPR spacer
acaaggtgctactggacctcaaggacc	Protospacer
    ********************  .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

299347 : 307724

Synechococcus_phage(33.33%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000625683.1\|299347_300655_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	6.4e-21	25.3
WP_001170542.1\|300743_301463_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	G8EYA2	Synechococcus_phage	5.2e-49	44.3
WP_000278823.1\|301455_301710_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_000666776.1\|301706_302390_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_000055577.1\|302373_304593_+	phosphoribosylformylglycinamidine synthase II	A6N228	Microbacterium_phage	1.7e-162	41.2
WP_000879029.1\|304577_305993_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	7.3e-55	35.4
WP_001262436.1\|306099_307140_+	phosphoribosylformylglycinamidine cyclo-ligase	Q58MH8	Prochlorococcus_phage	9.4e-68	46.4
WP_000088592.1\|307136_307724_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.2e-27	37.1

DBSCAN-SWA_2

1815024 : 1824343

Bacillus_phage(71.43%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000755546.1\|1815024_1816287_+	C40 family peptidase	A0A1V0DZX6	Clostridioides_phage	6.8e-12	32.0
WP_001194301.1\|1816385_1817150_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_000453763.1\|1817390_1819151_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	4.4e-267	95.9
WP_171856546.1\|1819212_1819917_+	response regulator	W8CYM9	Bacillus_phage	5.0e-121	93.6
WP_001231497.1\|1819913_1820987_+	membrane protein	W8CYF6	Bacillus_phage	1.2e-169	87.4
WP_000823554.1\|1821011_1821599_-	DUF3139 domain-containing protein	NA	NA	NA	NA
WP_000818985.1\|1821795_1822515_+	3-ketoacyl-ACP reductase	W8CYX9	Bacillus_phage	5.9e-61	100.0
WP_000103838.1\|1822664_1823336_+	O-methyltransferase	W8CYT3	Bacillus_phage	6.5e-62	86.9
WP_001258513.1\|1823470_1824343_+	aminoglycoside 6-adenylyltransferase	A0A1X9I6F2	Streptococcus_phage	2.7e-68	46.6

DBSCAN-SWA_3

2572300 : 2579506

Geobacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001065242.1\|2572300_2573668_-	lytic polysaccharide monooxygenase	A0A0K1Y848	Apis_mellifera_filamentous_virus	9.6e-20	38.1
WP_000720567.1\|2574105_2574624_-	DNA topology modulation protein	A0A097BYE2	Leuconostoc_phage	9.5e-45	47.3
WP_001093444.1\|2574833_2575220_-	DUF2809 domain-containing protein	NA	NA	NA	NA
WP_000655496.1\|2575285_2575993_-	class I SAM-dependent methyltransferase	A0A1X9I6N4	Streptococcus_phage	1.0e-17	27.0
WP_000994639.1\|2576014_2576368_-	MmcQ/YjbR family DNA-binding protein	NA	NA	NA	NA
WP_000288934.1\|2576381_2576786_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_000714659.1\|2577033_2578419_+	S-layer homology domain-containing protein	Q0H255	Geobacillus_phage	7.8e-78	59.9
WP_000820167.1\|2578421_2578634_+	DUF3006 domain-containing protein	Q0H256	Geobacillus_phage	7.3e-12	54.4
WP_000540634.1\|2578699_2579506_-	N-acetylmuramoyl-L-alanine amidase	D2XR33	Bacillus_phage	6.5e-109	69.7

DBSCAN-SWA_4

3298576 : 3310620

Bacillus_phage(69.23%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000966323.1\|3298576_3299134_+	CatB-related O-acetyltransferase	M1HKK6	Paramecium_bursaria_Chlorella_virus	3.4e-40	52.1
WP_000570190.1\|3300480_3300720_-	hypothetical protein	A0A0A7AR38	Bacillus_phage	2.2e-25	73.4
WP_000348873.1\|3300719_3300956_-	hemolysin XhlA family protein	A0A2H4J382	uncultured_Caudovirales_phage	3.1e-11	80.8
WP_000185566.1\|3301034_3301331_-	hypothetical protein	NA	NA	NA	NA
WP_001051364.1\|3301714_3302677_-	M23 family metallopeptidase	A0A2D0WXW0	Clostridium_phage	4.4e-11	39.3
WP_000025239.1\|3302783_3303902_-	lysozyme family protein	A0A223LKM8	Bacillus_phage	2.1e-33	43.7
WP_000716767.1\|3304300_3305353_-	glycoside hydrolase family 25 protein	A7KV11	Bacillus_phage	6.2e-67	48.3
WP_001051382.1\|3305485_3306370_-	M23 family metallopeptidase	A0A1D8EVX2	Mycobacterium_phage	6.2e-12	27.2
WP_000525559.1\|3306635_3307652_-	lysozyme family protein	A0A1B1PAK0	Bacillus_phage	9.0e-31	36.4
WP_000460739.1\|3307890_3308277_-	hypothetical protein	A0A288WG73	Bacillus_phage	3.4e-47	69.8
WP_000510875.1\|3308377_3309280_-	DnaD domain protein	A0A1C8E9B4	Bacillus_phage	3.9e-70	61.6
WP_000527104.1\|3309366_3309603_-	helix-turn-helix transcriptional regulator	W8CYU0	Bacillus_phage	2.4e-11	56.9
WP_000579786.1\|3309740_3310169_+	helix-turn-helix transcriptional regulator	Q786F1	Bacillus_phage	2.1e-29	50.7
WP_000673786.1\|3310191_3310620_+	ImmA/IrrE family metallo-endopeptidase	Q9T201	Bacillus_phage	1.6e-34	55.1

DBSCAN-SWA_5

4128814 : 4194892

uncultured_Mediterranean_phage(36.36%)

coat,protease,bacteriocin,integrase,tRNA

attL 4145214:4145229|attR 4189786:4189801

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000903175.1\|4128814_4129582_-\|tRNA	tRNA threonylcarbamoyladenosine dehydratase	NA	NA	NA	NA
WP_000840895.1\|4129931_4131707_-\|tRNA	aspartate--tRNA ligase	A0A1V0SIS0	Klosneuvirus	7.1e-15	33.1
WP_033681243.1\|4131719_4132991_-\|tRNA	histidine--tRNA ligase	NA	NA	NA	NA
WP_001242605.1\|4133345_4133522_-	hypothetical protein	NA	NA	NA	NA
WP_001266956.1\|4133707_4134148_-\|tRNA	D-tyrosyl-tRNA(Tyr) deacylase	NA	NA	NA	NA
WP_001262809.1\|4134165_4136349_-	GTP diphosphokinase	A0A1B1IUF0	uncultured_Mediterranean_phage	2.4e-12	36.5
WP_000346214.1\|4136559_4137072_-	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	6.5e-30	43.8
WP_000941267.1\|4137119_4139459_-	single-stranded-DNA-specific exonuclease RecJ	A7KV88	Bacillus_phage	2.0e-86	33.2
WP_000409725.1\|4139560_4140454_-	cation transporter	NA	NA	NA	NA
WP_049804378.1\|4140607_4142833_-	protein translocase subunit SecDF	A0A1B1IVP7	uncultured_Mediterranean_phage	3.2e-33	36.0
WP_000886975.1\|4143141_4143426_-	post-transcriptional regulator	NA	NA	NA	NA
WP_000198280.1\|4143600_4145160_+	stage V sporulation protein B	NA	NA	NA	NA
WP_000455389.1\|4145189_4145837_-	DUF421 domain-containing protein	NA	NA	NA	NA
4145214:4145229	attL	NA	NA	NA	NA
WP_000349134.1\|4145940_4146324_+	TIGR04086 family membrane protein	NA	NA	NA	NA
WP_000991116.1\|4146360_4146621_-	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	2.5e-06	46.3
WP_000125362.1\|4146648_4147788_-\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	2.5e-82	42.1
WP_000138162.1\|4148874_4149075_-	DUF2905 domain-containing protein	NA	NA	NA	NA
WP_000344460.1\|4149071_4150073_-	Holliday junction branch migration DNA helicase RuvB	A0A127AWE7	Bacillus_phage	1.2e-08	27.2
WP_000464508.1\|4150078_4150696_-	Holliday junction DNA helicase RuvA	NA	NA	NA	NA
WP_000823597.1\|4150884_4151829_+	iron-hydroxamate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_000871185.1\|4151841_4152372_-	BofC C-terminal domain-containing protein	NA	NA	NA	NA
WP_001079930.1\|4152492_4153422_-	DMT family transporter	NA	NA	NA	NA
WP_000426920.1\|4153489_4153810_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_049804381.1\|4154215_4154689_+	branched-chain amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_001093533.1\|4154722_4155367_-	YhcN/YlaJ family sporulation lipoprotein	NA	NA	NA	NA
WP_000690812.1\|4155545_4157393_-\|coat	spore coat assembly protein ExsA	NA	NA	NA	NA
WP_000025293.1\|4157767_4158874_-	quinolinate synthase NadA	NA	NA	NA	NA
WP_001092222.1\|4158904_4159738_-	carboxylating nicotinate-nucleotide diphosphorylase	NA	NA	NA	NA
WP_001138513.1\|4159757_4161287_-	L-aspartate oxidase	NA	NA	NA	NA
WP_000973787.1\|4161439_4162582_+	IscS subfamily cysteine desulfurase	A0A1X7QGF3	Faustovirus	7.7e-31	28.9
WP_000812272.1\|4162581_4163124_+	transcription repressor NadR	NA	NA	NA	NA
WP_000510695.1\|4163205_4163853_+	MOSC domain-containing protein	NA	NA	NA	NA
WP_000621722.1\|4163934_4164786_-	prephenate dehydratase	NA	NA	NA	NA
WP_001026352.1\|4164884_4166801_-	ABC transporter permease	NA	NA	NA	NA
WP_001011371.1\|4166850_4168773_-	ABC transporter permease	NA	NA	NA	NA
WP_000114531.1\|4168747_4169524_-	ABC transporter ATP-binding protein	W5SAS9	Pithovirus	1.2e-19	31.0
WP_000865392.1\|4169617_4170700_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_000276720.1\|4170689_4171397_-	response regulator transcription factor	NA	NA	NA	NA
WP_000496111.1\|4171536_4172823_-	GTPase ObgE	NA	NA	NA	NA
WP_001037006.1\|4172822_4173371_-	Spo0B domain-containing protein	NA	NA	NA	NA
WP_000944957.1\|4173434_4173725_-	50S ribosomal protein L27	NA	NA	NA	NA
WP_001973720.1\|4173728_4174073_-\|protease	ribosomal-processing cysteine protease Prp	NA	NA	NA	NA
WP_000270907.1\|4174084_4174393_-	50S ribosomal protein L21	NA	NA	NA	NA
WP_000855457.1\|4174562_4175951_-	Rne/Rng family ribonuclease	NA	NA	NA	NA
WP_000599074.1\|4176018_4176879_-\|protease	stage IV sporulation intramembrane metalloprotease SpoIVFB	NA	NA	NA	NA
WP_000797461.1\|4176871_4177618_-	stage IV sporulation protein SpoIVFA	NA	NA	NA	NA
WP_000503310.1\|4177751_4178549_-	septum site-determining protein MinD	NA	NA	NA	NA
WP_000391517.1\|4178551_4179238_-	septum site-determining protein MinC	NA	NA	NA	NA
WP_000975753.1\|4179273_4179819_-	rod shape-determining protein MreD	NA	NA	NA	NA
WP_001135493.1\|4179833_4180685_-	rod shape-determining protein MreC	NA	NA	NA	NA
WP_000466737.1\|4180726_4181746_-	rod shape-determining protein MreB	NA	NA	NA	NA
WP_000362816.1\|4182177_4183599_+	hypothetical protein	NA	NA	NA	NA
WP_000907108.1\|4183558_4186600_+	hypothetical protein	NA	NA	NA	NA
WP_000913004.1\|4186629_4188393_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_001087617.1\|4188379_4189132_+	hypothetical protein	NA	NA	NA	NA
WP_000426688.1\|4189657_4190056_+	RidA family protein	NA	NA	NA	NA
4189786:4189801	attR	NA	NA	NA	NA
WP_000081955.1\|4190689_4192057_-	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_000051676.1\|4192084_4194277_-	peptidase domain-containing ABC transporter	W8CYL7	Bacillus_phage	5.3e-44	27.7
WP_000849670.1\|4194486_4194663_-\|bacteriocin	class IIb bacteriocin, lactobin A/cerein 7B family	NA	NA	NA	NA
WP_001089676.1\|4194685_4194892_-\|bacteriocin	class IIb bacteriocin, lactobin A/cerein 7B family	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NC_016794

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

2571 : 18360

Bacillus_phage(76.19%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000529720.1\|2571_3201_-	Holliday junction resolvase RecU	A0A2H4J3A4	uncultured_Caudovirales_phage	1.3e-48	59.9
WP_001114347.1\|3203_3383_-	hypothetical protein	NA	NA	NA	NA
WP_001292053.1\|3407_3596_-	hypothetical protein	NA	NA	NA	NA
WP_049804382.1\|3598_3790_-	hypothetical protein	NA	NA	NA	NA
WP_014315615.1\|5831_6041_-	hypothetical protein	I1TLG8	Bacillus_phage	6.7e-34	97.1
WP_001053654.1\|6248_6695_-	dUTP diphosphatase	A0A0U3SLD3	Bacillus_phage	2.5e-70	90.5
WP_000712298.1\|6708_6876_-	hypothetical protein	A0A0U3SD36	Bacillus_phage	4.9e-19	96.4
WP_000434343.1\|6943_7069_-	Fur-regulated basic protein FbpA	A0A1B1P8B6	Bacillus_phage	2.4e-10	75.6
WP_000219523.1\|7077_7791_-	hypothetical protein	B5LPM7	Bacillus_virus	6.9e-38	50.8
WP_000811957.1\|7802_8066_-	hypothetical protein	A0A1B1P7U6	Bacillus_phage	7.2e-25	64.4
WP_011731652.1\|8062_8350_-	helix-turn-helix domain containing protein	A0A1B1P7W1	Bacillus_phage	6.4e-35	80.0
WP_000332351.1\|8264_8528_-	hypothetical protein	A0A1B1P8D7	Bacillus_phage	3.8e-18	70.7
WP_041184387.1\|8540_9422_-	ATP-binding protein	Q2I8C8	Bacillus_phage	1.9e-85	55.2
WP_000073890.1\|9372_10188_-	conserved phage C-terminal domain-containing protein	A0A1W6JP67	Staphylococcus_phage	1.4e-58	54.5
WP_000487937.1\|10188_10410_-	hypothetical protein	NA	NA	NA	NA
WP_001043060.1\|10609_11284_-	ERF family protein	A0A0M3ULL1	Bacillus_phage	2.5e-61	57.9
WP_000655888.1\|11774_11924_-	hypothetical protein	A0A0M5M3T1	Bacillus_phage	1.8e-09	72.1
WP_001006520.1\|12381_13152_-	phage antirepressor Ant	A0A2H4PQV4	Staphylococcus_phage	4.2e-57	45.1
WP_080011779.1\|13191_13413_-	helix-turn-helix transcriptional regulator	Q0H243	Geobacillus_phage	7.4e-07	50.0
WP_000578778.1\|13544_13895_+	helix-turn-helix transcriptional regulator	A0A0U3SD25	Bacillus_phage	6.9e-23	49.6
WP_000721629.1\|14215_14365_-	hypothetical protein	NA	NA	NA	NA
WP_001189353.1\|14404_15553_-	hypothetical protein	A0A0S2MVK2	Bacillus_phage	1.8e-51	33.8
WP_000859164.1\|16049_16397_+	helix-turn-helix transcriptional regulator	A0A1B1P888	Bacillus_phage	8.3e-21	46.3
WP_000448836.1\|16593_17298_+	DUF4352 domain-containing protein	A0A1B1P898	Bacillus_phage	2.7e-58	90.4
WP_000831284.1\|17317_17662_+	DUF4064 domain-containing protein	A0A0S2MVJ2	Bacillus_phage	2.0e-43	80.7
WP_000451516.1\|17796_18360_+	DUF4352 domain-containing protein	A0A0S2MVG4	Bacillus_phage	1.6e-37	50.0

DBSCAN-SWA_2

31484 : 54035

Bacillus_phage(42.86%)

holin,terminase,plate,portal,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000272603.1\|31484_32750_+	Y-family DNA polymerase	O64031	Bacillus_phage	1.3e-108	48.8
WP_001057806.1\|32746_33088_+	YolD-like family protein	NA	NA	NA	NA
WP_000249943.1\|33258_34668_+	WXG100 family type VII secretion target	A0A2H4J389	uncultured_Caudovirales_phage	1.7e-19	37.8
WP_000998625.1\|34686_34986_+	hypothetical protein	NA	NA	NA	NA
WP_001266379.1\|35086_35848_-	N-acetylmuramoyl-L-alanine amidase	A0A1B1P7G0	Bacillus_phage	1.0e-124	85.4
WP_000373905.1\|35847_36273_-\|holin	phage holin family protein	D2XPZ9	Bacillus_virus	2.7e-69	96.5
WP_001152006.1\|36364_37075_-	hypothetical protein	A0A2H4J9X9	uncultured_Caudovirales_phage	2.0e-53	67.4
WP_000807983.1\|37088_38426_-\|plate	BppU family phage baseplate upper protein	B5LPS6	Bacillus_virus	7.3e-81	43.6
WP_000289464.1\|38440_40738_-\|tail	phage tail protein	A0A2P1JTV8	Anoxybacillus_phage	2.1e-128	56.1
WP_000383070.1\|40749_41631_-\|tail	phage tail family protein	A0A2P1JTW0	Anoxybacillus_phage	8.2e-73	47.2
WP_041184389.1\|44377_44638_-	hypothetical protein	NA	NA	NA	NA
WP_001210045.1\|44715_45102_-	hypothetical protein	NA	NA	NA	NA
WP_000852142.1\|45168_45633_-\|tail	phage major tail protein, TP901-1 family	NA	NA	NA	NA
WP_000273212.1\|45647_46049_-	hypothetical protein	NA	NA	NA	NA
WP_000168162.1\|46051_46543_-	HK97 gp10 family phage protein	A0A249XXA4	Clostridium_phage	1.1e-39	50.9
WP_000058074.1\|46527_46920_-	DUF3599 family protein	NA	NA	NA	NA
WP_001128459.1\|46919_47309_-	DUF3199 family protein	NA	NA	NA	NA
WP_001110331.1\|47314_47482_-	YqbF domain-containing protein	NA	NA	NA	NA
WP_000746380.1\|48444_49455_-	hypothetical protein	A0A1B1P7E4	Bacillus_phage	5.9e-51	35.5
WP_001169137.1\|49501_50428_-	hypothetical protein	A0A1B1P7D7	Bacillus_phage	4.5e-45	35.3
WP_000182666.1\|50414_51953_-\|portal	phage portal protein	A0A1B1P7C8	Bacillus_phage	1.3e-94	38.6
WP_041184386.1\|51952_53269_-\|terminase	PBSX family phage terminase large subunit	A0A0S2MVC1	Bacillus_phage	1.9e-182	71.0
WP_000810415.1\|53240_54035_-	hypothetical protein	D2XPX8	Bacillus_virus	4.8e-72	72.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_016779

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NC_016794

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection