CRISPRimmunity

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NC_016511	Cutibacterium acnes TypeIA2 P.acn31, complete sequence	1 crisprs	DEDDh,DinG,csa3,WYL,cas3,cas1,cas2	0	1	0	0

1. NC_016511

CRISPR-Cas detection and classification

Crispr_ID: NC_016511_1

• CRISPR_ID: NC_016511_1
• CRISPR_location: 431151-431242
• CRISPR_type: Orphan
• Repeat_type: NA
• Spacer_info: 1 spacers

Consensus repeat of NC_016511_1

Consensus_repeat	Method
CGGTTGTTCCCATGCGAGGCTGGTTCAGCTT	CRISPRCasFinder

spacers of NC_016511_1

>1.1|431182|30|NC_016511|CRISPRCasFinder
AATCGCCGTCAAGGTCGAGAAAAAGTTTGT

CRISPR arrays and Neighbor proteins around NC_016511_1

CRISPR arrays

The CRISPR arrays of NC_016511_1

>merge|NC_016511|1|431151-431242|CRISPRCasFinder
CGGTTGTTCCCATGCGAGGCTGGTTCAGCTTAATCGCCGTCAAGGTCGAGAAAAAGTTTGTCGGTTGTTCCCATGCGAGGCTGGTTCAGCTT

>NC_016511|1|1|431151-431242|CRISPRCasFinder
CGGTTGTTCCCATGCGAGGCTGGTTCAGCTT	AATCGCCGTCAAGGTCGAGAAAAAGTTTGT
CGGTTGTTCCCATGCGAGGCTGGTTCAGCTT

Neighbor Proteins Overview

Protein	Signature genes	Signature genes Name	Protein_function
NC_016511.1|WP_002515074.1|442409_443105_-|ABC-transporter-permease-subunit	unknown	unknown	gnl|CDD|224095
NC_016511.1|WP_002518750.1|441464_442400_-|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl|CDD|270324
NC_016511.1|WP_002515092.1|429324_429678_+|hypothetical-protein	unknown	unknown	unknown
NC_016511.1|WP_014166833.1|428241_428817_+|RNA-polymerase-sigma-factor	unknown	unknown	gnl|CDD|236608
NC_016511.1|WP_002515059.1|436995_437952_+|sugar-ABC-transporter-permease	unknown	unknown	gnl|CDD|224096
NC_016511.1|WP_002520024.1|435706_436999_+|sugar-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl|CDD|270303
NC_016511.1|WP_002515101.1|431596_433033_-|L-serine-ammonia-lyase	unknown	unknown	gnl|CDD|273233
NC_016511.1|WP_002515080.1|429743_430844_-|sn-glycerol-3-phosphate-ABC-transporter-ATP-binding-protein-UgpC	unknown	unknown	gnl|CDD|236947
NC_016511.1|WP_014166835.1|437944_438835_+|carbohydrate-ABC-transporter-permease	unknown	unknown	gnl|CDD|223472
NC_016511.1|WP_002515053.1|427468_428185_+|alkaline-shock-response-membrane-anchor-protein-AmaP	unknown	unknown	gnl|CDD|380217
NC_016511.1|WP_002515081.1|426502_426916_+|Asp23/Gls24-family-envelope-stress-response-protein	unknown	unknown	gnl|CDD|377129
NC_016511.1|WP_002524701.1|440263_441448_+|glycine-C-acetyltransferase	unknown	unknown	gnl|CDD|235893
NC_016511.1|WP_014166836.1|439188_440226_+|L-threonine-3-dehydrogenase	unknown	unknown	gnl|CDD|180054
NC_016511.1|WP_014166831.1|426317_426503_+|DUF2273-domain-containing-protein	unknown	unknown	gnl|CDD|378362
NC_016511.1|WP_002517506.1|424117_425536_-|DUF4032-domain-containing-protein	unknown	unknown	gnl|CDD|379077
NC_016511.1|WP_014166832.1|426917_427472_+|hypothetical-protein	unknown	unknown	gnl|CDD|380217
NC_016511.1|WP_002515097.1|428807_429332_+|hypothetical-protein	unknown	unknown	unknown
NC_016511.1|WP_002515089.1|433057_433288_+|hypothetical-protein	unknown	unknown	unknown
NC_016511.1|WP_002530094.1|433323_435684_+|ROK-family-protein	unknown	unknown	gnl|CDD|223745
NC_016511.1|WP_002515072.1|425787_426306_+|Asp23/Gls24-family-envelope-stress-response-protein	unknown	unknown	gnl|CDD|377129

rpsblast for functional proteins

Protein	Function_ID	Function_description	E-value
NC_016511.1|WP_002515074.1|442409_443105_-|ABC-transporter-permease-subunit	gnl|CDD|224095	COG1174, OpuBB, ABC-type proline/glycine betaine transport systems, permease component [Amino acid transport and metabolism].	1.27466e-38
NC_016511.1|WP_002518750.1|441464_442400_-|ABC-transporter-substrate-binding-protein	gnl|CDD|270324	cd13606, PBP2_ProX_like, Bacterial substrate-binding protein ProX of ABC-type osmoregulated transporter and its related proteins; the type 2 periplasmic-binding protein fold. This group includes periplasmic substrate-binding component of ABC transport systems from gram-negative and -positive bacteria that are involved in uptake of osmoprotectants (also termed compatible solutes) such as betaine, choline, proline betaine, carnitine, and L-proline. To counteract the efflux of water, many microorganisms accumulate the compatible solutes for a sustained adjustment to high osmolarity surroundings. This substrate-binding domain belongs to the type 2 periplasmic binding fold protein superfamily (PBP2). The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	8.61162e-116
NC_016511.1|WP_014166833.1|428241_428817_+|RNA-polymerase-sigma-factor	gnl|CDD|236608	PRK09652, PRK09652, RNA polymerase sigma factor RpoE; Provisional.	9.24091e-32
NC_016511.1|WP_002515059.1|436995_437952_+|sugar-ABC-transporter-permease	gnl|CDD|224096	COG1175, UgpA, ABC-type sugar transport systems, permease components [Carbohydrate transport and metabolism].	5.46108e-80
NC_016511.1|WP_002515101.1|431596_433033_-|L-serine-ammonia-lyase	gnl|CDD|273233	TIGR00720, hypothetical_protein_NEICINOT_00681, L-serine dehydratase, iron-sulfur-dependent, single chain form. This enzyme is also called serine deaminase and L-serine dehydratase 1. L-serine ammonia-lyase converts serine into pyruvate in the gluconeogenesis pathway from serine. This enzyme is comprised of a single chain in Escherichia coli, Mycobacterium tuberculosis, and several other species, but has separate alpha and beta chains in Bacillus subtilis and related species. The beta and alpha chains are homologous to the N-terminal and C-terminal regions, respectively, but are rather deeply branched in a UPGMA tree. This enzyme requires iron and dithiothreitol for activation in vitro, and is a predicted 4Fe-4S protein. Escherichia coli Pseudomonas aeruginosa have two copies of this protein. [Energy metabolism, Amino acids and amines, Energy metabolism, Glycolysis/gluconeogenesis].	0
NC_016511.1|WP_002515080.1|429743_430844_-|sn-glycerol-3-phosphate-ABC-transporter-ATP-binding-protein-UgpC	gnl|CDD|236947	PRK11650, ugpC, sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC.	0
NC_016511.1|WP_014166835.1|437944_438835_+|carbohydrate-ABC-transporter-permease	gnl|CDD|223472	COG0395, UgpE, ABC-type sugar transport system, permease component [Carbohydrate transport and metabolism].	5.41479e-85
NC_016511.1|WP_002515053.1|427468_428185_+|alkaline-shock-response-membrane-anchor-protein-AmaP	gnl|CDD|380217	NF033218, anchor_AmaP, alkaline shock response membrane anchor protein AmaP. The founding member of this family, AmaP (Asp23 membrane anchoring protein), is related to Asp23 through part of its length, but includes a highly hydrophobic N-terminal region that should make it an integral membrane protein. Asp23 (alkaline shock protein of 23 kDa), described in PMID:7864904, is a cytosolic protein in Staphylococcus aureus, strongly induced by a pH shift from 7 to 10, and also recruited to the membrane. AmaP appears to be the partner protein with an integral membrane segment and the ability to anchor Asp23 to the membrane. This model was built to identify full-length homologs of AmaP, while excluding Asp23. Some but not all members of this family score above the cutoffs of Pfam model version PF03780.11, but full-length homologs of Asp23 score considerably higher. Asp23 family members previously were known as DUF322.	3.53133e-25
NC_016511.1|WP_002515081.1|426502_426916_+|Asp23/Gls24-family-envelope-stress-response-protein	gnl|CDD|377129	pfam03780, Asp23, Asp23 family, cell envelope-related function. The alkaline shock protein Asp23 was identified as an alkaline shock protein that was expressed in a sigmaB-dependent manner in Staphylococcus aureus. Following an alkaline shock Asp23 accumulates in the soluble protein fraction of the S. aureus cell. Asp23 is one of the most abundant proteins in the cytosolic protein fraction of stationary S. aureus cells, with a copy-number of >25000 per cell. A second Asp23-family protein, AmaP, which is encoded within the asp23-operon, is required to localize Asp23 to the cell membrane. The overall function for the family is thus a cell envelope-related one in Gram-positive bacteria.	3.02327e-06
NC_016511.1|WP_002524701.1|440263_441448_+|glycine-C-acetyltransferase	gnl|CDD|235893	PRK06939, PRK06939, 2-amino-3-ketobutyrate coenzyme A ligase; Provisional.	0
NC_016511.1|WP_014166836.1|439188_440226_+|L-threonine-3-dehydrogenase	gnl|CDD|180054	PRK05396, tdh, L-threonine 3-dehydrogenase; Validated.	0
NC_016511.1|WP_014166831.1|426317_426503_+|DUF2273-domain-containing-protein	gnl|CDD|378362	pfam10031, DUF2273, Small integral membrane protein (DUF2273). Members of this family of hypothetical bacterial proteins have no known function.	6.75284e-05
NC_016511.1|WP_002517506.1|424117_425536_-|DUF4032-domain-containing-protein	gnl|CDD|379077	pfam13224, DUF4032, Domain of unknown function (DUF4032). This presumed domain is functionally uncharacterized. This domain family is found in bacteria, and is approximately 170 amino acids in length. The family is found in association with pfam06293.	8.77124e-87
NC_016511.1|WP_014166832.1|426917_427472_+|hypothetical-protein	gnl|CDD|380217	NF033218, anchor_AmaP, alkaline shock response membrane anchor protein AmaP. The founding member of this family, AmaP (Asp23 membrane anchoring protein), is related to Asp23 through part of its length, but includes a highly hydrophobic N-terminal region that should make it an integral membrane protein. Asp23 (alkaline shock protein of 23 kDa), described in PMID:7864904, is a cytosolic protein in Staphylococcus aureus, strongly induced by a pH shift from 7 to 10, and also recruited to the membrane. AmaP appears to be the partner protein with an integral membrane segment and the ability to anchor Asp23 to the membrane. This model was built to identify full-length homologs of AmaP, while excluding Asp23. Some but not all members of this family score above the cutoffs of Pfam model version PF03780.11, but full-length homologs of Asp23 score considerably higher. Asp23 family members previously were known as DUF322.	3.15868e-07
NC_016511.1|WP_002520024.1|435706_436999_+|sugar-ABC-transporter-substrate-binding-protein	gnl|CDD|270303	cd13585, PBP2_TMBP_like, The periplasmic-binding component of ABC transport systems specific for trehalose/maltose and similar oligosaccharides; possess type 2 periplasmic binding fold. This family includes the periplasmic trehalose/maltose-binding component of an ABC transport system and related proteins from archaea and bacteria. Members of this group belong to the type 2 periplasmic-binding fold superfamily. PBP2 is comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. The majority of PBP2 proteins function in the uptake of small soluble substrates in eubacteria and archaea. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	2.38023e-87
NC_016511.1|WP_002530094.1|433323_435684_+|ROK-family-protein	gnl|CDD|223745	COG0673, MviM, Predicted dehydrogenases and related proteins [General function prediction only].	5.14828e-45
NC_016511.1|WP_002515072.1|425787_426306_+|Asp23/Gls24-family-envelope-stress-response-protein	gnl|CDD|377129	pfam03780, Asp23, Asp23 family, cell envelope-related function. The alkaline shock protein Asp23 was identified as an alkaline shock protein that was expressed in a sigmaB-dependent manner in Staphylococcus aureus. Following an alkaline shock Asp23 accumulates in the soluble protein fraction of the S. aureus cell. Asp23 is one of the most abundant proteins in the cytosolic protein fraction of stationary S. aureus cells, with a copy-number of >25000 per cell. A second Asp23-family protein, AmaP, which is encoded within the asp23-operon, is required to localize Asp23 to the cell membrane. The overall function for the family is thus a cell envelope-related one in Gram-positive bacteria.	1.05693e-32

Protein sequences

>NC_016511.1|WP_002515080.1|429743_430844_-|sn-glycerol-3-phosphate-ABC-transporter-ATP-binding-protein-UgpC
MATVQYKEATRVYPGTDRAAVSKLDLDIGDGEFMVLVGPSGCGKSTSLRMLAGLEEVNAGSIWIGDRDVTDLPPKDRDIAMVFQNYALYPHMTVADNMGFALKMQNVPKAERQQRVLEAAKLLGLEDFLNRKPKALSGGQRQRVAMGRAIVRNPQVFLMDEPLSNLDAKLRVQTRTQIAALQQRLGVTTVYVTHDQVEAMTMGDRVAVMRDGVLQQVDSPLALYDTPKNLFVAGFIGSPAMNLMEGDVVDGGVELGDYVVPVSRDVLAKVPNETKLTLGIRPEAFTLASEGIGLDVAVVEELGADAYLYGSLVGSGKQASIEDGEAHQVVARISSRRPPQRGEQVRLGVDPASVHVFSQETTERIS
>NC_016511.1|WP_002515092.1|429324_429678_+|hypothetical-protein
MSELKNDDVVSGTLLTGEHIIDDLAGIIVTTVRNTPGVTRLVKPWWRRIGNDDRSAIRISEEDGLSEVKVEVTVDLTVPIVQLTQDLRHRVSTAITQSGRTPGKVDIVVSKVEPNNE
>NC_016511.1|WP_002515097.1|428807_429332_+|hypothetical-protein
MEVKLACGADMNRVWEGATQPLTEHEAECPACQAVRIEALRADQLRDDTVAEDAQTKVVVDPLKLSSVWRSYAADLSPRHCVFDDDGGQVEVRETVLAAIVRNSLADCEDGRLNRIRFSVPHTPLRLRIDLSVARGVRIPDCAERVRHRISTAMTRELGGRPEAIDIIVEDIHV
>NC_016511.1|WP_014166833.1|428241_428817_+|RNA-polymerase-sigma-factor
MVSRVDGHGGDEVILADIRAAQDGDAGAYARIVKSWGGRLLRFCRNNLPATIDAEDVVQDVLLTAWQKLPGLDDRSRFRAWMYTIARNRCREVIRTAGRRATDPVSPEEVAVKIDSRQDPARAHARDTAMMALRKSVAGLPDTQRSIWVMAQIDGLGYAEIADIEGLPLSTVRGRLARARATIAKEMESWR
>NC_016511.1|WP_002515053.1|427468_428185_+|alkaline-shock-response-membrane-anchor-protein-AmaP
MKGRANRTRLAVVGIIGLVVVAWFMLVRFNVVSSWGWRQPKPDAPIVDVPKAWRTDYASWALLIVGILVAVIGLVWLLRQFSSSNRAHTYGMSHEADHGSTVLSTDALGRAVEEQIEEFPGVSSASVRFFGARVAPEMMVQIDIDDRADVRKLVDRLESEVARDVEATLDAKLVRFGTKLRTGAHVTGMGVSHVGVTEVPNIDDSGDSLPANPMPKSTFLQEKSDRAKPRTREGKVLA
>NC_016511.1|WP_014166832.1|426917_427472_+|hypothetical-protein
MSKQYVSPPLIRRPSRTLPVTILAVVLLAAGVVAIIAAIQRLQHGSLPQWVAWGRGHMTTASWLNDTALTVAIVIGVVALLFLIWAFNPGRTSGVFLQPSEGAPDNREIVMDNSDLTGWLSRWLDEEDGVASSVVKRRGKTLKVHAETDVKDPEVMREQLTTRIAARVDSLGLEQPLKVEVRLR
>NC_016511.1|WP_002515081.1|426502_426916_+|Asp23/Gls24-family-envelope-stress-response-protein
MSAGTTRVRSVPSLAVHNREKASRGTLTVTTAVVEKVAARVAAQSEGFGAPTSSFFGSGSRADFDRGPKVSAVLTGRTADLEVEVAIGYPAPVQAQCDDLRARLTEQVPKMSGVDIRTIDILVSRVVSKAPTMKELT
>NC_016511.1|WP_014166831.1|426317_426503_+|DUF2273-domain-containing-protein
MNASRIGALVGLLLGVIAVCAGVWQAIVVLVLGLLGLIIGRIIDGQLDVHDIFGKPSQRNR
>NC_016511.1|WP_002515072.1|425787_426306_+|Asp23/Gls24-family-envelope-stress-response-protein
MTDNKTASAKSDATKTENLPETTTKETLPPSPLHTDHGSTLIAEQVVQKIAGIACREVPGVHAMGSTGRRMLSSITDRIPGSTTNVSNGVQVEKGERQCAIDLSVVIEYGYSVVEVANKLRETIIDAVEYGTGLEVVEVNVQVTDVYIQGEDDHDDDQSDQVAGQRKNTELS
>NC_016511.1|WP_002517506.1|424117_425536_-|DUF4032-domain-containing-protein
MGGKLFLVTRFLSAKPDSRLLPLPWSTPLAQWPQERLVALPRGISRHVVRFITVDDDVYAAKEVVEHLAIHEYRLLHDLMRLDTPSVEPIGVITDRVASNGEPLEPIILTRHLRFSLPYRSLFHSGVRQGTVMRLLDALVVLLVRLHLVGFLWGDISLSNVLFRRDAEAFAAYLVDAETGELHDHLTTGQREHDLQIARTNLYGEFLDLEEGDMLDDALDPLGLVTTIEDRYHDLWNELTAAEEFDGGDYSQVESRVRRLNALGFDVAELDIQTSPDGQRLRIQPKVVDAGHHQRRLLRLTGLDTEEFQARRLLNDLDTFRARNGLQGVDEAVAAHRWLTECFEPVVQQIPPELSRKRELAQFYHEVLDYRWYESQRQQREVPHVEAAQGYVRDILAKLPDEAISTESVVPVDGSPAHSGHELVNVYDPSLGYVEDEEEDAPYDPWEAHAEAIDVESASRLDIDALRARMKR
>NC_016511.1|WP_002515101.1|431596_433033_-|L-serine-ammonia-lyase
MSVAVSVFDIFKVGIGPSSSHTVGPMRAARIFVTDLAQSPVWPEVTRVRAELFGSLGATGHGHGSEAAVLLGLEGEDPATVDTDQTPARAASIANDGRITLDAVHGGREISFDVTTDLVLHRNRSLPFHPNGMTFTAWSGQEVVVERTFYSIGGGFVVEHGEDEHPAIVRDSAPVPYPFKTGKELLEQCSDYRMSIPEVAMANEMTLRAEEEIRGQLLDIWAVMHACVERGCSRAGVLPGGLHVRRRAMKMHHDLVTRERITPGKPEPFGSVDWLTVWALAVNEENAAGGRIVTAPTNGAAGIIPSCLHFAVKFLSPGSDIDSGTPGVDTGDDDLIVNYLLAAGAVGEIYQQSASISGAEVGCQGEVGVACSMAAAGLAQVMGGTPTQVCNAAEIGLEHHLGLTCDPVGGLVQIPCIERNALGAIKAVTAARLAMAGDGSQIVSLDQVMKTMMETGRDMKVKYKETARGGLAVNIVEC
>NC_016511.1|WP_002515089.1|433057_433288_+|hypothetical-protein
MLSKEVVSVHGEAWFANRIDQGSRTCPWALCTIDDLLGRLTGRGRPCSTYNHSSRMRDANQICSKTLTSVLAGFNM
>NC_016511.1|WP_002530094.1|433323_435684_+|ROK-family-protein
MSLRERARDKPGQEWLTMTSQERPAGRGQRKDDVLRELRADGALTAAELVERTSLSRPTIISLLRELEEDGWVSSEVGGHGAPGRPATAWAPASRAGIVIGADVLVDSMLTVVSTFHGRVLEVRTDQLVDRCREARLDVVAGVIGEARDRWSEGFGLLRQVAVSTTGVVDGHGTVLRSDLVPQWEGLDLAAALVQRLGVSVSVENDINMAAWGEFCCRRGQSLSSDGDMLLVQMTKGLHTGLVLSGRIHRGRQWNAGEISDVLDLRLEDGQHPDDEWIDRAALTIGSVAGVVDPDLIVVAGPTSRSLDVIRQVIARLHQRRVPGSVPVPAEVAALGRAASVVGAVDVALGHASAAFLGVERPHPVALQGVERIHQEVEKGHHSVMATTRDKRTIEVLRVGVVGVGARSRLALNAELEGNGGAIVAVCEPHHLARRRVADRLGKDPDSIVITSDVAGLIRAGIDVAFVTSPDDTHVEVTCALLEAGVPVYLEKPLAITLESATKVLVTAHRTGTKLYVGHNMRHMNVVRSMRDLIRTGRIGEVKAIWCRHFVGAGGDFYFKDWHATREHGTGLLLQKAAHDIDVMHWFAGSHTTDVVGMEGLTLYDQITDRCDHSDELMGDWYSLDNWPPLSQKGLNPVIDVEDLSMVLMRMESGVYASYQQCHYTPDYWRNYTVIGTEGRIENFGDGEGGVIRLWNTRTHYNAEGDETFPIIGDANGHGDADVLTVTEFLNFVRNGTRTDTSPLGAWYAVAAGIEATESLRSGSTPRMVPSLDAELVEYFNNNQVK
>NC_016511.1|WP_002520024.1|435706_436999_+|sugar-ABC-transporter-substrate-binding-protein
MDRRGFIAGAALATLAVAGCSSSKKEAGSGTASIAPDTSAELVLAYWDKNQTRTIKENIKSFNKKYPNVKVTTNLAGYEDYWKKLRTQAQGNELPDVFWMNGPNIQLYAGNGMLAPIDKVTDAGVKWSDYPEALVKLYTYDGKHYGVPKDFDTIGVFYNKKIFKDAGVELPTADWTWDDFHDKAKKISDWGKSKGIYGCATTINGDGQGTYYNTIFQAGGFVIKDDKSGFDDPKSIEGLQCWADWVKDGSVASPKVITDTKPSQMFKSGKSAMYWSGDWTASELAEEFKGHENDYDVIVLPKKDRKATVIHGLGWVVSARSANQAAALALVAHMGSKQAQETEARNGTAIPAFHGTQDPWVKAFPQWNCKMFVDAATTYAVTYPVSRNTSVWADKEADYVNPAFSGEMPVPETARKLATFMNDALAKEKG
>NC_016511.1|WP_002515059.1|436995_437952_+|sugar-ABC-transporter-permease
MIHPGTRGDTAVAPLSSRSGHRKKKDPTSVGAWPALFIGPLMLGIAVFYYWPIFENVVASLKQTNAFGGNPQFVGFENYRELFASPDLRSAIGNTLLYTVIVLLGIPLSVAVAAMIELPGLRFKGLYRILYFMPYLAMPMAVAQVRKIVYNGQFGLLNQILRSVGVSDPPYWLVSPGWALFAVALFGLWASIGFNVIILSAGLKSIPRELYEAASIDGASAWRQFRMVTVPLLSPSIFFLTIMTTIGGFQLFDALYAMIGTGNPAEPRTRSLVSLFYRQAFVNHDQGLGAAVAIVIFALVAIVTLAQFLGQKRWVNYV
>NC_016511.1|WP_014166835.1|437944_438835_+|carbohydrate-ABC-transporter-permease
MSEVSTGSELSAVEVAALAKRGDTVSQRRFVGVHILLLLGGVLMVFPFVYQILMSLSTNMEIQSVPPKLIPDRWQFHNYTEVFTRLPFLKQFGVSVTITVLRTVVQLILCSMGGYAFARMKFGGKSVLFGFVLAILMVPGQSYLIGQYEIIRELGSLETPWGIVLPGFFSAFGVFLMRQSFMSLPAELEEAARLDGCNPWQTFWRVMVPVVKPGLFAVMITTVLWSWNDLLWPLIVTAREESMPLSVGIATLAGQHSSEFALMMAASVMAMAPIFLLFFSMQRKVIEGLASSGLKG
>NC_016511.1|WP_014166836.1|439188_440226_+|L-threonine-3-dehydrogenase
MKALVKTRPEPGLELVEVPDPVAGPNDVIVKVMRTGICGTDVHIDKWDGWAAKTVHTPLVLGHEFCGEIVELGSEVNDLEVGQFVSGEGHYVCGRCRACLAGKRHLCRNTQGIGYAVNGAYCQYFVMPAGNVWVHHIPDLDPDVAAIFDPFGNAVHTALQFPCLAEDVLVSGAGPIGIMAALVAQFQGARNVVVTDLSDERLELAQQLGLKNAVNVSREGLETVWGRFDMKEGFDIGLEMSGSGTALTSMIDNMTHGGRIALLGTPSTDITLDFSKIIFNMITIQGVTGRQIFETWYTMASLIRSGLDISGIITDRYPITEFREAFDVAGSGHGGKVVMNWECLD
>NC_016511.1|WP_002524701.1|440263_441448_+|glycine-C-acetyltransferase
MKDELSAKIAALKEEGLYKAEAPLTSPQSGKITVDDGREVINLCANNYLGLADSPVLIEAAKKALDEWGFGMASVRFICGTQTLHQKLERAITEFLHPDDPDNWDTILYSSCFDANGGLFEVLLGPDDAIISDELNHASIIDGVRLCKAQRFRYRNLDMADLEAQLQAAKDCRHIMIATDGVFSMDGFVAPLPQICDLAEKYGAMVMVDDSHAVGFVGEHGAGTPEQWGVRDRVDVLTGTLGKALGGASGGYTCSHREVVEMLRQNSRPYLFSNSLAPSIAGASLATLDLLKSSGDLLTKLRENTEYFRSEMTRRGFEIPESDHPIVPVMVGDAVKAAKMADAMLAKGIYVRAFSYPVVPKGKARIRTQMSAGLTREQLDKAIKAFEEARAEIG
>NC_016511.1|WP_002518750.1|441464_442400_-|ABC-transporter-substrate-binding-protein
MEHPMITTPMTRRTLLGTALLTGLAACSSNDPLNSDGSGSGSADLIVGSANFTESEIIAEVYAQSLETVGITIKRRMQIGARDVYVKALQDGSVNLVPEYSGNLLQFFQGASSASDEKSVMASLRKAVPAGMSVGEPSAAQDADSWCVTTEFSHTHKVTSLTDLATLDSLKVGGNPELKERPYGPKGLTKAYGVPSSIVKFTALSDSSGPLTVKALTSGTVDLVDLYTTTPAIKEQHLVVLSDPRHLIVPQNVVPLLSKKVDDKARAQLARVSKALTTDDLIGMNQRFQGDEKASAATIAKDWLAQRGLAS
>NC_016511.1|WP_002515074.1|442409_443105_-|ABC-transporter-permease-subunit
MNHIAAALTWLTTSSHWAGSGSIGVRIGEHLWYTLLALTIAAITAIPAGLAIGHTGRGKTIAVACSGALRALPSLGLLTLLAISTTIGIENPVVPSTIVLAILAIPPLLAGSYSGVDAIDDEVADGARACGMTEMQVLGRVELPLATPLLLGGLRSAALQVIATTTICSYLGMGGLGRFILDGLAVSDYPQMLAGSIVIIVLALVVDGLLCLVTRLLTGPGVRHALALTPQ

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_016511_1	1.1|431182|30|NC_016511|CRISPRCasFinder	431182-431211	30	NZ_CP050083	Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b3, complete sequence	272569-272598	6	0.8
NC_016511_1	1.1|431182|30|NC_016511|CRISPRCasFinder	431182-431211	30	NZ_CP050106	Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b5, complete sequence	51838-51867	6	0.8
NC_016511_1	1.1|431182|30|NC_016511|CRISPRCasFinder	431182-431211	30	NZ_CP049733	Rhizobium leguminosarum strain A1 plasmid pRL10, complete sequence	263538-263567	6	0.8
NC_016511_1	1.1|431182|30|NC_016511|CRISPRCasFinder	431182-431211	30	NZ_CP006991	Rhizobium sp. IE4771 plasmid pRetIE4771e, complete sequence	562924-562953	6	0.8
NC_016511_1	1.1|431182|30|NC_016511|CRISPRCasFinder	431182-431211	30	NZ_CP025506	Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvE, complete sequence	42775-42804	6	0.8
NC_016511_1	1.1|431182|30|NC_016511|CRISPRCasFinder	431182-431211	30	NZ_CP050111	Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b1, complete sequence	52022-52051	6	0.8
NC_016511_1	1.1|431182|30|NC_016511|CRISPRCasFinder	431182-431211	30	NZ_CP021128	Rhizobium sp. Kim5 plasmid pRetKim5d, complete sequence	512956-512985	6	0.8
NC_016511_1	1.1|431182|30|NC_016511|CRISPRCasFinder	431182-431211	30	NZ_CP022668	Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR3, complete sequence	495523-495552	6	0.8
NC_016511_1	1.1|431182|30|NC_016511|CRISPRCasFinder	431182-431211	30	CP007645	Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803d, complete sequence	571257-571286	6	0.8
NC_016511_1	1.1|431182|30|NC_016511|CRISPRCasFinder	431182-431211	30	NZ_CP050088	Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b6, complete sequence	177039-177068	6	0.8
NC_016511_1	1.1|431182|30|NC_016511|CRISPRCasFinder	431182-431211	30	NZ_CP053207	Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1C, complete sequence	294346-294375	7	0.767
NC_016511_1	1.1|431182|30|NC_016511|CRISPRCasFinder	431182-431211	30	MH051248	Mycobacterium phage BigPhil, complete genome	31319-31348	7	0.767
NC_016511_1	1.1|431182|30|NC_016511|CRISPRCasFinder	431182-431211	30	KF017004	Mycobacteriophage Velveteen, complete genome	31319-31348	7	0.767
NC_016511_1	1.1|431182|30|NC_016511|CRISPRCasFinder	431182-431211	30	MT889380	Mycobacterium phage Coco12, complete genome	35394-35423	7	0.767
NC_016511_1	1.1|431182|30|NC_016511|CRISPRCasFinder	431182-431211	30	KM215148	Mycobacterium phage Cerasum, complete genome	31337-31366	7	0.767
NC_016511_1	1.1|431182|30|NC_016511|CRISPRCasFinder	431182-431211	30	KY702574	Mycobacterium phage Kingsley, complete genome	34127-34156	7	0.767
NC_016511_1	1.1|431182|30|NC_016511|CRISPRCasFinder	431182-431211	30	NC_028844	Mycobacterium phage Phatniss, complete genome	35487-35516	7	0.767
NC_016511_1	1.1|431182|30|NC_016511|CRISPRCasFinder	431182-431211	30	NZ_CP007453	Peptoclostridium acidaminophilum DSM 3953 strain al-2 plasmid EAL2_808p, complete sequence	116511-116540	9	0.7

1. spacer 1.1|431182|30|NC_016511|CRISPRCasFinder matches to NZ_CP050083 (Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b3, complete sequence) position: , mismatch: 6, identity: 0.8

aatcgccgtcaaggtcgagaaaaagtttgt	CRISPR spacer
catcgccgtcaaggacgagaacaaggatgc	Protospacer
 ************* ****** ***  **.

2. spacer 1.1|431182|30|NC_016511|CRISPRCasFinder matches to NZ_CP050106 (Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b5, complete sequence) position: , mismatch: 6, identity: 0.8

aatcgccgtcaaggtcgagaaaaagtttgt	CRISPR spacer
catcgccgtcaaggacgagaacaaggatgc	Protospacer
 ************* ****** ***  **.

3. spacer 1.1|431182|30|NC_016511|CRISPRCasFinder matches to NZ_CP049733 (Rhizobium leguminosarum strain A1 plasmid pRL10, complete sequence) position: , mismatch: 6, identity: 0.8

aatcgccgtcaaggtcgagaaaaagtttgt	CRISPR spacer
catcgccgtcaaggacgagaacaaggatgc	Protospacer
 ************* ****** ***  **.

4. spacer 1.1|431182|30|NC_016511|CRISPRCasFinder matches to NZ_CP006991 (Rhizobium sp. IE4771 plasmid pRetIE4771e, complete sequence) position: , mismatch: 6, identity: 0.8

aatcgccgtcaaggtcgagaaaaagtttgt	CRISPR spacer
catcgccgtcaaggccgagaacaaggatgc	Protospacer
 *************.****** ***  **.

5. spacer 1.1|431182|30|NC_016511|CRISPRCasFinder matches to NZ_CP025506 (Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvE, complete sequence) position: , mismatch: 6, identity: 0.8

aatcgccgtcaaggtcgagaaaaagtttgt	CRISPR spacer
catcgccgtcaaggacgagaacaaggatgc	Protospacer
 ************* ****** ***  **.

6. spacer 1.1|431182|30|NC_016511|CRISPRCasFinder matches to NZ_CP050111 (Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b1, complete sequence) position: , mismatch: 6, identity: 0.8

aatcgccgtcaaggtcgagaaaaagtttgt	CRISPR spacer
catcgccgtcaaggacgagaacaaggatgc	Protospacer
 ************* ****** ***  **.

7. spacer 1.1|431182|30|NC_016511|CRISPRCasFinder matches to NZ_CP021128 (Rhizobium sp. Kim5 plasmid pRetKim5d, complete sequence) position: , mismatch: 6, identity: 0.8

aatcgccgtcaaggtcgagaaaaagtttgt	CRISPR spacer
catcgccgtcaaggccgagaacaaggatgc	Protospacer
 *************.****** ***  **.

8. spacer 1.1|431182|30|NC_016511|CRISPRCasFinder matches to NZ_CP022668 (Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR3, complete sequence) position: , mismatch: 6, identity: 0.8

aatcgccgtcaaggtcgagaaaaagtttgt	CRISPR spacer
catcgccgtcaaggacgagaacaaggatgc	Protospacer
 ************* ****** ***  **.

9. spacer 1.1|431182|30|NC_016511|CRISPRCasFinder matches to CP007645 (Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803d, complete sequence) position: , mismatch: 6, identity: 0.8

aatcgccgtcaaggtcgagaaaaagtttgt	CRISPR spacer
catcgccgtcaaggccgagaacaaggatgc	Protospacer
 *************.****** ***  **.

10. spacer 1.1|431182|30|NC_016511|CRISPRCasFinder matches to NZ_CP050088 (Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b6, complete sequence) position: , mismatch: 6, identity: 0.8

aatcgccgtcaaggtcgagaaaaagtttgt	CRISPR spacer
catcgccgtcaaggacgagaacaaggatgc	Protospacer
 ************* ****** ***  **.

11. spacer 1.1|431182|30|NC_016511|CRISPRCasFinder matches to NZ_CP053207 (Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1C, complete sequence) position: , mismatch: 7, identity: 0.767

aatcgccgtcaaggtcgagaaaaagtttgt	CRISPR spacer
catcgccgtcaaggacgagaacaaggaggc	Protospacer
 ************* ****** ***   *.

12. spacer 1.1|431182|30|NC_016511|CRISPRCasFinder matches to MH051248 (Mycobacterium phage BigPhil, complete genome) position: , mismatch: 7, identity: 0.767

aatcgccgtcaaggtcgagaaaaagtttgt	CRISPR spacer
cgtcgccgtcgaggccgagaaaaagatgtt	Protospacer
 .********.***.********** *  *

13. spacer 1.1|431182|30|NC_016511|CRISPRCasFinder matches to KF017004 (Mycobacteriophage Velveteen, complete genome) position: , mismatch: 7, identity: 0.767

aatcgccgtcaaggtcgagaaaaagtttgt	CRISPR spacer
cgtcgccgtcgaggccgagaaaaagatgtt	Protospacer
 .********.***.********** *  *

14. spacer 1.1|431182|30|NC_016511|CRISPRCasFinder matches to MT889380 (Mycobacterium phage Coco12, complete genome) position: , mismatch: 7, identity: 0.767

aatcgccgtcaaggtcgagaaaaagtttgt	CRISPR spacer
cgtcgccgtcgaggccgagaaaaagatgtt	Protospacer
 .********.***.********** *  *

15. spacer 1.1|431182|30|NC_016511|CRISPRCasFinder matches to KM215148 (Mycobacterium phage Cerasum, complete genome) position: , mismatch: 7, identity: 0.767

aatcgccgtcaaggtcgagaaaaagtttgt	CRISPR spacer
cgtcgccgtcgaggccgagaaaaagatgtt	Protospacer
 .********.***.********** *  *

16. spacer 1.1|431182|30|NC_016511|CRISPRCasFinder matches to KY702574 (Mycobacterium phage Kingsley, complete genome) position: , mismatch: 7, identity: 0.767

aatcgccgtcaaggtcgagaaaaagtttgt	CRISPR spacer
cgtcgccgtcgaggccgagaaaaagatgtt	Protospacer
 .********.***.********** *  *

17. spacer 1.1|431182|30|NC_016511|CRISPRCasFinder matches to NC_028844 (Mycobacterium phage Phatniss, complete genome) position: , mismatch: 7, identity: 0.767

aatcgccgtcaaggtcgagaaaaagtttgt	CRISPR spacer
cgtcgccgtcgaggccgagaaaaagatgtt	Protospacer
 .********.***.********** *  *

18. spacer 1.1|431182|30|NC_016511|CRISPRCasFinder matches to NZ_CP007453 (Peptoclostridium acidaminophilum DSM 3953 strain al-2 plasmid EAL2_808p, complete sequence) position: , mismatch: 9, identity: 0.7

aatcgccgtcaaggtcgagaaaaagtttgt	CRISPR spacer
tgaagccgtcaaggtcgaaaaaaagcacgg	Protospacer
 .  **************.******. .*