CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NC_016613	Vibrio sp. EJY3 chromosome 1, complete sequence	1 crisprs	cas3,DinG,csa3,csx1,DEDDh,WYL	1	1	4	0
NC_016614	Vibrio sp. EJY3 chromosome 2, complete sequence	0 crisprs	csa3,DEDDh,cas3,WYL,RT,cas6f,cas7f,cas5f	0	0	1	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_016613_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_016613_1

3012855-3013111

Orphan

Consensus_repeat	Method
GTGCCTCCTTAGCTCAGTAGGTAGAGCAACGGACTGATAATCCG	PILER-CR

2 spacers

The CRISPR arrays of NC_016613_1

>merge|NC_016613|1|3012855-3013111|PILER-CR
GTGCCGACTTAGCTCAGTAGGTAGAGCAACTGACTTGTAATCAGTAGGTCACCAGTTCGATTCCGGTAGTCGGCACCATTCTTTTGCCTCGATAGCTCAGTCGGTAGAGCAGAGGATTGAAAATCCTCGTGTCGGTGGTTCGATTCCGCCTCGAGGCACCATTATTTGGTGCACTTGCTTAATTTAATTGATTAGCAAGACACAAACAGAATAGTTCCTCCTTAGCTCAGTTGGTAGAGCGACGGACTGTTAATCCG

>NC_016613|1|1|3012855-3013111|PILER-CR
GTGCCGACTTAGCTCAGTAGGTAGAGCAACTGACTTGTAATCAG	TAGGTCACCAGTTCGATTCCGGTAGTCGGCACCATTCTT
TTGCCTCGATAGCTCAGTCGGTAGAGCAGAGGATTGAAAATCCT	CGTGTCGGTGGTTCGATTCCGCCTCGAGGCACCATTATTTGGTGCACTTGCTTAATTTAATTGATTAGCAAGACACAAACAGAATA
GTTCCTCCTTAGCTCAGTTGGTAGAGCGACGGACTGTTAATCCG

Protein	Signature genes	Signature genes Name	Protein_function
NC_016613.1\|WP_014233054.1\|3032240_3033749_+\|leucyl-aminopeptidase	unknown	unknown	gnl\|CDD\|234863
NC_016613.1\|WP_014233053.1\|3030939_3032040_-\|LPS-export-ABC-transporter-permease-LptF	unknown	unknown	gnl\|CDD\|185075
NC_016613.1\|WP_014233036.1\|3003869_3004160_+\|YggU-family-protein	unknown	unknown	gnl\|CDD\|179931
NC_016613.1\|WP_014233041.1\|3008722_3009442_-\|tRNA-(guanosine(46)-N7)-methyltransferase-TrmB	unknown	unknown	gnl\|CDD\|234649
NC_016613.1\|WP_014233046.1\|3023092_3024346_-\|HD-GYP-domain-containing-protein	unknown	unknown	gnl\|CDD\|225116
NC_016613.1\|WP_014233045.1\|3013410_3015036_+\|methyl-accepting-chemotaxis-protein	unknown	unknown	gnl\|CDD\|214599
NC_016613.1\|WP_014233040.1\|3007682_3008711_-\|DNA-methylase	unknown	unknown	gnl\|CDD\|223971
NC_016613.1\|WP_014233051.1\|3029354_3029834_+\|RDD-family-protein	unknown	unknown	gnl\|CDD\|377640
NC_016613.1\|WP_014233052.1\|3029865_3030936_-\|LPS-export-ABC-transporter-permease-LptG	unknown	unknown	gnl\|CDD\|237900
NC_016613.1\|WP_014233039.1\|3006673_3007594_-\|glutaminase-B	unknown	unknown	gnl\|CDD\|234880
NC_016613.1\|WP_014233038.1\|3004799_3005402_+\|XTP/dITP-diphosphatase	unknown	unknown	gnl\|CDD\|234648
NC_016613.1\|WP_014233047.1\|3024646_3025321_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|212491
NC_016613.1\|WP_014233037.1\|3004234_3004666_+\|DUF4426-domain-containing-protein	unknown	unknown	gnl\|CDD\|379616
NC_016613.1\|WP_014233043.1\|3010741_3011014_+\|oxidative-damage-protection-protein	unknown	unknown	gnl\|CDD\|180059
NC_016613.1\|WP_041170371.1\|3005419_3006595_+\|radical-SAM-family-heme-chaperone-HemW	unknown	unknown	gnl\|CDD\|235550
NC_016613.1\|WP_014233042.1\|3009645_3010722_+\|A/G-specific-adenine-glycosylase	unknown	unknown	gnl\|CDD\|182805
NC_016613.1\|WP_014233049.1\|3027048_3027714_-\|SDR-family-NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|187643
NC_016613.1\|WP_014233044.1\|3011106_3012249_+\|membrane-bound-lytic-murein-transglycosylase-MltC	unknown	unknown	gnl\|CDD\|183271
NC_016613.1\|WP_014233048.1\|3025459_3026398_-\|bile-acid:sodium-symporter-family-protein	unknown	unknown	gnl\|CDD\|223462
NC_016613.1\|WP_014233050.1\|3027892_3029161_+\|DUF2254-domain-containing-protein	unknown	unknown	gnl\|CDD\|378351

Protein	Function_ID	Function_description	E-value
NC_016613.1\|WP_014233054.1\|3032240_3033749_+\|leucyl-aminopeptidase	gnl\|CDD\|234863	PRK00913, PRK00913, multifunctional aminopeptidase A; Provisional.	0
NC_016613.1\|WP_014233053.1\|3030939_3032040_-\|LPS-export-ABC-transporter-permease-LptF	gnl\|CDD\|185075	PRK15120, PRK15120, lipopolysaccharide ABC transporter permease LptF; Provisional.	3.30248e-131
NC_016613.1\|WP_014233036.1\|3003869_3004160_+\|YggU-family-protein	gnl\|CDD\|179931	PRK05090, PRK05090, hypothetical protein; Validated.	6.66239e-61
NC_016613.1\|WP_014233041.1\|3008722_3009442_-\|tRNA-(guanosine(46)-N7)-methyltransferase-TrmB	gnl\|CDD\|234649	PRK00121, trmB, tRNA (guanine-N(7)-)-methyltransferase; Reviewed.	4.68784e-109
NC_016613.1\|WP_014233046.1\|3023092_3024346_-\|HD-GYP-domain-containing-protein	gnl\|CDD\|225116	COG2206, COG2206, c-di-GMP phosphodiesterase class II (HD-GYP domain) [Signal transduction mechanisms].	6.27423e-69
NC_016613.1\|WP_014233045.1\|3013410_3015036_+\|methyl-accepting-chemotaxis-protein	gnl\|CDD\|214599	smart00283, MA, Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer). Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.	2.78558e-58
NC_016613.1\|WP_014233040.1\|3007682_3008711_-\|DNA-methylase	gnl\|CDD\|223971	COG1041, COG1041, Predicted DNA modification methylase [DNA replication, recombination, and repair].	1.57658e-08
NC_016613.1\|WP_014233051.1\|3029354_3029834_+\|RDD-family-protein	gnl\|CDD\|377640	pfam06271, RDD, RDD family. This family of proteins contain three highly conserved amino acids: one arginine and two aspartates, hence the name of RDD family. This region contains two predicted transmembrane regions. The arginine occurs at the N-terminus of the first helix and the first aspartate occurs in the middle of this helix. The molecular function of this region is unknown. However this region may be involved in transport of an as yet unknown set of ligands (Bateman A pers. obs.).	1.51369e-15
NC_016613.1\|WP_014233052.1\|3029865_3030936_-\|LPS-export-ABC-transporter-permease-LptG	gnl\|CDD\|237900	PRK15071, PRK15071, lipopolysaccharide ABC transporter permease; Provisional.	0
NC_016613.1\|WP_014233039.1\|3006673_3007594_-\|glutaminase-B	gnl\|CDD\|234880	PRK00971, PRK00971, glutaminase; Provisional.	0
NC_016613.1\|WP_014233038.1\|3004799_3005402_+\|XTP/dITP-diphosphatase	gnl\|CDD\|234648	PRK00120, PRK00120, dITP/XTP pyrophosphatase; Reviewed.	3.98284e-124
NC_016613.1\|WP_014233047.1\|3024646_3025321_+\|SDR-family-oxidoreductase	gnl\|CDD\|212491	cd05233, SDR_c, classical (c) SDRs. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human prostaglandin dehydrogenase (PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, PGDH numbering) and/or an Asn (Asn-107, PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	2.14472e-59
NC_016613.1\|WP_014233037.1\|3004234_3004666_+\|DUF4426-domain-containing-protein	gnl\|CDD\|379616	pfam14467, DUF4426, Domain of unknown function (DUF4426). Members of this entry are found mostly in g-proteobacteria, especially in Vibrio. Strangely enough, there seems to be one eukaryotic homolog in Nematostella vectensis (NEMVEDRAFT_v1g226006), where the PA0388-like domain is fused with a domain homogous to the Methionine biosynthesis protein MetW (see below). In several Pseudomonas species, but also in Vibrio vulnificus and Azotobacter vinelandii PA0388 homologs are genomic neighbors of Nucleoside 5-triphosphatase RdgB (dHAPTP, dITP, XTP-specific) (EC 3.6.1.15) and Methionine biosynthesis protein MetW. On the other hand, in most Vibrio species it appears as a part of a conserved operon involved in possible response to stress.	2.7276e-65
NC_016613.1\|WP_014233043.1\|3010741_3011014_+\|oxidative-damage-protection-protein	gnl\|CDD\|180059	PRK05408, PRK05408, oxidative damage protection protein; Provisional.	3.33891e-59
NC_016613.1\|WP_041170371.1\|3005419_3006595_+\|radical-SAM-family-heme-chaperone-HemW	gnl\|CDD\|235550	PRK05660, PRK05660, radical SAM family heme chaperone HemW.	0
NC_016613.1\|WP_014233042.1\|3009645_3010722_+\|A/G-specific-adenine-glycosylase	gnl\|CDD\|182805	PRK10880, PRK10880, adenine DNA glycosylase.	0
NC_016613.1\|WP_014233049.1\|3027048_3027714_-\|SDR-family-NAD(P)-dependent-oxidoreductase	gnl\|CDD\|187643	cd08939, KDSR-like_SDR_c, 3-ketodihydrosphingosine reductase (KDSR) and related proteins, classical (c) SDR. These proteins include members identified as KDSR, ribitol type dehydrogenase, and others. The group shows strong conservation of the active site tetrad and glycine rich NAD-binding motif of the classical SDRs. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	4.5957e-70
NC_016613.1\|WP_014233044.1\|3011106_3012249_+\|membrane-bound-lytic-murein-transglycosylase-MltC	gnl\|CDD\|183271	PRK11671, mltC, membrane-bound lytic murein transglycosylase MltC.	7.01193e-147
NC_016613.1\|WP_014233048.1\|3025459_3026398_-\|bile-acid:sodium-symporter-family-protein	gnl\|CDD\|223462	COG0385, COG0385, Predicted Na+-dependent transporter [General function prediction only].	2.19836e-83
NC_016613.1\|WP_014233050.1\|3027892_3029161_+\|DUF2254-domain-containing-protein	gnl\|CDD\|378351	pfam10011, DUF2254, Predicted membrane protein (DUF2254). Members of this family of bacterial proteins comprises various hypothetical and putative membrane proteins. Their exact function, has not, as yet, been defined.	5.85034e-119

>NC_016613.1|WP_014233044.1|3011106_3012249_+|membrane-bound-lytic-murein-transglycosylase-MltC
MKKIVFIVAALLLTAGCSREVVEKFYDVEYEPTNRFANNLAELPGQFEKDTAALDSLINSFSGNIQKKWGKREVKLAGKSNYVKYIDNYLSRAEVDFQKGVITIETVSPTEPQKHLKNAIITTLLTPDDPANVDLFSSKDIKLEGQPFLYKQVVDQDNKPIQWSWRANRFADYLINHEIKTKDVDFKKAYYVEIPMVEDHFIQRSYQYANIVRRAAEKYDIPEDLIYAIIKTESSFNPYAVSWANAYGLMQVVPKTAGRDVFALVKNRSGQPSPEYLFNPENNIDTGTAYFYILKNRYLKEVSHPTSLEYSMISAYNGGTGGVLNTFNRSDRKRAMRDLNSLQPNQVYWALTKKHPNAEARRYLEKVTNFKKEFNSVQTF
>NC_016613.1|WP_014233043.1|3010741_3011014_+|oxidative-damage-protection-protein
MSRTVFCARLKKEGEGLDFQLYPGELGKRIFDNISKEAWAEWQHKQTMLINEKKLNMMDPEHRKLIETEMVNFLFEGKDVHIDGYTPPSE
>NC_016613.1|WP_014233042.1|3009645_3010722_+|A/G-specific-adenine-glycosylase
MTPFASAILEWYDAYGRKDLPWQQNKTAYSVWLSEIMLQQTQVTTVIPYYQRFLERFPTVVDLANAEQDEVLHLWTGLGYYARARNLHKAAKEVAQTYNGEFPLDIEQMNALPGIGRSTAAAVLSSVHKQPHAILDGNVKRTLSRCFAVDGWPGQKKVENKLWEIAEAHTPQTDVDKYNQAMMDMGAMVCTRSKPKCTLCPVADLCVAKKQGNILDYPGKKPKKDKPVKQTRFVMLHHKNANGHEVWLEQRPQTGIWGGLFCFPQTEHVDVESDIDLLLEQRGIQTNDIKEQQTLITFRHTFSHYHLDITPILIDLSKQPDVIMEGNKGLWYNLSKPEEVGLAAPVKLLLETLPHELR
>NC_016613.1|WP_014233041.1|3008722_3009442_-|tRNA-(guanosine(46)-N7)-methyltransferase-TrmB
MSEVTTNEYNEDGKLIRKIRSFVRREGRLTKGQESAMNECWPTMGIDYKAELLDWKEVFGNDNPVVLEIGFGMGASLVEMAKNAPEKNFIGIEVHSPGVGACLADAREAGLTNLRVMCHDAVEVFEHMIPNDSLATLQLFFPDPWHKKRHHKRRIVQLEFAEMVRQKLIPNEGIFHMATDWENYAEHMIEIMNQAPGFENIAEEGDFVPRPEERPLTKFEARGHRLGHGVWDIKFKRTA
>NC_016613.1|WP_014233040.1|3007682_3008711_-|DNA-methylase
MYHYAILANPGHNRIYFDSAMTIACSELKAMLASEGVEVTEIGNKDVGLPAALVFSCAEALNDEQSRKIAASSIYYALFEVREDGLLRPIQAPAFNTFPESMSQILRYTGKTNEQFTRLMVNLGVSAANTDSAQLTLMDPMCGKGTTLFEGLIHGLNVVGVEINQKWVQEIQTFVVKFMKNGRFKHKVSKEKRTSGGKKVADGFVVEAAATKEDYNQGNLQTMKLYSADTRIADQVVKKNSVDVMVSDLPYGVQHGSKNAKDSKLNRSPLELLKEALPAWKVVLKKQGSVVLSFNEFTLKWKDVAALFEEQGWKVLSEDPYIGYLHRVDQSINRNIIVAVKP
>NC_016613.1|WP_014233039.1|3006673_3007594_-|glutaminase-B
MKPTVEILTDILTEVRPLIGQGKVADYIPALAKVPSNKLGIAVYTNDGEVIKAGDADEPFSIQSISKALSLTLAMCLYKQEEIWARVGKEPSGQAFNSLIQLEMEQGIPRNPFINAGAIVVADLLQSRLSAPRQRLLEFVRQLSGDTHIVYDKVVAASEMMHGDRNAAIAYLMRSFGNFENEVIPVLQNYFHACALKMSCVDLAKTFSYLANKGTSVHTGKPIVSPTQTKQLNALLATCGLYDGAGEFAYRVGMPGKSGVGGGIIAVVPGDMTIAVWSPELDPAGNSLAGTKALELLSERIGRSIF
>NC_016613.1|WP_041170371.1|3005419_3006595_+|radical-SAM-family-heme-chaperone-HemW
MLTPPALSLYVHIPWCVQKCPYCDFNSHELKAEIPEEQYINALLEDLDTDIEKYRLNDAPRPLHSIFIGGGTPSLISAQGIERLLKGIEERIPFKTDIEITMEANPGTIEAERFAGYRKAGVTRISIGVQSFEQEKLERLGRIHGKDEAVNAANLAHQIGLNSFNLDLMHGLPDQSIEQALADLDKAIELAPPHLSWYQLTIEPNTMFYYKPPTLPDDDDLWDIFELGHKKLAAAGYVQYEISGYSKPGFQCQHNLNYWRFGDYLGIGCGSHGKLSFADGRIIRTTKVKHPRGYLAAYQNMVKPYLHTEQFVEDEDRPFEFFMNRFRLMEACPKQDFIDTTGLPLSSIQDTINWALELGYLSETETHWLITEKGKLFLNDLLEAFMAEEDE
>NC_016613.1|WP_014233038.1|3004799_3005402_+|XTP/dITP-diphosphatase
MKKIVLATGNQGKVREMADLLSDFGFEVLAQSEFNVSEVAETGTTFIENAIIKARHAAQETGLPAIADDSGLEVDYLNGAPGIYSARYAGEGATDQDNLEKLLKAMEGVPEAERTARFHCVLVLMRHKDDPTPVVCHGKWEGRILTEAHGENGFGYDPVFFVPEDNCASAELEPARKKQLSHRGKALKSLFAQLSEQAAQ
>NC_016613.1|WP_014233037.1|3004234_3004666_+|DUF4426-domain-containing-protein
MNKWITALLISLLPFPTFAEQFKNMKDIEVHYVAFNSTFLTPKIARSYDIKRNGYLAIINISVLDRASLGKPALEAQVAGQAKNLIGQTQQLTFREVKEGDAIYYLAELPVTHEETFTFDIDVKSGNKGSGKLQFTQKFYVEE
>NC_016613.1|WP_014233036.1|3003869_3004160_+|YggU-family-protein
MSAAVWRDGEDIVLRLYIQPKASRDKIVGLHGEELKIAITAPPVDGKANAHLTKFLAKQFKVAKGLVHIEKGELGRHKQIRIESPTQIPTDIEAIL
>NC_016613.1|WP_014233045.1|3013410_3015036_+|methyl-accepting-chemotaxis-protein
MKLKTQAYLLSAIILLALLALTATGLWTLRVASNLDNKARVTELFKSAYSILTEVEAMAASGELPEDEAKALATRLLRNNIYKDNEYVYVANENMIFVAAPLDPQLHGTSFHDFKDSNNNSVGQLILDILDNKTGQIVEYTWSQTQTDGSIEEKHSIAEKTPHWGWVVGTGIGFNEVNARFWATAQWQLVLCLFIAGAILTSLIIAIRKMLNVLGGEPHDVRQAVQAVSQGNIQTSFDTVAPKDSIYDAVQNMSQSLAIMVTNLDSSMLALRSELSAVESRSGTIADLTLSQQESTAMIATAMTEMASSANQVATSANDTARNTDEADKQSQQTQSLICSTVDNIQGLANQLSTASLAVANLDQDVNNIVKVLDVIGDIAEQTNLLALNAAIEAARAGEQGRGFAVVADEVRKLAGRTQDSTKEIQNMISNLQQGSRHAIQTMEICAETSQSTVTQSQSASEALQQIVTALEAITTMSQQIATAAAEQTHVSDDIAHRINLIEESGYQLNSVVTESQTSTQSLASLANDLEGWVNKFSVKH
>NC_016613.1|WP_014233046.1|3023092_3024346_-|HD-GYP-domain-containing-protein
MAAIKLTVDRIQPGLHIRLPLKWNDHPFLLNSFKIKDQGQVEMIRHLGVKFVYFNPEQSDSLPLPVNQDREDKVKSDDSLDLETKALWQEKQKRIEKLSAYRRRVIQCEKEFERSLARMRSVMMKIRNRPVAAVNEAKQLTEDIVDKLMCDDNVTLHLMNGKNEYEDIYFHSLNVAVIAMMIGRAKGYSAEQLKELSFAALFHDMGKVKIPTAILRKQEPLTVPEENYLKLHTKYGLDLANQIEDFPETAKTVIEQHHELRDGSGYPKGLQGDEINEFAQIIIVANAFDNLCHTRITSEQKIPYTALSHLYKNCKHLYKEENLKLLIKFMGVFPPGTVVQLTNNMIGLVISVNASNLLFPNVLVYDPSVPRTQAPILDLASKDLRIVNAIHPSKLPENIKEYLNPRSRISYFFDTDA
>NC_016613.1|WP_014233047.1|3024646_3025321_+|SDR-family-oxidoreductase
MKILVTGASSGIGFELVKQLCADHHDVFATGRNKNKLTELHQLTGCKFASYDLTESQQVMDMFKQATEELGGLDVLINNAGMNTRKCAIDEFSLEEFEQQYAINLRAPAILCREALSLMKEQKSGYIINVTSTVAKRASETMAVYTTMKQGLAGFTGVLMKEAQPHGIKVTNLFPGGTDTNFRAASRPEYMQPESVARTILGLLKLPEDVVVHEMVFRPLVELE
>NC_016613.1|WP_014233048.1|3025459_3026398_-|bile-acid:sodium-symporter-family-protein
MIGRLTQLFPVWAVIFALTAYFSPSLFVDLKSQIVPLLTIIMLAMGISLSPSDFLNVLKHKKAVGVGVFLQFLIMPLAALLISFLLGFSTELTVGMVLVGSVAGGTSSNVMVFLAKGDVALSISMTAISTLLGVILTPLLVEGLIGQSVDVPVSGMLMSLVKIVLLPVSIGVIINTFIPKAVAKVNAILPLISMLAIVVIIAIVVALNAENLNTIGPLVALAVILHNGLGLTAGYYCCRLLGFNESTCRTIAFEVGLQNSGLATALAMKFFSPASAIAGTIFSVWHNISGSLLAGYWASKKARKAKAVTNSL
>NC_016613.1|WP_014233049.1|3027048_3027714_-|SDR-family-NAD(P)-dependent-oxidoreductase
MILITGASSGLGAELAKLYDCDGQPTYLTGRSEGKLSEITNRLSNNIGYQACDLSLHQDVEQLFDQLDQPPQTVIHSAGSGYFGLLEDQEPEQIQKLINNNLNSAINVLRELVKRYKDHSVNVVMIMSTASQQPKAQESTYCAVKWAVKGLIESVRLELKGKPMKIIAVYPGGMATEFWETSGKSLDLSSFMQAEDAAQMIHDAVSTIGNGYVSDITVNRL
>NC_016613.1|WP_014233050.1|3027892_3029161_+|DUF2254-domain-containing-protein
MTGSKWQWLLKQVTRKLWVRTSLFALLAVATALMSIVLNEFVVLPPAINVSSELLNNILNILATSMLAVTTFSLNIMVSAYTAASAGVTPRATKLLMEDSTTQNALATFLGSFLFSLVGIIALGVGAYHEQARIYLFIVTMVVIVMIILTLLRWIQHLSVLGRVSETTSKVEQALISAIRKRGNEPWLGARPWSHPEHKPRGSKPIYSQEIGYLQHIDMHHLDGIAEENQCTIYIERQPGNFVYSGQPIAWLCGELEEESEVSAAFTIRTERSFDQDPRFGLVVLAEIASRALSPAVNDNGTAIDVLGRAIRALSLWGELLKQRPIKTRFPRLFVPSLSCQDLFDDVFLPIAHDGAAQLQVQIRLQKSLLAISSMHPKLFASPAQKLSEKALELALSQHYTEDEKHQLSQLSHQVIDQKFHD
>NC_016613.1|WP_014233051.1|3029354_3029834_+|RDD-family-protein
MTTSTTLPTAGLFRRLAALVYDSLIVIAIEMMAAGVVMAIVFALNAAGLLSYGEYVDAADMLSKHPVISPIFTLYLAVVWIYFFVFFWTRAGQTLGMRAWKLQVRNAADDAPITVTQALIRIATSGFGLANLTVPIDPQKRGFHDMWAKTKVVVLPKAQ
>NC_016613.1|WP_014233052.1|3029865_3030936_-|LPS-export-ABC-transporter-permease-LptG
MFKILDLYIGRTIISTTALVLATFVGLSGIIKYVEQLRKVGRGVYDLMHALYFVLLSIPRDIEMFFPMAALLGALIGLGMLASSSELVVMQAAGFSKLDIGLSVLKTAVPLMLIVMTLGQWGAPEAQKMARDLRSFAISGGSIVSVRAGVWARDANDFIFIGKVEDDKLYALNMWRFDEDKNLQKVIFAEEVDYEQDNNWVMKDVQITDMQGETVISKQSVDQMEWQTSLAPDKLAVVTVKPEELSLSGLYDYVTYLKASEQDASRYELAFWRKLTQPLSIAVMMLMALSFVFGPLRSVTMGARVLSGVVAGFTFYISSEFFGPLTLVYGIPPVFGALAPSLVFLAIAVSLLRRKL
>NC_016613.1|WP_014233053.1|3030939_3032040_-|LPS-export-ABC-transporter-permease-LptF
MIIVRYLIRETLKSQFAIFFVLFLVFLSQKFISVLADASDGDIPAGLIFSIVGLNMPAMGLLMLPLSLYIGILITFGRLYAESEIVVMNATGIGNKFLVQAALYLALITSAVAAFNALWLSPWSQERVEQLYEQVAAENSVDLLQKGQFQGTPDGSSVVFIDDIKDNTLSNVFVAQMRPRDSVLPSVMFSSSGEVKELSDGRQIITMKEGTRYEGVPTRVEYMITKFDQYEGVIGQREVKKKGRDWEAYPTADLIGHPDSEAQAELQWRISLFVCIPLLTMLVIPLSAVNPRQGRFAKMGPAILIYLAYFLAISATKSALEDGSIPTTVGMWPINAMLLIVAILANMMDSVPARRMKEKFRKKRLA
>NC_016613.1|WP_014233054.1|3032240_3033749_+|leucyl-aminopeptidase
MEFSVKSGSPEKQRSACIVVGVFEPRRLSPVAEQLDKISDGYISSLLRRGDLEGKPGQMLLLHQVPGVLSERVLLVGCGKERELGERQYKEIIQKTISTLNETGSMEAVCFLTELHVKGRDTYWKVRQAVEATKDGLYTFNQFKSVRPETRRPLRKLVFNVPTRRELSLGEKAITHGLAIASGVKASKDLGNMPPNVANPAYLASQARRLADDYETVTTKIIGEQEMEKLGMTSYLAVGRGSKNESMMSIIEYKGNPDSDAKPIVLVGKGLTFDSGGISLKPGEGMDEMKYDMCGAASVFGTMKALAKLNLPINVIGVLAGCENMPGSNAYRPGDILTTMSGQTVEVLNTDAEGRLVLCDALTYVERFEPDCVVDVATLTGACVIALGHHISGVLSNHNPLAHELVNASEQASDRAWRLPMADEYHEQLKSPFADMQNIGGRPAGTITAGCFLSKFAKKYNWAHLDIAGTAWKSGAAKGSTGRPVSMLVQFLLNRSGQETEE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NC_016613_1	1.1\|3012899\|39\|NC_016613\|PILER-CR	3012899-3012937	39	NC_016613.1	3012522-3012560	0	1.0

1. spacer 1.1|3012899|39|NC_016613|PILER-CR matches to position: 3012522-3012560, mismatch: 0, identity: 1.0

taggtcaccagttcgattccggtagtcggcaccattctt	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccattctt	Protospacer
***************************************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_016613_1	1.1\|3012899\|39\|NC_016613\|PILER-CR	3012899-3012937	39	NZ_CP041417	Escherichia coli strain STEC711 plasmid pSTEC711_1, complete sequence	296499-296537	4	0.897
NC_016613_1	1.1\|3012899\|39\|NC_016613\|PILER-CR	3012899-3012937	39	NZ_LN868946	Salmonella enterica subsp. enterica serovar Senftenberg strain NCTC10384 plasmid 4, complete sequence	103821-103859	4	0.897
NC_016613_1	1.1\|3012899\|39\|NC_016613\|PILER-CR	3012899-3012937	39	KU052038	Escherichia phage SerU-LTIIb, partial genome	1164-1202	4	0.897
NC_016613_1	1.1\|3012899\|39\|NC_016613\|PILER-CR	3012899-3012937	39	KU052038	Escherichia phage SerU-LTIIb, partial genome	3070-3108	4	0.897
NC_016613_1	1.1\|3012899\|39\|NC_016613\|PILER-CR	3012899-3012937	39	LN997803	Escherichia coli phage phi467	15124-15162	4	0.897
NC_016613_1	1.1\|3012899\|39\|NC_016613\|PILER-CR	3012899-3012937	39	NZ_CP023526	Cedecea neteri strain FDAARGOS_392 plasmid unnamed, complete sequence	1927-1965	4	0.897
NC_016613_1	1.1\|3012899\|39\|NC_016613\|PILER-CR	3012899-3012937	39	NZ_CP022660	Salmonella enterica subsp. enterica strain RM11060 plasmid pRM11060-2, complete sequence	52076-52114	4	0.897
NC_016613_1	1.1\|3012899\|39\|NC_016613\|PILER-CR	3012899-3012937	39	NZ_CP045061	Salmonella enterica subsp. enterica serovar Muenchen strain LG26 plasmid pLG26p2, complete sequence	52082-52120	4	0.897
NC_016613_1	1.1\|3012899\|39\|NC_016613\|PILER-CR	3012899-3012937	39	NZ_CP045054	Salmonella enterica subsp. enterica serovar Muenchen strain LG24 plasmid pLG24p2, complete sequence	52087-52125	4	0.897
NC_016613_1	1.1\|3012899\|39\|NC_016613\|PILER-CR	3012899-3012937	39	NZ_CP045058	Salmonella enterica subsp. enterica serovar Muenchen strain LG25 plasmid pLG25p2, complete sequence	52086-52124	4	0.897
NC_016613_1	1.1\|3012899\|39\|NC_016613\|PILER-CR	3012899-3012937	39	NC_021742	Serratia liquefaciens ATCC 27592 plasmid unnamed, complete sequence	35426-35464	4	0.897
NC_016613_1	1.1\|3012899\|39\|NC_016613\|PILER-CR	3012899-3012937	39	MH791411	UNVERIFIED: Escherichia phage Ecwhy_1, complete genome	13643-13681	4	0.897
NC_016613_1	1.1\|3012899\|39\|NC_016613\|PILER-CR	3012899-3012937	39	MH494197	Escherichia phage CMSTMSU, complete genome	196770-196808	4	0.897
NC_016613_1	1.1\|3012899\|39\|NC_016613\|PILER-CR	3012899-3012937	39	NZ_CP054057	Scandinavium goeteborgense strain CCUG 66741 plasmid pSg66741_1, complete sequence	85815-85853	5	0.872
NC_016613_1	1.1\|3012899\|39\|NC_016613\|PILER-CR	3012899-3012937	39	KY653118	Morganella phage IME1369_01, complete genome	696-734	5	0.872
NC_016613_1	1.1\|3012899\|39\|NC_016613\|PILER-CR	3012899-3012937	39	LC494302	Escherichia phage SP27 DNA, complete genome	76611-76649	7	0.821
NC_016613_1	1.1\|3012899\|39\|NC_016613\|PILER-CR	3012899-3012937	39	LT603033	Escherichia phage vB_Eco_slurp01 genome assembly, chromosome: I	17117-17155	7	0.821
NC_016613_1	1.1\|3012899\|39\|NC_016613\|PILER-CR	3012899-3012937	39	NC_027364	Escherichia phage PBECO 4, complete genome	207830-207868	7	0.821
NC_016613_1	1.1\|3012899\|39\|NC_016613\|PILER-CR	3012899-3012937	39	NC_049942	Escherichia phage JLK-2012, complete sequence	23524-23562	7	0.821
NC_016613_1	1.1\|3012899\|39\|NC_016613\|PILER-CR	3012899-3012937	39	MK817115	Escherichia phage vB_EcoM_phAPEC6, complete genome	52943-52981	8	0.795
NC_016613_1	1.1\|3012899\|39\|NC_016613\|PILER-CR	3012899-3012937	39	MH383160	Escherichia phage UB, complete genome	272122-272160	8	0.795
NC_016613_1	1.1\|3012899\|39\|NC_016613\|PILER-CR	3012899-3012937	39	MK327931	Escherichia phage vB_EcoM_G17, complete genome	77927-77965	8	0.795
NC_016613_1	1.1\|3012899\|39\|NC_016613\|PILER-CR	3012899-3012937	39	KM507819	Escherichia phage 121Q, complete genome	77938-77976	9	0.769

1. spacer 1.1|3012899|39|NC_016613|PILER-CR matches to NZ_CP041417 (Escherichia coli strain STEC711 plasmid pSTEC711_1, complete sequence) position: , mismatch: 4, identity: 0.897

taggtcaccagttcgattccggtagtcggcaccattctt	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccatatgc	Protospacer
*********************************** . .

2. spacer 1.1|3012899|39|NC_016613|PILER-CR matches to NZ_LN868946 (Salmonella enterica subsp. enterica serovar Senftenberg strain NCTC10384 plasmid 4, complete sequence) position: , mismatch: 4, identity: 0.897

taggtcaccagttcgattccggtagtcggcaccattctt	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccatcaag	Protospacer
***********************************.

3. spacer 1.1|3012899|39|NC_016613|PILER-CR matches to KU052038 (Escherichia phage SerU-LTIIb, partial genome) position: , mismatch: 4, identity: 0.897

taggtcaccagttcgattccggtagtcggcaccattctt	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccatatgc	Protospacer
*********************************** . .

4. spacer 1.1|3012899|39|NC_016613|PILER-CR matches to KU052038 (Escherichia phage SerU-LTIIb, partial genome) position: , mismatch: 4, identity: 0.897

taggtcaccagttcgattccggtagtcggcaccattctt	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccatatgc	Protospacer
*********************************** . .

5. spacer 1.1|3012899|39|NC_016613|PILER-CR matches to LN997803 (Escherichia coli phage phi467) position: , mismatch: 4, identity: 0.897

taggtcaccagttcgattccggtagtcggcaccattctt	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccatatgc	Protospacer
*********************************** . .

6. spacer 1.1|3012899|39|NC_016613|PILER-CR matches to NZ_CP023526 (Cedecea neteri strain FDAARGOS_392 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.897

taggtcaccagttcgattccggtagtcggcaccattctt	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccagaatg	Protospacer
**********************************   *

7. spacer 1.1|3012899|39|NC_016613|PILER-CR matches to NZ_CP022660 (Salmonella enterica subsp. enterica strain RM11060 plasmid pRM11060-2, complete sequence) position: , mismatch: 4, identity: 0.897

taggtcaccagttcgattccggtagtcggcaccattctt	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccacttac	Protospacer
**********************************.*. .

8. spacer 1.1|3012899|39|NC_016613|PILER-CR matches to NZ_CP045061 (Salmonella enterica subsp. enterica serovar Muenchen strain LG26 plasmid pLG26p2, complete sequence) position: , mismatch: 4, identity: 0.897

taggtcaccagttcgattccggtagtcggcaccattctt	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccacttac	Protospacer
**********************************.*. .

9. spacer 1.1|3012899|39|NC_016613|PILER-CR matches to NZ_CP045054 (Salmonella enterica subsp. enterica serovar Muenchen strain LG24 plasmid pLG24p2, complete sequence) position: , mismatch: 4, identity: 0.897

taggtcaccagttcgattccggtagtcggcaccattctt	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccacttac	Protospacer
**********************************.*. .

10. spacer 1.1|3012899|39|NC_016613|PILER-CR matches to NZ_CP045058 (Salmonella enterica subsp. enterica serovar Muenchen strain LG25 plasmid pLG25p2, complete sequence) position: , mismatch: 4, identity: 0.897

taggtcaccagttcgattccggtagtcggcaccattctt	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccacttac	Protospacer
**********************************.*. .

11. spacer 1.1|3012899|39|NC_016613|PILER-CR matches to NC_021742 (Serratia liquefaciens ATCC 27592 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.897

taggtcaccagttcgattccggtagtcggcaccattctt	CRISPR spacer
taggtcaccagttcgattccggtagccggcaccaatcaa	Protospacer
*************************.******** **

12. spacer 1.1|3012899|39|NC_016613|PILER-CR matches to MH791411 (UNVERIFIED: Escherichia phage Ecwhy_1, complete genome) position: , mismatch: 4, identity: 0.897

taggtcaccagttcgattccggtagtcggcaccattctt	CRISPR spacer
taggtcaccagttcgattccggtagtcggcacaaatcag	Protospacer
******************************** * **

13. spacer 1.1|3012899|39|NC_016613|PILER-CR matches to MH494197 (Escherichia phage CMSTMSU, complete genome) position: , mismatch: 4, identity: 0.897

taggtcaccagttcgattccggtagtcggcaccattctt	CRISPR spacer
taggtcaccagttcgattccggtagtcggcacaaatcag	Protospacer
******************************** * **

14. spacer 1.1|3012899|39|NC_016613|PILER-CR matches to NZ_CP054057 (Scandinavium goeteborgense strain CCUG 66741 plasmid pSg66741_1, complete sequence) position: , mismatch: 5, identity: 0.872

taggtcaccagttcgattccggtagtcggcaccattctt	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccaaatgc	Protospacer
**********************************  . .

15. spacer 1.1|3012899|39|NC_016613|PILER-CR matches to KY653118 (Morganella phage IME1369_01, complete genome) position: , mismatch: 5, identity: 0.872

taggtcaccagttcgattccggtagtcggcaccattctt	CRISPR spacer
taggtcaccagttcgactccggtagccggcaccatatta	Protospacer
****************.********.********* .*

16. spacer 1.1|3012899|39|NC_016613|PILER-CR matches to LC494302 (Escherichia phage SP27 DNA, complete genome) position: , mismatch: 7, identity: 0.821

taggtcaccagttcgattccggtagtcggcaccattctt	CRISPR spacer
aaggtcaccagttcgattccggtagtcggcacaaaataa	Protospacer
 ******************************* *  .

17. spacer 1.1|3012899|39|NC_016613|PILER-CR matches to LT603033 (Escherichia phage vB_Eco_slurp01 genome assembly, chromosome: I) position: , mismatch: 7, identity: 0.821

taggtcaccagttcgattccggtagtcggcaccattctt	CRISPR spacer
aaggtcaccagttcgattccggtagtcggcacaaaataa	Protospacer
 ******************************* *  .

18. spacer 1.1|3012899|39|NC_016613|PILER-CR matches to NC_027364 (Escherichia phage PBECO 4, complete genome) position: , mismatch: 7, identity: 0.821

taggtcaccagttcgattccggtagtcggcaccattctt	CRISPR spacer
aaggtcaccagttcgattccggtagtcggcacaaaataa	Protospacer
 ******************************* *  .

19. spacer 1.1|3012899|39|NC_016613|PILER-CR matches to NC_049942 (Escherichia phage JLK-2012, complete sequence) position: , mismatch: 7, identity: 0.821

taggtcaccagttcgattccggtagtcggcaccattctt	CRISPR spacer
caggtcgccagttcgattccggtagccggcaccatatgc	Protospacer
.*****.******************.********* . .

20. spacer 1.1|3012899|39|NC_016613|PILER-CR matches to MK817115 (Escherichia phage vB_EcoM_phAPEC6, complete genome) position: , mismatch: 8, identity: 0.795

taggtcaccagttcgattccggtagtcggcaccattctt	CRISPR spacer
aatgtcaccagttcgattccggtagtcggcacaaaataa	Protospacer
 * ***************************** *  .

21. spacer 1.1|3012899|39|NC_016613|PILER-CR matches to MH383160 (Escherichia phage UB, complete genome) position: , mismatch: 8, identity: 0.795

taggtcaccagttcgattccggtagtcggcaccattctt	CRISPR spacer
aatgtcaccagttcgattccggtagtcggcacaaaataa	Protospacer
 * ***************************** *  .

22. spacer 1.1|3012899|39|NC_016613|PILER-CR matches to MK327931 (Escherichia phage vB_EcoM_G17, complete genome) position: , mismatch: 8, identity: 0.795

taggtcaccagttcgattccggtagtcggcaccattctt	CRISPR spacer
aatgtcaccagttcgattccggtagtcggcacaaaataa	Protospacer
 * ***************************** *  .

23. spacer 1.1|3012899|39|NC_016613|PILER-CR matches to KM507819 (Escherichia phage 121Q, complete genome) position: , mismatch: 9, identity: 0.769

taggtcaccagttcgattccggtagtcggcaccattctt	CRISPR spacer
aatgtcaccagttcaattccggtagtcggcacaaaataa	Protospacer
 * ***********.***************** *  .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

709782 : 716436

Staphylococcus_phage(66.67%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014231006.1\|709782_710922_+	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	1.7e-62	41.7
WP_014231007.1\|710939_712190_+	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	6.1e-98	47.4
WP_014231008.1\|712306_712756_+	transcriptional regulator NrdR	NA	NA	NA	NA
WP_014231009.1\|712762_713881_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	4.9e-46	37.4
WP_014231010.1\|713898_714552_+	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	1.8e-32	37.0
WP_014231011.1\|714687_715797_+	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	2.7e-65	39.3
WP_014231012.1\|715965_716436_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	3.7e-32	48.0

DBSCAN-SWA_2

2153134 : 2177740

Vibrio_phage(23.08%)

integrase,tail,terminase,protease,portal

attL 2148864:2148876|attR 2170109:2170121

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2148864:2148876	attL	NA	NA	NA	NA
WP_041170239.1\|2153134_2154079_+\|integrase	integron integrase	A0A0K2CP59	Brevibacillus_phage	1.5e-16	27.1
WP_014232291.1\|2154373_2156281_+	acyltransferase	A0A193GZ69	Enterobacter_phage	4.8e-94	36.9
WP_014232292.1\|2156555_2159438_-	hypothetical protein	A0A0H5ART3	Pseudomonas_phage	4.0e-100	30.7
WP_014232293.1\|2159412_2159835_-	C40 family peptidase	NA	NA	NA	NA
WP_014232294.1\|2159853_2160342_-	DUF1833 family protein	A0A2H4J983	uncultured_Caudovirales_phage	1.8e-24	40.6
WP_014232295.1\|2160355_2162941_-	flagellar biosynthesis, cell-distal portion of basal-body rod	A0A2I7QLP4	Vibrio_phage	9.0e-19	27.5
WP_014232296.1\|2162940_2163414_-	hypothetical protein	NA	NA	NA	NA
WP_014232298.1\|2165827_2166106_-	hypothetical protein	NA	NA	NA	NA
WP_014232299.1\|2166168_2166597_-	hypothetical protein	NA	NA	NA	NA
WP_014232300.1\|2166648_2167173_-\|tail	tail fiber protein	NA	NA	NA	NA
WP_014232301.1\|2167176_2167599_-	hypothetical protein	NA	NA	NA	NA
WP_014232302.1\|2167595_2168231_-\|tail	phage tail protein	A0A291AWZ0	Escherichia_phage	3.3e-23	36.8
WP_049794635.1\|2168227_2168533_-	hypothetical protein	NA	NA	NA	NA
WP_014232304.1\|2168532_2168877_-	DUF2190 family protein	NA	NA	NA	NA
WP_041170354.1\|2168944_2170984_-\|protease	Clp protease ClpP	A0A1W6JT88	Pseudomonas_phage	4.2e-189	56.0
2170109:2170121	attR	NA	NA	NA	NA
WP_014232306.1\|2170976_2172503_-\|portal	phage portal protein	K7PHM5	Enterobacterial_phage	1.9e-141	51.6
WP_014232307.1\|2172499_2172712_-	hypothetical protein	K7PMB5	Enterobacterial_phage	5.4e-07	47.9
WP_014232308.1\|2172708_2174706_-\|terminase	phage terminase large subunit family protein	A0A0K2FJ14	Enterobacteria_phage	1.2e-209	57.6
WP_014232309.1\|2174680_2175226_-\|terminase	terminase small subunit	R9TRM5	Vibrio_phage	6.9e-46	54.4
WP_014232310.1\|2175691_2175934_-	hypothetical protein	NA	NA	NA	NA
WP_014232312.1\|2176045_2176309_-	hypothetical protein	NA	NA	NA	NA
WP_158308259.1\|2176349_2176637_-	hypothetical protein	W6E9J9	Shewanella_phage	5.8e-20	43.2
WP_014232314.1\|2176689_2176980_-	hypothetical protein	NA	NA	NA	NA
WP_014232315.1\|2177050_2177740_-	hypothetical protein	R9TRM8	Vibrio_phage	9.3e-56	48.6

DBSCAN-SWA_3

2180989 : 2192705

Vibrio_phage(78.57%)

integrase

attL 2175475:2175492|attR 2198336:2198353

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2175475:2175492	attL	NA	NA	NA	NA
WP_014232320.1\|2180989_2181961_-	DUF968 domain-containing protein	R9TRM9	Vibrio_phage	1.7e-58	42.1
WP_014232321.1\|2181971_2182277_-	DUF4406 domain-containing protein	A0A1V0E824	Vibrio_phage	2.1e-23	55.1
WP_014232322.1\|2182273_2182582_-	hypothetical protein	R9TNL4	Vibrio_phage	3.7e-36	68.6
WP_014232323.1\|2182578_2182767_-	hypothetical protein	R9TR49	Vibrio_phage	5.7e-16	69.5
WP_014232324.1\|2182763_2183462_-	phage antirepressor KilAC domain-containing protein	R9TMN1	Vibrio_phage	1.4e-83	72.9
WP_014232325.1\|2183628_2184615_-	helix-turn-helix domain-containing protein	R9TPU9	Vibrio_phage	1.2e-112	66.2
WP_014232326.1\|2184605_2184812_-	hypothetical protein	NA	NA	NA	NA
WP_086027146.1\|2184811_2184985_-	hypothetical protein	NA	NA	NA	NA
WP_158308260.1\|2185182_2185356_-	hypothetical protein	NA	NA	NA	NA
WP_014232327.1\|2185352_2185862_-	phage regulatory CII family protein	NA	NA	NA	NA
WP_020335501.1\|2185893_2186106_-	hypothetical protein	A0A1I9KFF6	Aeromonas_phage	2.0e-09	56.1
WP_014232328.1\|2186141_2186942_+	helix-turn-helix transcriptional regulator	W6MVG5	Pseudomonas_phage	3.6e-59	50.0
WP_014232329.1\|2187107_2187491_+	outer membrane protein assembly factor BamE	NA	NA	NA	NA
WP_014232330.1\|2187834_2188227_+	hypothetical protein	R9TMP0	Vibrio_phage	2.7e-60	89.1
WP_014232331.1\|2188267_2189086_+	DUF2303 family protein	R9TRN9	Vibrio_phage	4.4e-121	80.1
WP_014232332.1\|2189146_2189521_+	hypothetical protein	NA	NA	NA	NA
WP_014232333.1\|2189517_2189754_+	hypothetical protein	A0A1V0E8D1	Vibrio_phage	1.3e-20	69.4
WP_148263133.1\|2189732_2190341_+	HNH endonuclease	A0A1V0E8E4	Vibrio_phage	3.5e-54	53.1
WP_014232335.1\|2190337_2190715_+	hypothetical protein	NA	NA	NA	NA
WP_014232336.1\|2190716_2190929_+	hypothetical protein	NA	NA	NA	NA
WP_014232337.1\|2190921_2191137_+	hypothetical protein	A0A1V0E8D5	Vibrio_phage	4.2e-07	37.3
WP_014232338.1\|2191239_2191470_+	excisionase family protein	NA	NA	NA	NA
WP_014232339.1\|2191469_2192705_+\|integrase	tyrosine-type recombinase/integrase	A0A0U2JGI6	Escherichia_phage	1.6e-74	40.4
2198336:2198353	attR	NA	NA	NA	NA

DBSCAN-SWA_4

2935810 : 2952809

uncultured_Mediterranean_phage(18.18%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014232972.1\|2935810_2938393_-\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	6.6e-78	37.7
WP_014232973.1\|2938535_2939003_-	recombination regulator RecX	NA	NA	NA	NA
WP_014232974.1\|2939117_2940164_-	recombinase RecA	A0A2D1GPX2	Mycobacterium_phage	1.4e-111	60.7
WP_014232975.1\|2940354_2940846_-	nicotinamide-nucleotide amidase	B5TK85	Pseudomonas_phage	1.1e-26	46.8
WP_014232976.1\|2940930_2943492_+	DNA mismatch repair protein MutS	A0A1V0SC35	Catovirus	1.2e-31	23.3
WP_014232977.1\|2943566_2944553_-	RNA polymerase sigma factor RpoS	F4YCU2	Synechococcus_phage	6.9e-36	35.2
WP_041170268.1\|2944633_2945557_-	murein hydrolase activator NlpD	D7RWE0	Brochothrix_phage	1.8e-06	36.4
WP_014232979.1\|2945570_2946197_-	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	6.7e-37	52.7
WP_024372917.1\|2946196_2946943_-	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	9.7e-67	52.4
WP_014232981.1\|2946972_2948016_-\|tRNA	tRNA pseudouridine(13) synthase TruD	NA	NA	NA	NA
WP_014232982.1\|2948058_2948538_-	2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase	NA	NA	NA	NA
WP_014232983.1\|2948551_2949259_-	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	A0A2H4UTB4	Bodo_saltans_virus	3.1e-06	26.2
WP_014232984.1\|2949260_2949542_-	cell division protein FtsB	NA	NA	NA	NA
WP_014232985.1\|2949785_2951087_-	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	2.7e-136	60.3
WP_014232986.1\|2951168_2952809_-	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	5.5e-155	52.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NC_016614

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1922244 : 1930397

Bacillus_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014235081.1\|1922244_1923096_-	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	4.4e-31	36.9
WP_014235082.1\|1923125_1924157_-	taurine ABC transporter substrate-binding protein	G3M9Z0	Bacillus_virus	3.2e-07	27.3
WP_014235083.1\|1924372_1925788_-	aminotransferase class III-fold pyridoxal phosphate-dependent enzyme	A0A1V0SKB7	Klosneuvirus	1.8e-21	24.5
WP_014235084.1\|1925967_1927443_+	PLP-dependent aminotransferase family protein	A0A1X9I5H2	Streptococcus_phage	1.8e-16	27.8
WP_014235085.1\|1927636_1928362_+	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
WP_014235086.1\|1928396_1929173_+	SDR family NAD(P)-dependent oxidoreductase	F2NZ12	Diadromus_pulchellus_ascovirus	1.0e-05	29.6
WP_014235087.1\|1929701_1930397_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.6e-24	31.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_016613

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NC_016614

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection