CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NC_017045	Riemerella anatipestifer ATCC 11845 = DSM 15868, complete sequence	3 crisprs	cas3,WYL,DEDDh,cas2,cas1,Csx28,cas13b	4	35	3	2

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_017045_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_017045_1

1020412-1021382

Unclear

Consensus_repeat	Method
GTTGTGAATTGCTTTCAATTTTTACTATCTTTGTGATAGTTCGCAAC	CRISPRCasFinder
GTTGTGAATTGCTTTCAATTTTTACTATCTTTGTGATAGTTCGCAAC	PILER-CR

12 spacers

cas2,cas1

The CRISPR arrays of NC_017045_1

>merge|NC_017045|1|1020412-1021382|CRISPRCasFinder,PILER-CR
ATTATGAATTGCTTTCAATTTTCACTATCTTTGTGATAATTCGCAACTATCTGCACAGGAGAAAATAGAGTCAATCAGTTGTGAATTGCTTTCAATTTTCACTATCTTTGTGATAATTCGCAACGTCCGTTGTCGGTTCATCTGATACTATATCGTTGTGAATTGCTTTCAATTTTCACTATCTTTGTGATAATTCGCAACTGGGATTTGACAAAACCTTACCTCAAAGACGTTGTGAATTGCTTTCAATTTTCACTATCTTTGTGATAATTCGCAACATTTTACACGAAGATAAAGAGATGTATCTAGTTGTGAATTGCTTTCAATTTTTACTATCTTTGTGATAGTTCGCAACTAAATGTTTATTTATAGTTTGTTCGGTGTAGTTGTGAATTGCTTTCAATTTTTACTATCTTTGTGATAGTTCGCAACTCCCCCATCCGCTTTCAAGAGCTGCCTGTGGTTGTGAATTGCTTTCAATTTTTACTATCTTTGTGATAGTTCGCAACGCAATGAATAACTATATGGAAGCCTTGAAAGTTGTGAATTGCTTTCAATTTTTACTATCTTTGTGATAGTTCGCAACAACATTGCAATAAAACTAATAAACGAAGTAGTTGTGAATTGCTTTCAATTTTTACTATCTTTGTGATAGTTCGCAACATAGACGAGATTGAGATATGACAACACCTCGTTGTGAATTGCTTTCAATTTTTACTATCTTTGTGATAGTTCGCAACGATTTTCAGCTAATTAAATTATTTAATAAAGTTGTGAATTGCTTTCAATTTTTACTATCTTTGTGATAGTTCGCAACGACAAAATAAAACAGATGTGCGATGGGATAGTTGTGAATTGCTTTCAATTTTTACTATCTTTGTGATAGTTCGCAACAACTACTTTCTAAAGCATTACAATTAAGAAGTTGTGAATTGCTTTCAATTTTTACTATCTTTGTGATAGTTCGCAAC

>NC_017045|1|1|1020412-1021382|CRISPRCasFinder
ATTATGAATTGCTTTCAATTTTCACTATCTTTGTGATAATTCGCAAC	TATCTGCACAGGAGAAAATAGAGTCAATCA
GTTGTGAATTGCTTTCAATTTTCACTATCTTTGTGATAATTCGCAAC	GTCCGTTGTCGGTTCATCTGATACTATATC
GTTGTGAATTGCTTTCAATTTTCACTATCTTTGTGATAATTCGCAAC	TGGGATTTGACAAAACCTTACCTCAAAGAC
GTTGTGAATTGCTTTCAATTTTCACTATCTTTGTGATAATTCGCAAC	ATTTTACACGAAGATAAAGAGATGTATCTA
GTTGTGAATTGCTTTCAATTTTTACTATCTTTGTGATAGTTCGCAAC	TAAATGTTTATTTATAGTTTGTTCGGTGTA
GTTGTGAATTGCTTTCAATTTTTACTATCTTTGTGATAGTTCGCAAC	TCCCCCATCCGCTTTCAAGAGCTGCCTGTG
GTTGTGAATTGCTTTCAATTTTTACTATCTTTGTGATAGTTCGCAAC	GCAATGAATAACTATATGGAAGCCTTGAAA
GTTGTGAATTGCTTTCAATTTTTACTATCTTTGTGATAGTTCGCAAC	AACATTGCAATAAAACTAATAAACGAAGTA
GTTGTGAATTGCTTTCAATTTTTACTATCTTTGTGATAGTTCGCAAC	ATAGACGAGATTGAGATATGACAACACCTC
GTTGTGAATTGCTTTCAATTTTTACTATCTTTGTGATAGTTCGCAAC	GATTTTCAGCTAATTAAATTATTTAATAAA
GTTGTGAATTGCTTTCAATTTTTACTATCTTTGTGATAGTTCGCAAC	GACAAAATAAAACAGATGTGCGATGGGATA
GTTGTGAATTGCTTTCAATTTTTACTATCTTTGTGATAGTTCGCAAC	AACTACTTTCTAAAGCATTACAATTAAGAA
GTTGTGAATTGCTTTCAATTTTTACTATCTTTGTGATAGTTCGCAAC

>NC_017045|1|1|1020413-1021382|PILER-CR
TTATGAATTGCTTTCAATTTTCACTATCTTTGTGATAATTCGCAACT	ATCTGCACAGGAGAAAATAGAGTCAATCAG
TTGTGAATTGCTTTCAATTTTCACTATCTTTGTGATAATTCGCAACG	TCCGTTGTCGGTTCATCTGATACTATATCG
TTGTGAATTGCTTTCAATTTTCACTATCTTTGTGATAATTCGCAACT	GGGATTTGACAAAACCTTACCTCAAAGACG
TTGTGAATTGCTTTCAATTTTCACTATCTTTGTGATAATTCGCAACA	TTTTACACGAAGATAAAGAGATGTATCTAG
TTGTGAATTGCTTTCAATTTTTACTATCTTTGTGATAGTTCGCAACT	AAATGTTTATTTATAGTTTGTTCGGTGTAG
TTGTGAATTGCTTTCAATTTTTACTATCTTTGTGATAGTTCGCAACT	CCCCCATCCGCTTTCAAGAGCTGCCTGTGG
TTGTGAATTGCTTTCAATTTTTACTATCTTTGTGATAGTTCGCAACG	CAATGAATAACTATATGGAAGCCTTGAAAG
TTGTGAATTGCTTTCAATTTTTACTATCTTTGTGATAGTTCGCAACA	ACATTGCAATAAAACTAATAAACGAAGTAG
TTGTGAATTGCTTTCAATTTTTACTATCTTTGTGATAGTTCGCAACA	TAGACGAGATTGAGATATGACAACACCTCG
TTGTGAATTGCTTTCAATTTTTACTATCTTTGTGATAGTTCGCAACG	ATTTTCAGCTAATTAAATTATTTAATAAAG
TTGTGAATTGCTTTCAATTTTTACTATCTTTGTGATAGTTCGCAACG	ACAAAATAAAACAGATGTGCGATGGGATAG
TTGTGAATTGCTTTCAATTTTTACTATCTTTGTGATAGTTCGCAACA	ACTACTTTCTAAAGCATTACAATTAAGAAG
TTGTGAATTGCTTTCAATTTTTACTATCTTTGTGATAGTTCGCAAC

Protein	Signature genes	Signature genes Name	Protein_function
NC_017045.1\|WP_004918216.1\|1015896_1018704_+\|carboxypeptidase-regulatory-like-domain-containing-protein	unknown	unknown	gnl\|CDD\|200604
NC_017045.1\|WP_004918211.1\|1021489_1021828_-\|CRISPR-associated-endonuclease-Cas2	cas2	COG3512_cas2_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|226043
NC_017045.1\|WP_004918219.1\|1014431_1015625_-\|endonuclease/exonuclease/phosphatase-family-protein	unknown	unknown	gnl\|CDD\|197338
NC_017045.1\|WP_004918202.1\|1028164_1028494_-\|2Fe-2S-iron-sulfur-cluster-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|185668
NC_017045.1\|WP_004918223.1\|1012261_1012699_-\|hypothetical-protein	unknown	unknown	unknown
NC_017045.1\|WP_013446920.1\|1028499_1029552_-\|NAD(P)/FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|223566
NC_017045.1\|WP_013446921.1\|1029689_1030457_+\|DUF3108-domain-containing-protein	unknown	unknown	gnl\|CDD\|378635
NC_017045.1\|WP_004918222.1\|1012698_1014327_-\|methylcrotonoyl-CoA-carboxylase	unknown	unknown	gnl\|CDD\|178415
NC_017045.1\|WP_013446918.1\|1009610_1010279_-\|succinate-dehydrogenase-cytochrome-b-subunit	unknown	unknown	gnl\|CDD\|239578
NC_017045.1\|WP_013446916.1\|1005571_1006654_-\|DNA-polymerase-IV	unknown	unknown	gnl\|CDD\|235035
NC_017045.1\|WP_004918190.1\|1031851_1032826_+\|deoxyhypusine-synthase-family-protein	unknown	unknown	gnl\|CDD\|376661
NC_017045.1\|WP_004918209.1\|1021817_1022717_-\|type-II-CRISPR-associated-endonuclease-Cas1	cas1	cd09720_cas1_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|274694
NC_017045.1\|WP_004918191.1\|1031034_1031700_+\|DUF937-domain-containing-protein	unknown	unknown	gnl\|CDD\|368733
NC_017045.1\|WP_004918186.1\|1032930_1033458_+\|exosortase-family-protein-XrtF	unknown	unknown	gnl\|CDD\|275001
NC_017045.1\|WP_004918194.1\|1030486_1030987_+\|DUF2480-family-protein	unknown	unknown	gnl\|CDD\|313799
NC_017045.1\|WP_004918231.1\|1006739_1007510_-\|succinate-dehydrogenase/fumarate-reductase-iron-sulfur-subunit	unknown	unknown	gnl\|CDD\|181038
NC_017045.1\|WP_004918215.1\|1018729_1020133_+\|choice-of-anchor-J-domain-containing-protein	unknown	unknown	unknown
NC_017045.1\|WP_013446917.1\|1007533_1009546_-\|fumarate-reductase/succinate-dehydrogenase-flavoprotein-subunit	unknown	unknown	gnl\|CDD\|236054
NC_017045.1\|WP_004918205.1\|1027183_1028119_+\|nitronate-monooxygenase	unknown	unknown	gnl\|CDD\|240081
NC_017045.1\|WP_004918225.1\|1010403_1012212_-\|ComEC/Rec2-family-competence-protein	unknown	unknown	gnl\|CDD\|377126

Protein	Function_ID	Function_description	E-value
NC_017045.1\|WP_004918216.1\|1015896_1018704_+\|carboxypeptidase-regulatory-like-domain-containing-protein	gnl\|CDD\|200604	cd11308, Peptidase_M14NE-CP-C_like, Peptidase associated domain: C-terminal domain of M14 N/E carboxypeptidase; putative folding, regulation, or interaction domain. This domain is found C-terminal to the M14 carboxypeptidase (CP) N/E subfamily containing zinc-binding enzymes that hydrolyze single C-terminal amino acids from polypeptide chains, and have a recognition site for the free C-terminal carboxyl group, which is a key determinant of specificity. The N/E subfamily includes enzymatically active members (carboxypeptidase N, E, M, D, and Z), as well as non-active members (carboxypeptidase-like protein 1, -2, aortic CP-like protein, and adipocyte enhancer binding protein-1) which lack the critical active site and substrate-binding residues considered necessary for activity. The active N/E enzymes fulfill a variety of cellular functions, including prohormone processing, regulation of peptide hormone activity, alteration of protein-protein or protein-cell interactions and transcriptional regulation. For M14 CPs, it has been suggested that this domain may assist in folding of the CP domain, regulate enzyme activity, or be involved in interactions with other proteins or with membranes; for carboxypeptidase M, it may interact with the bradykinin 1 receptor at the cell surface. This domain may also be found in other peptidase families.	3.44158e-06
NC_017045.1\|WP_004918211.1\|1021489_1021828_-\|CRISPR-associated-endonuclease-Cas2	gnl\|CDD\|226043	COG3512, COG3512, CRISPR-associated protein, Cas2 homolog [Defense mechanisms].	2.87616e-22
NC_017045.1\|WP_004918219.1\|1014431_1015625_-\|endonuclease/exonuclease/phosphatase-family-protein	gnl\|CDD\|197338	cd10283, MnuA_DNase1-like, Mycoplasma pulmonis MnuA nuclease-like. This subfamily includes Mycoplasma pulmonis MnuA, a membrane-associated nuclease related to Deoxyribonuclease 1 (DNase1 or DNase I, EC 3.1.21.1). The in vivo role of MnuA is as yet undetermined. This subfamily belongs to the large EEP (exonuclease/endonuclease/phosphatase) superfamily that contains functionally diverse enzymes that share a common catalytic mechanism of cleaving phosphodiester bonds.	3.89325e-14
NC_017045.1\|WP_004918202.1\|1028164_1028494_-\|2Fe-2S-iron-sulfur-cluster-binding-domain-containing-protein	gnl\|CDD\|185668	PTZ00490, PTZ00490, Ferredoxin superfamily; Provisional.	4.90592e-18
NC_017045.1\|WP_013446920.1\|1028499_1029552_-\|NAD(P)/FAD-dependent-oxidoreductase	gnl\|CDD\|223566	COG0492, TrxB, Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones].	7.35118e-74
NC_017045.1\|WP_013446921.1\|1029689_1030457_+\|DUF3108-domain-containing-protein	gnl\|CDD\|378635	pfam11306, DUF3108, Protein of unknown function (DUF3108). This is a bacterial family of putative lipoproteins. Structure 3fzx, the first structural template for this large family including several homologs in the human gut microbiome and in metagenomic datasets, folds into a beta barrel that topologically looks like a small-scale porin (such as FepA). Bacteroides fragilis glyA is a putative exported protein, and this fold is of the YmcC-like type, with a predicted signal peptide SpI cleavage site AGAMA\|QNQDC, and a Phobius server prediction of non-cytoplasmic localization for amino acids 21-236. The possibility of it being a membrane protein can be ruled out by the hydrophilic nature of the solvent exposed surface outside the barrels. Analysis of sequence conservation suggests that an area near Glu172/Trp206 is potentially interesting. These two residues are also conserved in Dali hit Structure 2in5, a hypothetical lipoprotein classified as a new YmcC-like fold in SCOP (SCOP:159271, with a 12-stranded meander beta-sheet folded into a deformed beta-barrel) despite large structural differences between the two structures, suggesting similarity in function.	3.29914e-64
NC_017045.1\|WP_004918222.1\|1012698_1014327_-\|methylcrotonoyl-CoA-carboxylase	gnl\|CDD\|178415	PLN02820, PLN02820, 3-methylcrotonyl-CoA carboxylase, beta chain.	0
NC_017045.1\|WP_013446918.1\|1009610_1010279_-\|succinate-dehydrogenase-cytochrome-b-subunit	gnl\|CDD\|239578	cd03498, SQR_TypeB_2_TM, Succinate:quinone oxidoreductase (SQR)-like Type B subfamily 2, transmembrane subunit; composed of proteins with similarity to the SQRs of Geobacter metallireducens and Corynebacterium glutamicum. SQR catalyzes the oxidation of succinate to fumarate coupled to the reduction of quinone to quinol. C. glutamicum SQR reduces low potential quinones such as menaquinone. SQR is also called succinate dehydrogenase (Sdh) or Complex II and is part of the citric acid cycle and the aerobic respiratory chain. SQR is composed of a flavoprotein catalytic subunit, an iron-sulfur protein and one or two hydrophobic transmembrane subunits. Members of this subfamily are classified as Type B as they contain one transmembrane subunit and two heme groups. The heme and quinone binding sites reside in the transmembrane subunit. The transmembrane subunit of members of this subfamily is also called Sdh cytochrome b558 subunit based on the Bacillus subtilis protein. The structural arrangement allows efficient electron transfer between the catalytic subunit, through iron-sulfur centers, and the transmembrane subunit containing the electron acceptor (quinone). The reversible reduction of quinone is an essential feature of respiration, allowing transfer of electrons between respiratory complexes. Proteins in this subfamily from G. metallireducens and G. sulfurreducens are bifunctional enzymes with SQR and QFR activities.	1.19315e-61
NC_017045.1\|WP_013446916.1\|1005571_1006654_-\|DNA-polymerase-IV	gnl\|CDD\|235035	PRK02406, PRK02406, DNA polymerase IV; Validated.	0
NC_017045.1\|WP_004918190.1\|1031851_1032826_+\|deoxyhypusine-synthase-family-protein	gnl\|CDD\|376661	pfam01916, DS, Deoxyhypusine synthase. Eukaryotic initiation factor 5A (eIF-5A) contains an unusual amino acid, hypusine [N epsilon-(4-aminobutyl-2-hydroxy)lysine]. The first step in the post-translational formation of hypusine is catalyzed by the enzyme deoxyhypusine synthase (DS) EC:1.1.1.249. The modified version of eIF-5A, and DS, are required for eukaryotic cell proliferation.	5.74471e-36
NC_017045.1\|WP_004918209.1\|1021817_1022717_-\|type-II-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|274694	TIGR03639, cas1_NMENI, CRISPR-associated endonuclease Cas1, subtype II/NMENI. The CRISPR-associated protein Cas1 is virtually universal to CRISPR systems. CRISPR, an acronym for Clustered Regularly Interspaced Short Palindromic Repeats, is a prokaryotic immunity system for foreign DNA, mostly from phage. CRISPR systems belong to different subtypes, distinguished by both nature of the repeats, the makeup of the cohort of associated Cas proteins, and by molecular phylogeny within the more universal Cas proteins such as this one. This model is of type EXCEPTION and provides more specific information than the EQUIVALOG model TIGR00287. It describes the Cas1 variant of the NMENI subtype of CRISPR/Cas system.	2.58136e-92
NC_017045.1\|WP_004918191.1\|1031034_1031700_+\|DUF937-domain-containing-protein	gnl\|CDD\|368733	pfam06078, DUF937, Bacterial protein of unknown function (DUF937). This family consists of several hypothetical bacterial proteins of unknown function.	9.81533e-14
NC_017045.1\|WP_004918186.1\|1032930_1033458_+\|exosortase-family-protein-XrtF	gnl\|CDD\|275001	TIGR04128, hypothetical_protein_HMPREF0204_10576, exosortase family protein XrtF. Members of this protein family are exosortase-related proteins found always in association with a member of family TIGR04127, a small, hydrophobic, uncharacterized protein limited to the Bacteriodetes. Exosortases are proposed transpeptidases with a cysteine active site (3.4.22.-), but usually are associated with specific C-terminal target motifs (PEP-CTERM, PEF-CTERM, PGF-CTERM, etc).	1.54443e-54
NC_017045.1\|WP_004918194.1\|1030486_1030987_+\|DUF2480-family-protein	gnl\|CDD\|313799	pfam10652, DUF2480, Protein of unknown function (DUF2480). All the members of this family are uncharacterized proteins, but the environment in which they are found on the bacterial genome suggests a function as a glucose-6-phosphate isomerase (EC 5.3.1.9). This could not, however, be confirmed.	2.81272e-92
NC_017045.1\|WP_004918231.1\|1006739_1007510_-\|succinate-dehydrogenase/fumarate-reductase-iron-sulfur-subunit	gnl\|CDD\|181038	PRK07570, PRK07570, succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Validated.	0
NC_017045.1\|WP_013446917.1\|1007533_1009546_-\|fumarate-reductase/succinate-dehydrogenase-flavoprotein-subunit	gnl\|CDD\|236054	PRK07573, sdhA, fumarate reductase/succinate dehydrogenase flavoprotein subunit.	0
NC_017045.1\|WP_004918205.1\|1027183_1028119_+\|nitronate-monooxygenase	gnl\|CDD\|240081	cd04730, NPD_like, 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites. NDP is a member of the NAD(P)H-dependent flavin oxidoreductase family that reduce a range of alternative electron acceptors. Most use FAD/FMN as a cofactor and NAD(P)H as electron donor. Some contain 4Fe-4S cluster to transfer electron from FAD to FMN.	3.36357e-103
NC_017045.1\|WP_004918225.1\|1010403_1012212_-\|ComEC/Rec2-family-competence-protein	gnl\|CDD\|377126	pfam03772, Competence, Competence protein. Members of this family are integral membrane proteins with 6 predicted transmembrane helices. Some members of this family have been shown to be essential for bacterial competence in uptake of extracellular DNA. These proteins may transport DNA across the cell membrane. These proteins contain a highly conserved motif in the amino terminal transmembrane region that has two histidines that may form a metal binding site.	7.01026e-53

>NC_017045.1|WP_004918215.1|1018729_1020133_+|choice-of-anchor-J-domain-containing-protein
MKTTTYLKTSLIALSFGALTSCVHDDKFDTPAIQCSNQFSEPTTTIKDFKTLAPEPVNFVSNYTIPNGETDAPVIFEGYVISSDEGGNFYKQLTIQDNTENPTAGIQVAINKTFLYTDYPVGSRVRVRANGLSVGLDREVVKLGYVNPTGQIPEGNMRDFITGVCGGNTMDIKTITPRVVNSIAEATKDEYINTLVTIKGVQFSEADGKITYADAVNRQTVDRTLVDREDNTAVVRNSGFARFAGKTLPTKSGDITVVVNKYVSGRNVTWQLYIRDLNDVKFEQERFVSSKNVLGGNAPEYNKTIAETFDNVSTVTNFKRIADPKYINYSVFGNRFWEQKTFNGNNYIQISAFRANADVSTYFIVPAEFTGSSKLSFQTKDGYYTGDALKVYYTTKYTPGGVVNKTDLIDITSKFTLSKENTNGYAADWVDSGEFAIPATGKGYIFFEYAGNTTVTTTVQIDNITLK
>NC_017045.1|WP_004918216.1|1015896_1018704_+|carboxypeptidase-regulatory-like-domain-containing-protein
MIKKLSLVSMFCLLPASYYYAQTTVYAYVKDADGKPIENAVADLREANDDVKADKIGYFQFVDLKPGHYQMVVTQPNYETKVLEFDVFENEKRKDLGIITLFSNLKNSELGVVLLDDNSSMDESSSQATLGLLQSSRDVFSNIAAFDLGFYWFRPRGIDGRRSEVMMNGISMENADNGNVDYGNWGGLNEITRYPEIAVNHSPSEYAFGGVGSVVYKNMKASEYRKGFQFTQSLTNRNYRNRTSLRYSSGMNKKGWAFTVMGARRWAQEGIQEGTFYDAYGAYLGIEKKVSDKHTLTLNLIGSPYRRSTASPNTQEVIDYNGVHYNAFWGWQDGEKRSERVRKGFQPILQLTDYWKISSRSQLWATVSYQFGKDKASRLDWYNAQNPSPLYYRNLPSYFAGLANPSDSDIAQLEITKNRWESNDQNYTQINWDRLYLANRNREQAVYFLVNDVNDDKVWNVGTHFVHNFSDKTQLFINASYRNYLSNQYREIKDLLGAQYALNGDPFASTNQPKLSGLFNEGEENTHKKVGDKIGYDYTFRRQETKINPALKFNTGNFDIFVSALAAYITNNREGHFNHYLYKDALGKSENQDYWNFGLKGQVIYKLDGRNFLVYNSAYYSQAPYLNNLFINARVNSAIAPNIKNTIVSANDISYMVSSPFVKVRATAFLINTQNDTNVQRFFADGIKLDGVDSEGNTTSARSAFVTQVMSNVNRRNMGAELGVEVKVTPTITVNGVANYGKYIYTNNPEVYFASDAVGMFPNEKLYTSYGTSYIKNFRQGGTPQEAYSLGVKYSSPKYWWVGANWNYLGNNFLDPSPLIRSDFFVNNPVTGTPYAGISEEEYKRVTAQVKLPVAYFFNINAGKSWMLGKYYVLISATVNNVLDNTKYATGGFEQTRNVNFADFRRDYDREYPNFAPRYFFTQGRNYFINLQVRF
>NC_017045.1|WP_004918219.1|1014431_1015625_-|endonuclease/exonuclease/phosphatase-family-protein
MKMKKIFSLLTLGLFLTSFSQTGKLRRMATVGFYNVENLWDTIQSADYIDGTLPPNHPRFHRSVPIDSVKYLEREDYKGEWSDSKLIGKKVVRFQGSSEEFTPKSAKNYNTSIYNQKLINAARVISELGASVTKTAPVVVGLLEVENRQVVEDLVKQPALKKFDYGVIHYNSYDYRGIDVALIYQKRRFSPTYSTKKELKIYNEEGRREYTRDLLVVSGYLDGEKVAFFVNHWPSRRGGEAVSLPKRNAAAQLLRAQMDSVRALDANTKLIAMGDFNDDPISSSFKNHLKAVGSVKELSPEYPYINLMYPLYKKGVASLAYRDAPNLFDQIIVSENLVNPKDTSYSVFRTEVYAPAYLINKEGSFKGYPFRSWNGDKFTGGYSDHFPVFTILSKEVN
>NC_017045.1|WP_004918222.1|1012698_1014327_-|methylcrotonoyl-CoA-carboxylase
MDLQFNKNEDLNRLKLSEINQLLAKIKKGGGEKRLEKIRSEGKMTARERIDYLLDDNKDSIEIGAFAGFEMYEEHGGCPSAGVVVKMGYVSGKQCIVVANDASVKAGAWFPITGKKNLRAQEIAMENRLPIIYLVDSAGVYLPMQDEIFPDKEHFGRIFRNNAKMSAMGIIQISAVMGSCVAGGAYLPIMSDEAMIVDKTGSIFLAGSYLVKAAIGESIDNETLGGATTHCSISGVTDYKAKDDKDALDRIKNIMKSIGDFEKAGFDRTESFLPKESPENIFGIIPAARSEQYDTYEIIKCLVDKSEYEEYKPDYGKSIICATARIDGWSVGIVANQRKLVKSGKGEMQFGGVIYSDSADKATRFIANCNQRKIPLVFLQDVTGFMVGSKSEHGGIIKDGAKMVNAVSNSVVPKFTIITGNSYGAGNYAMCGKAYDPRLIVAWPWADLAVMGGAQAAKVLAQIQEATLRKKGKEITEEDRNEILQEISKKYQKQTEATYAAARLWTDAIISPLDTRKWISMGIEAANHSPITEKFNLGIIQV
>NC_017045.1|WP_004918223.1|1012261_1012699_-|hypothetical-protein
MNKEKKKLFRKVNTTTYGVRHHFGQDYNRRDKNQQGSKGKMKRGVERGLDYTPLFKFLLSKVGSDWDSVFSEAKSRLDKTGPIFWMVALTENEKQDFVRVGESSYFSGLFVDENNILQKCTPELNKSNMQKFCSCCTHTFNGEVY
>NC_017045.1|WP_004918225.1|1010403_1012212_-|ComEC/Rec2-family-competence-protein
MLNLVSCISLFIKVKKQILFSLFISFSLGVFLQDLNGFSWQNLNIIAILGVISLGLIWVKADWVVRIRIWLLNIFFLCFGVFTHYLNSEKSVLPSVSKKEELVFKIEQKLNSTAKNKRYEITAFHQNQPFKAVLSVPKDLEELDYKHYYQSQLSLYPLESSKNNYQFDYAKFQARKGVYYRAYARDLRKAPKSELTFSEKMKRWRLEFLSNIDKNEKLSQQTRAFLKGIVLADRTEVDAGTNSNFRRSGLAHILAISGTHIAIIFGVVYMLLRLVLPVRFRIGVMLLSLSLIWAFAWFIGWGNSVVRACIMLTVYFGFVLLQRKPQVLDSLALAGLGILMVDTQELFSVGFQLSFSAVLGIYWFNRPMIRLFPNPRNKIQKLLLYTFTMSTAAQLGTMPIVIYYFHQYSAWSILANLVVLPLMEIVIILSFLMTIVFGLGIYWNWLSFTYDWLIKALLWLIGFFGKIEMGYFQDIPLSIWEMGVWAVGLYFLREILIRFTWRGFMRLMFSVLLFFGIKMWLDIRAYHDKEAKWHYHYRTKVFSVLDKGKVCFWVADEDNLETLESNLIKPYVISKRAESYKVKMMSKEVDEVIFNGKRYLFQ
>NC_017045.1|WP_013446918.1|1009610_1010279_-|succinate-dehydrogenase-cytochrome-b-subunit
MAGLTSSTIGRKYAMALSAIFLLVFLVMHLSVNMLSVFSESAFNQASYFMGYNPFVQFLMQPILIFAVFFHFVMGFVLEAKNNKARPVKYAVNGAKANSSWMSRNMIISGAVILAFLALHMYDFWVHEMTYKYIPGEGDPSDVARFWEELHEKFSNPVRVAFYVVSFVLLGLHLAHGFQSSFQSIGARHPKYTPCIMALGKWYSILIPLGFIFVAVFHFVTQ
>NC_017045.1|WP_013446917.1|1007533_1009546_-|fumarate-reductase/succinate-dehydrogenase-flavoprotein-subunit
MSILDSKIPAGPLADKWKNHKNHMNLVAPNNRDKIDVIVVGTGLAGGSAAATLAEQGYNVKAFCYQDSPRRAHSIAAQGGINAAKNYQGDGDSIYRLFYDTIKGGDYRAREANVYRLAEVSANIIDQCVSQGVPFGRDYGGQLDNRSFGGVQVKRTFYAKGQTGQQLLLGAYSAMSRQIGKGRIKMYNRHEMMELVIVDGKARGIIARNLVTGEIERHSAHAVVIASGGYGNVYFLSTNAMGSNCSAAWKIHKKGAYFANPCFVQIHPTCIPVHGTQQSKLTLMSESLRNSGRIWVPKKIEDAVAIREGKLRPENIKEEDRDYYLERRYPAFGNLVPRDVASRAAKERCDAGFGIENNETKEGVYLDFSTEIMKKGKEAALERNLHNPTEQQIYDLGKAWVEEKYGNLFQMYEKITADNPYKTPMKIYPAVHYSMGGVWVDYNLMSTIPGCFVIGEANFSDHGANRLGASALMQGLADGYFVLPYTIADYLSADIRTGQIPTDTPAFEEAEKEIQEKVNFFINNNGTHSVDYFHKKLGNVMWNKVGMARNEQGLKEAIQEIEEIRKDFWQNVRVPGEANGMNPELEKAFRVADFLELGQLMAMDALNRNESCGGHFREEYSTPDGEAQRDDENYKYAAVWEYKGEDINQEVLHKEELVYENIEVKTRSYK
>NC_017045.1|WP_004918231.1|1006739_1007510_-|succinate-dehydrogenase/fumarate-reductase-iron-sulfur-subunit
MSAKKGLNLTLKIWRQKNNKSKGQFETYKISDVSPDSSFLEMLDMLNENLVNEGKEPVAFDHDCREGICGMCSLYINGRAHGPDTGITTCQLHMRMFKDGETIHIEPWRSAAFPVIKDLVVDRSAFDRIMAAGGFISVNTSGNTTDANSIPVPKEDADKAMDAAACIGCGACVATCKNGSAMLFVGAKVSQYALLPQGRVEAKRRVLKMVAAMDEEGFGNCSNTGACEVECPKGISLENIARMNREFLCATLSSAE
>NC_017045.1|WP_013446916.1|1005571_1006654_-|DNA-polymerase-IV
MEQFYRKIIHIDMDAFYASVEQRDFPELKGKPVVVGGEHRGVVAAASYEARKYGVRSAMSSVVAKKKCPQIIFVKPRFHRYKEVSEQIRTIFFEYTDLVEPLSLDEAYLDVTHNKKGIVSANLIAKEIRQKIFETTGLTASAGISVNKFLAKVASDINKPNGQKTIHPTKVLSFLENLPIERFYGIGNVTANKMYQLGIYKGKDLKEKPLEYLVTHFGKMGGHYYDIVRGIHRSEVKPHRIAKSVGVEHTYVDDIDTEQDIDKQLMRLAQELYRRIEKKKVKGKSLTLKIKYKDFSLFTRSKTQNLYFETEEEMYQTARFLWSLRPYDKAIRLLGLSLSSLNTSSQKKVYVQLKIPFNDL
>NC_017045.1|WP_004918211.1|1021489_1021828_-|CRISPR-associated-endonuclease-Cas2
MKFNRFNAYRVMWVMVLYDLPTETKAMRKAAQLFRKRLEDDGFSLFQFSIYIRHCPSRENAEVHIKRVKSILPKHGKVAIMSITDKQFGDIEIFFARAKEEPKPTYQQLELF
>NC_017045.1|WP_004918209.1|1021817_1022717_-|type-II-CRISPR-associated-endonuclease-Cas1
MLYRSIYIGNPAYLKLKDQQMKIICPETKVEKGSIPVEDLGLLMLDHFQITISHQLIQWLMGNNVVVISCDAHHLPHGIMLPLYGHSEYSERVKYQLEASEPLKKNLWKQVVESKINNQSEVLKRLGNYYEPMLEYKEQVKSGDTTNMEGIAAQHYWKYLIAPDFLRERFGDSPNQFFNFGYAVLRSIVARAIVETGLLPVLGIFHKNKYNPYCLADDLMEPYRPFVDFLVMEWLENHPESEELTKDFKAFMLNIATLDVRIENKLRPLIVAVKTSVVSVYKCYTGEKRQISVPEFYEV
>NC_017045.1|WP_004918205.1|1027183_1028119_+|nitronate-monooxygenase
MKNRISELFNIQYPIIQGGMVWHSGWQLASAVSNAGGLGLIGAGSMYPDVLREHLQKCKKATNKPFGVNIPMLYPNLDEIINIIMEEQVKIVFTSAGNPKTYTETLQKEGIKVAHVVSSLKFAIKCEEAGVDAVVAEGFEAGGHNGRDETTTFCLIPNVRKHISTPLIAAGGIATGQQIKAAMILGADGVQIGSRFAATTEASSHEAFKQKIVEAKEGDTQLTLKELAPVRLLKNKFFYDLEKLYENGRDIETLKQSLGRARAKKGMFEGDLDEGELEIGQVSALIDDIISVDEVFKRLIKEFSECKEPFL
>NC_017045.1|WP_004918202.1|1028164_1028494_-|2Fe-2S-iron-sulfur-cluster-binding-domain-containing-protein
MADIQLKITDREGVQHDIVAPTDMSMNLMEVIRAYELAEEGTVGVCGGMAMCASCQVYILNDVPLPEKGDEEEAMLSEAFDVKDNSRLGCQIHITEEIDGLEVEIAPYS
>NC_017045.1|WP_013446920.1|1028499_1029552_-|NAD(P)/FAD-dependent-oxidoreductase
MITTDLLIIGAGPTGLFAVFEAGLLKLKCHIIDALPQPGGQLAELYPKKPIFDIPGYPSVNAGELVDNLMEQIKQFQPGFTLAETAVSLEKIDDEWFEVITNKGTVHRAKAVAIAGGLGTFEPRKPLLENLEKYEENGVEYFVKDPEVFRDKKIVIAGGGDSALDWSIFLSNVAKEVTLVHRRNEFRGALDSVEKVQELKNQGKINLVTPAEVVELKGSNTLESIVIEREGEKTEIETDYFIPLFGLTPKLGPIADWGLEIEKNSIKVNNALDYQTNREGIYAIGDINTYPGKLKLILCGFHEATLMCQSVYNRLNPGKKYVLKYTTVSGVDGFDGSRKEAEKAVVKKID
>NC_017045.1|WP_013446921.1|1029689_1030457_+|DUF3108-domain-containing-protein
MKKILYLMTLVISASLWSQITNIKSGETLTYRIHYGILNAGYATLNIKETTYKGEPHYYVKGTGKTTGAVRAFFKVEDLYESYINISTALPSFYVRNVQEGSYRQHLETVFNHSNQTLILTDKKTPSNGSKTLKSVKGIQDMLSAFYYLRSRDNSALKVGTSIKMNVWIDDEMFPFQLRIADVETKRTKFGKVECLKIIPSVMSGRVFKDQEGVTMWVTNDANHIPVELKAELAVGSLKASLDDYKNVKYNINFK
>NC_017045.1|WP_004918194.1|1030486_1030987_+|DUF2480-family-protein
MSEIKNKVAESGLVNFDLSSLVPKGKRLGIDLKPFLFQELVLKEKDFREKVKGLELDSYKDAYVYIYNSAEAIVPLWAYFLIASQLSGVAKKVIYGDKDELELLIMHQALNDYDFSNLKDKRVLVKGCTDENIPENAYIELVEKLKPIVKSLMFGEACSNVPIFKN
>NC_017045.1|WP_004918191.1|1031034_1031700_+|DUF937-domain-containing-protein
MSLLDLITGNPGTQVAEKAESKFGISKSQIMALLVVATPLVISYLRNKSKDEKEAEALNNALERDHDGSILDDVSQVENRQEEGNSILSHIFGDKKSTVENQLSQNTGISMDKIGPLMAMLAPVIMGYIGKQKRENNVTSGGGLSDLLGGILGQGSQEAQQGGGGNPLTDLLGSVLGGGQSQQGGGNPLNDILGSVLGGGDNKQQSGGLGGLLGGLFGGSK
>NC_017045.1|WP_004918190.1|1031851_1032826_+|deoxyhypusine-synthase-family-protein
MSKPITEFIEKYYLHFNAAALVDASKGYVAHLKDGGKMMITLAGAMSTAEMGKILAEMIRQDKVQIISCTGANLEEDLMNLVAHSHYERVPNYRDLTPQQEWDLLERGLNRVTDTCIPEEEAFRRLQKHIVEIWKEAESKGERYFPHEYMYKMLLSGVLEQYYEIPKENSWMLAAAEKNLPIVVPGWEDSTMGNIFASYCIKGELKPSTMKSGIEYMTYLADWYTKNCGGKGVGFFQIGGGIAGDFPICVVPMLYQDMEMHDIPFWSYFCQISDSTTSYGSYSGAVPNEKITWGKLDIDTPKFIVESDATICAPLMFQYVLENS
>NC_017045.1|WP_004918186.1|1032930_1033458_+|exosortase-family-protein-XrtF
MFEDFKPTLKILLRFLLVYLVLLGVYQFYLNTQEGLDGLSIHIANQCTLIQNNIGYPSQAIPQPEHNTLWYYVGGEYMSRMVEGCNAVSVIILFIAFIFAFYRGFNTFIFVFAGVIFLYIINILRIVGINVVLLEYPSYGKAAHDYIFPAIIYGSVVLLWIIWIKFFVLKDEVQR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_017045_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_017045_2

1855428-1856795

TypeVI-B1,TypeVI-B2

VI-B2

Consensus_repeat	Method
GTTGTGAATACCCTTCAAAATGAGAGCAGTCCCAAC	CRISPRCasFinder
GTTGTGAATACCCTTCAAAGTGAGAGCAGTCCCAAC	PILER-CR
GTTGTGAATACCCTTCAAANTGAGAGCAGTCCCAAC	CRT
GTTGTGAATACCCTTCAAAATGAGAGCAGTCCCAACTCA	PILER-CR

17 spacers

WYL,Csx28,cas13b

The CRISPR arrays of NC_017045_2

>merge|NC_017045|2|1855428-1856795|CRISPRCasFinder,PILER-CR,CRT,PILER-CR
GTTGTTAATACCCTTCAAATGCTACGCATTCACGAACTCCGCTGAAACAACAACAAAGCTTGTGAGCTAAACTGAGAGCAGTCCCAACACTCACAACAACTTAAAATACCAAAATAAAGTTGTGAATACCCTTCAAATGTTATGCATTCACGAACTCTGCTGAAAACGACAACAAAGTTGTGAGCTAAACTGAGAGCAGTCCCAACAATCAGACTTAGCAGATACTCGTGAAAAAAGTTGTGAGTACCCTTCAAATGTTACGCATTCACGAACTCCGCTGAAAATACAACGAAGCTGTGAGCTAAAATGAGAGCAGTCCCAACTTGGACGAATAATACGCCATTGTTTAACTCGTTGTGAATACCCTTCAAATGCTATGCATTCACGAACTCCGCTGAAACTACAACAAAGCTGTGAGCTAAAATGAGAGCAGTCCCAACGGAAGGTAGAATTGAATGTTTTCATGATCTGTTGTGAATACCCTTCAAAGTGAGAGCAGTCCCAACATAGCAGTAGAACCATCAAACGCTGTGGCTGTTGTGAATACCCTTCAAAGTGAGAGCAGTCCCAACCGGCAACAAAAGAAGGAGAAGAACAAAGCAGTTGTGAATACCCTTCAAAGTGAGAGCAGTCCCAACAGCAACATATACGAAAATCCAGAAATCTTAGTTGTGAATACCCTTCAAAGTGAGAGCAGTCCCAACTGTGCTTCCTACAACGAGTAGCGTTCCTTTGTTGTGAATACCCTTCAAAGTGAGAGCAGTCCCAACTTAACTAAGTTACCTAGAAGTATAAATGAAGTTGTGAATACCCTTCAAAATGAGAGCAGTCCCAACTCTGCATCTACGAAGGTGATGAGGAAAAGGGTTGTGAATACCCTTCAAAATGAGAGCAGTCCCAACCAATAGGACCTATTATATTTACAACAACAGGTTGTGAATACCCTTCAAAATGAGAGCAGTCCCAACATTTTGAAAATATAGAGGCGATAAGCCTTTGTTGTGAATACCCTTCAAAATGAGAGCAGTCCCAACTAAGAACTTTGTAGATGAAAGTGGTAATCTGTTGTGAATACCCTTCAAACTGAGAGCAGTCCCAACATTCTAAAAGGTACAGAGAATGAAGCTAAAGTTGTGAATACCCTTCAAACTGAGAGCAATCCCAACTCAACCAATTTAATCTGCAACTCTGAAATGGTTGTGAATACCCTTCAAACTGAGAGCAGTCCCAACTGATAGGAATATTTCTTATTCTATTTTTTAGTTGTGAATACCCTTCAAAATGAGAGCAGTCCCAACTCACAAACGGAAAAATATGTTTATTCCGTTGGTTGTGAATACCCTTCAAAATGAGAGCAGTCCCAACTTA

>NC_017045|2|2|1855428-1856792|CRISPRCasFinder
GTTGTTAATACCCTTCAAATGCTACGCATTCACGAA	CTCCGCTGAAACAACAACAAAGCTTGTGAGCTAAACTGAGAGCAGTCCCAACACTCACAACAACTTAAAATACCAAAATAAA
GTTGTGAATACCCTTCAAATGTTATGCATTCACGAA	CTCTGCTGAAAACGACAACAAAGTTGTGAGCTAAACTGAGAGCAGTCCCAACAATCAGACTTAGCAGATACTCGTGAAAAAA
GTTGTGAGTACCCTTCAAATGTTACGCATTCACGAA	CTCCGCTGAAAATACAACGAAGCTGTGAGCTAAAATGAGAGCAGTCCCAACTTGGACGAATAATACGCCATTGTTTAACTC
GTTGTGAATACCCTTCAAATGCTATGCATTCACGAA	CTCCGCTGAAACTACAACAAAGCTGTGAGCTAAAATGAGAGCAGTCCCAACGGAAGGTAGAATTGAATGTTTTCATGATCT
GTTGTGAATACCCTTCAAAGTGAGAGCAGTCCCAAC	ATAGCAGTAGAACCATCAAACGCTGTGGCT
GTTGTGAATACCCTTCAAAGTGAGAGCAGTCCCAAC	CGGCAACAAAAGAAGGAGAAGAACAAAGCA
GTTGTGAATACCCTTCAAAGTGAGAGCAGTCCCAAC	AGCAACATATACGAAAATCCAGAAATCTTA
GTTGTGAATACCCTTCAAAGTGAGAGCAGTCCCAAC	TGTGCTTCCTACAACGAGTAGCGTTCCTTT
GTTGTGAATACCCTTCAAAGTGAGAGCAGTCCCAAC	TTAACTAAGTTACCTAGAAGTATAAATGAA
GTTGTGAATACCCTTCAAAATGAGAGCAGTCCCAAC	TCTGCATCTACGAAGGTGATGAGGAAAAGG
GTTGTGAATACCCTTCAAAATGAGAGCAGTCCCAAC	CAATAGGACCTATTATATTTACAACAACAG
GTTGTGAATACCCTTCAAAATGAGAGCAGTCCCAAC	ATTTTGAAAATATAGAGGCGATAAGCCTTT
GTTGTGAATACCCTTCAAAATGAGAGCAGTCCCAAC	TAAGAACTTTGTAGATGAAAGTGGTAATCT
GTTGTGAATACCCTTCAAACTGAGAGCAGTCCCAAC	ATTCTAAAAGGTACAGAGAATGAAGCTAAA
GTTGTGAATACCCTTCAAACTGAGAGCAATCCCAAC	TCAACCAATTTAATCTGCAACTCTGAAATG
GTTGTGAATACCCTTCAAACTGAGAGCAGTCCCAAC	TGATAGGAATATTTCTTATTCTATTTTTTA
GTTGTGAATACCCTTCAAAATGAGAGCAGTCCCAAC	TCACAAACGGAAAAATATGTTTATTCCGTTG
GTTGTGAATACCCTTCAAAATGAGAGCAGTCCCAAC

>NC_017045|2|2|1855898-1856527|PILER-CR
GTTGTGAATACCCTTCAAAGTGAGAGCAGTCCCAAC	ATAGCAGTAGAACCATCAAACGCTGTGGCT
GTTGTGAATACCCTTCAAAGTGAGAGCAGTCCCAAC	CGGCAACAAAAGAAGGAGAAGAACAAAGCA
GTTGTGAATACCCTTCAAAGTGAGAGCAGTCCCAAC	AGCAACATATACGAAAATCCAGAAATCTTA
GTTGTGAATACCCTTCAAAGTGAGAGCAGTCCCAAC	TGTGCTTCCTACAACGAGTAGCGTTCCTTT
GTTGTGAATACCCTTCAAAGTGAGAGCAGTCCCAAC	TTAACTAAGTTACCTAGAAGTATAAATGAA
GTTGTGAATACCCTTCAAAATGAGAGCAGTCCCAAC	TCTGCATCTACGAAGGTGATGAGGAAAAGG
GTTGTGAATACCCTTCAAAATGAGAGCAGTCCCAAC	CAATAGGACCTATTATATTTACAACAACAG
GTTGTGAATACCCTTCAAAATGAGAGCAGTCCCAAC	ATTTTGAAAATATAGAGGCGATAAGCCTTT
GTTGTGAATACCCTTCAAAATGAGAGCAGTCCCAAC	TAAGAACTTTGTAGATGAAAGTGGTAATCT
GTTGTGAATACCCTTCAAACTGAGAGCAGTCCCAACATTCTAAAAGGTACAGAGAATGAAGCTAAAGTTGTGAATACCCTTCAAACTGAGAGCAATCCCAACTCAACCAATTTAATCTGCAACTCTGAAATGGTTGTGAATACCCTTCAAACTGAGAGCAGTCCCAACTGA	TAGGAATATTTCTTATTCTATTTTTTA
GTTGTGAATACCCTTCAAAATGAGAGCAGTCCCAACTCA	CAAACGGAAAAATATGTTTATTCCGTTG


>NC_017045|2|1|1855898-1856792|CRT
GTTGTGAATACCCTTCAAAGTGAGAGCAGTCCCAAC	ATAGCAGTAGAACCATCAAACGCTGTGGCT
GTTGTGAATACCCTTCAAAGTGAGAGCAGTCCCAAC	CGGCAACAAAAGAAGGAGAAGAACAAAGCA
GTTGTGAATACCCTTCAAAGTGAGAGCAGTCCCAAC	AGCAACATATACGAAAATCCAGAAATCTTA
GTTGTGAATACCCTTCAAAGTGAGAGCAGTCCCAAC	TGTGCTTCCTACAACGAGTAGCGTTCCTTT
GTTGTGAATACCCTTCAAAGTGAGAGCAGTCCCAAC	TTAACTAAGTTACCTAGAAGTATAAATGAA
GTTGTGAATACCCTTCAAAATGAGAGCAGTCCCAAC	TCTGCATCTACGAAGGTGATGAGGAAAAGG
GTTGTGAATACCCTTCAAAATGAGAGCAGTCCCAAC	CAATAGGACCTATTATATTTACAACAACAG
GTTGTGAATACCCTTCAAAATGAGAGCAGTCCCAAC	ATTTTGAAAATATAGAGGCGATAAGCCTTT
GTTGTGAATACCCTTCAAAATGAGAGCAGTCCCAAC	TAAGAACTTTGTAGATGAAAGTGGTAATCT
GTTGTGAATACCCTTCAAACTGAGAGCAGTCCCAAC	ATTCTAAAAGGTACAGAGAATGAAGCTAAA
GTTGTGAATACCCTTCAAACTGAGAGCAATCCCAAC	TCAACCAATTTAATCTGCAACTCTGAAATG
GTTGTGAATACCCTTCAAACTGAGAGCAGTCCCAAC	TGATAGGAATATTTCTTATTCTATTTTTTA
GTTGTGAATACCCTTCAAAATGAGAGCAGTCCCAAC	TCACAAACGGAAAAATATGTTTATTCCGTTG
GTTGTGAATACCCTTCAAAATGAGAGCAGTCCCAAC

>NC_017045|2|3|1856624-1856795|PILER-CR
	ATAGCAGTAGAACCATCAAACGCTGTGGCT
GTTGTGAATACCCTTCAAAGTGAGAGCAGTCCCAAC	CGGCAACAAAAGAAGGAGAAGAACAAAGCA
GTTGTGAATACCCTTCAAAGTGAGAGCAGTCCCAAC	AGCAACATATACGAAAATCCAGAAATCTTA
GTTGTGAATACCCTTCAAAGTGAGAGCAGTCCCAAC	TGTGCTTCCTACAACGAGTAGCGTTCCTTT
GTTGTGAATACCCTTCAAAGTGAGAGCAGTCCCAAC	TTAACTAAGTTACCTAGAAGTATAAATGAA
GTTGTGAATACCCTTCAAAATGAGAGCAGTCCCAAC	TCTGCATCTACGAAGGTGATGAGGAAAAGG
GTTGTGAATACCCTTCAAAATGAGAGCAGTCCCAAC	CAATAGGACCTATTATATTTACAACAACAG
GTTGTGAATACCCTTCAAAATGAGAGCAGTCCCAAC	ATTTTGAAAATATAGAGGCGATAAGCCTTT
GTTGTGAATACCCTTCAAAATGAGAGCAGTCCCAAC	TAAGAACTTTGTAGATGAAAGTGGTAATCT
GTTGTGAATACCCTTCAAACTGAGAGCAGTCCCAACATTCTAAAAGGTACAGAGAATGAAGCTAAAGTTGTGAATACCCTTCAAACTGAGAGCAATCCCAACTCAACCAATTTAATCTGCAACTCTGAAATGGTTGTGAATACCCTTCAAACTGAGAGCAGTCCCAACTGA	TAGGAATATTTCTTATTCTATTTTTTA
GTTGTGAATACCCTTCAAAATGAGAGCAGTCCCAACTCA	CAAACGGAAAAATATGTTTATTCCGTTG
GTTGTGAATACCCTTCAAAATGAGAGCAGTCCCAACTTA

Protein	Signature genes	Signature genes Name	Protein_function
NC_017045.1\|WP_013447131.1\|1862097_1864701_+\|alanine--tRNA-ligase	unknown	unknown	gnl\|CDD\|234701
NC_017045.1\|WP_004919750.1\|1864796_1866164_-\|peptidylprolyl-isomerase	unknown	unknown	gnl\|CDD\|376360
NC_017045.1\|WP_004919767.1\|1851855_1852542_+\|hypothetical-protein	unknown	unknown	unknown
NC_017045.1\|WP_004919772.1\|1850015_1851179_-\|homogentisate-1,2-dioxygenase	unknown	unknown	gnl\|CDD\|226039
NC_017045.1\|WP_004919744.1\|1867814_1868855_-\|A/G-specific-adenine-glycosylase	unknown	unknown	gnl\|CDD\|224115
NC_017045.1\|WP_014615042.1\|1843059_1843272_+\|hypothetical-protein	unknown	unknown	unknown
NC_017045.1\|WP_004919774.1\|1848708_1849989_-\|acetyl-CoA-hydrolase/transferase-family-protein	unknown	unknown	gnl\|CDD\|223504
NC_017045.1\|WP_013447132.1\|1869418_1870978_+\|ribonuclease-E/G	unknown	unknown	gnl\|CDD\|378414
NC_017045.1\|WP_014937385.1\|1868817_1869195_+\|integration-host-factor-subunit-beta	unknown	unknown	gnl\|CDD\|259858
NC_017045.1\|WP_004919749.1\|1866260_1867181_-\|bifunctional-hydroxymethylpyrimidine-kinase/phosphomethylpyrimidine-kinase	unknown	unknown	gnl\|CDD\|238921
NC_017045.1\|WP_004919760.1\|1853919_1854639_+\|DUF4469-domain-containing-protein	unknown	unknown	gnl\|CDD\|373337
NC_017045.1\|WP_004919758.1\|1856920_1857457_-\|hypothetical-protein	Csx28	-	unknown
NC_017045.1\|WP_004919765.1\|1852569_1853898_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|153057
NC_017045.1\|WP_004916855.1\|1836414_1837326_+\|WYL-domain-containing-protein	WYL	pfam13280_WYL_CAS-I:CAS-III	gnl\|CDD\|379100
NC_017045.1\|WP_004919778.1\|1847095_1848544_-\|asparagine--tRNA-ligase	unknown	unknown	gnl\|CDD\|235176
NC_017045.1\|WP_004919753.1\|1860882_1861932_-\|glucokinase	unknown	unknown	gnl\|CDD\|367143
NC_017045.1\|WP_004919747.1\|1867206_1867770_-\|gliding-motility-lipoprotein-GldD	unknown	unknown	gnl\|CDD\|132551
NC_017045.1\|WP_004919780.1\|1845623_1847093_-\|RNA-polymerase-factor-sigma-54	unknown	unknown	gnl\|CDD\|235648
NC_017045.1\|WP_004919755.1\|1857463_1860751_-\|hypothetical-protein	cas13b	cas13b_CAS_V-B1	gnl\|CDD\|380475
NC_017045.1\|WP_004919782.1\|1843258_1845376_-\|TonB-dependent-receptor	unknown	unknown	gnl\|CDD\|238657

Protein	Function_ID	Function_description	E-value
NC_017045.1\|WP_013447131.1\|1862097_1864701_+\|alanine--tRNA-ligase	gnl\|CDD\|234701	PRK00252, alaS, alanyl-tRNA synthetase; Reviewed.	0
NC_017045.1\|WP_004919749.1\|1866260_1867181_-\|bifunctional-hydroxymethylpyrimidine-kinase/phosphomethylpyrimidine-kinase	gnl\|CDD\|238921	cd01946, ribokinase_group_C, Ribokinase-like subgroup C. Found only in bacteria, this subgroup is part of the ribokinase/pfkB superfamily. Its oligomerization state is unknown at this time.	9.31888e-140
NC_017045.1\|WP_004919744.1\|1867814_1868855_-\|A/G-specific-adenine-glycosylase	gnl\|CDD\|224115	COG1194, MutY, A/G-specific DNA glycosylase [DNA replication, recombination, and repair].	5.64307e-109
NC_017045.1\|WP_004919772.1\|1850015_1851179_-\|homogentisate-1,2-dioxygenase	gnl\|CDD\|226039	COG3508, HmgA, Homogentisate 1,2-dioxygenase [Secondary metabolites biosynthesis, transport, and catabolism].	1.61556e-58
NC_017045.1\|WP_004919774.1\|1848708_1849989_-\|acetyl-CoA-hydrolase/transferase-family-protein	gnl\|CDD\|223504	COG0427, ACH1, Acetyl-CoA hydrolase [Energy production and conversion].	1.39745e-90
NC_017045.1\|WP_013447132.1\|1869418_1870978_+\|ribonuclease-E/G	gnl\|CDD\|378414	pfam10150, RNase_E_G, Ribonuclease E/G family. Ribonuclease E and Ribonuclease G are related enzymes that cleave a wide variety of RNAs.	1.38312e-128
NC_017045.1\|WP_014937385.1\|1868817_1869195_+\|integration-host-factor-subunit-beta	gnl\|CDD\|259858	cd13836, IHF_B, Beta subunit of integration host factor (IHFB). This subfamily consists of the beta subunit of integration host factor (IHF) and IHF-like domains. IHF is a nucleoid-associated protein (NAP) that binds and sharply bends many DNA targets in a sequence specific manner. It is a heterodimeric protein composed of two highly homologous subunits IHFA (IHF-alpha) and IHFB (IHF-beta). It is known to act as a transcription factor at many gene regulatory regions in E. coli. IHF is an essential cofactor in phage lambda site-specific recombination, having an architectural role during assembly of specialized nucleoprotein structures (snups). IHF is also involved in formation as well as maintenance of bacterial biofilms since it is found in complex with extracellular DNA (eDNA) within the extracellular polymeric substances (EPS) matrix of many biofilms.	1.11811e-32
NC_017045.1\|WP_004919760.1\|1853919_1854639_+\|DUF4469-domain-containing-protein	gnl\|CDD\|373337	pfam14848, HU-DNA_bdg, DNA-binding domain.	9.36221e-48
NC_017045.1\|WP_004919750.1\|1864796_1866164_-\|peptidylprolyl-isomerase	gnl\|CDD\|376360	pfam00639, Rotamase, PPIC-type PPIASE domain. Rotamases increase the rate of protein folding by catalyzing the interconversion of cis-proline and trans-proline.	1.88982e-23
NC_017045.1\|WP_004919765.1\|1852569_1853898_+\|hypothetical-protein	gnl\|CDD\|153057	cd00037, CLECT, C-type lectin (CTL)/C-type lectin-like (CTLD) domain. CLECT: C-type lectin (CTL)/C-type lectin-like (CTLD) domain; protein domains homologous to the carbohydrate-recognition domains (CRDs) of the C-type lectins. This group is chiefly comprised of eukaryotic CTLDs, but contains some, as yet functionally uncharacterized, bacterial CTLDs. Many CTLDs are calcium-dependent carbohydrate binding modules; other CTLDs bind protein ligands, lipids, and inorganic surfaces, including CaCO3 and ice. Animal C-type lectins are involved in such functions as extracellular matrix organization, endocytosis, complement activation, pathogen recognition, and cell-cell interactions. For example: mannose-binding lectin and lung surfactant proteins A and D bind carbohydrates on surfaces (e.g. pathogens, allergens, necrotic, and apoptotic cells) and mediate functions associated with killing and phagocytosis; P (platlet)-, E (endothelial)-, and L (leukocyte)- selectins (sels) mediate the initial attachment, tethering, and rolling of lymphocytes on inflamed vascular walls enabling subsequent lymphocyte adhesion and transmigration. CTLDs may bind a variety of carbohydrate ligands including mannose, N-acetylglucosamine, galactose, N-acetylgalactosamine, and fucose. Several CTLDs bind to protein ligands, and only some of these binding interactions are Ca2+-dependent; including the CTLDs of Coagulation Factors IX/X (IX/X) and Von Willebrand Factor (VWF) binding proteins, and natural killer cell receptors. C-type lectins, such as lithostathine, and some type II antifreeze glycoproteins function in a Ca2+-independent manner to bind inorganic surfaces. Many proteins in this group contain a single CTLD; these CTLDs associate with each other through several different surfaces to form dimers, trimers, or tetramers, from which ligand-binding sites project in different orientations. Various vertebrate type 1 transmembrane proteins including macrophage mannose receptor, endo180, phospholipase A2 receptor, and dendritic and epithelial cell receptor (DEC205) have extracellular domains containing 8 or more CTLDs; these CTLDs remain in the parent model. In some members (IX/X and VWF binding proteins), a loop extends to the adjoining domain to form a loop-swapped dimer. A similar conformation is seen in the macrophage mannose receptor CRD4's putative non-sugar bound form of the domain in the acid environment of the endosome. Lineage specific expansions of CTLDs have occurred in several animal lineages including Drosophila melanogaster and Caenorhabditis elegans; these CTLDs also remain in the parent model.	1.57156e-05
NC_017045.1\|WP_004916855.1\|1836414_1837326_+\|WYL-domain-containing-protein	gnl\|CDD\|379100	pfam13280, WYL, WYL domain. WYL is a Sm-like SH3 beta-barrel fold containing domain. It is a member of the WYL-like superfamily, named for three conserved amino acids found in a subset of the superfamily. However, these residues are not strongly conserved throughout the family. Rather, the conservation pattern includes four basic residues and a position often occupied by a cysteine, which are predicted to line a ligand-binding groove typical of the Sm-like SH3 beta-barrels. A WYL domain protein (sll7009) is a negative regulator of the I-D CRISPR-Cas system in Synechocystis sp. It is predicted to be a ligand-sensing domain that could bind negatively charged ligands, such as nucleotides or nucleic acid fragments, to regulate CRISPR-Cas and other defense systems such as the abortive infection AbiG system.	6.66185e-29
NC_017045.1\|WP_004919778.1\|1847095_1848544_-\|asparagine--tRNA-ligase	gnl\|CDD\|235176	PRK03932, asnC, asparaginyl-tRNA synthetase; Validated.	0
NC_017045.1\|WP_004919753.1\|1860882_1861932_-\|glucokinase	gnl\|CDD\|367143	pfam02685, Glucokinase, Glucokinase. This is a family of glucokinases or glucose kinases EC:2.7.1.2. These enzymes phosphorylate glucose using ATP as a donor to give glucose-6-phosphate and ADP.	7.69078e-71
NC_017045.1\|WP_004919747.1\|1867206_1867770_-\|gliding-motility-lipoprotein-GldD	gnl\|CDD\|132551	TIGR03512, GldD_lipo, gliding motility-associated lipoprotein GldD. Members of this protein family are found a number of Bacteriodetes lineage bacteria, including both species such as Flavobacterium johnsoniae, which possess a poorly understood form of rapid gliding motility, and other species which apparently do not. Mutation of GldD blocks both this motility and chitin utilization in the model species, Flavobacterium johnsoniae. [Cellular processes, Chemotaxis and motility].	1.03026e-67
NC_017045.1\|WP_004919780.1\|1845623_1847093_-\|RNA-polymerase-factor-sigma-54	gnl\|CDD\|235648	PRK05932, PRK05932, RNA polymerase factor sigma-54; Reviewed.	9.39554e-130
NC_017045.1\|WP_004919755.1\|1857463_1860751_-\|hypothetical-protein	gnl\|CDD\|380475	cd20477, Cas13b_Pb-like, Class 2 type VI-B CRISPR-associated RNA-guided ribonuclease Cas13b from Prevotella buccae and similar Cas13b proteins. CRISPR-Cas (clustered regularly interspaced short palindromic repeats and CRISPR-associated proteins) adaptive immune systems defend microbes against foreign nucleic acids via RNA-guided endonucleases. These systems are divided into two classes: class 1 systems utilize multiple Cas proteins and CRISPR RNA (crRNA) to form an effector complex while class 2 systems employ a large, single effector with crRNA to mediate interference. Class 2 type VI CRISPR-Cas13 systems use a single enzyme to target RNA using a programmable crRNA guide and are divided into four subtypes based on the identity of the Cas13 protein (Cas13a-d). The Cas13 proteins are capable of both pre-crRNA processing and target RNA cleavage, which protect the host from phage attacks. Once bound to a target RNA, their non-specific RNase activity is activated. Cas13b has many distinctive features compared to the other Cas13 proteins, including the lack of significant sequence similarity, disparate crRNA repeat region, and double-sided protospacer flanking sequence (PFS)-dependent target RNA cleavage.	0
NC_017045.1\|WP_004919782.1\|1843258_1845376_-\|TonB-dependent-receptor	gnl\|CDD\|238657	cd01347, ligand_gated_channel, TonB dependent/Ligand-Gated channels are created by a monomeric 22 strand (22,24) anti-parallel beta-barrel. Ligands apparently bind to the large extracellular loops. The N-terminal 150-200 residues form a plug from the periplasmic end of barrel. Energy (proton-motive force) and TonB-dependent conformational alteration of channel (parts of plug, and loops 7 and 8) allow passage of ligand. FepA residues 12-18 form the TonB box, which mediates the interaction with the TonB-containing inner membrane complex. TonB preferentially interacts with ligand-bound receptors. Transport thru the channel may resemble passage thru an air lock. In this model, ligand binding leads to closure of the extracellular end of pore, then a TonB-mediated signal facillitates opening of the interior side of pore, deforming the N-terminal plug and allowing passage of the ligand to the periplasm. Such a mechanism would prevent the free diffusion of small molecules thru the pore.	2.61651e-38

>NC_017045.1|WP_004919760.1|1853919_1854639_+|DUF4469-domain-containing-protein
MNTLKAWLRPNLLTKDDPNDFVAVPLLGGSLGITEIIDALKKEGMEIQTETAVDIITRFNRKASELVLNGYSVNTGLVYMRPAIKGVFYDKTWDKEKHSVYVNVNQGTDLRKAANDTKVEILGEQSSPMSVFSITDKATGKADGTLTKGKNAEIKGTYIKIDGDNPKNGIVFKNLDTQQEVKLSAEHIVLNEPSRLLILVPTDLEAGNYELSITTQSSKGTTLLKEPRTETLSTPITIV
>NC_017045.1|WP_004919765.1|1852569_1853898_+|hypothetical-protein
MNKIILLGLLAFFTANAQIQVQNQSANTIGGENPFMDASYFNQFSNTLGKGLYFPTTNLTTWEFKLSSIDPGKFSNYFDGMVVYNSGTGLTVSNTGKGGKQVSVSPGFYYFKNPNQTFPTGSVANGEWVRLSSDGGVSTNLYTADGTLAGNRTVTLEANNLVFKGAGNIGIGTDAPTTKLDVAGGVRIADGTQGENKVLVSDATGKASWKIINQVQNISVTSTIDPNVLGYFPDPTKTVYTAASSVTYNGKTATKGPHLLNYIDPYGNYHSYTTYISPNNITWYEAYNMAKNLGGYLATFTSDEEWKIVEMGLLNNNTTFNTVGAWIGMVKYSWYAGSALQPNPEMKWITGEQPFHDYASGGTSAVRKSNWFNTGEVGGGVEPNNDAGNEGFVHTWPKDIGFTKTYNGYTSLHPWNDIPANPDNVIDRANVKAFIIEFIGRP
>NC_017045.1|WP_004919767.1|1851855_1852542_+|hypothetical-protein
MKTKTTKLSVCAFLGLGLMAYGQYDGKVGINESQPKATLEIKPNTANSLSTASTVEGVLIPRVSRLRAANMGTGVAESTLLYISSVADGTASGTTANVDATGFYFFKGGVWVKLGAEATSSTGGATLQSITGNIREVAHANIAEWSVPNTFALAQTGDQQIALPDPKKYIGKIISVNNQHNTALAYSGTNQPKNVNALASGKAHILMAGLQDPNDENSAIWYLIGGSY
>NC_017045.1|WP_004919772.1|1850015_1851179_-|homogentisate-1,2-dioxygenase
MRYIQLGDIPQKRHTVFKSKEGQFYYEQLFGTEGFHGIASLLYHIHRPTQIKSIGAPKDVSPKIAVEKNITPRMFKGMNVTPEKDFLDSRKVLLLNNDLKMGLAKPQQSMDYFYKNAECDELLFVHQGKGVLKTFVGNLDFSVGDYLIIPRGTIYQISFETEDTVLFFLESHSPIYTPKRYRNEFGQLLEHSPFCERDIIAPTFVPPIDEKGDFLIKVKKENHITDFIYATHPFDVVGWDGYFYPYKFNIKNFEPITGRIHQPPPVHQNFEGHNFVVCSFVARLYDYHPDAIPAPYNHSNIDSDEVLFYTEGDFMSRNHIDLMDFTLHPGGIVHGPHPGAMERSIGKKSTEEYAVMVDPFRPLKITEEAIKVEDTSYKTSWLEDENN
>NC_017045.1|WP_004919774.1|1848708_1849989_-|acetyl-CoA-hydrolase/transferase-family-protein
MHHYVSAEEAISIVKSGDRVFLHGSACTPNVLIDEMARQADRLRNVEVVSITQQGNMEIAKPQYKDSFYIKSLFVSTPVREAVNCGRGDFVPVFLSEIPLLFKNKVLPLDVAIVTVSPPDVHGYCTLGTSIDVARSAIDSAKSIIAVVNPKMPRTHGDGMIHVQRIDKMIWHEEELLTIDYGSKVTDVERQIGKNVAELIDDRSTLQMGIGTIPDAVLQCLANHKDLGIHTEMLSDGVIDLIKNDVINNKYKGAHENRTITSFCFGTKRLYDFINDNPSIAFLDVLKVNHPIEIMKNQKMTAINSAIEVDLTGQVCADSIGTYQFSGIGGQMDFMRGAALSEGGKPIIAISSRTKKGVPRIVPLLKPGAGVVTTRGHIHYVITEYGTAYLYGKSLRERAKALIEIAHPDDREMLDKAAFERFKVEL
>NC_017045.1|WP_004919778.1|1847095_1848544_-|asparagine--tRNA-ligase
MEKQTIKDILSNYKTILHHDITIEGWVRAFRSNRFIALNDGSTLNNLQIVVDFEKFDDEIIKNIHTASSLKVTGEVVESQGAGQSVEIIAKKIELLGENLSEELQSTILQPKRHTLEKLREQAHLRFRTNLFGAVFRVRSAVSFAIHQFFNQNQFFYINTPIITGADAEGAGEMFGVSNFDLNKVPKNEDGEVDYTQDFFGKKTNLTVSGQLEAETAAMGLGRVYTFGPTFRAENSNTTRHLAEFWMVEPEVAFNNLEDNIDLAESFLKYVIQYVLDHCKDDLELLDKRFAEEQKQKPEKDRAKEGLIEKLENVVKKRFKRVSYTEAIEILLNSKDNKKGKFQFPVEKWGADLQSEHERYLVEKHFECPVVLFDYPKEIKAFYMRLNEDQKTVAAMDVLFPGIGEIIGGSQREERLEVLKQKMADMNVDEHELWWYLDTRKFGSVPHAGFGLGLERLVLFVTGMTNIRDVIPFPRTPKNAEF
>NC_017045.1|WP_004919780.1|1845623_1847093_-|RNA-polymerase-factor-sigma-54
MLKQNLQLKLGQKLAPQQIQLMKLIQLHTLDFEEELERELEENPALEKVEEEADYGEEFSELDKLNDEDSDSIETDFDVNEYLFDDEPSYKTASSNYSPDDEEFDQQSVLTEGQTIYDYLIEQIRLRHISGEELAIAEYLIGNLDNDGYIRRELKAIVDDLAFSQGIYTTEERVEEILLNRVQKLDPPGVGARDLQECLLLQIRSKLQTAPNKNTELAEEILKTQFEALTNKHYKKIMQRLDCSEEELKEALDEISNLSPRLGGNFDTQTITINQEIIPDFTIQVKDNKVTPLLNSKNAPQLRVSSEYRDILDTYSHDKESKDHKQAALFIKQKLDAAKWYIDAINQRQNTLMQTISAIVKLQHEYFLTGDDKSLKPMILKDVADITGFDISTISRVVKSKYADTPNGIVLLKDLFSDSLTNEDGEEVSTKEIKTFLQEVVDNENKRKPYTDDALVKILKDKGYNIARRTIAKYRDQLNIPVARLRKEL
>NC_017045.1|WP_004919782.1|1843258_1845376_-|TonB-dependent-receptor
MKGFVFYGLFASSVVGAQQTPKDSTKTTEVAEVTFTKRLPISKDIINVEKELGAKNLGQDLPILLKNQMSVVSTSDAGNGVGYTGFRIRGTAGTSVNVMMNGVPYNDSESQGTFFVNVPDLTSSASQIVIQRGVGTSSNGAAAFGASVNIISREPEEHFYLRSDNSYGSFNTYKYSAEIGSGKFWNNRLSVMGRYTTIHSDGYIDRAFSDLSSYNFTALFEEGKTRLRLKMFGGKEQTYHAWNGINAKTMQENRRYNPSGAIYSKDWSQIIGYYDNETDNYQQNHYQLLWQQKFNSNWNLETTLHYTKGAGYYENYRQDNKFSRYNLPNISINGNEISRTDFIRKKWLDNDFYGIVSNLYGSLDNLDLNFGLVGNQYYGWHFGNVTGVQFTNIHEHEYYRNRSLKNEVSGFAKAIFKLNQWEIFGDLQLRNIEYDTKILTGKEDGLNFNKNWLFFNPKAGINYRIPKGKVFLSYAVANREPNRAALVNNPQTVSERLNDWEFGIEKQWGSFSLTTNAYYMLYKNQLVLSGLINDVGAFIPQNVKNSYRLGLEIGTSTRITEQLHLTANATISRNKIKELDSQNEKGEKVVLKDTDISFSPNIIGNIGLNYQLSPQFLVGLTQQYIGKQYLDNTQNINYSLSDYYLADVNVKYNLKLNRTNIDFSLLVNNLFNRKYANNGYVWAPDAYFFPQAGTNFMFGMNIKFQ
>NC_017045.1|WP_014615042.1|1843059_1843272_+|hypothetical-protein
MPLREGEGHCWSSSYKGVRDRCGLCKIATARRPTLEEALELAKGHAKKNSLHRIMERVVIVSGLCNLTEI
>NC_017045.1|WP_004916855.1|1836414_1837326_+|WYL-domain-containing-protein
MVIEQIFRLKYIEEFLKRRKDRGASYQEIFEYLSERFINEDLDLSFTNRTFLRDKKLIEKLSGINISYDKNKKVYIISDDEPEEYFESLLLLNAYRSSKKNADILLFENRSPRGITENLEDLLNAINKHRIISFKHYSLWNNDEIPKLKKIKPYALKEFRYRWYVLGQAYDDGKTSKEITAYGLDRISDLEVASSSFVPEIIDIENLYKDSFGIVLPNGMPPEKIILSFDKQQGSYVKKLPIHHSQKVEKETDTETIVSVFLVPTYDFWQEILSYGKRVKVLQPKSFVDIIKSELKESLINYT
>NC_017045.1|WP_004919758.1|1856920_1857457_-|hypothetical-protein
MYWILEVLKIVTPTIAVIVSAIVSTIVLSRKIRQELKGNIERQKYEDILHAHKQMYRLLAYMTDQDNPKNLLKWEVPKGQKDKIHYINRANAQAFLRELPELFYGEGCGLFLSEEVTKKFFEYRSIVHKLLLAEQNSTEAEFRLKNEEAATRMKVLHHKLSQSIRQCLKIEQRDLKAL
>NC_017045.1|WP_004919755.1|1857463_1860751_-|hypothetical-protein
MEKPLLPNVYTLKHKFFWGAFLNIARHNAFITICHINEQLGLKTPSNDDKIVDVVCETWNNILNNDHDLLKKSQLTELILKHFPFLTAMCYHPPKKEGKKKGHQKEQQKEKESEAQSQAEALNPSKLIEALEILVNQLHSLRNYYSHYKHKKPDAEKDIFKHLYKAFDASLRMVKEDYKAHFTVNLTRDFAHLNRKGKNKQDNPDFNRYRFEKDGFFTESGLLFFTNLFLDKRDAYWMLKKVSGFKASHKQREKMTTEVFCRSRILLPKLRLESRYDHNQMLLDMLSELSRCPKLLYEKLSEENKKHFQVEADGFLDEIEEEQNPFKDTLIRHQDRFPYFALRYLDLNESFKSIRFQVDLGTYHYCIYDKKIGDEQEKRHLTRTLLSFGRLQDFTEINRPQEWKALTKDLDYKETSNQPFISKTTPHYHITDNKIGFRLGTSKELYPSLEIKDGANRIAKYPYNSGFVAHAFISVHELLPLMFYQHLTGKSEDLLKETVRHIQRIYKDFEEERINTIEDLEKANQGRLPLGAFPKQMLGLLQNKQPDLSEKAKIKIEKLIAETKLLSHRLNTKLKSSPKLGKRREKLIKTGVLADWLVKDFMRFQPVAYDAQNQPIKSSKANSTEFWFIRRALALYGGEKNRLEGYFKQTNLIGNTNPHPFLNKFNWKACRNLVDFYQQYLEQREKFLEAIKNQPWEPYQYCLLLKIPKENRKNLVKGWEQGGISLPRGLFTEAIRETLSEDLMLSKPIRKEIKKHGRVGFISRAITLYFKEKYQDKHQSFYNLSYKLEAKAPLLKREEHYEYWQQNKPQSPTESQRLELHTSDRWKDYLLYKRWQHLEKKLRLYRNQDVMLWLMTLELTKNHFKELNLNYHQLKLENLAVNVQEADAKLNPLNQTLPMVLPVKVYPATAFGEVQYHKTPIRTVYIREEHTKALKMGNFKALVKDRRLNGLFSFIKEENDTQKHPISQLRLRRELEIYQSLRVDAFKETLSLEEKLLNKHTSLSSLENEFRALLEEWKKEYAASSMVTDEHIAFIASVRNAFCHNQYPFYKEALHAPIPLFTVAQPTTEEKDGLGIAEALLKVLREYCEIVKSQI
>NC_017045.1|WP_004919753.1|1860882_1861932_-|glucokinase
MPFQNKFPLHLPGEKSTENQNISLVATDVKQKDTTLGYYVSENGKLELKAKKEYNTQDFGLFSDILNLFLEEYGLSKPSRISIAVPGPVLNGKCTTENLPFDLDIELIRSRTEVEHITLINDLEAMAYGLKGTEDKDFCTLHKNSSTTKGNVAILAPGRGLGEAGMFWDGECLRPFATEGGHSEFSPRAEDELELYRFLKAIHGIVSWESVLSHEGLFNVYRFVRDMRRQEEPEWLTQKLEKGDCHEVIIDAALNGENRACALTVEAYVDFIAREASNLVLKLKATGGLILAGSLAVKIEALLKMPSFYQTFVISDKMENILKSTPIYLLKNENAILTGAAYYGAFGKH
>NC_017045.1|WP_013447131.1|1862097_1864701_+|alanine--tRNA-ligase
MTSQQIRQAFLDFFKSKEHLIVPSAPIVLKDDPTLMFSNSGMTQFKDYFLGYKTPKAPRIADTQKCLRVSGKHNDLDDVGRDTYHHTMFEMLGNWSFGNYFKKEAIVFAWELLTEVYKIPKENLYVTIFEGDATENLERDQEAYNCWKSYIAEDRILNGNKKDNFWEMGESGPCGPCSEIHIDLRSEEEKSKVSGKDLVNQDHPQVVEVWNLVFMEFNRKADGSLEKLPAQHVDTGMGFERLCMALQGKTSNYDTDVFTPLIAKVEQLSQKKYEGLLDNEKDIAIRVVVDHIRAVSFAIADGQLPSNTGAGYVIRRILRRAISYSYRFLDMKEVFLYELVAVLKNQMGAFFPEIEKQEKLVTEVIKEEENSFLKTIEHGLVRLENIIQETLKKGEKTLPGAEVFELYDTYGFPADLSRIIAEEKGLTVDEKGFDEEMEKQKQRSKKSSAQKVYDWVTLKDETESFVGYDQLEHKVFITRYRKLENKDGVFYQVVFNQTPFYAEGGGQVGDKGYIESEEGQFEVLDTKKENNLNISLIKDLPQAPEKEFTAVVDSRLRRNTQANHSATHLLHEALREVLGTHVEQKGSFVGADYLRFDFSHFSKMSDEEIALVEEKVNAKIKENISLQEYRNIPIQEALDKGAMALFGEKYGDNVRMIQFGSSKELCGGTHAKSTSEIGLFKIVSESSTAAGIRRIEAISSEKANAYFKELEEQMTQLSLALKTKDVQKSVEKLLEENQKLKSELEAIKKELAKNETADWKNQFVSKEGKNLLVKMTSLDAASVKDIVFQLKKEVPTSVIVILSDANDKPMISVGVSDDLGDSYNAGVIVKELAKEIQGGGGGNPGFATAGGKNLEGLPKAYEKAQSL
>NC_017045.1|WP_004919750.1|1864796_1866164_-|peptidylprolyl-isomerase
MNYKHKITFLLSFFITLLSFNAHAQLKPGDLVDGIAAVVGNEIVLESDIEQQENYARQQGAQTANRCEFLEKVLSNKLLIYEAKKDTLIENHSEAIKQQAEAKYNELLAQFPSEKELLAAYKFRNSFEMKSAIEQIDTDQYYGQAKYQRITSGVNITPNEVTDFYNIYKGQLPMVKDEISLAKITLYPKLTKEHQQKLIDKLNQIKKDIEGGESFEKMARIYSEDPGSAATGGLYKNIAKGAMVKAFEAAALNLQEGELSKPIESEFGYHLIQLIKKSGKFYDARHILLKAEPNTEEIAAAKKELNEIRKQIEDGKITFKEAAYKYSDDKATKFNAGVISTPGGSDRLEKLHLPANYSYQIVGLKVGDITEAFEDVADRDKKVVSIVKVLEEIPAHSLDLTSDYERIKNYALEQKKGKVMEKWIVEKLPDTFISIDGRYKSCQFDVDWNKQALTK
>NC_017045.1|WP_004919749.1|1866260_1867181_-|bifunctional-hydroxymethylpyrimidine-kinase/phosphomethylpyrimidine-kinase
MKLLAVGTVAFDAIETPFGKTDKTLGGAATYIGLAASVMEASVGLVSVVGGDFPQEELDMMLRKNINIDGIEIIPNGKTFFWSGKYHSDLNVRDTVSTELNVLENFDPKIPEKAQEAEVLLLGNLHPAVQMSVLNKMKNRPKLVILDTMNFWMKHTWDLLLDIISKIDIICINDEEARQLSGEYSLVKAAQKIRKMGPNFVIIKKGEHGALLFDKNQIFAIPALPLEDVFDPTGAGDSFAGGFAAYLAKTQDYSFENMKTALMMGSAIASFTVEKFGTERLANISETMLKERIQEFKKLTAFEVKL
>NC_017045.1|WP_004919747.1|1867206_1867770_-|gliding-motility-lipoprotein-GldD
MFKVITLSIILVFTLIGCKGETLPKPKGELRLEYPKAHYQPFNNTCNYTFEFSDFAKVTPAKQRECWFNLSYPKMKANVFLTYFPIKNDFQLHVKEAEKMVYEHTIKASAIETKSFSYPEKRVFGNFYELKGESASNIQFFITDSTHHFITGNLYFNSRPKPDSLAPAVEYIKTDILHLIETFQWKK
>NC_017045.1|WP_004919744.1|1867814_1868855_-|A/G-specific-adenine-glycosylase
MKTNKQNPDFLNIGFRILQWYKQNARDLPWRATKNPYNIWICEIILQQTQVQQGLQHYLNFIARFPDVKSLAEADTDEVLLYWKGLGYYSRAINLQYAARQIMQDFGGTFPTNHKDILKLKGIGKYTAAAICSISYQLPYPAIDGNFYRVFSRFFADDFDISKSNAFDYFSELTKDFIPKDNPGDFNQAIMDLGSGICKPKQPSCGFCPLNKDCIAFNTGTIDKFPVKIKKVKTEDLKLKYYFIHHNDFFVVKKRDRSSIWKNLYDFPEFLPEHLKEYISNHNTVKHKLTHKNLEIELVTVTLPSVKLLEQFAHDHNNFNFVDYESSQQKSFPKPLENYIDKTFNK
>NC_017045.1|WP_014937385.1|1868817_1869195_+|integration-host-factor-subunit-beta
MFRKSGFCLFVFKNKLYICTPKIKTKKEMTKAELVNTISNKLGIEKNDTQKVIEAFMQEIRGSLYEGNNVYLRGFGSFIIKTRAAKTGRNISKNTAIEIPAHNIPAFKPSKSFAERVKTKVPVKD
>NC_017045.1|WP_013447132.1|1869418_1870978_+|ribonuclease-E/G
MKKELLISNEGGASKIALIEDGRLFELHEQEQESDFVVGDIFLGKIKKLAPNLNAAFVNIGYDKDAFLHYQDLGPQYLTYRKFLNETLSKRKNDSGLKNFPIEKALDKNGMVDSVLAKDDVVLLQVTKEPISTKGARISTQVSLTGRFLVLIPFDQKVSVSKKIKDSAERERLRTLIESIKPEGFGVIIRTVAEGKKVAELHNGMNQLIQKWETCFKNIQRGKVPSKILSEEEKASAILRDNFNADFVSIICDDEDMVQEMKNYLEVIAPERKNIVEFYEHHIPLLEYYNVEKQLKQSFGKHVNIPSSKGAYLVIEHTEALHVIDVNSGNNITAGSQANKEHAFNVNRMAATEIARQLRLRDMGGIIVVDFIDMRDAEHRRELYEHLKNEMKRDKAKHKILPPSKFGLIQITRQRVRSETVIETKEENPNKDGEILAPVVIVEKMTEVLKGLMQKEKGRLYLHAHPFVEAYLTKGLMSIQTKWYLKYKKWVTIIPRDSFKYLEYRVYNSQKQELASFSN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_017045_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_017045_3

1991207-1991466

Orphan

Consensus_repeat	Method
GGTTCTAGGCTAAGTCGCCTAGGTTCGTT	CRISPRCasFinder

3 spacers

The CRISPR arrays of NC_017045_3

>merge|NC_017045|3|1991207-1991466|CRISPRCasFinder
GGTTCTAGGCTAAGTCGCCTAGGTTCGTTGGGAAGAGGTTGGGGCTAAATGTAAAGTCGTCTAGGTTAAGTTGGAAGTGTTTTAGGTTCTAGGCTAAGTCGTCTAGGTTCGTTTCTAAGTCGTCTAGGTTAAATAGGAAGTGCTTTAAGCTAAAGACCAAGTCGTCTATATTCTAAACCAAGTTGTCTAGGTTCGTTAGGAAGTAAATGACGTTCTGAACCAAGAGTTCTAGGTTCTAGACCAAGTCCACTAGGTTAAAT

>NC_017045|3|3|1991207-1991466|CRISPRCasFinder
GGTTCTAGGCTAAGTCGCCTAGGTTCGTT	GGGAAGAGGTTGGGGCTAAATGTAAAGTCGTCTAGGTTAAGTTGGAAGTGTTTTA
GGTTCTAGGCTAAGTCGTCTAGGTTCGTT	TCTAAGTCGTCTAGGTTAAATAGGAAGTGCTTTAAGCTAAAGACCAAGTCGTCTA
TATTCTAAACCAAGTTGTCTAGGTTCGTT	AGGAAGTAAATGACGTTCTGAACCAAGAGTTCTA
GGTTCTAGACCAAGTCCACTAGGTTAAAT

Protein	Signature genes	Signature genes Name	Protein_function
NC_017045.1\|WP_013447159.1\|1984327_1985350_+\|two-component-sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|274368
NC_017045.1\|WP_013447160.1\|1985432_1986092_+\|YceI-family-protein	unknown	unknown	gnl\|CDD\|377274
NC_017045.1\|WP_004919543.1\|1991675_1992449_+\|nucleoside-triphosphate-pyrophosphohydrolase	unknown	unknown	gnl\|CDD\|236569
NC_017045.1\|WP_004919532.1\|1999596_2000472_-\|pirin-family-protein	unknown	unknown	gnl\|CDD\|224655
NC_017045.1\|WP_013447163.1\|1997902_1999447_-\|bifunctional-response-regulator/alkaline-phosphatase-family-protein	unknown	unknown	gnl\|CDD\|380291
NC_017045.1\|WP_004919528.1\|2001135_2001921_+\|hypothetical-protein	unknown	unknown	unknown
NC_017045.1\|WP_004919537.1\|1995214_1996234_+\|bifunctional-diaminohydroxyphosphoribosylaminopyrimidine-deaminase/5-amino-6-(5-phosphoribosylamino)uracil-reductase-RibD	unknown	unknown	gnl\|CDD\|273015
NC_017045.1\|WP_004919540.1\|1993305_1995120_+\|DUF349-domain-containing-protein	unknown	unknown	gnl\|CDD\|377186
NC_017045.1\|WP_004919530.1\|2000620_2001121_+\|sigma-70-family-RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|274357
NC_017045.1\|WP_013447161.1\|1986145_1989505_-\|transcription-repair-coupling-factor	unknown	unknown	gnl\|CDD\|224118
NC_017045.1\|WP_013447156.1\|1979571_1980789_-\|hypothetical-protein	unknown	unknown	unknown
NC_017045.1\|WP_014411365.1\|1980826_1983379_-\|TonB-dependent-receptor	unknown	unknown	gnl\|CDD\|273804
NC_017045.1\|WP_004919548.1\|1990113_1990686_+\|peptide-deformylase	unknown	unknown	gnl\|CDD\|234668
NC_017045.1\|WP_013447155.1\|1978451_1979498_+\|FAD-binding-oxidoreductase	unknown	unknown	gnl\|CDD\|334462
NC_017045.1\|WP_013447162.1\|1996239_1997877_+\|hypothetical-protein	unknown	unknown	unknown
NC_017045.1\|WP_014411366.1\|1992500_1993226_+\|shikimate-dehydrogenase	unknown	unknown	gnl\|CDD\|223247
NC_017045.1\|WP_004919550.1\|1989703_1990117_+\|Holliday-junction-resolvase-RuvX	unknown	unknown	gnl\|CDD\|340815
NC_017045.1\|WP_013447164.1\|2001915_2002602_-\|5'-methylthioadenosine/adenosylhomocysteine-nucleosidase	unknown	unknown	gnl\|CDD\|180148
NC_017045.1\|WP_013447158.1\|1983642_1984320_+\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|223816
NC_017045.1\|WP_004919546.1\|1990713_1991136_+\|DUF5606-domain-containing-protein	unknown	unknown	gnl\|CDD\|375774

Protein	Function_ID	Function_description	E-value
NC_017045.1\|WP_013447159.1\|1984327_1985350_+\|two-component-sensor-histidine-kinase	gnl\|CDD\|274368	TIGR02966, Phosphate_regulon_sensor_protein_PhoR, phosphate regulon sensor kinase PhoR. Members of this protein family are the regulatory histidine kinase PhoR associated with the phosphate ABC transporter in most Proteobacteria. Related proteins from Gram-positive organisms are not included in this model. The phoR gene usually is adjacent to the response regulator phoB gene (TIGR02154). [Signal transduction, Two-component systems].	2.89641e-63
NC_017045.1\|WP_013447160.1\|1985432_1986092_+\|YceI-family-protein	gnl\|CDD\|377274	pfam04264, YceI, YceI-like domain. E. coli YceI is a base-induced periplasmic protein. The recent structure of a member of this family shows that it binds to poly-isoprenoid. The structure consists of an extended, eight-stranded, antiparallel beta-barrel that resembles the lipocalin fold.	1.22691e-30
NC_017045.1\|WP_004919543.1\|1991675_1992449_+\|nucleoside-triphosphate-pyrophosphohydrolase	gnl\|CDD\|236569	PRK09562, mazG, nucleoside triphosphate pyrophosphohydrolase; Reviewed.	2.82996e-128
NC_017045.1\|WP_004919532.1\|1999596_2000472_-\|pirin-family-protein	gnl\|CDD\|224655	COG1741, COG1741, Pirin-related protein [General function prediction only].	3.52489e-76
NC_017045.1\|WP_013447163.1\|1997902_1999447_-\|bifunctional-response-regulator/alkaline-phosphatase-family-protein	gnl\|CDD\|380291	NF033449, BREX_PglZ_3, BREX-3 system phosphatase PglZ. BREX is a phage defense system (BacteRiophage EXclusion), with a number of described subtypes. The first described, PGL (phage growth limitation), is not called BREX-2. This model describes one of the two core proteins universal across the first six defined BREX subtypes, the phosphatase-like PglZ domain protein, as found in BREX-3 systems.	1.46626e-20
NC_017045.1\|WP_004919537.1\|1995214_1996234_+\|bifunctional-diaminohydroxyphosphoribosylaminopyrimidine-deaminase/5-amino-6-(5-phosphoribosylamino)uracil-reductase-RibD	gnl\|CDD\|273015	TIGR00326, eubact_ribD, riboflavin biosynthesis protein RibD. This model describes the ribD protein as found in Escherichia coli. The N-terminal domain includes the conserved zinc-binding site region captured in the model dCMP_cyt_deam and shared by proteins such as cytosine deaminase, mammalian apolipoprotein B mRNA editing protein, blasticidin-S deaminase, and Bacillus subtilis competence protein comEB. The C-terminal domain is homologous to the full length of yeast HTP reductase, a protein required for riboflavin biosynthesis. A number of archaeal proteins believed related to riboflavin biosynthesis contain only this C-terminal domain and are not found as full-length matches to this model. [Biosynthesis of cofactors, prosthetic groups, and carriers, Riboflavin, FMN, and FAD].	3.96492e-88
NC_017045.1\|WP_004919540.1\|1993305_1995120_+\|DUF349-domain-containing-protein	gnl\|CDD\|377186	pfam03993, DUF349, Domain of Unknown Function (DUF349). This domain is found singly or as up to five tandem repeats in a small set of bacterial proteins. There are two or three alpha-helices, and possibly a beta-strand.	2.64065e-12
NC_017045.1\|WP_004919530.1\|2000620_2001121_+\|sigma-70-family-RNA-polymerase-sigma-factor	gnl\|CDD\|274357	TIGR02937, RNA_polymerase_sigma_factor, RNA polymerase sigma factor, sigma-70 family. This model encompasses all varieties of the sigma-70 type sigma factors including the ECF subfamily. A number of sigma factors have names with a different number than 70 (i.e. sigma-38), but in fact, all except for the Sigma-54 family (TIGR02395) are included within this family. Several Pfam models hit segments of these sequences including Sigma-70 region 2 (pfam04542) and Sigma-70, region 4 (pfam04545), but not always above their respective trusted cutoffs.	2.34615e-24
NC_017045.1\|WP_013447161.1\|1986145_1989505_-\|transcription-repair-coupling-factor	gnl\|CDD\|224118	COG1197, Mfd, Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription].	0
NC_017045.1\|WP_014411365.1\|1980826_1983379_-\|TonB-dependent-receptor	gnl\|CDD\|273804	TIGR01782, TonB-dependent_receptor, TonB-dependent receptor. This model represents a family of TonB-dependent outer-membrane receptors which are found mainly in Xanthomonas and Caulobacter. These appear to represent the expansion of a paralogous family in that the 22 X. axonopodis (21 in X. campestris) and 18 C. crescentus sequences are more closely related to each other than any of the many TonB-dependent receptors found in other species. In fact, the Crescentus and Xanthomonas sequences are inseparable on a phylogenetic tree using a PAM-weighted neighbor-joining method, indicating that one of the two genuses may have acquired this set of receptors from the other. The mechanism by which this family is shared between Xanthomonas, a gamma proteobacterial plant pathogen and Caulobacter, an alpha proteobacterial aquatic organism is unclear. [Transport and binding proteins, Porins].	6.07785e-28
NC_017045.1\|WP_004919548.1\|1990113_1990686_+\|peptide-deformylase	gnl\|CDD\|234668	PRK00150, def, peptide deformylase; Reviewed.	3.0345e-74
NC_017045.1\|WP_013447155.1\|1978451_1979498_+\|FAD-binding-oxidoreductase	gnl\|CDD\|334462	pfam01266, DAO, FAD dependent oxidoreductase. This family includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase EC:1.1.99.5, Sarcosine oxidase beta subunit EC:1.5.3.1, D-alanine oxidase EC:1.4.99.1, D-aspartate oxidase EC:1.4.3.1.	1.48625e-15
NC_017045.1\|WP_014411366.1\|1992500_1993226_+\|shikimate-dehydrogenase	gnl\|CDD\|223247	COG0169, AroE, Shikimate 5-dehydrogenase [Amino acid transport and metabolism].	3.53843e-65
NC_017045.1\|WP_004919550.1\|1989703_1990117_+\|Holliday-junction-resolvase-RuvX	gnl\|CDD\|340815	cd16964, YqgF, putative pre-16S rRNA nuclease YqgF and RuvX family. Escherichia coli YqgF has been shown to act as a pre-16S rRNA nuclease, presumably as a monomer. It is involved in the processing of pre-16S rRNA during ribosome maturation. The RuvX gene product from Mycobacterium tuberculosis was shown to act, in a dimeric form, as a Holliday junction resolvase (HJR). HJRs endonucleases specifically resolve Holliday junction DNA intermediates during homologous recombination. Holliday junctions are formed by the reciprocal exchange of strands between two DNA duplexes. HJRs occur in archaea, bacteria, and in the mitochondria of certain fungi; they may form homodimers and display structural similarity to RNase H and Hsp70.	3.11808e-38
NC_017045.1\|WP_013447164.1\|2001915_2002602_-\|5'-methylthioadenosine/adenosylhomocysteine-nucleosidase	gnl\|CDD\|180148	PRK05584, PRK05584, 5'-methylthioadenosine/adenosylhomocysteine nucleosidase.	4.44785e-97
NC_017045.1\|WP_013447158.1\|1983642_1984320_+\|response-regulator-transcription-factor	gnl\|CDD\|223816	COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription].	1.1829e-73
NC_017045.1\|WP_004919546.1\|1990713_1991136_+\|DUF5606-domain-containing-protein	gnl\|CDD\|375774	pfam18347, DUF5606, Domain of unknown function (DUF5606). This is a domain of unknown function found at the N-terminal region of bacterial proteins.	9.02458e-21

>NC_017045.1|WP_004919546.1|1990713_1991136_+|DUF5606-domain-containing-protein
MLLEKIISISGKPGLYKLVSQLRNGFIVEDITTKKKLSISNSSQVSLLDNIAMFSFDREVPLFEVFENIAKNENYEQTINHKSSDEELRAFMLKSLPTYDTERVYVSDIRKLAQWYNLLQKAGYITPDSFVKEEINEEEK
>NC_017045.1|WP_004919548.1|1990113_1990686_+|peptide-deformylase
MILPIRAYGDPVLRKKGQDITPDYPNLKELIQNMFETMEGAHGIGLAAPQIGLDIRLFIVDVRPLAEDEDYLDIADELKDFRKVFINAKILEETGEEWKFNEGCLSIPEVREDVKRKDTITIEYYDEDFKKHTETYSDIRARVIQHEYDHIEGILFTDKLSALKKKLVKGKLNKISAGEVSVSYKMRFPK
>NC_017045.1|WP_004919550.1|1989703_1990117_+|Holliday-junction-resolvase-RuvX
MGQILAIDYGKARTGIAATDDMKLIASGLASVPTGELLSFLSEYIHNNAVEAVVVGYPVDLKGNVSEVETSILEFIEKFKVQFPEIEVHRLDERFTSKMASFFISQSGKNKKQRQEKGLIDKISATIILQNFLEQKR
>NC_017045.1|WP_013447161.1|1986145_1989505_-|transcription-repair-coupling-factor
MILSPIHESLLPFLLKHQFGNSVLEALPHHQHISVKGMAGSSPSLICAELFLTQNQPILLIVDDKEDAHYTTTELEELLGEDKVLYFPATHLEPYQTEKTQNANLVLRTEVLNQLNANPEPKVIVAHYAALCEKVLKKEDFKAISHHIKVGYQLDFDFTGELLEQFNFHLTDFVSEPGEFAVRGGIVDVFSYANDKPYRITFFGNEVESIKTFDIETQLSISKVESLQLVSNMNFAVQGTKVPFLDLLPKDSFIVTKNAYLGLNYIRDFYTKAEEKYTQLNPDIKHQKPNELFISDEVFFKTYQKFRTVDFTSQSLQLPQAPFIELKQNPQPSFNKNFELLIEDLEEKQKQGFNLWISFSSEKQKERLKSIFEDLGSAISFQFFKSELHQGFIDHQHKILVYTDHQIFDRYQRYRAKNTFAKSEQLTLKDLMSLKVGDYIAHIDHGIGKFMGLVKVNNGGKTQECFKLTYKNGDLLYVSIHALHKISKYNGAEGKEITLSKIGSPSWKNLKNKTKAKVKQIAFDLIKLYAKRKTAKGFAYTPDTYLQNELEASFLYEDTPDQEKATLDVKRDMEADTIMDRLVCGDVGFGKTEVAIRAAFKAATDGKQVAVLVPTTILAFQHYRSFAERLKDFPVNISYLNRFRTAKQKRETLEKLAEGKIDIIIGTHQLASDKVKFKDLGLLIIDEEHKFGVSVKDKLKTLKANIDTLTLTATPIPRTLQFSLMAARDLSVIKTPPPNRQPVETQLIGFDEEIIRDAISYELQRDGQVYFINNRIDNLKDIAGMIQRLVPDARVITGHGQMDGKQLEENILDFMEGRYDVLVSTTIVESGVDVPNANTIFINDAQRFGMADVHQMRGRVGRSNRKAFCYLITPPFDMVTSDARKRLEAIEQFSDLGSGFQIAMKDLEIRGAGDLLGAEQSGFINEMGFETYQKIMQEALEELQNDAEFESLFENEADRKKLFKSSKDVNIDTDLELMLPDSYVSSTEERLSLYQKLAEINNKEELKRFEAELEDRFGSLPEEAINLLKSVELKWLAAAIGFEKIVMKNGILLGYFPSNPQDKFYQTEKFKKIIQYLSQNPQKASLKEKHSAEGNQLMMRKDHINDVDEVNELLQAILN
>NC_017045.1|WP_013447160.1|1985432_1986092_+|YceI-family-protein
MKKNILSLFFATSIGLLALSSCGKDKPLTSESNEVTTTKEGQVYAIDTATSKIEWKGYKVVKSDNTSHFGDIKFESGEITVKDGKLESGKFVANMNTLANRDITDDAEKSAKLDGHLKNEDFFEVEKFPTSSFEITKVTETTEGDYNTLLDGNLTIKGITKPVQFKANVKVEEGKVSIKTEPTDIKREDFGVKFQMPVANGVIKNEVTVHVSIDASQLK
>NC_017045.1|WP_013447159.1|1984327_1985350_+|two-component-sensor-histidine-kinase
MKPSSLSIVASLCLTGAMGLVVFAFEYVKTKDWFNNVGFIVILFVLSVIFFINYTIVSFLFRFYGKEKIRQISTILPDEIATEDENINFKELGERISGLSEKASSEIDMMKEMERYRKEYIGNISHELKTPLFSIQSYVGTLIDGGVEDLEIRDKYLHRIDKSLDRLMNIVKDLDMINRFESGEITLEFVKFDLNVLVKEIFDFLDIEAQKKGTQLSLKSNGAIWVLADKQKISQVLLNLVSNAIHYANREKAVVEVITSVHKDKVVVEVKDNGMGIKPEILPRIFERFYRVESSRNRREGGSGLGLAIVKHILEAHGQNIEAKSVYLNGASFIFTLDKA
>NC_017045.1|WP_013447158.1|1983642_1984320_+|response-regulator-transcription-factor
MKGKRILLIDDEPDILEIISYNLKKEGYEVHTANNGNEGIEKAKEILPHLILLDVMMPDKDGIETCQEIRKIATLEGCLIVFLSARGEEFSQLAGYQAGANDYIVKLIKPKVLISKVNALMNLTQQVEEKNKILKIGHLIIDRDNFKVTKGDESFILPKKEFDLLNLLASNTEKVFKREEILEKVWGNDVVVGERTIDVHIRRLREKLGSKSIQTLKGIGYKLII
>NC_017045.1|WP_014411365.1|1980826_1983379_-|TonB-dependent-receptor
MGQEVKKDSIKNEKKIDGVQLKATINKKTETAVLQAVKKSSVQVQAMGSEEISRKGISNVEQSLTKITGVNTVEGKGLFVRGLEERYNTLLINGLGSPSNNPFQKIIALKQFPTDVVGKLNIYKTFNSNLYADFAGATFDIETLSYDKPFTKVEFSIGFNSQTTFRDRFKISENANTIDGYLGLNYRNRQLPSEVKGFRPSNYIFNGQESVSSFKDSWNVDNIKALPNTGLSFTTAQRFKAGSGRIGLLLSLNQANKYQYQEGHNNLFLFSGSNITYNNKLYQKEYEYETESSALLGLGYKNKGTDVMLNAIFLQNSTNIIQDNIGYVDQGNSGEGLFRVNQQDISRFTDIQLIASQKLGKRHLIKVGGSWVNNIYQQPDRKIFSGTPETPHNYDRIRLSYGGNNLIRQYLDVNGKNYLSAFAEYKLSLGEKNDRKSYPIELSLGYNGFMDRRSTSYRFIYSVFNNSASPNGRTVIINPDTPQDTFNQSTLNGFFNYREGSNVVYRNNIYQFVNAGYTSLNYKPNDTWDIILGGRIENNMNITRYKELSNSINGKFLNLTRNQYYILPSLSVKKELNSKTNLRFAFSKTVTRPILIEYMPITYINPNNENILGNPRLTNSENYNFDLKYELFPTKDEMFAFGIFGKKIVNAIEKSYTASANSNGQTITFFNATEANLAGIELEGIINLKRISESLSPFSLGTNATLMYSDVKRSSLQKEQESNRQKGLKRGLQGAAPWTLNADLKYETKNAKNLTQTASLVYNVSGSKIHTLGSIGVDHIYERPFHKLDFVYQKELSKQWKAKFSIINLLNSKYRLEYGDNSDVEVRADSFVHTDYRRGTNFNLSVEYTF
>NC_017045.1|WP_013447156.1|1979571_1980789_-|hypothetical-protein
MKKHLLSLCSLALVLSVTSCTIDIREDNDASTSTKIENTTGSVMEGSGSLNGTITKDLLIKKGNYTLDGVVKVASGVTLTIEPGAVFTANSSNDTSLVILQGAKINAQGTADNPIVFTSNTKIPGDWGGISIYGKAPIIALNGAKTAISEDGNNLQYGGDDANDNSGVMKFVRVEYGGKKIGDGKSENNSMTFYSVGAGTVLENLVAYKGTDDGFEFFGGTVSATNLVSYGNFDDSFDWQDGWSGQNNSNWFAYQTKVGNFGMEIEASSNKNNTAPKINGITLIREAGTKPEVEGSTEISAIQFKKQGSGIFKNVYIDGYKDTDGKKAYAVLIQDKDTQNDQVATNNIKVTPINYLNSSNPAVWGYGYANDNPASFTSDSSVKKVNLVSGAWANVDGVDLLKALK
>NC_017045.1|WP_013447155.1|1978451_1979498_+|FAD-binding-oxidoreductase
MKNVEYIIVGDGYAGLFFAHQLLKNNHSFVLFSNGEKGASQVSAGIVNPVVLKKFTTFWKAQEQIDFLTDTMKEIEAYTGTNYLIEAPIHRIFHDESERELWKKKRLEKEELKPFLSDDFSALENVENPFETGKVLKSSRLNVPLFFSGYLQYLEKQNKLIKEKFDYNQLDVENNKYKDWSYKKIVFAEGIGVKNNPFFRDIMVNPNKGHHLKVKLSKELYSDVTIKKKHFLFPLEEADVFYYGGTYDRDNTDEEIDTKAVEQLKNGLREFYPFDFEIQEVCYGFRPTVKDRRPILGAHEVYSNLYVFNGLGARGILNGSYFSKILYDFIYAQIELSKEISNLRFFIR
>NC_017045.1|WP_004919543.1|1991675_1992449_+|nucleoside-triphosphate-pyrophosphohydrolase
MTTREQQLNAFGELLEIMDTLRAQCPWDRKQTLQSLRHLTLEEVYELSDALLNEDLDEIKKELGDVLLHLVFYAKIGSEQQHFDIGDALKSLNKKLIFRHPHIYGNTEVKDEEEVKQNWEKLKLKEGNRSILSGVPKGLPSLVKAYRIQDKVRGIGFEFPNAEAAWSKVEEELQEFHNTQNPQQKEQEFGDVLFSLVNYARLSGINPDTALERTNHKFISRFQTMEALASQKNLNLDSLSLEEMDCLWEEAKKQEQL
>NC_017045.1|WP_014411366.1|1992500_1993226_+|shikimate-dehydrogenase
MGKQLGLIGRNISYSFSQKYFEAKFKKLFIKDISYYILDLPSIEGVAELWSNPRLVGFNVTIPYKVEIINYLDELSEEAQAIGAVNTVSIKDGKKIGYNTDAYGFERTLDLHLKTIHQKALVLGDGGAAKAVKFVLERKGIPYLVVSRRGTIKFEQLTREHLSEYQIIIQCTPVGTYPNVEDCVPFPFDGLSGEHLVLDLIYNPERTKLIKEAQKRGAKTANGLFMLEQQAEKAWEIWNLV
>NC_017045.1|WP_004919540.1|1993305_1995120_+|DUF349-domain-containing-protein
MNKETLNSGQEELNTPQPNQEVKANTVLETSSYQELEVEEEDHDDDDHEENEKLSLKELVDKLEKLINLENAGEEIQKFNALRKSISEQIDEITENKKQEFEAADNDPSEVFSYEHPLQAKFSALINIFKEKRDLFTQKQEEEHQKNLEVRLGIVEKLKNLYTNTEPGTDLFKAIREIKEAWANAGKVAKSEFKNLNNNYYHHLNGFYQMLDLNKEYREQEYAHNLEKRQHIIARAKELLVEPLIQKALNELQYLHKLWREEAEPVAEEFRDSTWEEFKEISNQIHDRKTELFAAREAEQKENLEKKNTIIAQIKALGAPEKPNHNYWQKSINKMEELREEFIKLGSVPRKLSTQNWTDFKQSVRAFNSAKNEFYKGLKQTQINNLEEKYKLIKVAQDNKNSEDWETMVPLFKKLQKDWQAIGHVPRSQANKVWDAFREACNYFFDQYRTKSEAAGDDWNENFKQKKALLEELKKIEKGENSLEIIEDIKNKWNAIGKVPKDKLGINSEFNKTLKQKLKLNNLNEFDIKEEGLSESQITDRARKLKNQITDLEAEVVKLENNLSFFNNPTRENPLLKDTFEKIDDKRAQLESLRITLHQMISGE
>NC_017045.1|WP_004919537.1|1995214_1996234_+|bifunctional-diaminohydroxyphosphoribosylaminopyrimidine-deaminase/5-amino-6-(5-phosphoribosylamino)uracil-reductase-RibD
MSHEKYISRCIALAEKARGNTYPNPLVGAVIVHNGIIIGEGYHHKAGEPHAEINAINSVENKGLLKESTIYVSLEPCSHFGRTPPCATKITEIGFKKVVIGSADSNEKVSGKGKAMIEEAGIEVVDKVLEERCRWLNRRFFTFHEKKRPYIILKWAESNDGFIDRNFVPTPISNTLASQYVHKMRAEEHAILVGTQTALNDNPTLDVRHLDGRNPTRVLIDLELKVPQSFNIFNTNAPTIIFNLHKNDNQDHLKWIKIDKENFLEELMYHLYEQQIQSIIIEGGSKMLNTFIEAQLWDEAVVIKAPNLTLNNGTKAPIFNEKPYRQKQMRDNVLNFYKK
>NC_017045.1|WP_013447162.1|1996239_1997877_+|hypothetical-protein
MLYLLLSVGVIFSSLLGVGMLFEKLLGKLWEEKLSSAFFAGCMGLSLVWAVLAFAVPINRVVEVSSLGLGLSAFIYFKMYRFLGAFITKNYSVFILLLFVVLLFGSGYPFILDHFGYYVPSIKWIAEIGLVKGIGNLDLILGQMSLWHILQAGFSNTSDVFLRLNVVLLLGYIIYIIEKKAWVHFIFLPILLLFLQSPSTDLPVIVGSLIILNEVLNKNYNVSALFGFSVWIFSIKPTIIWLPLMVFLYAFLIRKFTYKLIIVGVGVVSVFVIKNWYCFGFPIFPVQVLDLGLSWKPNEFLLKNSAETAILKTYDFQYSYEEIKQFSVWESIKNWIFLKGIKGVINVAFVLSLLALLIFAIKSKSRLIWLIVISIFIKSVLVLLFSAQYRFFLEVFFVVALLVFRNWFSAKKVAFVSIIGTLGMSVFLFAPSLIVKYIPSFRLGGFIKNIELSQVVKPATYKYQRYKTFTIGNLTFNVVENYPFSFDTPLPAISPSFLELYLEAGIFPQKMGSNLKEGFVWKKLSNEDKEQLQQIVNGFYINEKR
>NC_017045.1|WP_013447163.1|1997902_1999447_-|bifunctional-response-regulator/alkaline-phosphatase-family-protein
MAKKILWIDDEVDLLKPHIVFLENKGYQVTPINNVNEALEILDEESFSLVLLDENMPGISGLDAIPLLKEKNSAMKIVMVTKSEEEHIMEQAIGSQIADYILKPVNPNQVLLSLKKNLQSDDLVEQQTKQEYQQEFRNISMELSYLNTYEDWSNYYKKILGWEIKFDKVFDNEFADLLQSQKEEANIQFAKFIERNYENWLNSNEKPLMSHTLFKEKVKPEMQNDKVLLLMIDNLRYDQWKVIEPLFLKFYNKTLETSYYSILPTATQYARNAFFAGLMPSEIEKRFPDQWLNDNEEGNKNEVEQDFLKDQMKRLGLSSKTMKYIKVLNSDFEQKVLKDFHQHQNKDLVVVVYNFIDILSHAKTDNSIVNQLIRDDKTFRSLTLNWFENAPIMRLIKQAAESGFKLIITTDHGTIYVKKPSKVVGDRETSTNIRYKTGKSLSYEDSDVWAINQPEKLFLPKGNLSSKYVFAKNNTFLAYPKNYNHFVNYYKETYQHGGISLEECIIPFCVLEPK
>NC_017045.1|WP_004919532.1|1999596_2000472_-|pirin-family-protein
MNTKKIELIAAPRPAHFVGDGFRVHNFIPSGFRLDMKRMDPFIMMDYNSKFYFEPSQTPRGVGVHPHRGFETVTIAYQGKVEHHDSAGGGGIIQEGDVQWMTAGSGVLHKEYHETEWSKKGGIFQMVQLWVNLPSRYKMSPPKYQSIQHAEFPKVSVGENSWVEVIAGEYNGSKGIASTFSPIHMMNARLKKGASASFSFPAHFNTVALVIEGNIIANEEEEAPTDHLVLFENSGEDFNIEALDDAVVLILSGEPLNEPIAAHGPFVMNTRAEIIQAFDDFKNNKFGVLED
>NC_017045.1|WP_004919530.1|2000620_2001121_+|sigma-70-family-RNA-polymerase-sigma-factor
MSLETEFLQQIEKHKGVIFKISKMYMDNKNDQEDLFQEIIYQAWKSYPSFQGKSLFSTWLYRVALNTSIVFLRSDKKKINTSDIELSTINKRVENNDVEQQQLELMYKAIQQLGAIDKALIFYYLENYSGKEIAAQMGITEVNVRVKLNRAKQKLKTLINELRTQQ
>NC_017045.1|WP_004919528.1|2001135_2001921_+|hypothetical-protein
MELDNIKDLWHREKVSDLPNISLEQQKAVKTPLEKIRANMKMEFWTTLLAMVLIVPLYYSQIKNAQQGSLFLLLYIISILIIVYYFVKFYSLYKTISTQNFQTYHNLLNLRYELVLNTELYKSYYISFVPILFSVFLLFLDLNSWNGVMFVVVSLFMTSIIMYVMGKVWLREVYGNYVVEITDLVSELSDESDDFKFNRNSLSHQGKYQIFQKTKHFFRKIFGKYATLANWIFWFFILIVISAITGYVIAYFSILLGKNQL
>NC_017045.1|WP_013447164.1|2001915_2002602_-|5'-methylthioadenosine/adenosylhomocysteine-nucleosidase
MKIVVIGAMEVEIKHLCDALENPIKKEIHSFQFHIGTITNHEVIVLLSGVGKVSSAIGTCLLINHFAPDLIINTGTAGGLKEVQVKDIILATEVRHHDVDLTAFGYELGQQSKMPPAFIPDSFYVEKAETVIKKHGINANKGLVISGDAFINCPDKFQWLKDNFRTAKAVEMEAASIAQVCHQMKTPFIVLRAISDIAGEGTTVSFDTFVTEAGKISAEINIDLIKSL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Identity
NC_017045_1	1.11\|1021229\|30\|NC_017045\|CRISPRCasFinder	1021229-1021258	30	NC_017045.1	134442-134471	1.0
NC_017045_1	1.12\|1021306\|30\|NC_017045\|CRISPRCasFinder	1021306-1021335	30	NC_017045.1	1634793-1634822	1.0
NC_017045_1	1.23\|1021230\|30\|NC_017045\|PILER-CR	1021230-1021259	30	NC_017045.1	134442-134471	1.0
NC_017045_1	1.24\|1021307\|30\|NC_017045\|PILER-CR	1021307-1021336	30	NC_017045.1	1634793-1634822	1.0

1. spacer 1.11|1021229|30|NC_017045|CRISPRCasFinder matches to position: 134442-134471, mismatch: 0, identity: 1.0

gacaaaataaaacagatgtgcgatgggata	CRISPR spacer
gacaaaataaaacagatgtgcgatgggata	Protospacer
******************************

2. spacer 1.12|1021306|30|NC_017045|CRISPRCasFinder matches to position: 1634793-1634822, mismatch: 0, identity: 1.0

aactactttctaaagcattacaattaagaa	CRISPR spacer
aactactttctaaagcattacaattaagaa	Protospacer
******************************

3. spacer 1.23|1021230|30|NC_017045|PILER-CR matches to position: 134442-134471, mismatch: 0, identity: 1.0

gacaaaataaaacagatgtgcgatgggata	CRISPR spacer
gacaaaataaaacagatgtgcgatgggata	Protospacer
******************************

4. spacer 1.24|1021307|30|NC_017045|PILER-CR matches to position: 1634793-1634822, mismatch: 0, identity: 1.0

aactactttctaaagcattacaattaagaa	CRISPR spacer
aactactttctaaagcattacaattaagaa	Protospacer
******************************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_017045_1	1.10\|1021152\|30\|NC_017045\|CRISPRCasFinder	1021152-1021181	30	NC_019490	Riemerella phage RAP44, complete genome	42842-42871	3	0.9
NC_017045_1	1.22\|1021153\|30\|NC_017045\|PILER-CR	1021153-1021182	30	NC_019490	Riemerella phage RAP44, complete genome	42842-42871	3	0.9
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_CP015806	Borrelia mayonii strain MN14-1539 plasmid lp28-3	22175-22201	3	0.889
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_CP015791	Borrelia mayonii strain MN14-1420 plasmid lp28-3, complete sequence	22175-22201	3	0.889
NC_017045_2	2.19\|1856729\|28\|NC_017045\|PILER-CR	1856729-1856756	28	NC_010555	Proteus mirabilis HI4320 plasmid pHI4320, complete sequence	8899-8926	3	0.893
NC_017045_2	2.19\|1856729\|28\|NC_017045\|PILER-CR	1856729-1856756	28	NZ_CP017056	Providencia stuartii strain BE2467 plasmid pPS2, complete sequence	4510-4537	3	0.893
NC_017045_1	1.9\|1021075\|30\|NC_017045\|CRISPRCasFinder	1021075-1021104	30	NC_019490	Riemerella phage RAP44, complete genome	42578-42607	4	0.867
NC_017045_1	1.21\|1021076\|30\|NC_017045\|PILER-CR	1021076-1021105	30	NC_019490	Riemerella phage RAP44, complete genome	42578-42607	4	0.867
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	AP014361	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S40-C80, * SEQUENCING IN PROGRESS *	15910-15936	4	0.852
NC_017045_1	1.1\|1020459\|30\|NC_017045\|CRISPRCasFinder	1020459-1020488	30	MT664722	Proteus phage Vb_PmiP-P59, complete genome	55041-55070	5	0.833
NC_017045_1	1.1\|1020459\|30\|NC_017045\|CRISPRCasFinder	1020459-1020488	30	LC519601	Cronobacter phage vB_CsaP_009 DNA, complete genome	89131-89160	5	0.833
NC_017045_1	1.13\|1020460\|30\|NC_017045\|PILER-CR	1020460-1020489	30	MT664722	Proteus phage Vb_PmiP-P59, complete genome	55041-55070	5	0.833
NC_017045_1	1.13\|1020460\|30\|NC_017045\|PILER-CR	1020460-1020489	30	LC519601	Cronobacter phage vB_CsaP_009 DNA, complete genome	89131-89160	5	0.833
NC_017045_2	2.7\|1856066\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856066-1856095	30	MK448860	Streptococcus phage Javan172, complete genome	10326-10355	5	0.833
NC_017045_2	2.7\|1856066\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856066-1856095	30	MK448751	Streptococcus phage Javan399, complete genome	13489-13518	5	0.833
NC_017045_2	2.7\|1856066\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856066-1856095	30	MK448957	Streptococcus phage Javan484, complete genome	15250-15279	5	0.833
NC_017045_2	2.7\|1856066\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856066-1856095	30	JX409894	Streptococcus phage LYGO9, complete genome	35096-35125	5	0.833
NC_017045_2	2.7\|1856066\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856066-1856095	30	JX409895	Streptococcus phage JX01, complete genome	3914-3943	5	0.833
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_CP015806	Borrelia mayonii strain MN14-1539 plasmid lp28-3	22175-22204	5	0.833
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_CP015791	Borrelia mayonii strain MN14-1420 plasmid lp28-3, complete sequence	22175-22204	5	0.833
NC_017045_2	2.17\|1856726\|31\|NC_017045\|CRISPRCasFinder,CRT	1856726-1856756	31	NC_010555	Proteus mirabilis HI4320 plasmid pHI4320, complete sequence	8896-8926	5	0.839
NC_017045_2	2.17\|1856726\|31\|NC_017045\|CRISPRCasFinder,CRT	1856726-1856756	31	NZ_CP017056	Providencia stuartii strain BE2467 plasmid pPS2, complete sequence	4507-4537	5	0.839
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_AP018048	Photobacterium damselae subsp. piscicida strain 91-197 plasmid p91-197-2	16539-16565	5	0.815
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NC_002102	Lactobacillus helveticus DSM 20075 plasmid pLH1, complete sequence	17236-17262	5	0.815
NC_017045_2	2.19\|1856729\|28\|NC_017045\|PILER-CR	1856729-1856756	28	NZ_CP026282	Klebsiella oxytoca strain KONIH2 plasmid pKOR-e3cb, complete sequence	46958-46985	5	0.821
NC_017045_2	2.19\|1856729\|28\|NC_017045\|PILER-CR	1856729-1856756	28	NZ_CP050835	Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-1, complete sequence	3635-3662	5	0.821
NC_017045_2	2.19\|1856729\|28\|NC_017045\|PILER-CR	1856729-1856756	28	NZ_CP037735	Citrobacter freundii strain CAV1857 plasmid pCAV1857-208, complete sequence	140134-140161	5	0.821
NC_017045_2	2.19\|1856729\|28\|NC_017045\|PILER-CR	1856729-1856756	28	NZ_CP035215	Klebsiella michiganensis strain M82255 plasmid pKOCBH-A, complete sequence	347998-348025	5	0.821
NC_017045_2	2.19\|1856729\|28\|NC_017045\|PILER-CR	1856729-1856756	28	CP045556	Citrobacter sp. S39 plasmid pS39-1, complete sequence	193063-193090	5	0.821
NC_017045_2	2.19\|1856729\|28\|NC_017045\|PILER-CR	1856729-1856756	28	NZ_CP045203	Citrobacter sp. NMI7904_11 plasmid pCTEL-2, complete sequence	82080-82107	5	0.821
NC_017045_2	2.19\|1856729\|28\|NC_017045\|PILER-CR	1856729-1856756	28	NZ_CP022152	Citrobacter freundii strain 705SK3 plasmid p705SK3_1, complete sequence	223084-223111	5	0.821
NC_017045_2	2.19\|1856729\|28\|NC_017045\|PILER-CR	1856729-1856756	28	NZ_CP030224	Salmonella enterica strain SA20083039 plasmid pSA20083039.1, complete sequence	174907-174934	5	0.821
NC_017045_2	2.19\|1856729\|28\|NC_017045\|PILER-CR	1856729-1856756	28	NZ_CP041248	Raoultella electrica strain DSM 102253 plasmid unnamed1, complete sequence	234561-234588	5	0.821
NC_017045_2	2.19\|1856729\|28\|NC_017045\|PILER-CR	1856729-1856756	28	NZ_CP011611	Citrobacter freundii strain CAV1321 plasmid pKPC_CAV1321-244, complete sequence	175216-175243	5	0.821
NC_017045_2	2.19\|1856729\|28\|NC_017045\|PILER-CR	1856729-1856756	28	CP052139	Klebsiella pneumoniae strain F17KP0040 plasmid pF17KP0040-1, complete sequence	226337-226364	5	0.821
NC_017045_2	2.19\|1856729\|28\|NC_017045\|PILER-CR	1856729-1856756	28	NZ_MG387191	Citrobacter freundii strain 2262 plasmid pTEM-2262, complete sequence	197205-197232	5	0.821
NC_017045_2	2.19\|1856729\|28\|NC_017045\|PILER-CR	1856729-1856756	28	NZ_CP041047	Citrobacter sp. CF971 plasmid pBM527-1, complete sequence	240752-240779	5	0.821
NC_017045_2	2.19\|1856729\|28\|NC_017045\|PILER-CR	1856729-1856756	28	NZ_CP042535	Citrobacter freundii strain E51 plasmid pE51_001, complete sequence	18708-18735	5	0.821
NC_017045_2	2.19\|1856729\|28\|NC_017045\|PILER-CR	1856729-1856756	28	NZ_CP026058	Citrobacter freundii strain FDAARGOS_73 plasmid unnamed2, complete sequence	162007-162034	5	0.821
NC_017045_2	2.19\|1856729\|28\|NC_017045\|PILER-CR	1856729-1856756	28	NZ_CP029436	Klebsiella quasipneumoniae strain CAV2013 plasmid pKPC_CAV2013, complete sequence	196707-196734	5	0.821
NC_017045_2	2.19\|1856729\|28\|NC_017045\|PILER-CR	1856729-1856756	28	NZ_CP029431	Klebsiella quasipneumoniae strain CAV2018 plasmid pKPC_CAV2018-435, complete sequence	317362-317389	5	0.821
NC_017045_2	2.19\|1856729\|28\|NC_017045\|PILER-CR	1856729-1856756	28	NZ_CP026234	Citrobacter freundii complex sp. CFNIH4 plasmid pCFR-4109, complete sequence	129537-129564	5	0.821
NC_017045_2	2.19\|1856729\|28\|NC_017045\|PILER-CR	1856729-1856756	28	NZ_CP018017	Kosakonia radicincitans DSM 16656 plasmid pKrDSM16656L, complete sequence	42458-42485	5	0.821
NC_017045_2	2.19\|1856729\|28\|NC_017045\|PILER-CR	1856729-1856756	28	NZ_CP029442	Klebsiella quasipneumoniae strain CAV1947 plasmid pKPC_CAV1947-412, complete sequence	288561-288588	5	0.821
NC_017045_1	1.7\|1020921\|30\|NC_017045\|CRISPRCasFinder	1020921-1020950	30	KT351734	Pectobacterium carotovorum plasmid Drgb3, complete sequence	99436-99465	6	0.8
NC_017045_1	1.19\|1020922\|30\|NC_017045\|PILER-CR	1020922-1020951	30	KT351734	Pectobacterium carotovorum plasmid Drgb3, complete sequence	99436-99465	6	0.8
NC_017045_2	2.6\|1856000\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856000-1856029	30	MK817115	Escherichia phage vB_EcoM_phAPEC6, complete genome	38044-38073	6	0.8
NC_017045_2	2.6\|1856000\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856000-1856029	30	NC_027364	Escherichia phage PBECO 4, complete genome	192931-192960	6	0.8
NC_017045_2	2.6\|1856000\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856000-1856029	30	MH383160	Escherichia phage UB, complete genome	257225-257254	6	0.8
NC_017045_2	2.6\|1856000\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856000-1856029	30	MK327931	Escherichia phage vB_EcoM_G17, complete genome	63029-63058	6	0.8
NC_017045_2	2.6\|1856000\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856000-1856029	30	LC494302	Escherichia phage SP27 DNA, complete genome	91521-91550	6	0.8
NC_017045_2	2.6\|1856000\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856000-1856029	30	LT603033	Escherichia phage vB_Eco_slurp01 genome assembly, chromosome: I	32026-32055	6	0.8
NC_017045_2	2.6\|1856000\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856000-1856029	30	KM507819	Escherichia phage 121Q, complete genome	92863-92892	6	0.8
NC_017045_2	2.7\|1856066\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856066-1856095	30	MH937471	Streptococcus phage CHPC927, complete genome	35219-35248	6	0.8
NC_017045_2	2.7\|1856066\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856066-1856095	30	MG708275	Streptococcus phage vB_SthS_VA460, complete genome	12153-12182	6	0.8
NC_017045_2	2.7\|1856066\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856066-1856095	30	KY065505	Streptococcus phage IPP69, complete genome	15201-15230	6	0.8
NC_017045_2	2.7\|1856066\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856066-1856095	30	KY065454	Streptococcus phage IPP12, complete genome	11268-11297	6	0.8
NC_017045_2	2.7\|1856066\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856066-1856095	30	KY065465	Streptococcus phage IPP24, complete genome	12742-12771	6	0.8
NC_017045_2	2.7\|1856066\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856066-1856095	30	KY065486	Streptococcus phage IPP46, complete genome	13941-13970	6	0.8
NC_017045_2	2.7\|1856066\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856066-1856095	30	MK448881	Streptococcus phage Javan240, complete genome	7844-7873	6	0.8
NC_017045_2	2.7\|1856066\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856066-1856095	30	KT337360	Streptococcus phage phiARI0578, partial genome	16817-16846	6	0.8
NC_017045_2	2.7\|1856066\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856066-1856095	30	KT337367	Streptococcus phage phiARI0826b, partial genome	18804-18833	6	0.8
NC_017045_2	2.7\|1856066\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856066-1856095	30	KT337359	Streptococcus phage phiARI0468b-3, partial genome	17235-17264	6	0.8
NC_017045_2	2.7\|1856066\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856066-1856095	30	KT337341	Streptococcus phage phiARI0131-1, complete genome	30228-30257	6	0.8
NC_017045_2	2.7\|1856066\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856066-1856095	30	NC_031929	Streptococcus phage phiARI0468-1, complete genome	24763-24792	6	0.8
NC_017045_2	2.7\|1856066\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856066-1856095	30	KT337345	Streptococcus phage phiARI0285-1, partial genome	19458-19487	6	0.8
NC_017045_2	2.7\|1856066\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856066-1856095	30	NC_024370	Streptococcus phage IC1, complete sequence	25729-25758	6	0.8
NC_017045_2	2.7\|1856066\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856066-1856095	30	KT337349	Streptococcus phage phiARI0399, partial genome	25346-25375	6	0.8
NC_017045_2	2.7\|1856066\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856066-1856095	30	NC_031920	Streptococcus phage phiARI0004, complete genome	25671-25700	6	0.8
NC_017045_2	2.7\|1856066\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856066-1856095	30	FR671411	Streptococcus phage 2167	22248-22277	6	0.8
NC_017045_2	2.7\|1856066\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856066-1856095	30	KT337356	Streptococcus phage phiARI0468-2, complete genome	25037-25066	6	0.8
NC_017045_2	2.7\|1856066\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856066-1856095	30	KT337340	Streptococcus phage phiARI0031, complete genome	26411-26440	6	0.8
NC_017045_2	2.13\|1856462\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856462-1856491	30	NZ_CP049229	Lactobacillus iners strain C0210C1 plasmid pC0210C1, complete sequence	84267-84296	6	0.8
NC_017045_2	2.13\|1856462\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856462-1856491	30	NZ_CP049227	Lactobacillus iners strain C0011D1 plasmid pC0011D1, complete sequence	93022-93051	6	0.8
NC_017045_2	2.13\|1856462\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856462-1856491	30	NZ_CP049224	Lactobacillus iners strain C0094A1 plasmid pC0094A1, complete sequence	7282-7311	6	0.8
NC_017045_2	2.15\|1856594\|30\|NC_017045\|CRISPRCasFinder,CRT	1856594-1856623	30	NZ_CP045341	Vibrio sp. THAF190c plasmid pTHAF190c_c, complete sequence	148461-148490	6	0.8
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NC_002102	Lactobacillus helveticus DSM 20075 plasmid pLH1, complete sequence	17236-17265	6	0.8
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_AP018048	Photobacterium damselae subsp. piscicida strain 91-197 plasmid p91-197-2	16536-16565	6	0.8
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	CP008939	Candidatus Caedibacter acanthamoebae plasmid Plasmid_00003, complete sequence	48454-48480	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_CP020577	Acinetobacter baumannii strain SSA12 plasmid pSSA12_1, complete sequence	16068-16094	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_CP039703	Clostridium butyricum strain 29-1 plasmid p-butyl_plas_29-1, complete sequence	482659-482685	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_CP012008	Acinetobacter baumannii strain Ab04-mff plasmid pAB04-2, complete sequence	38961-38987	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	CP033518	Acinetobacter baumannii strain 2008S11-069 plasmid p2008S11-069-2, complete sequence	64518-64544	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_CP032741	Acinetobacter baumannii strain C25 plasmid unnamed1	4488-4514	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_CP032742	Acinetobacter baumannii strain C25 plasmid unnamed2	27137-27163	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_CP033857	Acinetobacter sp. FDAARGOS_493 plasmid unnamed1, complete sequence	11902-11928	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_CP008851	Acinetobacter baumannii strain AC29 plasmid pAC29b, complete sequence	56627-56653	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_CP023033	Acinetobacter baumannii strain 7847 plasmid pAba7847b, complete sequence	3317-3343	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	CP014292	Acinetobacter baumannii strain AB34299 plasmid unnamed1, complete sequence	41440-41466	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_CP027121	Acinetobacter baumannii strain AR_0056 plasmid unnamed2, complete sequence	53039-53065	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_CP015497	Lactobacillus helveticus strain FAM8105 plasmid pFAM8105, complete sequence	9755-9781	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_CP020580	Acinetobacter baumannii strain SSMA17 plasmid pSSMA17_1, complete sequence	16669-16695	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_CP015366	Acinetobacter baumannii strain 3207 plasmid pAba3207b, complete sequence	3317-3343	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_CP017645	Acinetobacter baumannii strain KAB02 plasmid unnamed, complete sequence	30191-30217	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_CP020573	Acinetobacter baumannii strain 15A5 plasmid p15A5_1, complete sequence	16718-16744	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_CP012891	Lactobacillus gallinarum strain HFD4 plasmid pMKG01, complete sequence	3156-3182	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_CP012891	Lactobacillus gallinarum strain HFD4 plasmid pMKG01, complete sequence	7584-7610	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_CP012891	Lactobacillus gallinarum strain HFD4 plasmid pMKG01, complete sequence	12011-12037	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_CP020582	Acinetobacter baumannii strain JBA13 plasmid pJBA13_1, complete sequence	68491-68517	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_CP026712	Acinetobacter baumannii strain AR_0063 plasmid unitig_2_pilon, complete sequence	62581-62607	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_CP017647	Acinetobacter baumannii strain KAB03 plasmid unnamed, complete sequence	56978-57004	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_CP026706	Acinetobacter baumannii strain AR_0056 plasmid tig00000059_pilon, complete sequence	18736-18762	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_CP033245	Acinetobacter baumannii strain 7835 plasmid pAba7835b, complete sequence	3316-3342	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_CP021787	Acinetobacter baumannii strain A85 plasmid pA85-3, complete sequence	56550-56576	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_MG954379	Acinetobacter baumannii strain SGH0905 plasmid pS32-2, complete sequence	41048-41074	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_CP023028	Acinetobacter baumannii strain 10042 plasmid pAba10042b, complete sequence	55663-55689	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_CP027243	Acinetobacter baumannii strain WCHAB005078 plasmid p1_005078, complete sequence	39310-39336	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_KY022424	Acinetobacter baumannii strain Ab8098 plasmid pAb8098, complete sequence	78880-78906	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_CP035052	Acinetobacter baumannii strain ABUH763 plasmid p74.1Kbp, complete sequence	41075-41101	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_CP017657	Acinetobacter baumannii strain KAB08 plasmid unnamed, complete sequence	4027-4053	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NC_025111	Acinetobacter baumannii strain D72 plasmid pD72-2, complete sequence	40162-40188	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_KF889012	Acinetobacter baumannii TYTH-1 plasmid pAB_CC, complete sequence	26989-27015	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NC_025109	Acinetobacter baumannii strain A85 plasmid pA85-3 clone GC1 AbaR4 resistance island, complete sequence	56551-56577	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_CP016302	Acinetobacter baumannii strain CMC-CR-MDR-Ab66 plasmid pCMCVTAb2-Ab66, complete sequence	7702-7728	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_CP016297	Acinetobacter baumannii strain CMC-CR-MDR-Ab4 plasmid pCMCVTAb2-Ab4, complete sequence	7702-7728	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NC_017163	Acinetobacter baumannii 1656-2 plasmid ABKp1, complete sequence	17795-17821	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_CP050392	Acinetobacter baumannii strain VB11737 plasmid pVB11737_1, complete sequence	37085-37111	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_CP050413	Acinetobacter baumannii strain PM192696 plasmid pPM192696_1, complete sequence	37083-37109	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_CP017649	Acinetobacter baumannii strain KAB04 plasmid unnamed, complete sequence	6160-6186	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_CP017649	Acinetobacter baumannii strain KAB04 plasmid unnamed, complete sequence	108484-108510	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_CP050404	Acinetobacter baumannii strain VB2486 plasmid pVB2486_1, complete sequence	47760-47786	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_LT984690	Acinetobacter baumannii isolate K50 plasmid I, complete sequence	48568-48594	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_CP029571	Acinetobacter baumannii strain DA33098 plasmid pDA33098-71, complete sequence	40637-40663	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_CP039994	Acinetobacter baumannii strain TG22182 plasmid pTG22182_1, complete sequence	39746-39772	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_CP014216	Acinetobacter baumannii strain YU-R612 plasmid unnamed1, complete sequence	23199-23225	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_CP017655	Acinetobacter baumannii strain KAB07 plasmid pKAB07, complete sequence	68610-68636	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_CP023030	Acinetobacter baumannii strain 9102 plasmid pAba9102a, complete sequence	59509-59535	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_CP050915	Acinetobacter baumannii strain DT-Ab007 plasmid unnamed1, complete sequence	62236-62262	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_CP050909	Acinetobacter baumannii strain DT-Ab022 plasmid unnamed2, complete sequence	41404-41430	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_CP008707	Acinetobacter baumannii strain AB5075-UW plasmid p1AB5075, complete sequence	50595-50621	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_CP017643	Acinetobacter baumannii strain KAB01 plasmid unnamed, complete sequence	59545-59571	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_CP030109	Acinetobacter baumannii strain DA33382 plasmid pDA33382-85, complete sequence	10945-10971	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_CP017651	Acinetobacter baumannii strain KAB05 plasmid unnamed, complete sequence	15332-15358	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_CP020589	Acinetobacter baumannii strain 15A34 plasmid p15A34_1, complete sequence	62079-62105	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NC_010606	Acinetobacter baumannii ACICU plasmid pACICU2, complete sequence	33184-33210	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_CP042842	Acinetobacter baumannii strain ATCC BAA-1790 plasmid unnamed, complete sequence	62407-62433	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	CP007580	Acinetobacter baumannii AC30 plasmid pAC30c, complete sequence	14895-14921	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_CP019115	Acinetobacter baumannii strain MDR-CQ plasmid pMDR-CQ, complete sequence	11282-11308	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_KU549175	Acinetobacter baumannii strain C13 plasmid pC13-2 clone GC2, complete sequence	37085-37111	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_KX230794	Acinetobacter baumannii strain MAL plasmid pMAL-2, complete sequence	37085-37111	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_CP025267	Acinetobacter baumannii isolate SMC_Paed_Ab_BL01 plasmid pSMC_AB_BL01_1, complete sequence	57142-57168	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_CP020593	Acinetobacter baumannii strain USA2 plasmid pUSA2_1, complete sequence	35144-35170	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_CP020594	Acinetobacter baumannii strain USA15 plasmid pUSA15_1, complete sequence	75721-75747	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_KR535992	Acinetobacter baumannii strain A105 plasmid pA105-1, complete sequence	40158-40184	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	CP002524	Acinetobacter baumannii TCDC-AB0715 plasmid p2ABTCDC0715, complete sequence	524-550	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_KM977710	Acinetobacter baumannii strain D46 plasmid pD46-3, complete sequence	44976-45002	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_CP017653	Acinetobacter baumannii strain KAB06 plasmid unnamed, complete sequence	35717-35743	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_KF669606	Acinetobacter baumannii strain G7 plasmid pAb-G7-2 clone GC1 (global clone 1), complete sequence	37085-37111	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_MK386681	Acinetobacter baumannii strain ABAY09008 plasmid pABAY09008_1B, complete sequence	41722-41748	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_CP024578	Acinetobacter baumannii strain AbPK1 plasmid pAbPK1b, complete sequence	45222-45248	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_MK243454	Acinetobacter baumannii strain 09A16CRGN0014 plasmid pCRA914-67, complete sequence	37086-37112	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_CP019218	Acinetobacter baumannii strain XH731 plasmid pXH731, complete sequence	4789-4815	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_CP021438	Bacillus thuringiensis strain C15 plasmid pBMB172, complete sequence	9571-9597	6	0.778
NC_017045_2	2.18\|1856663\|27\|NC_017045\|PILER-CR	1856663-1856689	27	NZ_CP035047	Acinetobacter baumannii strain ABUH793 plasmid p74.1Kbp, complete sequence	41075-41101	6	0.778
NC_017045_1	1.2\|1020536\|30\|NC_017045\|CRISPRCasFinder	1020536-1020565	30	NC_014633	Ilyobacter polytropus DSM 2926 plasmid pILYOP01, complete sequence	86401-86430	7	0.767
NC_017045_1	1.4\|1020690\|30\|NC_017045\|CRISPRCasFinder	1020690-1020719	30	NZ_CP053208	Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1B, complete sequence	118538-118567	7	0.767
NC_017045_1	1.5\|1020767\|30\|NC_017045\|CRISPRCasFinder	1020767-1020796	30	MK542648	Poxviridae sp. strain 1000-15 DNA polymerase gene, partial cds	946-975	7	0.767
NC_017045_1	1.5\|1020767\|30\|NC_017045\|CRISPRCasFinder	1020767-1020796	30	MK542650	Poxviridae sp. strain 1000-15 DNA polymerase gene, complete cds	1738-1767	7	0.767
NC_017045_1	1.10\|1021152\|30\|NC_017045\|CRISPRCasFinder	1021152-1021181	30	MG557979	Lactobacillus phage Lpa804, complete genome	71292-71321	7	0.767
NC_017045_1	1.10\|1021152\|30\|NC_017045\|CRISPRCasFinder	1021152-1021181	30	NZ_MF133442	Klebsiella pneumoniae strain 11219 plasmid p11219-CTXM, complete sequence	113447-113476	7	0.767
NC_017045_1	1.10\|1021152\|30\|NC_017045\|CRISPRCasFinder	1021152-1021181	30	NZ_CP044034	Klebsiella pneumoniae strain FDAARGOS_631 plasmid unnamed2, complete sequence	13432-13461	7	0.767
NC_017045_1	1.10\|1021152\|30\|NC_017045\|CRISPRCasFinder	1021152-1021181	30	NC_025170	Acinetobacter sp. M131 plasmid pM131-7, complete sequence	4617-4646	7	0.767
NC_017045_1	1.10\|1021152\|30\|NC_017045\|CRISPRCasFinder	1021152-1021181	30	NZ_CP036194	Klebsiella pneumoniae strain BA34918 plasmid pIncFIB, complete sequence	52074-52103	7	0.767
NC_017045_1	1.10\|1021152\|30\|NC_017045\|CRISPRCasFinder	1021152-1021181	30	NZ_CP027045	Klebsiella pneumoniae strain 1_GR_13 plasmid IncFIB, complete sequence	17531-17560	7	0.767
NC_017045_1	1.10\|1021152\|30\|NC_017045\|CRISPRCasFinder	1021152-1021181	30	NZ_CP046951	Klebsiella pneumoniae strain BD_DM_914 plasmid punnamed2, complete sequence	141513-141542	7	0.767
NC_017045_1	1.10\|1021152\|30\|NC_017045\|CRISPRCasFinder	1021152-1021181	30	NZ_CP046941	Klebsiella pneumoniae strain BD_DM_697 plasmid punnamed2	141486-141515	7	0.767
NC_017045_1	1.10\|1021152\|30\|NC_017045\|CRISPRCasFinder	1021152-1021181	30	NZ_CP020063	Klebsiella pneumoniae strain AR_0117 plasmid unitig_2, complete sequence	10590-10619	7	0.767
NC_017045_1	1.10\|1021152\|30\|NC_017045\|CRISPRCasFinder	1021152-1021181	30	NZ_CP035909	Klebsiella pneumoniae strain BA4656 plasmid unnamed2, complete sequence	100217-100246	7	0.767
NC_017045_1	1.10\|1021152\|30\|NC_017045\|CRISPRCasFinder	1021152-1021181	30	NZ_CP046383	Klebsiella pneumoniae strain BD_DM_782 plasmid punnamed2, complete sequence	141494-141523	7	0.767
NC_017045_1	1.10\|1021152\|30\|NC_017045\|CRISPRCasFinder	1021152-1021181	30	NZ_CP015755	Klebsiella pneumoniae strain W14 plasmid unnamed2, complete sequence	4193-4222	7	0.767
NC_017045_1	1.10\|1021152\|30\|NC_017045\|CRISPRCasFinder	1021152-1021181	30	NZ_CP044370	Klebsiella pneumoniae strain 2018C01-046 plasmid p2018C01-046-2, complete sequence	26435-26464	7	0.767
NC_017045_1	1.10\|1021152\|30\|NC_017045\|CRISPRCasFinder	1021152-1021181	30	NZ_CP016161	Klebsiella pneumoniae strain TH1 isolate TH1 plasmid unnamed2, complete sequence	16883-16912	7	0.767
NC_017045_1	1.10\|1021152\|30\|NC_017045\|CRISPRCasFinder	1021152-1021181	30	NZ_CP044046	Klebsiella pneumoniae strain FDAARGOS_629 plasmid unnamed4, complete sequence	48687-48716	7	0.767
NC_017045_1	1.10\|1021152\|30\|NC_017045\|CRISPRCasFinder	1021152-1021181	30	NZ_CP032225	Klebsiella pneumoniae strain AR_0046 plasmid unnamed3, complete sequence	15370-15399	7	0.767
NC_017045_1	1.10\|1021152\|30\|NC_017045\|CRISPRCasFinder	1021152-1021181	30	NZ_MF144193	Klebsiella pneumoniae strain 205880 plasmid p205880-NR1, complete sequence	99403-99432	7	0.767
NC_017045_1	1.10\|1021152\|30\|NC_017045\|CRISPRCasFinder	1021152-1021181	30	KT070867	Bacillus phage PBC2, complete genome	132033-132062	7	0.767
NC_017045_1	1.11\|1021229\|30\|NC_017045\|CRISPRCasFinder	1021229-1021258	30	MN552143	Lactococcus phage P1046, complete genome	19253-19282	7	0.767
NC_017045_1	1.11\|1021229\|30\|NC_017045\|CRISPRCasFinder	1021229-1021258	30	MK779875	Lactococcus phage CHPC971, complete genome	20218-20247	7	0.767
NC_017045_1	1.14\|1020537\|30\|NC_017045\|PILER-CR	1020537-1020566	30	NC_014633	Ilyobacter polytropus DSM 2926 plasmid pILYOP01, complete sequence	86401-86430	7	0.767
NC_017045_1	1.16\|1020691\|30\|NC_017045\|PILER-CR	1020691-1020720	30	NZ_CP053208	Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1B, complete sequence	118538-118567	7	0.767
NC_017045_1	1.17\|1020768\|30\|NC_017045\|PILER-CR	1020768-1020797	30	MK542648	Poxviridae sp. strain 1000-15 DNA polymerase gene, partial cds	946-975	7	0.767
NC_017045_1	1.17\|1020768\|30\|NC_017045\|PILER-CR	1020768-1020797	30	MK542650	Poxviridae sp. strain 1000-15 DNA polymerase gene, complete cds	1738-1767	7	0.767
NC_017045_1	1.22\|1021153\|30\|NC_017045\|PILER-CR	1021153-1021182	30	MG557979	Lactobacillus phage Lpa804, complete genome	71292-71321	7	0.767
NC_017045_1	1.22\|1021153\|30\|NC_017045\|PILER-CR	1021153-1021182	30	NZ_MF133442	Klebsiella pneumoniae strain 11219 plasmid p11219-CTXM, complete sequence	113447-113476	7	0.767
NC_017045_1	1.22\|1021153\|30\|NC_017045\|PILER-CR	1021153-1021182	30	NZ_CP044034	Klebsiella pneumoniae strain FDAARGOS_631 plasmid unnamed2, complete sequence	13432-13461	7	0.767
NC_017045_1	1.22\|1021153\|30\|NC_017045\|PILER-CR	1021153-1021182	30	NC_025170	Acinetobacter sp. M131 plasmid pM131-7, complete sequence	4617-4646	7	0.767
NC_017045_1	1.22\|1021153\|30\|NC_017045\|PILER-CR	1021153-1021182	30	NZ_CP036194	Klebsiella pneumoniae strain BA34918 plasmid pIncFIB, complete sequence	52074-52103	7	0.767
NC_017045_1	1.22\|1021153\|30\|NC_017045\|PILER-CR	1021153-1021182	30	NZ_CP027045	Klebsiella pneumoniae strain 1_GR_13 plasmid IncFIB, complete sequence	17531-17560	7	0.767
NC_017045_1	1.22\|1021153\|30\|NC_017045\|PILER-CR	1021153-1021182	30	NZ_CP046951	Klebsiella pneumoniae strain BD_DM_914 plasmid punnamed2, complete sequence	141513-141542	7	0.767
NC_017045_1	1.22\|1021153\|30\|NC_017045\|PILER-CR	1021153-1021182	30	NZ_CP046941	Klebsiella pneumoniae strain BD_DM_697 plasmid punnamed2	141486-141515	7	0.767
NC_017045_1	1.22\|1021153\|30\|NC_017045\|PILER-CR	1021153-1021182	30	NZ_CP020063	Klebsiella pneumoniae strain AR_0117 plasmid unitig_2, complete sequence	10590-10619	7	0.767
NC_017045_1	1.22\|1021153\|30\|NC_017045\|PILER-CR	1021153-1021182	30	NZ_CP035909	Klebsiella pneumoniae strain BA4656 plasmid unnamed2, complete sequence	100217-100246	7	0.767
NC_017045_1	1.22\|1021153\|30\|NC_017045\|PILER-CR	1021153-1021182	30	NZ_CP046383	Klebsiella pneumoniae strain BD_DM_782 plasmid punnamed2, complete sequence	141494-141523	7	0.767
NC_017045_1	1.22\|1021153\|30\|NC_017045\|PILER-CR	1021153-1021182	30	NZ_CP015755	Klebsiella pneumoniae strain W14 plasmid unnamed2, complete sequence	4193-4222	7	0.767
NC_017045_1	1.22\|1021153\|30\|NC_017045\|PILER-CR	1021153-1021182	30	NZ_CP044370	Klebsiella pneumoniae strain 2018C01-046 plasmid p2018C01-046-2, complete sequence	26435-26464	7	0.767
NC_017045_1	1.22\|1021153\|30\|NC_017045\|PILER-CR	1021153-1021182	30	NZ_CP016161	Klebsiella pneumoniae strain TH1 isolate TH1 plasmid unnamed2, complete sequence	16883-16912	7	0.767
NC_017045_1	1.22\|1021153\|30\|NC_017045\|PILER-CR	1021153-1021182	30	NZ_CP044046	Klebsiella pneumoniae strain FDAARGOS_629 plasmid unnamed4, complete sequence	48687-48716	7	0.767
NC_017045_1	1.22\|1021153\|30\|NC_017045\|PILER-CR	1021153-1021182	30	NZ_CP032225	Klebsiella pneumoniae strain AR_0046 plasmid unnamed3, complete sequence	15370-15399	7	0.767
NC_017045_1	1.22\|1021153\|30\|NC_017045\|PILER-CR	1021153-1021182	30	NZ_MF144193	Klebsiella pneumoniae strain 205880 plasmid p205880-NR1, complete sequence	99403-99432	7	0.767
NC_017045_1	1.22\|1021153\|30\|NC_017045\|PILER-CR	1021153-1021182	30	KT070867	Bacillus phage PBC2, complete genome	132033-132062	7	0.767
NC_017045_1	1.23\|1021230\|30\|NC_017045\|PILER-CR	1021230-1021259	30	MN552143	Lactococcus phage P1046, complete genome	19253-19282	7	0.767
NC_017045_1	1.23\|1021230\|30\|NC_017045\|PILER-CR	1021230-1021259	30	MK779875	Lactococcus phage CHPC971, complete genome	20218-20247	7	0.767
NC_017045_2	2.5\|1855934\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1855934-1855963	30	NZ_CP045829	Escherichia coli strain AUSMDU00014361 plasmid pAUSMDU00014361_02, complete sequence	35738-35767	7	0.767
NC_017045_2	2.5\|1855934\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1855934-1855963	30	NZ_CP021340	Escherichia coli strain 95NR1 plasmid p95NR1A, complete sequence	61186-61215	7	0.767
NC_017045_2	2.5\|1855934\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1855934-1855963	30	NZ_CP021336	Escherichia coli strain 95JB1 plasmid p95JB1A, complete sequence	61187-61216	7	0.767
NC_017045_2	2.5\|1855934\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1855934-1855963	30	NZ_CP038378	Escherichia coli O157:H7 strain F1273 plasmid pF1273-3, complete sequence	17493-17522	7	0.767
NC_017045_2	2.5\|1855934\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1855934-1855963	30	NZ_CP027443	Escherichia coli strain 2013C-3252 plasmid unnamed1, complete sequence	45345-45374	7	0.767
NC_017045_2	2.5\|1855934\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1855934-1855963	30	NZ_AP018809	Escherichia coli strain E2865 plasmid pE2865-1, complete sequence	29885-29914	7	0.767
NC_017045_2	2.5\|1855934\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1855934-1855963	30	NZ_CP027223	Escherichia coli strain 2015C-3101 plasmid unnamed2	5159-5188	7	0.767
NC_017045_2	2.5\|1855934\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1855934-1855963	30	NZ_CP027590	Escherichia coli strain 2014C-3011 plasmid unnamed2	5621-5650	7	0.767
NC_017045_2	2.5\|1855934\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1855934-1855963	30	NZ_CP013030	Escherichia coli strain 2012C-4227 plasmid unnamed2, complete sequence	14966-14995	7	0.767
NC_017045_2	2.5\|1855934\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1855934-1855963	30	NZ_CP028125	Escherichia coli O26 str. RM10386 plasmid pRM10386-1, complete sequence	76614-76643	7	0.767
NC_017045_2	2.5\|1855934\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1855934-1855963	30	NZ_AP018798	Escherichia coli strain E2855 plasmid pE2855-2, complete sequence	26791-26820	7	0.767
NC_017045_2	2.5\|1855934\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1855934-1855963	30	NC_013370	Escherichia coli O111:H- str. 11128 plasmid pO111_2, complete sequence	28399-28428	7	0.767
NC_017045_2	2.5\|1855934\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1855934-1855963	30	NZ_CP038288	Escherichia coli O157:H7 strain TX 376-2 plasmid pTX376-2, complete sequence	27850-27879	7	0.767
NC_017045_2	2.5\|1855934\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1855934-1855963	30	MH160767	Escherichia phage vB_EcoM-Ro157c2YLVW, complete genome	27333-27362	7	0.767
NC_017045_2	2.5\|1855934\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1855934-1855963	30	HQ316603	Cyanophage S-SSM6b genomic sequence	18864-18893	7	0.767
NC_017045_2	2.5\|1855934\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1855934-1855963	30	NC_020875	Cyanophage S-SSM4 genomic sequence	63369-63398	7	0.767
NC_017045_2	2.6\|1856000\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856000-1856029	30	GU580940	Rhodococcus phage ReqiDocB7, complete genome	56759-56788	7	0.767
NC_017045_2	2.6\|1856000\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856000-1856029	30	MN694027	Marine virus AFVG_250M455, complete genome	50636-50665	7	0.767
NC_017045_2	2.6\|1856000\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856000-1856029	30	MN694007	Marine virus AFVG_250M456, complete genome	993-1022	7	0.767
NC_017045_2	2.6\|1856000\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856000-1856029	30	NC_030920	Bacillus phage Eldridge, complete genome	27720-27749	7	0.767
NC_017045_2	2.6\|1856000\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856000-1856029	30	AP014376	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S42-C64, * SEQUENCING IN PROGRESS *	10054-10083	7	0.767
NC_017045_2	2.7\|1856066\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856066-1856095	30	NC_029029	Brevibacillus phage Abouo, complete genome	37249-37278	7	0.767
NC_017045_2	2.7\|1856066\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856066-1856095	30	NC_029006	Clostridium phage phiCT19406C, complete genome	11385-11414	7	0.767
NC_017045_2	2.7\|1856066\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856066-1856095	30	MH341451	Listeria phage PSU-VKH-LP019, complete genome	33515-33544	7	0.767
NC_017045_2	2.7\|1856066\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856066-1856095	30	MH937509	Streptococcus phage CHPC1230, complete genome	37664-37693	7	0.767
NC_017045_2	2.7\|1856066\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856066-1856095	30	KC348600	Streptococcus phage phi5218, complete genome	25300-25329	7	0.767
NC_017045_2	2.12\|1856396\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856396-1856425	30	MK448708	Streptococcus phage Javan23, complete genome	815-844	7	0.767
NC_017045_2	2.12\|1856396\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856396-1856425	30	MK448897	Streptococcus phage Javan28, complete genome	815-844	7	0.767
NC_017045_2	2.14\|1856528\|30\|NC_017045\|CRISPRCasFinder,CRT	1856528-1856557	30	NZ_CP031095	Clostridium botulinum strain CFSAN034200 plasmid p1_CDC51232, complete sequence	235696-235725	7	0.767
NC_017045_2	2.14\|1856528\|30\|NC_017045\|CRISPRCasFinder,CRT	1856528-1856557	30	LT960608	Bacillus phage SBSphiJ genome assembly, complete genome: monopartite	151662-151691	7	0.767
NC_017045_2	2.14\|1856528\|30\|NC_017045\|CRISPRCasFinder,CRT	1856528-1856557	30	NC_012654	Clostridium botulinum Ba4 str. 657 plasmid pCLJ, complete sequence	146458-146487	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	CP008939	Candidatus Caedibacter acanthamoebae plasmid Plasmid_00003, complete sequence	48451-48480	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_CP021787	Acinetobacter baumannii strain A85 plasmid pA85-3, complete sequence	56550-56579	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_MG954379	Acinetobacter baumannii strain SGH0905 plasmid pS32-2, complete sequence	41048-41077	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_CP023028	Acinetobacter baumannii strain 10042 plasmid pAba10042b, complete sequence	55663-55692	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_CP027243	Acinetobacter baumannii strain WCHAB005078 plasmid p1_005078, complete sequence	39310-39339	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_KY022424	Acinetobacter baumannii strain Ab8098 plasmid pAb8098, complete sequence	78880-78909	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_CP035052	Acinetobacter baumannii strain ABUH763 plasmid p74.1Kbp, complete sequence	41075-41104	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_CP017657	Acinetobacter baumannii strain KAB08 plasmid unnamed, complete sequence	4027-4056	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NC_025111	Acinetobacter baumannii strain D72 plasmid pD72-2, complete sequence	40162-40191	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_KF889012	Acinetobacter baumannii TYTH-1 plasmid pAB_CC, complete sequence	26989-27018	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NC_025109	Acinetobacter baumannii strain A85 plasmid pA85-3 clone GC1 AbaR4 resistance island, complete sequence	56551-56580	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_CP016302	Acinetobacter baumannii strain CMC-CR-MDR-Ab66 plasmid pCMCVTAb2-Ab66, complete sequence	7702-7731	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_CP016297	Acinetobacter baumannii strain CMC-CR-MDR-Ab4 plasmid pCMCVTAb2-Ab4, complete sequence	7702-7731	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NC_017163	Acinetobacter baumannii 1656-2 plasmid ABKp1, complete sequence	17795-17824	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_CP050392	Acinetobacter baumannii strain VB11737 plasmid pVB11737_1, complete sequence	37085-37114	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_CP050413	Acinetobacter baumannii strain PM192696 plasmid pPM192696_1, complete sequence	37083-37112	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_CP017649	Acinetobacter baumannii strain KAB04 plasmid unnamed, complete sequence	6160-6189	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_CP017649	Acinetobacter baumannii strain KAB04 plasmid unnamed, complete sequence	108484-108513	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_CP050404	Acinetobacter baumannii strain VB2486 plasmid pVB2486_1, complete sequence	47760-47789	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_LT984690	Acinetobacter baumannii isolate K50 plasmid I, complete sequence	48568-48597	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_CP029571	Acinetobacter baumannii strain DA33098 plasmid pDA33098-71, complete sequence	40637-40666	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_CP039994	Acinetobacter baumannii strain TG22182 plasmid pTG22182_1, complete sequence	39746-39775	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_CP014216	Acinetobacter baumannii strain YU-R612 plasmid unnamed1, complete sequence	23199-23228	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_CP017655	Acinetobacter baumannii strain KAB07 plasmid pKAB07, complete sequence	68610-68639	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_CP023030	Acinetobacter baumannii strain 9102 plasmid pAba9102a, complete sequence	59509-59538	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_CP050915	Acinetobacter baumannii strain DT-Ab007 plasmid unnamed1, complete sequence	62236-62265	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_CP050909	Acinetobacter baumannii strain DT-Ab022 plasmid unnamed2, complete sequence	41404-41433	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_CP008707	Acinetobacter baumannii strain AB5075-UW plasmid p1AB5075, complete sequence	50595-50624	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_CP017643	Acinetobacter baumannii strain KAB01 plasmid unnamed, complete sequence	59545-59574	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_CP030109	Acinetobacter baumannii strain DA33382 plasmid pDA33382-85, complete sequence	10945-10974	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_CP017651	Acinetobacter baumannii strain KAB05 plasmid unnamed, complete sequence	15332-15361	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_CP020589	Acinetobacter baumannii strain 15A34 plasmid p15A34_1, complete sequence	62079-62108	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NC_010606	Acinetobacter baumannii ACICU plasmid pACICU2, complete sequence	33184-33213	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_CP042842	Acinetobacter baumannii strain ATCC BAA-1790 plasmid unnamed, complete sequence	62407-62436	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	CP007580	Acinetobacter baumannii AC30 plasmid pAC30c, complete sequence	14895-14924	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_CP019115	Acinetobacter baumannii strain MDR-CQ plasmid pMDR-CQ, complete sequence	11282-11311	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_KU549175	Acinetobacter baumannii strain C13 plasmid pC13-2 clone GC2, complete sequence	37085-37114	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_KX230794	Acinetobacter baumannii strain MAL plasmid pMAL-2, complete sequence	37085-37114	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_CP025267	Acinetobacter baumannii isolate SMC_Paed_Ab_BL01 plasmid pSMC_AB_BL01_1, complete sequence	57142-57171	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_CP020593	Acinetobacter baumannii strain USA2 plasmid pUSA2_1, complete sequence	35144-35173	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_CP020594	Acinetobacter baumannii strain USA15 plasmid pUSA15_1, complete sequence	75721-75750	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_KR535992	Acinetobacter baumannii strain A105 plasmid pA105-1, complete sequence	40158-40187	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	CP002524	Acinetobacter baumannii TCDC-AB0715 plasmid p2ABTCDC0715, complete sequence	524-553	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_KM977710	Acinetobacter baumannii strain D46 plasmid pD46-3, complete sequence	44976-45005	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_CP017653	Acinetobacter baumannii strain KAB06 plasmid unnamed, complete sequence	35717-35746	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_KF669606	Acinetobacter baumannii strain G7 plasmid pAb-G7-2 clone GC1 (global clone 1), complete sequence	37085-37114	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_MK386681	Acinetobacter baumannii strain ABAY09008 plasmid pABAY09008_1B, complete sequence	41722-41751	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_CP024578	Acinetobacter baumannii strain AbPK1 plasmid pAbPK1b, complete sequence	45222-45251	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_MK243454	Acinetobacter baumannii strain 09A16CRGN0014 plasmid pCRA914-67, complete sequence	37086-37115	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_CP019218	Acinetobacter baumannii strain XH731 plasmid pXH731, complete sequence	4789-4818	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_CP035047	Acinetobacter baumannii strain ABUH793 plasmid p74.1Kbp, complete sequence	41075-41104	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_CP020577	Acinetobacter baumannii strain SSA12 plasmid pSSA12_1, complete sequence	16065-16094	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_CP012008	Acinetobacter baumannii strain Ab04-mff plasmid pAB04-2, complete sequence	38958-38987	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	CP033518	Acinetobacter baumannii strain 2008S11-069 plasmid p2008S11-069-2, complete sequence	64515-64544	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_CP032741	Acinetobacter baumannii strain C25 plasmid unnamed1	4485-4514	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_CP032742	Acinetobacter baumannii strain C25 plasmid unnamed2	27134-27163	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_CP033857	Acinetobacter sp. FDAARGOS_493 plasmid unnamed1, complete sequence	11899-11928	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_CP008851	Acinetobacter baumannii strain AC29 plasmid pAC29b, complete sequence	56624-56653	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_CP023033	Acinetobacter baumannii strain 7847 plasmid pAba7847b, complete sequence	3314-3343	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	CP014292	Acinetobacter baumannii strain AB34299 plasmid unnamed1, complete sequence	41437-41466	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_CP027121	Acinetobacter baumannii strain AR_0056 plasmid unnamed2, complete sequence	53036-53065	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_CP020580	Acinetobacter baumannii strain SSMA17 plasmid pSSMA17_1, complete sequence	16666-16695	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_CP015366	Acinetobacter baumannii strain 3207 plasmid pAba3207b, complete sequence	3314-3343	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_CP017645	Acinetobacter baumannii strain KAB02 plasmid unnamed, complete sequence	30188-30217	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_CP020573	Acinetobacter baumannii strain 15A5 plasmid p15A5_1, complete sequence	16715-16744	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_CP020582	Acinetobacter baumannii strain JBA13 plasmid pJBA13_1, complete sequence	68488-68517	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_CP026712	Acinetobacter baumannii strain AR_0063 plasmid unitig_2_pilon, complete sequence	62578-62607	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_CP017647	Acinetobacter baumannii strain KAB03 plasmid unnamed, complete sequence	56975-57004	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_CP026706	Acinetobacter baumannii strain AR_0056 plasmid tig00000059_pilon, complete sequence	18733-18762	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_CP033245	Acinetobacter baumannii strain 7835 plasmid pAba7835b, complete sequence	3313-3342	7	0.767
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	AP014361	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S40-C80, * SEQUENCING IN PROGRESS *	15907-15936	7	0.767
NC_017045_2	2.19\|1856729\|28\|NC_017045\|PILER-CR	1856729-1856756	28	NZ_CP033045	Bacillus foraminis strain Bac44 plasmid unnamed, complete sequence	111586-111613	7	0.75
NC_017045_1	1.3\|1020613\|30\|NC_017045\|CRISPRCasFinder	1020613-1020642	30	MN693807	Marine virus AFVG_250M375, complete genome	153-182	8	0.733
NC_017045_1	1.3\|1020613\|30\|NC_017045\|CRISPRCasFinder	1020613-1020642	30	MN693807	Marine virus AFVG_250M375, complete genome	59786-59815	8	0.733
NC_017045_1	1.7\|1020921\|30\|NC_017045\|CRISPRCasFinder	1020921-1020950	30	NZ_CP049914	Vibrio sp. HDW18 plasmid p_unnamed1, complete sequence	521683-521712	8	0.733
NC_017045_1	1.8\|1020998\|30\|NC_017045\|CRISPRCasFinder	1020998-1021027	30	NC_018980	Borrelia burgdorferi 297 plasmid 297_cp32-7, complete sequence	9342-9371	8	0.733
NC_017045_1	1.11\|1021229\|30\|NC_017045\|CRISPRCasFinder	1021229-1021258	30	MT446421	UNVERIFIED: Escherichia virus TH55, complete genome	67693-67722	8	0.733
NC_017045_1	1.11\|1021229\|30\|NC_017045\|CRISPRCasFinder	1021229-1021258	30	NC_028894	Enterobacteria phage vB_EcoM_VR20, complete genome	8308-8337	8	0.733
NC_017045_1	1.11\|1021229\|30\|NC_017045\|CRISPRCasFinder	1021229-1021258	30	MT446420	UNVERIFIED: Escherichia virus TH54, complete genome	67336-67365	8	0.733
NC_017045_1	1.11\|1021229\|30\|NC_017045\|CRISPRCasFinder	1021229-1021258	30	MT446412	UNVERIFIED: Escherichia virus TH41, complete genome	131052-131081	8	0.733
NC_017045_1	1.11\|1021229\|30\|NC_017045\|CRISPRCasFinder	1021229-1021258	30	MT446422	UNVERIFIED: Escherichia virus TH57, complete genome	140221-140250	8	0.733
NC_017045_1	1.11\|1021229\|30\|NC_017045\|CRISPRCasFinder	1021229-1021258	30	MT446396	UNVERIFIED: Escherichia virus TH22, complete genome	150664-150693	8	0.733
NC_017045_1	1.12\|1021306\|30\|NC_017045\|CRISPRCasFinder	1021306-1021335	30	NZ_CP029365	Escherichia coli strain WCHEC035148 plasmid p1_035148, complete sequence	1176-1205	8	0.733
NC_017045_1	1.12\|1021306\|30\|NC_017045\|CRISPRCasFinder	1021306-1021335	30	MW067003	CrAssphage sp. C0531BW4, complete genome	68221-68250	8	0.733
NC_017045_1	1.12\|1021306\|30\|NC_017045\|CRISPRCasFinder	1021306-1021335	30	MK238400	CrAssphage ZA, complete genome	65498-65527	8	0.733
NC_017045_1	1.12\|1021306\|30\|NC_017045\|CRISPRCasFinder	1021306-1021335	30	MK069403	UNVERIFIED: CrAssphage sp. O-152, partial genome	54269-54298	8	0.733
NC_017045_1	1.12\|1021306\|30\|NC_017045\|CRISPRCasFinder	1021306-1021335	30	MT006214	CrAssphage LMMB, complete genome	67057-67086	8	0.733
NC_017045_1	1.15\|1020614\|30\|NC_017045\|PILER-CR	1020614-1020643	30	MN693807	Marine virus AFVG_250M375, complete genome	153-182	8	0.733
NC_017045_1	1.15\|1020614\|30\|NC_017045\|PILER-CR	1020614-1020643	30	MN693807	Marine virus AFVG_250M375, complete genome	59786-59815	8	0.733
NC_017045_1	1.19\|1020922\|30\|NC_017045\|PILER-CR	1020922-1020951	30	NZ_CP049914	Vibrio sp. HDW18 plasmid p_unnamed1, complete sequence	521683-521712	8	0.733
NC_017045_1	1.20\|1020999\|30\|NC_017045\|PILER-CR	1020999-1021028	30	NC_018980	Borrelia burgdorferi 297 plasmid 297_cp32-7, complete sequence	9342-9371	8	0.733
NC_017045_1	1.23\|1021230\|30\|NC_017045\|PILER-CR	1021230-1021259	30	MT446421	UNVERIFIED: Escherichia virus TH55, complete genome	67693-67722	8	0.733
NC_017045_1	1.23\|1021230\|30\|NC_017045\|PILER-CR	1021230-1021259	30	NC_028894	Enterobacteria phage vB_EcoM_VR20, complete genome	8308-8337	8	0.733
NC_017045_1	1.23\|1021230\|30\|NC_017045\|PILER-CR	1021230-1021259	30	MT446420	UNVERIFIED: Escherichia virus TH54, complete genome	67336-67365	8	0.733
NC_017045_1	1.23\|1021230\|30\|NC_017045\|PILER-CR	1021230-1021259	30	MT446412	UNVERIFIED: Escherichia virus TH41, complete genome	131052-131081	8	0.733
NC_017045_1	1.23\|1021230\|30\|NC_017045\|PILER-CR	1021230-1021259	30	MT446422	UNVERIFIED: Escherichia virus TH57, complete genome	140221-140250	8	0.733
NC_017045_1	1.23\|1021230\|30\|NC_017045\|PILER-CR	1021230-1021259	30	MT446396	UNVERIFIED: Escherichia virus TH22, complete genome	150664-150693	8	0.733
NC_017045_1	1.24\|1021307\|30\|NC_017045\|PILER-CR	1021307-1021336	30	NZ_CP029365	Escherichia coli strain WCHEC035148 plasmid p1_035148, complete sequence	1176-1205	8	0.733
NC_017045_1	1.24\|1021307\|30\|NC_017045\|PILER-CR	1021307-1021336	30	MW067003	CrAssphage sp. C0531BW4, complete genome	68221-68250	8	0.733
NC_017045_1	1.24\|1021307\|30\|NC_017045\|PILER-CR	1021307-1021336	30	MK238400	CrAssphage ZA, complete genome	65498-65527	8	0.733
NC_017045_1	1.24\|1021307\|30\|NC_017045\|PILER-CR	1021307-1021336	30	MK069403	UNVERIFIED: CrAssphage sp. O-152, partial genome	54269-54298	8	0.733
NC_017045_1	1.24\|1021307\|30\|NC_017045\|PILER-CR	1021307-1021336	30	MT006214	CrAssphage LMMB, complete genome	67057-67086	8	0.733
NC_017045_2	2.5\|1855934\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1855934-1855963	30	KJ419279	Enterobacteria phage 9g, complete genome	55024-55053	8	0.733
NC_017045_2	2.6\|1856000\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856000-1856029	30	AJ344259	Sulfolobus virus SIRV-2 genomic DNA	6713-6742	8	0.733
NC_017045_2	2.6\|1856000\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856000-1856029	30	NZ_CP030852	Runella sp. HYN0085 plasmid unnamed2, complete sequence	15604-15633	8	0.733
NC_017045_2	2.6\|1856000\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856000-1856029	30	MN693856	Marine virus AFVG_250M393, complete genome	49911-49940	8	0.733
NC_017045_2	2.7\|1856066\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856066-1856095	30	MN905160	Pseudomonas phage PE09, complete genome	64100-64129	8	0.733
NC_017045_2	2.7\|1856066\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856066-1856095	30	MF360958	Salicola phage SCTP-2, complete genome	323749-323778	8	0.733
NC_017045_2	2.10\|1856264\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856264-1856293	30	MN856071	Myoviridae sp. isolate 215, complete genome	13964-13993	8	0.733
NC_017045_2	2.11\|1856330\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856330-1856359	30	NZ_CP033045	Bacillus foraminis strain Bac44 plasmid unnamed, complete sequence	279480-279509	8	0.733
NC_017045_2	2.12\|1856396\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856396-1856425	30	JQ680374	Unidentified phage clone 2209_scaffold441 genomic sequence	11180-11209	8	0.733
NC_017045_2	2.12\|1856396\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856396-1856425	30	MK448834	Streptococcus phage Javan91, complete genome	815-844	8	0.733
NC_017045_2	2.12\|1856396\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856396-1856425	30	MK449009	Streptococcus phage Javan88, complete genome	2519-2548	8	0.733
NC_017045_2	2.13\|1856462\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856462-1856491	30	JF974300	Synechococcus phage S-CBP42, * SEQUENCING IN PROGRESS *, 8 unordered pieces	18976-19005	8	0.733
NC_017045_2	2.13\|1856462\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856462-1856491	30	KC310805	Synechococcus phage S-CBP42, complete genome	5990-6019	8	0.733
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_CP021438	Bacillus thuringiensis strain C15 plasmid pBMB172, complete sequence	9571-9600	8	0.733
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_CP039703	Clostridium butyricum strain 29-1 plasmid p-butyl_plas_29-1, complete sequence	482656-482685	8	0.733
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_CP015497	Lactobacillus helveticus strain FAM8105 plasmid pFAM8105, complete sequence	9752-9781	8	0.733
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_CP012891	Lactobacillus gallinarum strain HFD4 plasmid pMKG01, complete sequence	3153-3182	8	0.733
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_CP012891	Lactobacillus gallinarum strain HFD4 plasmid pMKG01, complete sequence	7581-7610	8	0.733
NC_017045_2	2.16\|1856660\|30\|NC_017045\|CRISPRCasFinder,CRT	1856660-1856689	30	NZ_CP012891	Lactobacillus gallinarum strain HFD4 plasmid pMKG01, complete sequence	12008-12037	8	0.733
NC_017045_2	2.17\|1856726\|31\|NC_017045\|CRISPRCasFinder,CRT	1856726-1856756	31	NZ_CP026282	Klebsiella oxytoca strain KONIH2 plasmid pKOR-e3cb, complete sequence	46955-46985	8	0.742
NC_017045_2	2.17\|1856726\|31\|NC_017045\|CRISPRCasFinder,CRT	1856726-1856756	31	NZ_CP041047	Citrobacter sp. CF971 plasmid pBM527-1, complete sequence	240752-240782	8	0.742
NC_017045_2	2.17\|1856726\|31\|NC_017045\|CRISPRCasFinder,CRT	1856726-1856756	31	NZ_CP050835	Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-1, complete sequence	3632-3662	8	0.742
NC_017045_2	2.17\|1856726\|31\|NC_017045\|CRISPRCasFinder,CRT	1856726-1856756	31	NZ_CP037735	Citrobacter freundii strain CAV1857 plasmid pCAV1857-208, complete sequence	140131-140161	8	0.742
NC_017045_2	2.17\|1856726\|31\|NC_017045\|CRISPRCasFinder,CRT	1856726-1856756	31	NZ_CP035215	Klebsiella michiganensis strain M82255 plasmid pKOCBH-A, complete sequence	347995-348025	8	0.742
NC_017045_2	2.17\|1856726\|31\|NC_017045\|CRISPRCasFinder,CRT	1856726-1856756	31	CP045556	Citrobacter sp. S39 plasmid pS39-1, complete sequence	193060-193090	8	0.742
NC_017045_2	2.17\|1856726\|31\|NC_017045\|CRISPRCasFinder,CRT	1856726-1856756	31	NZ_CP045203	Citrobacter sp. NMI7904_11 plasmid pCTEL-2, complete sequence	82077-82107	8	0.742
NC_017045_2	2.17\|1856726\|31\|NC_017045\|CRISPRCasFinder,CRT	1856726-1856756	31	NZ_CP042535	Citrobacter freundii strain E51 plasmid pE51_001, complete sequence	18708-18738	8	0.742
NC_017045_2	2.17\|1856726\|31\|NC_017045\|CRISPRCasFinder,CRT	1856726-1856756	31	NZ_CP022152	Citrobacter freundii strain 705SK3 plasmid p705SK3_1, complete sequence	223081-223111	8	0.742
NC_017045_2	2.17\|1856726\|31\|NC_017045\|CRISPRCasFinder,CRT	1856726-1856756	31	NZ_CP030224	Salmonella enterica strain SA20083039 plasmid pSA20083039.1, complete sequence	174904-174934	8	0.742
NC_017045_2	2.17\|1856726\|31\|NC_017045\|CRISPRCasFinder,CRT	1856726-1856756	31	NZ_CP041248	Raoultella electrica strain DSM 102253 plasmid unnamed1, complete sequence	234558-234588	8	0.742
NC_017045_2	2.17\|1856726\|31\|NC_017045\|CRISPRCasFinder,CRT	1856726-1856756	31	NZ_CP026058	Citrobacter freundii strain FDAARGOS_73 plasmid unnamed2, complete sequence	162007-162037	8	0.742
NC_017045_2	2.17\|1856726\|31\|NC_017045\|CRISPRCasFinder,CRT	1856726-1856756	31	NZ_CP029436	Klebsiella quasipneumoniae strain CAV2013 plasmid pKPC_CAV2013, complete sequence	196707-196737	8	0.742
NC_017045_2	2.17\|1856726\|31\|NC_017045\|CRISPRCasFinder,CRT	1856726-1856756	31	NZ_CP029431	Klebsiella quasipneumoniae strain CAV2018 plasmid pKPC_CAV2018-435, complete sequence	317362-317392	8	0.742
NC_017045_2	2.17\|1856726\|31\|NC_017045\|CRISPRCasFinder,CRT	1856726-1856756	31	NZ_CP011611	Citrobacter freundii strain CAV1321 plasmid pKPC_CAV1321-244, complete sequence	175213-175243	8	0.742
NC_017045_2	2.17\|1856726\|31\|NC_017045\|CRISPRCasFinder,CRT	1856726-1856756	31	CP052139	Klebsiella pneumoniae strain F17KP0040 plasmid pF17KP0040-1, complete sequence	226334-226364	8	0.742
NC_017045_2	2.17\|1856726\|31\|NC_017045\|CRISPRCasFinder,CRT	1856726-1856756	31	NZ_CP026234	Citrobacter freundii complex sp. CFNIH4 plasmid pCFR-4109, complete sequence	129537-129567	8	0.742
NC_017045_2	2.17\|1856726\|31\|NC_017045\|CRISPRCasFinder,CRT	1856726-1856756	31	NZ_CP018017	Kosakonia radicincitans DSM 16656 plasmid pKrDSM16656L, complete sequence	42458-42488	8	0.742
NC_017045_2	2.17\|1856726\|31\|NC_017045\|CRISPRCasFinder,CRT	1856726-1856756	31	NZ_MG387191	Citrobacter freundii strain 2262 plasmid pTEM-2262, complete sequence	197202-197232	8	0.742
NC_017045_2	2.17\|1856726\|31\|NC_017045\|CRISPRCasFinder,CRT	1856726-1856756	31	NZ_CP029442	Klebsiella quasipneumoniae strain CAV1947 plasmid pKPC_CAV1947-412, complete sequence	288561-288591	8	0.742
NC_017045_1	1.10\|1021152\|30\|NC_017045\|CRISPRCasFinder	1021152-1021181	30	NZ_CP028863	Borreliella garinii strain 20047 plasmid lp28-4, complete sequence	24016-24045	9	0.7
NC_017045_1	1.10\|1021152\|30\|NC_017045\|CRISPRCasFinder	1021152-1021181	30	NC_007773	Clostridium perfringens plasmid pCPF5603, complete sequence	32296-32325	9	0.7
NC_017045_1	1.22\|1021153\|30\|NC_017045\|PILER-CR	1021153-1021182	30	NZ_CP028863	Borreliella garinii strain 20047 plasmid lp28-4, complete sequence	24016-24045	9	0.7
NC_017045_1	1.22\|1021153\|30\|NC_017045\|PILER-CR	1021153-1021182	30	NC_007773	Clostridium perfringens plasmid pCPF5603, complete sequence	32296-32325	9	0.7
NC_017045_2	2.6\|1856000\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856000-1856029	30	CP052419	Klebsiella pneumoniae strain C16KP0189 plasmid pC16KP0189-5, complete sequence	161-190	9	0.7
NC_017045_2	2.6\|1856000\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856000-1856029	30	NZ_CP029435	Klebsiella quasipneumoniae strain CAV2013 plasmid pCAV2013-156, complete sequence	82586-82615	9	0.7
NC_017045_2	2.6\|1856000\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856000-1856029	30	NZ_CP029430	Klebsiella quasipneumoniae strain CAV2018 plasmid pCAV2018-177, complete sequence	63977-64006	9	0.7
NC_017045_2	2.6\|1856000\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856000-1856029	30	CP052482	Klebsiella pneumoniae strain C16KP0050 plasmid pC16KP0050-6, complete sequence	473-502	9	0.7
NC_017045_2	2.6\|1856000\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856000-1856029	30	NZ_CP029441	Klebsiella quasipneumoniae strain CAV1947 plasmid pCAV1947-173, complete sequence	52727-52756	9	0.7
NC_017045_2	2.6\|1856000\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856000-1856029	30	NZ_CP044041	Klebsiella pneumoniae strain FDAARGOS_630 plasmid unnamed6	1506-1535	9	0.7
NC_017045_2	2.6\|1856000\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856000-1856029	30	NZ_CP044379	Klebsiella pneumoniae strain 2018S06-082 plasmid p2018S06-082-3, complete sequence	3551-3580	9	0.7
NC_017045_2	2.6\|1856000\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856000-1856029	30	CP052475	Klebsiella pneumoniae strain C16KP0053 plasmid pC16KP0053-7, complete sequence	3505-3534	9	0.7
NC_017045_2	2.6\|1856000\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856000-1856029	30	MN694379	Marine virus AFVG_250M394, complete genome	11027-11056	9	0.7
NC_017045_2	2.7\|1856066\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856066-1856095	30	NC_019746	Gloeocapsa sp. PCC 7428 plasmid pGLO7428.01, complete sequence	153677-153706	9	0.7
NC_017045_2	2.13\|1856462\|30\|NC_017045\|CRISPRCasFinder,PILER-CR,CRT	1856462-1856491	30	AP014357	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S39-C89, * SEQUENCING IN PROGRESS *	3533-3562	9	0.7
NC_017045_1	1.1\|1020459\|30\|NC_017045\|CRISPRCasFinder	1020459-1020488	30	MT028297	Proteus phage Privateer, complete genome	46107-46136	10	0.667
NC_017045_1	1.1\|1020459\|30\|NC_017045\|CRISPRCasFinder	1020459-1020488	30	MT740244	Proteus phage 3H10_20, partial genome	46300-46329	10	0.667
NC_017045_1	1.13\|1020460\|30\|NC_017045\|PILER-CR	1020460-1020489	30	MT028297	Proteus phage Privateer, complete genome	46107-46136	10	0.667
NC_017045_1	1.13\|1020460\|30\|NC_017045\|PILER-CR	1020460-1020489	30	MT740244	Proteus phage 3H10_20, partial genome	46300-46329	10	0.667
NC_017045_2	2.17\|1856726\|31\|NC_017045\|CRISPRCasFinder,CRT	1856726-1856756	31	NZ_CP033045	Bacillus foraminis strain Bac44 plasmid unnamed, complete sequence	111586-111616	10	0.677

1. spacer 1.10|1021152|30|NC_017045|CRISPRCasFinder matches to NC_019490 (Riemerella phage RAP44, complete genome) position: , mismatch: 3, identity: 0.9

gattttcagctaattaaattatttaataaa	CRISPR spacer
gattttcagttaattaaattgtttaataca	Protospacer
*********.**********.******* *

2. spacer 1.22|1021153|30|NC_017045|PILER-CR matches to NC_019490 (Riemerella phage RAP44, complete genome) position: , mismatch: 3, identity: 0.9

gattttcagctaattaaattatttaataaa	CRISPR spacer
gattttcagttaattaaattgtttaataca	Protospacer
*********.**********.******* *

3. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_CP015806 (Borrelia mayonii strain MN14-1539 plasmid lp28-3) position: , mismatch: 3, identity: 0.889

taggaatatttcttattctatttttta	CRISPR spacer
taggaatatttgtttttctatttttaa	Protospacer
*********** ** ********** *

4. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_CP015791 (Borrelia mayonii strain MN14-1420 plasmid lp28-3, complete sequence) position: , mismatch: 3, identity: 0.889

taggaatatttcttattctatttttta	CRISPR spacer
taggaatatttgtttttctatttttaa	Protospacer
*********** ** ********** *

5. spacer 2.19|1856729|28|NC_017045|PILER-CR matches to NC_010555 (Proteus mirabilis HI4320 plasmid pHI4320, complete sequence) position: , mismatch: 3, identity: 0.893

caaacggaaaaatatgtttattccgttg	CRISPR spacer
gaaacggaaacatatatttattccgttg	Protospacer
 ********* ****.************

6. spacer 2.19|1856729|28|NC_017045|PILER-CR matches to NZ_CP017056 (Providencia stuartii strain BE2467 plasmid pPS2, complete sequence) position: , mismatch: 3, identity: 0.893

caaacggaaaaatatgtttattccgttg	CRISPR spacer
gaaacggaaacatatatttattccgttg	Protospacer
 ********* ****.************

7. spacer 1.9|1021075|30|NC_017045|CRISPRCasFinder matches to NC_019490 (Riemerella phage RAP44, complete genome) position: , mismatch: 4, identity: 0.867

atagacgagattgagatatgacaacacctc	CRISPR spacer
atagacgagattgagatatgacagcagagc	Protospacer
***********************.**   *

8. spacer 1.21|1021076|30|NC_017045|PILER-CR matches to NC_019490 (Riemerella phage RAP44, complete genome) position: , mismatch: 4, identity: 0.867

atagacgagattgagatatgacaacacctc	CRISPR spacer
atagacgagattgagatatgacagcagagc	Protospacer
***********************.**   *

9. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to AP014361 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S40-C80, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

taggaatatttcttattctatttttta	CRISPR spacer
tagggttatttcttattctatttgata	Protospacer
****. *****************  **

10. spacer 1.1|1020459|30|NC_017045|CRISPRCasFinder matches to MT664722 (Proteus phage Vb_PmiP-P59, complete genome) position: , mismatch: 5, identity: 0.833

tatctgcacaggagaaaatagagtcaatca-	CRISPR spacer
tatctgcacaagagaaaatag-gtaagtctg	Protospacer
**********.********** ** *.**

11. spacer 1.1|1020459|30|NC_017045|CRISPRCasFinder matches to LC519601 (Cronobacter phage vB_CsaP_009 DNA, complete genome) position: , mismatch: 5, identity: 0.833

tatctgcacaggagaaaatagagtcaatca-	CRISPR spacer
tatctgcacaagagaaaatag-gtaagtctg	Protospacer
**********.********** ** *.**

12. spacer 1.13|1020460|30|NC_017045|PILER-CR matches to MT664722 (Proteus phage Vb_PmiP-P59, complete genome) position: , mismatch: 5, identity: 0.833

tatctgcacaggagaaaatagagtcaatca-	CRISPR spacer
tatctgcacaagagaaaatag-gtaagtctg	Protospacer
**********.********** ** *.**

13. spacer 1.13|1020460|30|NC_017045|PILER-CR matches to LC519601 (Cronobacter phage vB_CsaP_009 DNA, complete genome) position: , mismatch: 5, identity: 0.833

tatctgcacaggagaaaatagagtcaatca-	CRISPR spacer
tatctgcacaagagaaaatag-gtaagtctg	Protospacer
**********.********** ** *.**

14. spacer 2.7|1856066|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to MK448860 (Streptococcus phage Javan172, complete genome) position: , mismatch: 5, identity: 0.833

agcaacatatacgaaaatccagaaatctta	CRISPR spacer
ggcaacatctacgaaaatccagaattgcta	Protospacer
.******* *************** * .**

15. spacer 2.7|1856066|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to MK448751 (Streptococcus phage Javan399, complete genome) position: , mismatch: 5, identity: 0.833

agcaacatatacgaaaatccagaaatctta	CRISPR spacer
ggcaacatctacgaaaatccagaattaata	Protospacer
.******* *************** *  **

16. spacer 2.7|1856066|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to MK448957 (Streptococcus phage Javan484, complete genome) position: , mismatch: 5, identity: 0.833

agcaacatatacgaaaatccagaaatctta	CRISPR spacer
ggcaacatctacgaaaatccagaattacta	Protospacer
.******* *************** * .**

17. spacer 2.7|1856066|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to JX409894 (Streptococcus phage LYGO9, complete genome) position: , mismatch: 5, identity: 0.833

agcaacatatacgaaaatccagaaatctta	CRISPR spacer
ggaaacatatacgaaaatccagaattacta	Protospacer
.* ********************* * .**

18. spacer 2.7|1856066|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to JX409895 (Streptococcus phage JX01, complete genome) position: , mismatch: 5, identity: 0.833

agcaacatatacgaaaatccagaaatctta	CRISPR spacer
ggaaacatatacgaaaatccagaattacta	Protospacer
.* ********************* * .**

19. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP015806 (Borrelia mayonii strain MN14-1539 plasmid lp28-3) position: , mismatch: 5, identity: 0.833

tgataggaatatttcttattctatttttta	CRISPR spacer
ttgtaggaatatttgtttttctatttttaa	Protospacer
* .*********** ** ********** *

20. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP015791 (Borrelia mayonii strain MN14-1420 plasmid lp28-3, complete sequence) position: , mismatch: 5, identity: 0.833

tgataggaatatttcttattctatttttta	CRISPR spacer
ttgtaggaatatttgtttttctatttttaa	Protospacer
* .*********** ** ********** *

21. spacer 2.17|1856726|31|NC_017045|CRISPRCasFinder,CRT matches to NC_010555 (Proteus mirabilis HI4320 plasmid pHI4320, complete sequence) position: , mismatch: 5, identity: 0.839

tcacaaacggaaaaatatgtttattccgttg	CRISPR spacer
aaagaaacggaaacatatatttattccgttg	Protospacer
  * ********* ****.************

22. spacer 2.17|1856726|31|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP017056 (Providencia stuartii strain BE2467 plasmid pPS2, complete sequence) position: , mismatch: 5, identity: 0.839

tcacaaacggaaaaatatgtttattccgttg	CRISPR spacer
aaagaaacggaaacatatatttattccgttg	Protospacer
  * ********* ****.************

23. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_AP018048 (Photobacterium damselae subsp. piscicida strain 91-197 plasmid p91-197-2) position: , mismatch: 5, identity: 0.815

taggaatatttcttattctatttttta	CRISPR spacer
gcggaatatttcttattatttttttaa	Protospacer
  *************** * ***** *

24. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NC_002102 (Lactobacillus helveticus DSM 20075 plasmid pLH1, complete sequence) position: , mismatch: 5, identity: 0.815

taggaatatttcttattctatttttta	CRISPR spacer
aaaaactatttctttttctatttttta	Protospacer
 *..* ******** ************

25. spacer 2.19|1856729|28|NC_017045|PILER-CR matches to NZ_CP026282 (Klebsiella oxytoca strain KONIH2 plasmid pKOR-e3cb, complete sequence) position: , mismatch: 5, identity: 0.821

caaacggaaaaatatgtttattccgttg	CRISPR spacer
agaacggacaaatatgttttttccgtgg	Protospacer
 .****** ********** ****** *

26. spacer 2.19|1856729|28|NC_017045|PILER-CR matches to NZ_CP050835 (Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-1, complete sequence) position: , mismatch: 5, identity: 0.821

caaacggaaaaatatgtttattccgttg	CRISPR spacer
agaacggacaaatatgttttttccgtgg	Protospacer
 .****** ********** ****** *

27. spacer 2.19|1856729|28|NC_017045|PILER-CR matches to NZ_CP037735 (Citrobacter freundii strain CAV1857 plasmid pCAV1857-208, complete sequence) position: , mismatch: 5, identity: 0.821

caaacggaaaaatatgtttattccgttg	CRISPR spacer
agaacggacaaatatgttttttccgtgg	Protospacer
 .****** ********** ****** *

28. spacer 2.19|1856729|28|NC_017045|PILER-CR matches to NZ_CP035215 (Klebsiella michiganensis strain M82255 plasmid pKOCBH-A, complete sequence) position: , mismatch: 5, identity: 0.821

caaacggaaaaatatgtttattccgttg	CRISPR spacer
agaacggacaaatatgttttttccgtgg	Protospacer
 .****** ********** ****** *

29. spacer 2.19|1856729|28|NC_017045|PILER-CR matches to CP045556 (Citrobacter sp. S39 plasmid pS39-1, complete sequence) position: , mismatch: 5, identity: 0.821

caaacggaaaaatatgtttattccgttg	CRISPR spacer
agaacggacaaatatgttttttccgtgg	Protospacer
 .****** ********** ****** *

30. spacer 2.19|1856729|28|NC_017045|PILER-CR matches to NZ_CP045203 (Citrobacter sp. NMI7904_11 plasmid pCTEL-2, complete sequence) position: , mismatch: 5, identity: 0.821

caaacggaaaaatatgtttattccgttg	CRISPR spacer
agaacggacaaatatgttttttccgtgg	Protospacer
 .****** ********** ****** *

31. spacer 2.19|1856729|28|NC_017045|PILER-CR matches to NZ_CP022152 (Citrobacter freundii strain 705SK3 plasmid p705SK3_1, complete sequence) position: , mismatch: 5, identity: 0.821

caaacggaaaaatatgtttattccgttg	CRISPR spacer
agaacggacaaatatgttttttccgtgg	Protospacer
 .****** ********** ****** *

32. spacer 2.19|1856729|28|NC_017045|PILER-CR matches to NZ_CP030224 (Salmonella enterica strain SA20083039 plasmid pSA20083039.1, complete sequence) position: , mismatch: 5, identity: 0.821

caaacggaaaaatatgtttattccgttg	CRISPR spacer
agaacggacaaatatgttttttccgtgg	Protospacer
 .****** ********** ****** *

33. spacer 2.19|1856729|28|NC_017045|PILER-CR matches to NZ_CP041248 (Raoultella electrica strain DSM 102253 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

caaacggaaaaatatgtttattccgttg	CRISPR spacer
agaacggacaaatatgttttttccgtgg	Protospacer
 .****** ********** ****** *

34. spacer 2.19|1856729|28|NC_017045|PILER-CR matches to NZ_CP011611 (Citrobacter freundii strain CAV1321 plasmid pKPC_CAV1321-244, complete sequence) position: , mismatch: 5, identity: 0.821

caaacggaaaaatatgtttattccgttg	CRISPR spacer
agaacggacaaatatgttttttccgtgg	Protospacer
 .****** ********** ****** *

35. spacer 2.19|1856729|28|NC_017045|PILER-CR matches to CP052139 (Klebsiella pneumoniae strain F17KP0040 plasmid pF17KP0040-1, complete sequence) position: , mismatch: 5, identity: 0.821

caaacggaaaaatatgtttattccgttg	CRISPR spacer
agaacggacaaatatgttttttccgtgg	Protospacer
 .****** ********** ****** *

36. spacer 2.19|1856729|28|NC_017045|PILER-CR matches to NZ_MG387191 (Citrobacter freundii strain 2262 plasmid pTEM-2262, complete sequence) position: , mismatch: 5, identity: 0.821

caaacggaaaaatatgtttattccgttg	CRISPR spacer
agaacggacaaatatgttttttccgtgg	Protospacer
 .****** ********** ****** *

37. spacer 2.19|1856729|28|NC_017045|PILER-CR matches to NZ_CP041047 (Citrobacter sp. CF971 plasmid pBM527-1, complete sequence) position: , mismatch: 5, identity: 0.821

caaacggaaaaatatgtttattccgttg	CRISPR spacer
agaacggacaaatatgttttttccgtgg	Protospacer
 .****** ********** ****** *

38. spacer 2.19|1856729|28|NC_017045|PILER-CR matches to NZ_CP042535 (Citrobacter freundii strain E51 plasmid pE51_001, complete sequence) position: , mismatch: 5, identity: 0.821

caaacggaaaaatatgtttattccgttg	CRISPR spacer
agaacggacaaatatgttttttccgtgg	Protospacer
 .****** ********** ****** *

39. spacer 2.19|1856729|28|NC_017045|PILER-CR matches to NZ_CP026058 (Citrobacter freundii strain FDAARGOS_73 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.821

caaacggaaaaatatgtttattccgttg	CRISPR spacer
agaacggacaaatatgttttttccgtgg	Protospacer
 .****** ********** ****** *

40. spacer 2.19|1856729|28|NC_017045|PILER-CR matches to NZ_CP029436 (Klebsiella quasipneumoniae strain CAV2013 plasmid pKPC_CAV2013, complete sequence) position: , mismatch: 5, identity: 0.821

caaacggaaaaatatgtttattccgttg	CRISPR spacer
agaacggacaaatatgttttttccgtgg	Protospacer
 .****** ********** ****** *

41. spacer 2.19|1856729|28|NC_017045|PILER-CR matches to NZ_CP029431 (Klebsiella quasipneumoniae strain CAV2018 plasmid pKPC_CAV2018-435, complete sequence) position: , mismatch: 5, identity: 0.821

caaacggaaaaatatgtttattccgttg	CRISPR spacer
agaacggacaaatatgttttttccgtgg	Protospacer
 .****** ********** ****** *

42. spacer 2.19|1856729|28|NC_017045|PILER-CR matches to NZ_CP026234 (Citrobacter freundii complex sp. CFNIH4 plasmid pCFR-4109, complete sequence) position: , mismatch: 5, identity: 0.821

caaacggaaaaatatgtttattccgttg	CRISPR spacer
agaacggacaaatatgttttttccgtgg	Protospacer
 .****** ********** ****** *

43. spacer 2.19|1856729|28|NC_017045|PILER-CR matches to NZ_CP018017 (Kosakonia radicincitans DSM 16656 plasmid pKrDSM16656L, complete sequence) position: , mismatch: 5, identity: 0.821

caaacggaaaaatatgtttattccgttg	CRISPR spacer
agaacggacaaatatgttttttccgtgg	Protospacer
 .****** ********** ****** *

44. spacer 2.19|1856729|28|NC_017045|PILER-CR matches to NZ_CP029442 (Klebsiella quasipneumoniae strain CAV1947 plasmid pKPC_CAV1947-412, complete sequence) position: , mismatch: 5, identity: 0.821

caaacggaaaaatatgtttattccgttg	CRISPR spacer
agaacggacaaatatgttttttccgtgg	Protospacer
 .****** ********** ****** *

45. spacer 1.7|1020921|30|NC_017045|CRISPRCasFinder matches to KT351734 (Pectobacterium carotovorum plasmid Drgb3, complete sequence) position: , mismatch: 6, identity: 0.8

-gcaatgaataactatatggaagccttgaaa	CRISPR spacer
ggctgt-tatgactatatggaagcctttaaa	Protospacer
 ** .*  **.**************** ***

46. spacer 1.19|1020922|30|NC_017045|PILER-CR matches to KT351734 (Pectobacterium carotovorum plasmid Drgb3, complete sequence) position: , mismatch: 6, identity: 0.8

-gcaatgaataactatatggaagccttgaaa	CRISPR spacer
ggctgt-tatgactatatggaagcctttaaa	Protospacer
 ** .*  **.**************** ***

47. spacer 2.6|1856000|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to MK817115 (Escherichia phage vB_EcoM_phAPEC6, complete genome) position: , mismatch: 6, identity: 0.8

cggcaacaaaagaaggagaagaacaaagca	CRISPR spacer
ctgaaacaaaagaagaagcagaacaaatct	Protospacer
* * ***********.** ******** *

48. spacer 2.6|1856000|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to NC_027364 (Escherichia phage PBECO 4, complete genome) position: , mismatch: 6, identity: 0.8

cggcaacaaaagaaggagaagaacaaagca	CRISPR spacer
ctgaaacaaaagaagaagcagaacaaatct	Protospacer
* * ***********.** ******** *

49. spacer 2.6|1856000|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to MH383160 (Escherichia phage UB, complete genome) position: , mismatch: 6, identity: 0.8

cggcaacaaaagaaggagaagaacaaagca	CRISPR spacer
ctgaaacaaaagaagaagcagaacaaatct	Protospacer
* * ***********.** ******** *

50. spacer 2.6|1856000|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to MK327931 (Escherichia phage vB_EcoM_G17, complete genome) position: , mismatch: 6, identity: 0.8

cggcaacaaaagaaggagaagaacaaagca	CRISPR spacer
ctgaaacaaaagaagaagcagaacaaatct	Protospacer
* * ***********.** ******** *

51. spacer 2.6|1856000|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to LC494302 (Escherichia phage SP27 DNA, complete genome) position: , mismatch: 6, identity: 0.8

cggcaacaaaagaaggagaagaacaaagca	CRISPR spacer
ctgaaacaaaagaagaagcagaacaaatct	Protospacer
* * ***********.** ******** *

52. spacer 2.6|1856000|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to LT603033 (Escherichia phage vB_Eco_slurp01 genome assembly, chromosome: I) position: , mismatch: 6, identity: 0.8

cggcaacaaaagaaggagaagaacaaagca	CRISPR spacer
ctgaaacaaaagaagaagcagaacaaatct	Protospacer
* * ***********.** ******** *

53. spacer 2.6|1856000|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to KM507819 (Escherichia phage 121Q, complete genome) position: , mismatch: 6, identity: 0.8

cggcaacaaaagaaggagaagaacaaagca	CRISPR spacer
ctgaaacaaaagaagaagcagaacaaatct	Protospacer
* * ***********.** ******** *

54. spacer 2.7|1856066|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to MH937471 (Streptococcus phage CHPC927, complete genome) position: , mismatch: 6, identity: 0.8

agcaacatatacgaaaatccagaaatctta	CRISPR spacer
ggcaacatctacgaaaatccagaattactt	Protospacer
.******* *************** * .*

55. spacer 2.7|1856066|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to MG708275 (Streptococcus phage vB_SthS_VA460, complete genome) position: , mismatch: 6, identity: 0.8

agcaacatatacgaaaatccagaaatctta	CRISPR spacer
ggcaacatctacgaaaatccagaattactt	Protospacer
.******* *************** * .*

56. spacer 2.7|1856066|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to KY065505 (Streptococcus phage IPP69, complete genome) position: , mismatch: 6, identity: 0.8

agcaacatatacgaaaatccagaaatctta	CRISPR spacer
ggcaacatctacgaaaatccagagcttttg	Protospacer
.******* **************. *.**.

57. spacer 2.7|1856066|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to KY065454 (Streptococcus phage IPP12, complete genome) position: , mismatch: 6, identity: 0.8

agcaacatatacgaaaatccagaaatctta	CRISPR spacer
ggcaacatctacgaaaatccagagcttttg	Protospacer
.******* **************. *.**.

58. spacer 2.7|1856066|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to KY065465 (Streptococcus phage IPP24, complete genome) position: , mismatch: 6, identity: 0.8

agcaacatatacgaaaatccagaaatctta	CRISPR spacer
ggcaacatctacgaaaatccagagcttttg	Protospacer
.******* **************. *.**.

59. spacer 2.7|1856066|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to KY065486 (Streptococcus phage IPP46, complete genome) position: , mismatch: 6, identity: 0.8

agcaacatatacgaaaatccagaaatctta	CRISPR spacer
ggcaacatctacgaaaatccagagcttttg	Protospacer
.******* **************. *.**.

60. spacer 2.7|1856066|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to MK448881 (Streptococcus phage Javan240, complete genome) position: , mismatch: 6, identity: 0.8

agcaacatatacgaaaatccagaaatctta	CRISPR spacer
ggcaacatttacgaaaatccagatttattg	Protospacer
.******* **************  * **.

61. spacer 2.7|1856066|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to KT337360 (Streptococcus phage phiARI0578, partial genome) position: , mismatch: 6, identity: 0.8

agcaacatatacgaaaatccagaaatctta	CRISPR spacer
ggcaatatatacgaaaatccagagcttttg	Protospacer
.****.*****************. *.**.

62. spacer 2.7|1856066|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to KT337367 (Streptococcus phage phiARI0826b, partial genome) position: , mismatch: 6, identity: 0.8

agcaacatatacgaaaatccagaaatctta	CRISPR spacer
ggcaacatctacgaaaatccagagcttttg	Protospacer
.******* **************. *.**.

63. spacer 2.7|1856066|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to KT337359 (Streptococcus phage phiARI0468b-3, partial genome) position: , mismatch: 6, identity: 0.8

agcaacatatacgaaaatccagaaatctta	CRISPR spacer
ggcaacatctacgaaaatccagagcttttg	Protospacer
.******* **************. *.**.

64. spacer 2.7|1856066|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to KT337341 (Streptococcus phage phiARI0131-1, complete genome) position: , mismatch: 6, identity: 0.8

agcaacatatacgaaaatccagaaatctta	CRISPR spacer
ggcaacatctacgaaaatccagagcttttg	Protospacer
.******* **************. *.**.

65. spacer 2.7|1856066|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to NC_031929 (Streptococcus phage phiARI0468-1, complete genome) position: , mismatch: 6, identity: 0.8

agcaacatatacgaaaatccagaaatctta	CRISPR spacer
ggcaacatctacgaaaatccagagcttttg	Protospacer
.******* **************. *.**.

66. spacer 2.7|1856066|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to KT337345 (Streptococcus phage phiARI0285-1, partial genome) position: , mismatch: 6, identity: 0.8

agcaacatatacgaaaatccagaaatctta	CRISPR spacer
ggcaacatctacgaaaatccagagcttttg	Protospacer
.******* **************. *.**.

67. spacer 2.7|1856066|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to NC_024370 (Streptococcus phage IC1, complete sequence) position: , mismatch: 6, identity: 0.8

agcaacatatacgaaaatccagaaatctta	CRISPR spacer
ggcaacatctacgaaaatccagagcttttg	Protospacer
.******* **************. *.**.

68. spacer 2.7|1856066|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to KT337349 (Streptococcus phage phiARI0399, partial genome) position: , mismatch: 6, identity: 0.8

agcaacatatacgaaaatccagaaatctta	CRISPR spacer
ggcaacatctacgaaaatccagagcttttg	Protospacer
.******* **************. *.**.

69. spacer 2.7|1856066|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to NC_031920 (Streptococcus phage phiARI0004, complete genome) position: , mismatch: 6, identity: 0.8

agcaacatatacgaaaatccagaaatctta	CRISPR spacer
ggcaacatctacgaaaatccagagcttttg	Protospacer
.******* **************. *.**.

70. spacer 2.7|1856066|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to FR671411 (Streptococcus phage 2167) position: , mismatch: 6, identity: 0.8

agcaacatatacgaaaatccagaaatctta	CRISPR spacer
ggcaacatctacgaaaatccagagcttttg	Protospacer
.******* **************. *.**.

71. spacer 2.7|1856066|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to KT337356 (Streptococcus phage phiARI0468-2, complete genome) position: , mismatch: 6, identity: 0.8

agcaacatatacgaaaatccagaaatctta	CRISPR spacer
ggcaacatctacgaaaatccagagcttttg	Protospacer
.******* **************. *.**.

72. spacer 2.7|1856066|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to KT337340 (Streptococcus phage phiARI0031, complete genome) position: , mismatch: 6, identity: 0.8

agcaacatatacgaaaatccagaaatctta	CRISPR spacer
ggcaacatctacgaaaatccagagcttttg	Protospacer
.******* **************. *.**.

73. spacer 2.13|1856462|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to NZ_CP049229 (Lactobacillus iners strain C0210C1 plasmid pC0210C1, complete sequence) position: , mismatch: 6, identity: 0.8

taagaactttgtagatgaaagtggtaatct	CRISPR spacer
tatcaattttgttgatgaaagtggtaaaat	Protospacer
**  **.***** **************  *

74. spacer 2.13|1856462|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to NZ_CP049227 (Lactobacillus iners strain C0011D1 plasmid pC0011D1, complete sequence) position: , mismatch: 6, identity: 0.8

taagaactttgtagatgaaagtggtaatct	CRISPR spacer
tatcaattttgttgatgaaagtggtaaaat	Protospacer
**  **.***** **************  *

75. spacer 2.13|1856462|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to NZ_CP049224 (Lactobacillus iners strain C0094A1 plasmid pC0094A1, complete sequence) position: , mismatch: 6, identity: 0.8

taagaactttgtagatgaaagtggtaatct	CRISPR spacer
tatcaattttgttgatgaaagtggtaaaat	Protospacer
**  **.***** **************  *

76. spacer 2.15|1856594|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP045341 (Vibrio sp. THAF190c plasmid pTHAF190c_c, complete sequence) position: , mismatch: 6, identity: 0.8

tcaaccaatttaatctgcaactctgaaatg	CRISPR spacer
ttgaccactttcatctgcaactctgataag	Protospacer
*..**** *** ************** * *

77. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NC_002102 (Lactobacillus helveticus DSM 20075 plasmid pLH1, complete sequence) position: , mismatch: 6, identity: 0.8

tgataggaatatttcttattctatttttta	CRISPR spacer
agaaaaaactatttctttttctatttttta	Protospacer
 ** *..* ******** ************

78. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_AP018048 (Photobacterium damselae subsp. piscicida strain 91-197 plasmid p91-197-2) position: , mismatch: 6, identity: 0.8

tgataggaatatttcttattctatttttta	CRISPR spacer
ttagcggaatatttcttattatttttttaa	Protospacer
* *  *************** * ***** *

79. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to CP008939 (Candidatus Caedibacter acanthamoebae plasmid Plasmid_00003, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
attctatatttcttattctattttttt	Protospacer
     *********************

80. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_CP020577 (Acinetobacter baumannii strain SSA12 plasmid pSSA12_1, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttt	Protospacer
*    ***********.*********

81. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_CP039703 (Clostridium butyricum strain 29-1 plasmid p-butyl_plas_29-1, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttgaatatttctttttctattttagg	Protospacer
*  *********** *********  .

82. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_CP012008 (Acinetobacter baumannii strain Ab04-mff plasmid pAB04-2, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttt	Protospacer
*    ***********.*********

83. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to CP033518 (Acinetobacter baumannii strain 2008S11-069 plasmid p2008S11-069-2, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttc	Protospacer
*    ***********.*********

84. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_CP032741 (Acinetobacter baumannii strain C25 plasmid unnamed1) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttt	Protospacer
*    ***********.*********

85. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_CP032742 (Acinetobacter baumannii strain C25 plasmid unnamed2) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttt	Protospacer
*    ***********.*********

86. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_CP033857 (Acinetobacter sp. FDAARGOS_493 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttt	Protospacer
*    ***********.*********

87. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_CP008851 (Acinetobacter baumannii strain AC29 plasmid pAC29b, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttt	Protospacer
*    ***********.*********

88. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_CP023033 (Acinetobacter baumannii strain 7847 plasmid pAba7847b, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttt	Protospacer
*    ***********.*********

89. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to CP014292 (Acinetobacter baumannii strain AB34299 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttt	Protospacer
*    ***********.*********

90. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_CP027121 (Acinetobacter baumannii strain AR_0056 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttt	Protospacer
*    ***********.*********

91. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_CP015497 (Lactobacillus helveticus strain FAM8105 plasmid pFAM8105, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
aaaacctatttctttttctatttttta	Protospacer
 *..  ******** ************

92. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_CP020580 (Acinetobacter baumannii strain SSMA17 plasmid pSSMA17_1, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttt	Protospacer
*    ***********.*********

93. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_CP015366 (Acinetobacter baumannii strain 3207 plasmid pAba3207b, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttt	Protospacer
*    ***********.*********

94. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_CP017645 (Acinetobacter baumannii strain KAB02 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttt	Protospacer
*    ***********.*********

95. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_CP020573 (Acinetobacter baumannii strain 15A5 plasmid p15A5_1, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttt	Protospacer
*    ***********.*********

96. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_CP012891 (Lactobacillus gallinarum strain HFD4 plasmid pMKG01, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
aaaacctatttctttttctatttttta	Protospacer
 *..  ******** ************

97. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_CP012891 (Lactobacillus gallinarum strain HFD4 plasmid pMKG01, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
aaaacctatttctttttctatttttta	Protospacer
 *..  ******** ************

98. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_CP012891 (Lactobacillus gallinarum strain HFD4 plasmid pMKG01, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
aaaacctatttctttttctatttttta	Protospacer
 *..  ******** ************

99. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_CP020582 (Acinetobacter baumannii strain JBA13 plasmid pJBA13_1, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttt	Protospacer
*    ***********.*********

100. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_CP026712 (Acinetobacter baumannii strain AR_0063 plasmid unitig_2_pilon, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttt	Protospacer
*    ***********.*********

101. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_CP017647 (Acinetobacter baumannii strain KAB03 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttt	Protospacer
*    ***********.*********

102. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_CP026706 (Acinetobacter baumannii strain AR_0056 plasmid tig00000059_pilon, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttt	Protospacer
*    ***********.*********

103. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_CP033245 (Acinetobacter baumannii strain 7835 plasmid pAba7835b, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttt	Protospacer
*    ***********.*********

104. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_CP021787 (Acinetobacter baumannii strain A85 plasmid pA85-3, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttt	Protospacer
*    ***********.*********

105. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_MG954379 (Acinetobacter baumannii strain SGH0905 plasmid pS32-2, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttt	Protospacer
*    ***********.*********

106. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_CP023028 (Acinetobacter baumannii strain 10042 plasmid pAba10042b, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttt	Protospacer
*    ***********.*********

107. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_CP027243 (Acinetobacter baumannii strain WCHAB005078 plasmid p1_005078, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttt	Protospacer
*    ***********.*********

108. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_KY022424 (Acinetobacter baumannii strain Ab8098 plasmid pAb8098, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttt	Protospacer
*    ***********.*********

109. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_CP035052 (Acinetobacter baumannii strain ABUH763 plasmid p74.1Kbp, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttt	Protospacer
*    ***********.*********

110. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_CP017657 (Acinetobacter baumannii strain KAB08 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttt	Protospacer
*    ***********.*********

111. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NC_025111 (Acinetobacter baumannii strain D72 plasmid pD72-2, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttt	Protospacer
*    ***********.*********

112. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_KF889012 (Acinetobacter baumannii TYTH-1 plasmid pAB_CC, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttt	Protospacer
*    ***********.*********

113. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NC_025109 (Acinetobacter baumannii strain A85 plasmid pA85-3 clone GC1 AbaR4 resistance island, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttt	Protospacer
*    ***********.*********

114. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_CP016302 (Acinetobacter baumannii strain CMC-CR-MDR-Ab66 plasmid pCMCVTAb2-Ab66, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttt	Protospacer
*    ***********.*********

115. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_CP016297 (Acinetobacter baumannii strain CMC-CR-MDR-Ab4 plasmid pCMCVTAb2-Ab4, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttt	Protospacer
*    ***********.*********

116. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NC_017163 (Acinetobacter baumannii 1656-2 plasmid ABKp1, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttt	Protospacer
*    ***********.*********

117. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_CP050392 (Acinetobacter baumannii strain VB11737 plasmid pVB11737_1, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttt	Protospacer
*    ***********.*********

118. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_CP050413 (Acinetobacter baumannii strain PM192696 plasmid pPM192696_1, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttt	Protospacer
*    ***********.*********

119. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_CP017649 (Acinetobacter baumannii strain KAB04 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttt	Protospacer
*    ***********.*********

120. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_CP017649 (Acinetobacter baumannii strain KAB04 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttt	Protospacer
*    ***********.*********

121. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_CP050404 (Acinetobacter baumannii strain VB2486 plasmid pVB2486_1, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttt	Protospacer
*    ***********.*********

122. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_LT984690 (Acinetobacter baumannii isolate K50 plasmid I, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttt	Protospacer
*    ***********.*********

123. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_CP029571 (Acinetobacter baumannii strain DA33098 plasmid pDA33098-71, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttt	Protospacer
*    ***********.*********

124. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_CP039994 (Acinetobacter baumannii strain TG22182 plasmid pTG22182_1, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttt	Protospacer
*    ***********.*********

125. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_CP014216 (Acinetobacter baumannii strain YU-R612 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttt	Protospacer
*    ***********.*********

126. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_CP017655 (Acinetobacter baumannii strain KAB07 plasmid pKAB07, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttt	Protospacer
*    ***********.*********

127. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_CP023030 (Acinetobacter baumannii strain 9102 plasmid pAba9102a, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttt	Protospacer
*    ***********.*********

128. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_CP050915 (Acinetobacter baumannii strain DT-Ab007 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttt	Protospacer
*    ***********.*********

129. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_CP050909 (Acinetobacter baumannii strain DT-Ab022 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttt	Protospacer
*    ***********.*********

130. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_CP008707 (Acinetobacter baumannii strain AB5075-UW plasmid p1AB5075, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttt	Protospacer
*    ***********.*********

131. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_CP017643 (Acinetobacter baumannii strain KAB01 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttt	Protospacer
*    ***********.*********

132. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_CP030109 (Acinetobacter baumannii strain DA33382 plasmid pDA33382-85, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttt	Protospacer
*    ***********.*********

133. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_CP017651 (Acinetobacter baumannii strain KAB05 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttt	Protospacer
*    ***********.*********

134. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_CP020589 (Acinetobacter baumannii strain 15A34 plasmid p15A34_1, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttt	Protospacer
*    ***********.*********

135. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NC_010606 (Acinetobacter baumannii ACICU plasmid pACICU2, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttt	Protospacer
*    ***********.*********

136. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_CP042842 (Acinetobacter baumannii strain ATCC BAA-1790 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttt	Protospacer
*    ***********.*********

137. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to CP007580 (Acinetobacter baumannii AC30 plasmid pAC30c, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttt	Protospacer
*    ***********.*********

138. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_CP019115 (Acinetobacter baumannii strain MDR-CQ plasmid pMDR-CQ, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttt	Protospacer
*    ***********.*********

139. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_KU549175 (Acinetobacter baumannii strain C13 plasmid pC13-2 clone GC2, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttt	Protospacer
*    ***********.*********

140. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_KX230794 (Acinetobacter baumannii strain MAL plasmid pMAL-2, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttt	Protospacer
*    ***********.*********

141. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_CP025267 (Acinetobacter baumannii isolate SMC_Paed_Ab_BL01 plasmid pSMC_AB_BL01_1, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttt	Protospacer
*    ***********.*********

142. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_CP020593 (Acinetobacter baumannii strain USA2 plasmid pUSA2_1, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttt	Protospacer
*    ***********.*********

143. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_CP020594 (Acinetobacter baumannii strain USA15 plasmid pUSA15_1, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttt	Protospacer
*    ***********.*********

144. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_KR535992 (Acinetobacter baumannii strain A105 plasmid pA105-1, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttt	Protospacer
*    ***********.*********

145. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to CP002524 (Acinetobacter baumannii TCDC-AB0715 plasmid p2ABTCDC0715, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttt	Protospacer
*    ***********.*********

146. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_KM977710 (Acinetobacter baumannii strain D46 plasmid pD46-3, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttt	Protospacer
*    ***********.*********

147. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_CP017653 (Acinetobacter baumannii strain KAB06 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttt	Protospacer
*    ***********.*********

148. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_KF669606 (Acinetobacter baumannii strain G7 plasmid pAb-G7-2 clone GC1 (global clone 1), complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttt	Protospacer
*    ***********.*********

149. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_MK386681 (Acinetobacter baumannii strain ABAY09008 plasmid pABAY09008_1B, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttt	Protospacer
*    ***********.*********

150. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_CP024578 (Acinetobacter baumannii strain AbPK1 plasmid pAbPK1b, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttt	Protospacer
*    ***********.*********

151. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_MK243454 (Acinetobacter baumannii strain 09A16CRGN0014 plasmid pCRA914-67, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttt	Protospacer
*    ***********.*********

152. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_CP019218 (Acinetobacter baumannii strain XH731 plasmid pXH731, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttc	Protospacer
*    ***********.*********

153. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_CP021438 (Bacillus thuringiensis strain C15 plasmid pBMB172, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttgttattctattttttt	Protospacer
*    ****** **************

154. spacer 2.18|1856663|27|NC_017045|PILER-CR matches to NZ_CP035047 (Acinetobacter baumannii strain ABUH793 plasmid p74.1Kbp, complete sequence) position: , mismatch: 6, identity: 0.778

taggaatatttcttattctatttttta	CRISPR spacer
tttttatatttcttatcctattttttt	Protospacer
*    ***********.*********

155. spacer 1.2|1020536|30|NC_017045|CRISPRCasFinder matches to NC_014633 (Ilyobacter polytropus DSM 2926 plasmid pILYOP01, complete sequence) position: , mismatch: 7, identity: 0.767

gtccgttgtcggttcatctgatactatatc	CRISPR spacer
cccttttgtcggttcatctgatattattac	Protospacer
 .*. ******************.***  *

156. spacer 1.4|1020690|30|NC_017045|CRISPRCasFinder matches to NZ_CP053208 (Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1B, complete sequence) position: , mismatch: 7, identity: 0.767

attttacacgaagataaagagatgtatcta	CRISPR spacer
attttatatgaagataaagagatggctggg	Protospacer
******.*.***************  *  .

157. spacer 1.5|1020767|30|NC_017045|CRISPRCasFinder matches to MK542648 (Poxviridae sp. strain 1000-15 DNA polymerase gene, partial cds) position: , mismatch: 7, identity: 0.767

taaatgtttatttatagtttgttcggtgta	CRISPR spacer
taactgtttatttatagtttcttctaactt	Protospacer
*** **************** *** .  *

158. spacer 1.5|1020767|30|NC_017045|CRISPRCasFinder matches to MK542650 (Poxviridae sp. strain 1000-15 DNA polymerase gene, complete cds) position: , mismatch: 7, identity: 0.767

taaatgtttatttatagtttgttcggtgta	CRISPR spacer
taactgtttatttatagtttcttctaactt	Protospacer
*** **************** *** .  *

159. spacer 1.10|1021152|30|NC_017045|CRISPRCasFinder matches to MG557979 (Lactobacillus phage Lpa804, complete genome) position: , mismatch: 7, identity: 0.767

gattttcagctaattaaattatttaataaa	CRISPR spacer
acatttcagcgaattaaattctttaattga	Protospacer
.  ******* ********* ****** .*

160. spacer 1.10|1021152|30|NC_017045|CRISPRCasFinder matches to NZ_MF133442 (Klebsiella pneumoniae strain 11219 plasmid p11219-CTXM, complete sequence) position: , mismatch: 7, identity: 0.767

gattttcagctaattaaattatttaataaa	CRISPR spacer
gaagcgcatctaattaaattgtttaataat	Protospacer
**  . ** ***********.********

161. spacer 1.10|1021152|30|NC_017045|CRISPRCasFinder matches to NZ_CP044034 (Klebsiella pneumoniae strain FDAARGOS_631 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.767

gattttcagctaattaaattatttaataaa	CRISPR spacer
gaagcgcatctaattaaattgtttaataat	Protospacer
**  . ** ***********.********

162. spacer 1.10|1021152|30|NC_017045|CRISPRCasFinder matches to NC_025170 (Acinetobacter sp. M131 plasmid pM131-7, complete sequence) position: , mismatch: 7, identity: 0.767

gattttcagctaattaaattatttaataaa	CRISPR spacer
gcctgtcagccaattcaattatttaatagc	Protospacer
* .* *****.**** ************.

163. spacer 1.10|1021152|30|NC_017045|CRISPRCasFinder matches to NZ_CP036194 (Klebsiella pneumoniae strain BA34918 plasmid pIncFIB, complete sequence) position: , mismatch: 7, identity: 0.767

gattttcagctaattaaattatttaataaa	CRISPR spacer
gaagcgcatctaattaaattgtttaataat	Protospacer
**  . ** ***********.********

164. spacer 1.10|1021152|30|NC_017045|CRISPRCasFinder matches to NZ_CP027045 (Klebsiella pneumoniae strain 1_GR_13 plasmid IncFIB, complete sequence) position: , mismatch: 7, identity: 0.767

gattttcagctaattaaattatttaataaa	CRISPR spacer
gaagcgcatctaattaaattgtttaataat	Protospacer
**  . ** ***********.********

165. spacer 1.10|1021152|30|NC_017045|CRISPRCasFinder matches to NZ_CP046951 (Klebsiella pneumoniae strain BD_DM_914 plasmid punnamed2, complete sequence) position: , mismatch: 7, identity: 0.767

gattttcagctaattaaattatttaataaa	CRISPR spacer
gaagcgcatctaattaaattgtttaataat	Protospacer
**  . ** ***********.********

166. spacer 1.10|1021152|30|NC_017045|CRISPRCasFinder matches to NZ_CP046941 (Klebsiella pneumoniae strain BD_DM_697 plasmid punnamed2) position: , mismatch: 7, identity: 0.767

gattttcagctaattaaattatttaataaa	CRISPR spacer
gaagcgcatctaattaaattgtttaataat	Protospacer
**  . ** ***********.********

167. spacer 1.10|1021152|30|NC_017045|CRISPRCasFinder matches to NZ_CP020063 (Klebsiella pneumoniae strain AR_0117 plasmid unitig_2, complete sequence) position: , mismatch: 7, identity: 0.767

gattttcagctaattaaattatttaataaa	CRISPR spacer
gaagcgcatctaattaaattgtttaataat	Protospacer
**  . ** ***********.********

168. spacer 1.10|1021152|30|NC_017045|CRISPRCasFinder matches to NZ_CP035909 (Klebsiella pneumoniae strain BA4656 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.767

gattttcagctaattaaattatttaataaa	CRISPR spacer
gaagcgcatctaattaaattgtttaataat	Protospacer
**  . ** ***********.********

169. spacer 1.10|1021152|30|NC_017045|CRISPRCasFinder matches to NZ_CP046383 (Klebsiella pneumoniae strain BD_DM_782 plasmid punnamed2, complete sequence) position: , mismatch: 7, identity: 0.767

gattttcagctaattaaattatttaataaa	CRISPR spacer
gaagcgcatctaattaaattgtttaataat	Protospacer
**  . ** ***********.********

170. spacer 1.10|1021152|30|NC_017045|CRISPRCasFinder matches to NZ_CP015755 (Klebsiella pneumoniae strain W14 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.767

gattttcagctaattaaattatttaataaa	CRISPR spacer
gaagcgcatctaattaaattgtttaataat	Protospacer
**  . ** ***********.********

171. spacer 1.10|1021152|30|NC_017045|CRISPRCasFinder matches to NZ_CP044370 (Klebsiella pneumoniae strain 2018C01-046 plasmid p2018C01-046-2, complete sequence) position: , mismatch: 7, identity: 0.767

gattttcagctaattaaattatttaataaa	CRISPR spacer
gaagcgcatctaattaaattgtttaataat	Protospacer
**  . ** ***********.********

172. spacer 1.10|1021152|30|NC_017045|CRISPRCasFinder matches to NZ_CP016161 (Klebsiella pneumoniae strain TH1 isolate TH1 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.767

gattttcagctaattaaattatttaataaa	CRISPR spacer
gaagcgcatctaattaaattgtttaataat	Protospacer
**  . ** ***********.********

173. spacer 1.10|1021152|30|NC_017045|CRISPRCasFinder matches to NZ_CP044046 (Klebsiella pneumoniae strain FDAARGOS_629 plasmid unnamed4, complete sequence) position: , mismatch: 7, identity: 0.767

gattttcagctaattaaattatttaataaa	CRISPR spacer
gaagcgcatctaattaaattgtttaataat	Protospacer
**  . ** ***********.********

174. spacer 1.10|1021152|30|NC_017045|CRISPRCasFinder matches to NZ_CP032225 (Klebsiella pneumoniae strain AR_0046 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.767

gattttcagctaattaaattatttaataaa	CRISPR spacer
gaagcgcatctaattaaattgtttaataat	Protospacer
**  . ** ***********.********

175. spacer 1.10|1021152|30|NC_017045|CRISPRCasFinder matches to NZ_MF144193 (Klebsiella pneumoniae strain 205880 plasmid p205880-NR1, complete sequence) position: , mismatch: 7, identity: 0.767

gattttcagctaattaaattatttaataaa	CRISPR spacer
gaagcgcatctaattaaattgtttaataat	Protospacer
**  . ** ***********.********

176. spacer 1.10|1021152|30|NC_017045|CRISPRCasFinder matches to KT070867 (Bacillus phage PBC2, complete genome) position: , mismatch: 7, identity: 0.767

gattttc-----agctaattaaattatttaataaa	CRISPR spacer
-----tcaaagaaactaattaaatcatttaataaa	Protospacer
     **     *.**********.**********

177. spacer 1.11|1021229|30|NC_017045|CRISPRCasFinder matches to MN552143 (Lactococcus phage P1046, complete genome) position: , mismatch: 7, identity: 0.767

gacaaaataaaacagatgtgcgatgggata	CRISPR spacer
gtaaaaataaaacagatgtgctatcagact	Protospacer
*  ****************** ** .**.

178. spacer 1.11|1021229|30|NC_017045|CRISPRCasFinder matches to MK779875 (Lactococcus phage CHPC971, complete genome) position: , mismatch: 7, identity: 0.767

gacaaaataaaacagatgtgcgatgggata	CRISPR spacer
gtaaaaataaaacagatgtgctatcagact	Protospacer
*  ****************** ** .**.

179. spacer 1.14|1020537|30|NC_017045|PILER-CR matches to NC_014633 (Ilyobacter polytropus DSM 2926 plasmid pILYOP01, complete sequence) position: , mismatch: 7, identity: 0.767

gtccgttgtcggttcatctgatactatatc	CRISPR spacer
cccttttgtcggttcatctgatattattac	Protospacer
 .*. ******************.***  *

180. spacer 1.16|1020691|30|NC_017045|PILER-CR matches to NZ_CP053208 (Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1B, complete sequence) position: , mismatch: 7, identity: 0.767

attttacacgaagataaagagatgtatcta	CRISPR spacer
attttatatgaagataaagagatggctggg	Protospacer
******.*.***************  *  .

181. spacer 1.17|1020768|30|NC_017045|PILER-CR matches to MK542648 (Poxviridae sp. strain 1000-15 DNA polymerase gene, partial cds) position: , mismatch: 7, identity: 0.767

taaatgtttatttatagtttgttcggtgta	CRISPR spacer
taactgtttatttatagtttcttctaactt	Protospacer
*** **************** *** .  *

182. spacer 1.17|1020768|30|NC_017045|PILER-CR matches to MK542650 (Poxviridae sp. strain 1000-15 DNA polymerase gene, complete cds) position: , mismatch: 7, identity: 0.767

taaatgtttatttatagtttgttcggtgta	CRISPR spacer
taactgtttatttatagtttcttctaactt	Protospacer
*** **************** *** .  *

183. spacer 1.22|1021153|30|NC_017045|PILER-CR matches to MG557979 (Lactobacillus phage Lpa804, complete genome) position: , mismatch: 7, identity: 0.767

gattttcagctaattaaattatttaataaa	CRISPR spacer
acatttcagcgaattaaattctttaattga	Protospacer
.  ******* ********* ****** .*

184. spacer 1.22|1021153|30|NC_017045|PILER-CR matches to NZ_MF133442 (Klebsiella pneumoniae strain 11219 plasmid p11219-CTXM, complete sequence) position: , mismatch: 7, identity: 0.767

gattttcagctaattaaattatttaataaa	CRISPR spacer
gaagcgcatctaattaaattgtttaataat	Protospacer
**  . ** ***********.********

185. spacer 1.22|1021153|30|NC_017045|PILER-CR matches to NZ_CP044034 (Klebsiella pneumoniae strain FDAARGOS_631 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.767

gattttcagctaattaaattatttaataaa	CRISPR spacer
gaagcgcatctaattaaattgtttaataat	Protospacer
**  . ** ***********.********

186. spacer 1.22|1021153|30|NC_017045|PILER-CR matches to NC_025170 (Acinetobacter sp. M131 plasmid pM131-7, complete sequence) position: , mismatch: 7, identity: 0.767

gattttcagctaattaaattatttaataaa	CRISPR spacer
gcctgtcagccaattcaattatttaatagc	Protospacer
* .* *****.**** ************.

187. spacer 1.22|1021153|30|NC_017045|PILER-CR matches to NZ_CP036194 (Klebsiella pneumoniae strain BA34918 plasmid pIncFIB, complete sequence) position: , mismatch: 7, identity: 0.767

gattttcagctaattaaattatttaataaa	CRISPR spacer
gaagcgcatctaattaaattgtttaataat	Protospacer
**  . ** ***********.********

188. spacer 1.22|1021153|30|NC_017045|PILER-CR matches to NZ_CP027045 (Klebsiella pneumoniae strain 1_GR_13 plasmid IncFIB, complete sequence) position: , mismatch: 7, identity: 0.767

gattttcagctaattaaattatttaataaa	CRISPR spacer
gaagcgcatctaattaaattgtttaataat	Protospacer
**  . ** ***********.********

189. spacer 1.22|1021153|30|NC_017045|PILER-CR matches to NZ_CP046951 (Klebsiella pneumoniae strain BD_DM_914 plasmid punnamed2, complete sequence) position: , mismatch: 7, identity: 0.767

gattttcagctaattaaattatttaataaa	CRISPR spacer
gaagcgcatctaattaaattgtttaataat	Protospacer
**  . ** ***********.********

190. spacer 1.22|1021153|30|NC_017045|PILER-CR matches to NZ_CP046941 (Klebsiella pneumoniae strain BD_DM_697 plasmid punnamed2) position: , mismatch: 7, identity: 0.767

gattttcagctaattaaattatttaataaa	CRISPR spacer
gaagcgcatctaattaaattgtttaataat	Protospacer
**  . ** ***********.********

191. spacer 1.22|1021153|30|NC_017045|PILER-CR matches to NZ_CP020063 (Klebsiella pneumoniae strain AR_0117 plasmid unitig_2, complete sequence) position: , mismatch: 7, identity: 0.767

gattttcagctaattaaattatttaataaa	CRISPR spacer
gaagcgcatctaattaaattgtttaataat	Protospacer
**  . ** ***********.********

192. spacer 1.22|1021153|30|NC_017045|PILER-CR matches to NZ_CP035909 (Klebsiella pneumoniae strain BA4656 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.767

gattttcagctaattaaattatttaataaa	CRISPR spacer
gaagcgcatctaattaaattgtttaataat	Protospacer
**  . ** ***********.********

193. spacer 1.22|1021153|30|NC_017045|PILER-CR matches to NZ_CP046383 (Klebsiella pneumoniae strain BD_DM_782 plasmid punnamed2, complete sequence) position: , mismatch: 7, identity: 0.767

gattttcagctaattaaattatttaataaa	CRISPR spacer
gaagcgcatctaattaaattgtttaataat	Protospacer
**  . ** ***********.********

194. spacer 1.22|1021153|30|NC_017045|PILER-CR matches to NZ_CP015755 (Klebsiella pneumoniae strain W14 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.767

gattttcagctaattaaattatttaataaa	CRISPR spacer
gaagcgcatctaattaaattgtttaataat	Protospacer
**  . ** ***********.********

195. spacer 1.22|1021153|30|NC_017045|PILER-CR matches to NZ_CP044370 (Klebsiella pneumoniae strain 2018C01-046 plasmid p2018C01-046-2, complete sequence) position: , mismatch: 7, identity: 0.767

gattttcagctaattaaattatttaataaa	CRISPR spacer
gaagcgcatctaattaaattgtttaataat	Protospacer
**  . ** ***********.********

196. spacer 1.22|1021153|30|NC_017045|PILER-CR matches to NZ_CP016161 (Klebsiella pneumoniae strain TH1 isolate TH1 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.767

gattttcagctaattaaattatttaataaa	CRISPR spacer
gaagcgcatctaattaaattgtttaataat	Protospacer
**  . ** ***********.********

197. spacer 1.22|1021153|30|NC_017045|PILER-CR matches to NZ_CP044046 (Klebsiella pneumoniae strain FDAARGOS_629 plasmid unnamed4, complete sequence) position: , mismatch: 7, identity: 0.767

gattttcagctaattaaattatttaataaa	CRISPR spacer
gaagcgcatctaattaaattgtttaataat	Protospacer
**  . ** ***********.********

198. spacer 1.22|1021153|30|NC_017045|PILER-CR matches to NZ_CP032225 (Klebsiella pneumoniae strain AR_0046 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.767

gattttcagctaattaaattatttaataaa	CRISPR spacer
gaagcgcatctaattaaattgtttaataat	Protospacer
**  . ** ***********.********

199. spacer 1.22|1021153|30|NC_017045|PILER-CR matches to NZ_MF144193 (Klebsiella pneumoniae strain 205880 plasmid p205880-NR1, complete sequence) position: , mismatch: 7, identity: 0.767

gattttcagctaattaaattatttaataaa	CRISPR spacer
gaagcgcatctaattaaattgtttaataat	Protospacer
**  . ** ***********.********

200. spacer 1.22|1021153|30|NC_017045|PILER-CR matches to KT070867 (Bacillus phage PBC2, complete genome) position: , mismatch: 7, identity: 0.767

gattttc-----agctaattaaattatttaataaa	CRISPR spacer
-----tcaaagaaactaattaaatcatttaataaa	Protospacer
     **     *.**********.**********

201. spacer 1.23|1021230|30|NC_017045|PILER-CR matches to MN552143 (Lactococcus phage P1046, complete genome) position: , mismatch: 7, identity: 0.767

gacaaaataaaacagatgtgcgatgggata	CRISPR spacer
gtaaaaataaaacagatgtgctatcagact	Protospacer
*  ****************** ** .**.

202. spacer 1.23|1021230|30|NC_017045|PILER-CR matches to MK779875 (Lactococcus phage CHPC971, complete genome) position: , mismatch: 7, identity: 0.767

gacaaaataaaacagatgtgcgatgggata	CRISPR spacer
gtaaaaataaaacagatgtgctatcagact	Protospacer
*  ****************** ** .**.

203. spacer 2.5|1855934|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to NZ_CP045829 (Escherichia coli strain AUSMDU00014361 plasmid pAUSMDU00014361_02, complete sequence) position: , mismatch: 7, identity: 0.767

atagcagtagaaccatcaaacgctgtggct	CRISPR spacer
atatcagtagaaccatcaaacgagacgcca	Protospacer
*** ******************  ..* *

204. spacer 2.5|1855934|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to NZ_CP021340 (Escherichia coli strain 95NR1 plasmid p95NR1A, complete sequence) position: , mismatch: 7, identity: 0.767

atagcagtagaaccatcaaacgctgtggct	CRISPR spacer
atatcagtagaaccatcaaacgagacgcca	Protospacer
*** ******************  ..* *

205. spacer 2.5|1855934|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to NZ_CP021336 (Escherichia coli strain 95JB1 plasmid p95JB1A, complete sequence) position: , mismatch: 7, identity: 0.767

atagcagtagaaccatcaaacgctgtggct	CRISPR spacer
atatcagtagaaccatcaaacgagacgcca	Protospacer
*** ******************  ..* *

206. spacer 2.5|1855934|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to NZ_CP038378 (Escherichia coli O157:H7 strain F1273 plasmid pF1273-3, complete sequence) position: , mismatch: 7, identity: 0.767

atagcagtagaaccatcaaacgctgtggct	CRISPR spacer
atatcagtagaaccatcaaacgagacgcca	Protospacer
*** ******************  ..* *

207. spacer 2.5|1855934|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to NZ_CP027443 (Escherichia coli strain 2013C-3252 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

atagcagtagaaccatcaaacgctgtggct	CRISPR spacer
atatcagtagaaccatcaaacgagacgcca	Protospacer
*** ******************  ..* *

208. spacer 2.5|1855934|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to NZ_AP018809 (Escherichia coli strain E2865 plasmid pE2865-1, complete sequence) position: , mismatch: 7, identity: 0.767

atagcagtagaaccatcaaacgctgtggct	CRISPR spacer
atatcagtagaaccatcaaacgagacgcca	Protospacer
*** ******************  ..* *

209. spacer 2.5|1855934|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to NZ_CP027223 (Escherichia coli strain 2015C-3101 plasmid unnamed2) position: , mismatch: 7, identity: 0.767

atagcagtagaaccatcaaacgctgtggct	CRISPR spacer
atatcagtagaaccatcaaacgagacgcca	Protospacer
*** ******************  ..* *

210. spacer 2.5|1855934|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to NZ_CP027590 (Escherichia coli strain 2014C-3011 plasmid unnamed2) position: , mismatch: 7, identity: 0.767

atagcagtagaaccatcaaacgctgtggct	CRISPR spacer
atatcagtagaaccatcaaacgagacgcca	Protospacer
*** ******************  ..* *

211. spacer 2.5|1855934|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to NZ_CP013030 (Escherichia coli strain 2012C-4227 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.767

atagcagtagaaccatcaaacgctgtggct	CRISPR spacer
atatcagtagaaccatcaaacgagacgcca	Protospacer
*** ******************  ..* *

212. spacer 2.5|1855934|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to NZ_CP028125 (Escherichia coli O26 str. RM10386 plasmid pRM10386-1, complete sequence) position: , mismatch: 7, identity: 0.767

atagcagtagaaccatcaaacgctgtggct	CRISPR spacer
atatcagtagaaccatcaaacgagacgcca	Protospacer
*** ******************  ..* *

213. spacer 2.5|1855934|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to NZ_AP018798 (Escherichia coli strain E2855 plasmid pE2855-2, complete sequence) position: , mismatch: 7, identity: 0.767

atagcagtagaaccatcaaacgctgtggct	CRISPR spacer
atatcagtagaaccatcaaacgagacgcca	Protospacer
*** ******************  ..* *

214. spacer 2.5|1855934|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to NC_013370 (Escherichia coli O111:H- str. 11128 plasmid pO111_2, complete sequence) position: , mismatch: 7, identity: 0.767

atagcagtagaaccatcaaacgctgtggct	CRISPR spacer
atatcagtagaaccatcaaacgagacgcca	Protospacer
*** ******************  ..* *

215. spacer 2.5|1855934|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to NZ_CP038288 (Escherichia coli O157:H7 strain TX 376-2 plasmid pTX376-2, complete sequence) position: , mismatch: 7, identity: 0.767

atagcagtagaaccatcaaacgctgtggct	CRISPR spacer
atatcagtagaaccatcaaacgagacgcca	Protospacer
*** ******************  ..* *

216. spacer 2.5|1855934|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to MH160767 (Escherichia phage vB_EcoM-Ro157c2YLVW, complete genome) position: , mismatch: 7, identity: 0.767

atagcagtagaaccatcaaacgctgtggct	CRISPR spacer
atatcagtagaaccatcaaacgagacgcca	Protospacer
*** ******************  ..* *

217. spacer 2.5|1855934|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to HQ316603 (Cyanophage S-SSM6b genomic sequence) position: , mismatch: 7, identity: 0.767

atagcagtagaaccatcaaacgctgtggct	CRISPR spacer
atagcattagaaccatcaaactcattaagt	Protospacer
****** ************** *  *.. *

218. spacer 2.5|1855934|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to NC_020875 (Cyanophage S-SSM4 genomic sequence) position: , mismatch: 7, identity: 0.767

atagcagtagaaccatcaaacgctgtggct	CRISPR spacer
atagcattagaaccatcaaactcattaagt	Protospacer
****** ************** *  *.. *

219. spacer 2.6|1856000|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to GU580940 (Rhodococcus phage ReqiDocB7, complete genome) position: , mismatch: 7, identity: 0.767

cggcaacaaaagaaggagaagaacaaagca	CRISPR spacer
atgcatcaagagaaggagaagaacaatgac	Protospacer
  *** ***.**************** *

220. spacer 2.6|1856000|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to MN694027 (Marine virus AFVG_250M455, complete genome) position: , mismatch: 7, identity: 0.767

cggcaacaaaagaaggagaagaacaaagca	CRISPR spacer
tggcaacaaaagaagaagaagaaagactga	Protospacer
.**************.******* .*   *

221. spacer 2.6|1856000|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to MN694007 (Marine virus AFVG_250M456, complete genome) position: , mismatch: 7, identity: 0.767

cggcaacaaaagaaggagaagaacaaagca	CRISPR spacer
tggcaacaaaagaagaagaagaaagactga	Protospacer
.**************.******* .*   *

222. spacer 2.6|1856000|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to NC_030920 (Bacillus phage Eldridge, complete genome) position: , mismatch: 7, identity: 0.767

cggcaacaaaagaaggagaagaacaaagca	CRISPR spacer
aggaaacaaaagaagtagaagaacgtatta	Protospacer
 ** *********** ********. * .*

223. spacer 2.6|1856000|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to AP014376 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S42-C64, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 7, identity: 0.767

cggcaacaaaagaaggagaagaacaaagca-	CRISPR spacer
aggcaccaaaagaaggagaagag-atactat	Protospacer
 **** ****************. * * .*

224. spacer 2.7|1856066|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to NC_029029 (Brevibacillus phage Abouo, complete genome) position: , mismatch: 7, identity: 0.767

agcaacatatacgaaaatccagaaatctta	CRISPR spacer
ggcaatatatacgaaaatccagaggtactg	Protospacer
.****.*****************..* .*.

225. spacer 2.7|1856066|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to NC_029006 (Clostridium phage phiCT19406C, complete genome) position: , mismatch: 7, identity: 0.767

agcaacatatacgaaaatccagaaatctta	CRISPR spacer
ggaaacatatacgaaaacccagaacttctg	Protospacer
.* **************.****** *..*.

226. spacer 2.7|1856066|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to MH341451 (Listeria phage PSU-VKH-LP019, complete genome) position: , mismatch: 7, identity: 0.767

agcaacatatacgaaaatccagaaatctta	CRISPR spacer
ggcaacatacacgaaaatccggaactgatg	Protospacer
.********.**********.*** *  *.

227. spacer 2.7|1856066|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to MH937509 (Streptococcus phage CHPC1230, complete genome) position: , mismatch: 7, identity: 0.767

agcaacatatacgaaaatccagaaatctta	CRISPR spacer
ggcaatatctacgaaaatccagaattactt	Protospacer
.****.** *************** * .*

228. spacer 2.7|1856066|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to KC348600 (Streptococcus phage phi5218, complete genome) position: , mismatch: 7, identity: 0.767

agcaacatatacgaaaatccagaaatctta	CRISPR spacer
ggcaacatctacgaaaatccggaattggtg	Protospacer
.******* ***********.*** *  *.

229. spacer 2.12|1856396|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to MK448708 (Streptococcus phage Javan23, complete genome) position: , mismatch: 7, identity: 0.767

attttgaaaatatagaggcgataagccttt	CRISPR spacer
caatggaatatatagaggcgataaaccttg	Protospacer
   * *** ***************.****

230. spacer 2.12|1856396|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to MK448897 (Streptococcus phage Javan28, complete genome) position: , mismatch: 7, identity: 0.767

attttgaaaatatagaggcgataagccttt	CRISPR spacer
caatggaatatatagaggcgataaaccttg	Protospacer
   * *** ***************.****

231. spacer 2.14|1856528|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP031095 (Clostridium botulinum strain CFSAN034200 plasmid p1_CDC51232, complete sequence) position: , mismatch: 7, identity: 0.767

attctaaaaggtacagagaatgaagctaaa	CRISPR spacer
ataacaaaaggttcagaaaatgaagctatg	Protospacer
**  .******* ****.********** .

232. spacer 2.14|1856528|30|NC_017045|CRISPRCasFinder,CRT matches to LT960608 (Bacillus phage SBSphiJ genome assembly, complete genome: monopartite) position: , mismatch: 7, identity: 0.767

attctaaaaggtacagagaatgaa---gctaaa	CRISPR spacer
cccctaaaaggtaaagagaatgaataggct---	Protospacer
 ..********** **********   ***

233. spacer 2.14|1856528|30|NC_017045|CRISPRCasFinder,CRT matches to NC_012654 (Clostridium botulinum Ba4 str. 657 plasmid pCLJ, complete sequence) position: , mismatch: 7, identity: 0.767

attctaaaaggtacagagaatgaagctaaa	CRISPR spacer
ataacaaaaggttcagaaaatgaagctatg	Protospacer
**  .******* ****.********** .

234. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to CP008939 (Candidatus Caedibacter acanthamoebae plasmid Plasmid_00003, complete sequence) position: , mismatch: 7, identity: 0.767

tgatagga----atatttcttattctatttttta	CRISPR spacer
----aatattctatatttcttattctattttttt	Protospacer
    *. *    *********************

235. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP021787 (Acinetobacter baumannii strain A85 plasmid pA85-3, complete sequence) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttt	Protospacer
* **    ***********.*********

236. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_MG954379 (Acinetobacter baumannii strain SGH0905 plasmid pS32-2, complete sequence) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttt	Protospacer
* **    ***********.*********

237. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP023028 (Acinetobacter baumannii strain 10042 plasmid pAba10042b, complete sequence) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttt	Protospacer
* **    ***********.*********

238. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP027243 (Acinetobacter baumannii strain WCHAB005078 plasmid p1_005078, complete sequence) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttt	Protospacer
* **    ***********.*********

239. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_KY022424 (Acinetobacter baumannii strain Ab8098 plasmid pAb8098, complete sequence) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttt	Protospacer
* **    ***********.*********

240. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP035052 (Acinetobacter baumannii strain ABUH763 plasmid p74.1Kbp, complete sequence) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttt	Protospacer
* **    ***********.*********

241. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP017657 (Acinetobacter baumannii strain KAB08 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttt	Protospacer
* **    ***********.*********

242. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NC_025111 (Acinetobacter baumannii strain D72 plasmid pD72-2, complete sequence) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttt	Protospacer
* **    ***********.*********

243. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_KF889012 (Acinetobacter baumannii TYTH-1 plasmid pAB_CC, complete sequence) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttt	Protospacer
* **    ***********.*********

244. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NC_025109 (Acinetobacter baumannii strain A85 plasmid pA85-3 clone GC1 AbaR4 resistance island, complete sequence) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttt	Protospacer
* **    ***********.*********

245. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP016302 (Acinetobacter baumannii strain CMC-CR-MDR-Ab66 plasmid pCMCVTAb2-Ab66, complete sequence) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttt	Protospacer
* **    ***********.*********

246. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP016297 (Acinetobacter baumannii strain CMC-CR-MDR-Ab4 plasmid pCMCVTAb2-Ab4, complete sequence) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttt	Protospacer
* **    ***********.*********

247. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NC_017163 (Acinetobacter baumannii 1656-2 plasmid ABKp1, complete sequence) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttt	Protospacer
* **    ***********.*********

248. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP050392 (Acinetobacter baumannii strain VB11737 plasmid pVB11737_1, complete sequence) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttt	Protospacer
* **    ***********.*********

249. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP050413 (Acinetobacter baumannii strain PM192696 plasmid pPM192696_1, complete sequence) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttt	Protospacer
* **    ***********.*********

250. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP017649 (Acinetobacter baumannii strain KAB04 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttt	Protospacer
* **    ***********.*********

251. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP017649 (Acinetobacter baumannii strain KAB04 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttt	Protospacer
* **    ***********.*********

252. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP050404 (Acinetobacter baumannii strain VB2486 plasmid pVB2486_1, complete sequence) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttt	Protospacer
* **    ***********.*********

253. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_LT984690 (Acinetobacter baumannii isolate K50 plasmid I, complete sequence) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttt	Protospacer
* **    ***********.*********

254. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP029571 (Acinetobacter baumannii strain DA33098 plasmid pDA33098-71, complete sequence) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttt	Protospacer
* **    ***********.*********

255. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP039994 (Acinetobacter baumannii strain TG22182 plasmid pTG22182_1, complete sequence) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttt	Protospacer
* **    ***********.*********

256. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP014216 (Acinetobacter baumannii strain YU-R612 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttt	Protospacer
* **    ***********.*********

257. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP017655 (Acinetobacter baumannii strain KAB07 plasmid pKAB07, complete sequence) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttt	Protospacer
* **    ***********.*********

258. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP023030 (Acinetobacter baumannii strain 9102 plasmid pAba9102a, complete sequence) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttt	Protospacer
* **    ***********.*********

259. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP050915 (Acinetobacter baumannii strain DT-Ab007 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttt	Protospacer
* **    ***********.*********

260. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP050909 (Acinetobacter baumannii strain DT-Ab022 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttt	Protospacer
* **    ***********.*********

261. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP008707 (Acinetobacter baumannii strain AB5075-UW plasmid p1AB5075, complete sequence) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttt	Protospacer
* **    ***********.*********

262. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP017643 (Acinetobacter baumannii strain KAB01 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttt	Protospacer
* **    ***********.*********

263. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP030109 (Acinetobacter baumannii strain DA33382 plasmid pDA33382-85, complete sequence) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttt	Protospacer
* **    ***********.*********

264. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP017651 (Acinetobacter baumannii strain KAB05 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttt	Protospacer
* **    ***********.*********

265. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP020589 (Acinetobacter baumannii strain 15A34 plasmid p15A34_1, complete sequence) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttt	Protospacer
* **    ***********.*********

266. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NC_010606 (Acinetobacter baumannii ACICU plasmid pACICU2, complete sequence) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttt	Protospacer
* **    ***********.*********

267. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP042842 (Acinetobacter baumannii strain ATCC BAA-1790 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttt	Protospacer
* **    ***********.*********

268. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to CP007580 (Acinetobacter baumannii AC30 plasmid pAC30c, complete sequence) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttt	Protospacer
* **    ***********.*********

269. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP019115 (Acinetobacter baumannii strain MDR-CQ plasmid pMDR-CQ, complete sequence) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttt	Protospacer
* **    ***********.*********

270. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_KU549175 (Acinetobacter baumannii strain C13 plasmid pC13-2 clone GC2, complete sequence) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttt	Protospacer
* **    ***********.*********

271. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_KX230794 (Acinetobacter baumannii strain MAL plasmid pMAL-2, complete sequence) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttt	Protospacer
* **    ***********.*********

272. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP025267 (Acinetobacter baumannii isolate SMC_Paed_Ab_BL01 plasmid pSMC_AB_BL01_1, complete sequence) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttt	Protospacer
* **    ***********.*********

273. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP020593 (Acinetobacter baumannii strain USA2 plasmid pUSA2_1, complete sequence) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttt	Protospacer
* **    ***********.*********

274. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP020594 (Acinetobacter baumannii strain USA15 plasmid pUSA15_1, complete sequence) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttt	Protospacer
* **    ***********.*********

275. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_KR535992 (Acinetobacter baumannii strain A105 plasmid pA105-1, complete sequence) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttt	Protospacer
* **    ***********.*********

276. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to CP002524 (Acinetobacter baumannii TCDC-AB0715 plasmid p2ABTCDC0715, complete sequence) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttt	Protospacer
* **    ***********.*********

277. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_KM977710 (Acinetobacter baumannii strain D46 plasmid pD46-3, complete sequence) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttt	Protospacer
* **    ***********.*********

278. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP017653 (Acinetobacter baumannii strain KAB06 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttt	Protospacer
* **    ***********.*********

279. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_KF669606 (Acinetobacter baumannii strain G7 plasmid pAb-G7-2 clone GC1 (global clone 1), complete sequence) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttt	Protospacer
* **    ***********.*********

280. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_MK386681 (Acinetobacter baumannii strain ABAY09008 plasmid pABAY09008_1B, complete sequence) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttt	Protospacer
* **    ***********.*********

281. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP024578 (Acinetobacter baumannii strain AbPK1 plasmid pAbPK1b, complete sequence) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttt	Protospacer
* **    ***********.*********

282. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_MK243454 (Acinetobacter baumannii strain 09A16CRGN0014 plasmid pCRA914-67, complete sequence) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttt	Protospacer
* **    ***********.*********

283. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP019218 (Acinetobacter baumannii strain XH731 plasmid pXH731, complete sequence) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttc	Protospacer
* **    ***********.*********

284. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP035047 (Acinetobacter baumannii strain ABUH793 plasmid p74.1Kbp, complete sequence) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttt	Protospacer
* **    ***********.*********

285. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP020577 (Acinetobacter baumannii strain SSA12 plasmid pSSA12_1, complete sequence) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttt	Protospacer
* **    ***********.*********

286. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP012008 (Acinetobacter baumannii strain Ab04-mff plasmid pAB04-2, complete sequence) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttt	Protospacer
* **    ***********.*********

287. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to CP033518 (Acinetobacter baumannii strain 2008S11-069 plasmid p2008S11-069-2, complete sequence) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttc	Protospacer
* **    ***********.*********

288. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP032741 (Acinetobacter baumannii strain C25 plasmid unnamed1) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttt	Protospacer
* **    ***********.*********

289. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP032742 (Acinetobacter baumannii strain C25 plasmid unnamed2) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttt	Protospacer
* **    ***********.*********

290. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP033857 (Acinetobacter sp. FDAARGOS_493 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttt	Protospacer
* **    ***********.*********

291. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP008851 (Acinetobacter baumannii strain AC29 plasmid pAC29b, complete sequence) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttt	Protospacer
* **    ***********.*********

292. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP023033 (Acinetobacter baumannii strain 7847 plasmid pAba7847b, complete sequence) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttt	Protospacer
* **    ***********.*********

293. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to CP014292 (Acinetobacter baumannii strain AB34299 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttt	Protospacer
* **    ***********.*********

294. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP027121 (Acinetobacter baumannii strain AR_0056 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttt	Protospacer
* **    ***********.*********

295. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP020580 (Acinetobacter baumannii strain SSMA17 plasmid pSSMA17_1, complete sequence) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttt	Protospacer
* **    ***********.*********

296. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP015366 (Acinetobacter baumannii strain 3207 plasmid pAba3207b, complete sequence) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttt	Protospacer
* **    ***********.*********

297. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP017645 (Acinetobacter baumannii strain KAB02 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttt	Protospacer
* **    ***********.*********

298. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP020573 (Acinetobacter baumannii strain 15A5 plasmid p15A5_1, complete sequence) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttt	Protospacer
* **    ***********.*********

299. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP020582 (Acinetobacter baumannii strain JBA13 plasmid pJBA13_1, complete sequence) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttt	Protospacer
* **    ***********.*********

300. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP026712 (Acinetobacter baumannii strain AR_0063 plasmid unitig_2_pilon, complete sequence) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttt	Protospacer
* **    ***********.*********

301. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP017647 (Acinetobacter baumannii strain KAB03 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttt	Protospacer
* **    ***********.*********

302. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP026706 (Acinetobacter baumannii strain AR_0056 plasmid tig00000059_pilon, complete sequence) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttt	Protospacer
* **    ***********.*********

303. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP033245 (Acinetobacter baumannii strain 7835 plasmid pAba7835b, complete sequence) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
ttatttttatatttcttatcctattttttt	Protospacer
* **    ***********.*********

304. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to AP014361 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S40-C80, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 7, identity: 0.767

tgataggaatatttcttattctatttttta	CRISPR spacer
acttagggttatttcttattctatttgata	Protospacer
   ****. *****************  **

305. spacer 2.19|1856729|28|NC_017045|PILER-CR matches to NZ_CP033045 (Bacillus foraminis strain Bac44 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.75

caaacggaaaaatatgtttattccgttg	CRISPR spacer
ggttcggaaaaatattttaattccgtta	Protospacer
 .  *********** ** ********.

306. spacer 1.3|1020613|30|NC_017045|CRISPRCasFinder matches to MN693807 (Marine virus AFVG_250M375, complete genome) position: , mismatch: 8, identity: 0.733

tgggatttgacaaaaccttacctcaaagac	CRISPR spacer
gatgatttgacaaaaccttcccttaaactt	Protospacer
 . **************** ***.***  .

307. spacer 1.3|1020613|30|NC_017045|CRISPRCasFinder matches to MN693807 (Marine virus AFVG_250M375, complete genome) position: , mismatch: 8, identity: 0.733

tgggatttgacaaaaccttacctcaaagac	CRISPR spacer
gatgatttgacaaaaccttcccttaaactt	Protospacer
 . **************** ***.***  .

308. spacer 1.7|1020921|30|NC_017045|CRISPRCasFinder matches to NZ_CP049914 (Vibrio sp. HDW18 plasmid p_unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

gcaatgaataactatatggaagccttgaaa	CRISPR spacer
gatgtgcataactatatggaaaccttggtt	Protospacer
*  .** **************.*****.

309. spacer 1.8|1020998|30|NC_017045|CRISPRCasFinder matches to NC_018980 (Borrelia burgdorferi 297 plasmid 297_cp32-7, complete sequence) position: , mismatch: 8, identity: 0.733

aacattgcaataaaactaataaacgaagta	CRISPR spacer
aacatttcaataaaactaatagatttgatg	Protospacer
****** **************.*.  ..*.

310. spacer 1.11|1021229|30|NC_017045|CRISPRCasFinder matches to MT446421 (UNVERIFIED: Escherichia virus TH55, complete genome) position: , mismatch: 8, identity: 0.733

gacaaaataaaacagatgtgcgatgggata	CRISPR spacer
cagaaattaaaagagatgtgcgatggttgc	Protospacer
 * *** ***** *************

311. spacer 1.11|1021229|30|NC_017045|CRISPRCasFinder matches to NC_028894 (Enterobacteria phage vB_EcoM_VR20, complete genome) position: , mismatch: 8, identity: 0.733

gacaaaataaaacagatgtgcgatgggata	CRISPR spacer
cagaaattaaaagagatgtgcgatggttgc	Protospacer
 * *** ***** *************

312. spacer 1.11|1021229|30|NC_017045|CRISPRCasFinder matches to MT446420 (UNVERIFIED: Escherichia virus TH54, complete genome) position: , mismatch: 8, identity: 0.733

gacaaaataaaacagatgtgcgatgggata	CRISPR spacer
cagaaattaaaagagatgtgcgatggttgc	Protospacer
 * *** ***** *************

313. spacer 1.11|1021229|30|NC_017045|CRISPRCasFinder matches to MT446412 (UNVERIFIED: Escherichia virus TH41, complete genome) position: , mismatch: 8, identity: 0.733

gacaaaataaaacagatgtgcgatgggata	CRISPR spacer
cagaaattaaaagagatgtgcgatggttgc	Protospacer
 * *** ***** *************

314. spacer 1.11|1021229|30|NC_017045|CRISPRCasFinder matches to MT446422 (UNVERIFIED: Escherichia virus TH57, complete genome) position: , mismatch: 8, identity: 0.733

gacaaaataaaacagatgtgcgatgggata	CRISPR spacer
cagaaattaaaagagatgtgcgatggttgc	Protospacer
 * *** ***** *************

315. spacer 1.11|1021229|30|NC_017045|CRISPRCasFinder matches to MT446396 (UNVERIFIED: Escherichia virus TH22, complete genome) position: , mismatch: 8, identity: 0.733

gacaaaataaaacagatgtgcgatgggata	CRISPR spacer
cagaaattaaaagagatgtgcgatggttgc	Protospacer
 * *** ***** *************

316. spacer 1.12|1021306|30|NC_017045|CRISPRCasFinder matches to NZ_CP029365 (Escherichia coli strain WCHEC035148 plasmid p1_035148, complete sequence) position: , mismatch: 8, identity: 0.733

aactactttctaaagcattacaattaagaa	CRISPR spacer
acacgctttctacagcattacagttaagtg	Protospacer
*  ..******* *********.***** .

317. spacer 1.12|1021306|30|NC_017045|CRISPRCasFinder matches to MW067003 (CrAssphage sp. C0531BW4, complete genome) position: , mismatch: 8, identity: 0.733

aactactttctaaagcattacaattaagaa	CRISPR spacer
ccatactttgtaaagcattataattattta	Protospacer
   ****** **********.*****   *

318. spacer 1.12|1021306|30|NC_017045|CRISPRCasFinder matches to MK238400 (CrAssphage ZA, complete genome) position: , mismatch: 8, identity: 0.733

aactactttctaaagcattacaattaagaa	CRISPR spacer
ccatactttgtaaagcattataattattta	Protospacer
   ****** **********.*****   *

319. spacer 1.12|1021306|30|NC_017045|CRISPRCasFinder matches to MK069403 (UNVERIFIED: CrAssphage sp. O-152, partial genome) position: , mismatch: 8, identity: 0.733

aactactttctaaagcattacaattaagaa	CRISPR spacer
ccatactttgtaaagcattataattattta	Protospacer
   ****** **********.*****   *

320. spacer 1.12|1021306|30|NC_017045|CRISPRCasFinder matches to MT006214 (CrAssphage LMMB, complete genome) position: , mismatch: 8, identity: 0.733

aactactttctaaagcattacaattaagaa	CRISPR spacer
ccatactttgtaaagcattataattattta	Protospacer
   ****** **********.*****   *

321. spacer 1.15|1020614|30|NC_017045|PILER-CR matches to MN693807 (Marine virus AFVG_250M375, complete genome) position: , mismatch: 8, identity: 0.733

tgggatttgacaaaaccttacctcaaagac	CRISPR spacer
gatgatttgacaaaaccttcccttaaactt	Protospacer
 . **************** ***.***  .

322. spacer 1.15|1020614|30|NC_017045|PILER-CR matches to MN693807 (Marine virus AFVG_250M375, complete genome) position: , mismatch: 8, identity: 0.733

tgggatttgacaaaaccttacctcaaagac	CRISPR spacer
gatgatttgacaaaaccttcccttaaactt	Protospacer
 . **************** ***.***  .

323. spacer 1.19|1020922|30|NC_017045|PILER-CR matches to NZ_CP049914 (Vibrio sp. HDW18 plasmid p_unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

gcaatgaataactatatggaagccttgaaa	CRISPR spacer
gatgtgcataactatatggaaaccttggtt	Protospacer
*  .** **************.*****.

324. spacer 1.20|1020999|30|NC_017045|PILER-CR matches to NC_018980 (Borrelia burgdorferi 297 plasmid 297_cp32-7, complete sequence) position: , mismatch: 8, identity: 0.733

aacattgcaataaaactaataaacgaagta	CRISPR spacer
aacatttcaataaaactaatagatttgatg	Protospacer
****** **************.*.  ..*.

325. spacer 1.23|1021230|30|NC_017045|PILER-CR matches to MT446421 (UNVERIFIED: Escherichia virus TH55, complete genome) position: , mismatch: 8, identity: 0.733

gacaaaataaaacagatgtgcgatgggata	CRISPR spacer
cagaaattaaaagagatgtgcgatggttgc	Protospacer
 * *** ***** *************

326. spacer 1.23|1021230|30|NC_017045|PILER-CR matches to NC_028894 (Enterobacteria phage vB_EcoM_VR20, complete genome) position: , mismatch: 8, identity: 0.733

gacaaaataaaacagatgtgcgatgggata	CRISPR spacer
cagaaattaaaagagatgtgcgatggttgc	Protospacer
 * *** ***** *************

327. spacer 1.23|1021230|30|NC_017045|PILER-CR matches to MT446420 (UNVERIFIED: Escherichia virus TH54, complete genome) position: , mismatch: 8, identity: 0.733

gacaaaataaaacagatgtgcgatgggata	CRISPR spacer
cagaaattaaaagagatgtgcgatggttgc	Protospacer
 * *** ***** *************

328. spacer 1.23|1021230|30|NC_017045|PILER-CR matches to MT446412 (UNVERIFIED: Escherichia virus TH41, complete genome) position: , mismatch: 8, identity: 0.733

gacaaaataaaacagatgtgcgatgggata	CRISPR spacer
cagaaattaaaagagatgtgcgatggttgc	Protospacer
 * *** ***** *************

329. spacer 1.23|1021230|30|NC_017045|PILER-CR matches to MT446422 (UNVERIFIED: Escherichia virus TH57, complete genome) position: , mismatch: 8, identity: 0.733

gacaaaataaaacagatgtgcgatgggata	CRISPR spacer
cagaaattaaaagagatgtgcgatggttgc	Protospacer
 * *** ***** *************

330. spacer 1.23|1021230|30|NC_017045|PILER-CR matches to MT446396 (UNVERIFIED: Escherichia virus TH22, complete genome) position: , mismatch: 8, identity: 0.733

gacaaaataaaacagatgtgcgatgggata	CRISPR spacer
cagaaattaaaagagatgtgcgatggttgc	Protospacer
 * *** ***** *************

331. spacer 1.24|1021307|30|NC_017045|PILER-CR matches to NZ_CP029365 (Escherichia coli strain WCHEC035148 plasmid p1_035148, complete sequence) position: , mismatch: 8, identity: 0.733

aactactttctaaagcattacaattaagaa	CRISPR spacer
acacgctttctacagcattacagttaagtg	Protospacer
*  ..******* *********.***** .

332. spacer 1.24|1021307|30|NC_017045|PILER-CR matches to MW067003 (CrAssphage sp. C0531BW4, complete genome) position: , mismatch: 8, identity: 0.733

aactactttctaaagcattacaattaagaa	CRISPR spacer
ccatactttgtaaagcattataattattta	Protospacer
   ****** **********.*****   *

333. spacer 1.24|1021307|30|NC_017045|PILER-CR matches to MK238400 (CrAssphage ZA, complete genome) position: , mismatch: 8, identity: 0.733

aactactttctaaagcattacaattaagaa	CRISPR spacer
ccatactttgtaaagcattataattattta	Protospacer
   ****** **********.*****   *

334. spacer 1.24|1021307|30|NC_017045|PILER-CR matches to MK069403 (UNVERIFIED: CrAssphage sp. O-152, partial genome) position: , mismatch: 8, identity: 0.733

aactactttctaaagcattacaattaagaa	CRISPR spacer
ccatactttgtaaagcattataattattta	Protospacer
   ****** **********.*****   *

335. spacer 1.24|1021307|30|NC_017045|PILER-CR matches to MT006214 (CrAssphage LMMB, complete genome) position: , mismatch: 8, identity: 0.733

aactactttctaaagcattacaattaagaa	CRISPR spacer
ccatactttgtaaagcattataattattta	Protospacer
   ****** **********.*****   *

336. spacer 2.5|1855934|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to KJ419279 (Enterobacteria phage 9g, complete genome) position: , mismatch: 8, identity: 0.733

atagcagtagaaccatcaaacgctgtggct	CRISPR spacer
atatcagtagaaccatcaaacgaaacacca	Protospacer
*** ******************  ... *

337. spacer 2.6|1856000|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to AJ344259 (Sulfolobus virus SIRV-2 genomic DNA) position: , mismatch: 8, identity: 0.733

cggcaacaaaagaaggagaagaacaaagca	CRISPR spacer
ctttaacaaaagaagaagaagaacaattat	Protospacer
*  .***********.**********

338. spacer 2.6|1856000|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to NZ_CP030852 (Runella sp. HYN0085 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.733

cggcaacaaaagaaggagaagaacaaagca	CRISPR spacer
tgaatacaaaagaaggagaagaaaatagtc	Protospacer
.*.  ****************** * **.

339. spacer 2.6|1856000|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to MN693856 (Marine virus AFVG_250M393, complete genome) position: , mismatch: 8, identity: 0.733

cggcaacaaaagaaggagaagaacaaagca	CRISPR spacer
caaaaacaaaataaggagaagaaaaaatgg	Protospacer
*.. ******* *********** ***  .

340. spacer 2.7|1856066|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to MN905160 (Pseudomonas phage PE09, complete genome) position: , mismatch: 8, identity: 0.733

agcaacatatacgaaaatccagaaatctta	CRISPR spacer
agcaacgtctacgaaaatccagacgacagt	Protospacer
******.* ************** . *

341. spacer 2.7|1856066|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to MF360958 (Salicola phage SCTP-2, complete genome) position: , mismatch: 8, identity: 0.733

agcaacatatacgaaaatccagaaatctta	CRISPR spacer
ggaaacatttacgaaaatcccgaaattaac	Protospacer
.* ***** *********** *****.

342. spacer 2.10|1856264|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to MN856071 (Myoviridae sp. isolate 215, complete genome) position: , mismatch: 8, identity: 0.733

tctgcatctacgaaggtgatgaggaaaagg	CRISPR spacer
aaattaactatgacggtgatgaggaaaagg	Protospacer
    .* ***.** ****************

343. spacer 2.11|1856330|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to NZ_CP033045 (Bacillus foraminis strain Bac44 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

caataggacctattatatttacaacaacag	CRISPR spacer
caacaggacctattatatttaggtgattat	Protospacer
***.***************** .  * .*

344. spacer 2.12|1856396|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to JQ680374 (Unidentified phage clone 2209_scaffold441 genomic sequence) position: , mismatch: 8, identity: 0.733

attttgaaaatatagaggcgataagccttt	CRISPR spacer
attttgaaaatatacaggccatacggtcgg	Protospacer
************** **** *** * ..

345. spacer 2.12|1856396|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to MK448834 (Streptococcus phage Javan91, complete genome) position: , mismatch: 8, identity: 0.733

attttgaaaatatagaggcgataagccttt	CRISPR spacer
taatcaaatatatagaggtgataagccttg	Protospacer
   *..** *********.**********

346. spacer 2.12|1856396|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to MK449009 (Streptococcus phage Javan88, complete genome) position: , mismatch: 8, identity: 0.733

attttgaaaatatagaggcgataagccttt	CRISPR spacer
taatcaaatatatagaggtgataagccttg	Protospacer
   *..** *********.**********

347. spacer 2.13|1856462|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to JF974300 (Synechococcus phage S-CBP42, *** SEQUENCING IN PROGRESS ***, 8 unordered pieces) position: , mismatch: 8, identity: 0.733

taagaactttgtagatgaaagtggtaatct	CRISPR spacer
tggatcctttgtagatgacagtggtaatag	Protospacer
*...  ************ *********

348. spacer 2.13|1856462|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to KC310805 (Synechococcus phage S-CBP42, complete genome) position: , mismatch: 8, identity: 0.733

taagaactttgtagatgaaagtggtaatct	CRISPR spacer
tggatcctttgtagatgacagtggtaatag	Protospacer
*...  ************ *********

349. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP021438 (Bacillus thuringiensis strain C15 plasmid pBMB172, complete sequence) position: , mismatch: 8, identity: 0.733

tgataggaatatttcttattctatttttta	CRISPR spacer
agttttttatatttgttattctattttttt	Protospacer
 * *    ****** **************

350. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP039703 (Clostridium butyricum strain 29-1 plasmid p-butyl_plas_29-1, complete sequence) position: , mismatch: 8, identity: 0.733

tgataggaatatttcttattctatttttta	CRISPR spacer
agctttgaatatttctttttctattttagg	Protospacer
 * *  *********** *********  .

351. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP015497 (Lactobacillus helveticus strain FAM8105 plasmid pFAM8105, complete sequence) position: , mismatch: 8, identity: 0.733

tgataggaatatttcttattctatttttta	CRISPR spacer
gaaaaaacctatttctttttctatttttta	Protospacer
 .* *..  ******** ************

352. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP012891 (Lactobacillus gallinarum strain HFD4 plasmid pMKG01, complete sequence) position: , mismatch: 8, identity: 0.733

tgataggaatatttcttattctatttttta	CRISPR spacer
gaaaaaacctatttctttttctatttttta	Protospacer
 .* *..  ******** ************

353. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP012891 (Lactobacillus gallinarum strain HFD4 plasmid pMKG01, complete sequence) position: , mismatch: 8, identity: 0.733

tgataggaatatttcttattctatttttta	CRISPR spacer
gaaaaaacctatttctttttctatttttta	Protospacer
 .* *..  ******** ************

354. spacer 2.16|1856660|30|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP012891 (Lactobacillus gallinarum strain HFD4 plasmid pMKG01, complete sequence) position: , mismatch: 8, identity: 0.733

tgataggaatatttcttattctatttttta	CRISPR spacer
gaaaaaacctatttctttttctatttttta	Protospacer
 .* *..  ******** ************

355. spacer 2.17|1856726|31|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP026282 (Klebsiella oxytoca strain KONIH2 plasmid pKOR-e3cb, complete sequence) position: , mismatch: 8, identity: 0.742

tcacaaacggaaaaatatgtttattccgttg	CRISPR spacer
agcagaacggacaaatatgttttttccgtgg	Protospacer
    .****** ********** ****** *

356. spacer 2.17|1856726|31|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP041047 (Citrobacter sp. CF971 plasmid pBM527-1, complete sequence) position: , mismatch: 8, identity: 0.742

tcacaaacggaaaaatatgtttattccgttg	CRISPR spacer
agcagaacggacaaatatgttttttccgtgg	Protospacer
    .****** ********** ****** *

357. spacer 2.17|1856726|31|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP050835 (Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-1, complete sequence) position: , mismatch: 8, identity: 0.742

tcacaaacggaaaaatatgtttattccgttg	CRISPR spacer
agcagaacggacaaatatgttttttccgtgg	Protospacer
    .****** ********** ****** *

358. spacer 2.17|1856726|31|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP037735 (Citrobacter freundii strain CAV1857 plasmid pCAV1857-208, complete sequence) position: , mismatch: 8, identity: 0.742

tcacaaacggaaaaatatgtttattccgttg	CRISPR spacer
agcagaacggacaaatatgttttttccgtgg	Protospacer
    .****** ********** ****** *

359. spacer 2.17|1856726|31|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP035215 (Klebsiella michiganensis strain M82255 plasmid pKOCBH-A, complete sequence) position: , mismatch: 8, identity: 0.742

tcacaaacggaaaaatatgtttattccgttg	CRISPR spacer
agcagaacggacaaatatgttttttccgtgg	Protospacer
    .****** ********** ****** *

360. spacer 2.17|1856726|31|NC_017045|CRISPRCasFinder,CRT matches to CP045556 (Citrobacter sp. S39 plasmid pS39-1, complete sequence) position: , mismatch: 8, identity: 0.742

tcacaaacggaaaaatatgtttattccgttg	CRISPR spacer
agcagaacggacaaatatgttttttccgtgg	Protospacer
    .****** ********** ****** *

361. spacer 2.17|1856726|31|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP045203 (Citrobacter sp. NMI7904_11 plasmid pCTEL-2, complete sequence) position: , mismatch: 8, identity: 0.742

tcacaaacggaaaaatatgtttattccgttg	CRISPR spacer
agcagaacggacaaatatgttttttccgtgg	Protospacer
    .****** ********** ****** *

362. spacer 2.17|1856726|31|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP042535 (Citrobacter freundii strain E51 plasmid pE51_001, complete sequence) position: , mismatch: 8, identity: 0.742

tcacaaacggaaaaatatgtttattccgttg	CRISPR spacer
agcagaacggacaaatatgttttttccgtgg	Protospacer
    .****** ********** ****** *

363. spacer 2.17|1856726|31|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP022152 (Citrobacter freundii strain 705SK3 plasmid p705SK3_1, complete sequence) position: , mismatch: 8, identity: 0.742

tcacaaacggaaaaatatgtttattccgttg	CRISPR spacer
agcagaacggacaaatatgttttttccgtgg	Protospacer
    .****** ********** ****** *

364. spacer 2.17|1856726|31|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP030224 (Salmonella enterica strain SA20083039 plasmid pSA20083039.1, complete sequence) position: , mismatch: 8, identity: 0.742

tcacaaacggaaaaatatgtttattccgttg	CRISPR spacer
agcagaacggacaaatatgttttttccgtgg	Protospacer
    .****** ********** ****** *

365. spacer 2.17|1856726|31|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP041248 (Raoultella electrica strain DSM 102253 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

tcacaaacggaaaaatatgtttattccgttg	CRISPR spacer
agcagaacggacaaatatgttttttccgtgg	Protospacer
    .****** ********** ****** *

366. spacer 2.17|1856726|31|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP026058 (Citrobacter freundii strain FDAARGOS_73 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

tcacaaacggaaaaatatgtttattccgttg	CRISPR spacer
agcagaacggacaaatatgttttttccgtgg	Protospacer
    .****** ********** ****** *

367. spacer 2.17|1856726|31|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP029436 (Klebsiella quasipneumoniae strain CAV2013 plasmid pKPC_CAV2013, complete sequence) position: , mismatch: 8, identity: 0.742

tcacaaacggaaaaatatgtttattccgttg	CRISPR spacer
agcagaacggacaaatatgttttttccgtgg	Protospacer
    .****** ********** ****** *

368. spacer 2.17|1856726|31|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP029431 (Klebsiella quasipneumoniae strain CAV2018 plasmid pKPC_CAV2018-435, complete sequence) position: , mismatch: 8, identity: 0.742

tcacaaacggaaaaatatgtttattccgttg	CRISPR spacer
agcagaacggacaaatatgttttttccgtgg	Protospacer
    .****** ********** ****** *

369. spacer 2.17|1856726|31|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP011611 (Citrobacter freundii strain CAV1321 plasmid pKPC_CAV1321-244, complete sequence) position: , mismatch: 8, identity: 0.742

tcacaaacggaaaaatatgtttattccgttg	CRISPR spacer
agcagaacggacaaatatgttttttccgtgg	Protospacer
    .****** ********** ****** *

370. spacer 2.17|1856726|31|NC_017045|CRISPRCasFinder,CRT matches to CP052139 (Klebsiella pneumoniae strain F17KP0040 plasmid pF17KP0040-1, complete sequence) position: , mismatch: 8, identity: 0.742

tcacaaacggaaaaatatgtttattccgttg	CRISPR spacer
agcagaacggacaaatatgttttttccgtgg	Protospacer
    .****** ********** ****** *

371. spacer 2.17|1856726|31|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP026234 (Citrobacter freundii complex sp. CFNIH4 plasmid pCFR-4109, complete sequence) position: , mismatch: 8, identity: 0.742

tcacaaacggaaaaatatgtttattccgttg	CRISPR spacer
agcagaacggacaaatatgttttttccgtgg	Protospacer
    .****** ********** ****** *

372. spacer 2.17|1856726|31|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP018017 (Kosakonia radicincitans DSM 16656 plasmid pKrDSM16656L, complete sequence) position: , mismatch: 8, identity: 0.742

tcacaaacggaaaaatatgtttattccgttg	CRISPR spacer
agcagaacggacaaatatgttttttccgtgg	Protospacer
    .****** ********** ****** *

373. spacer 2.17|1856726|31|NC_017045|CRISPRCasFinder,CRT matches to NZ_MG387191 (Citrobacter freundii strain 2262 plasmid pTEM-2262, complete sequence) position: , mismatch: 8, identity: 0.742

tcacaaacggaaaaatatgtttattccgttg	CRISPR spacer
agcagaacggacaaatatgttttttccgtgg	Protospacer
    .****** ********** ****** *

374. spacer 2.17|1856726|31|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP029442 (Klebsiella quasipneumoniae strain CAV1947 plasmid pKPC_CAV1947-412, complete sequence) position: , mismatch: 8, identity: 0.742

tcacaaacggaaaaatatgtttattccgttg	CRISPR spacer
agcagaacggacaaatatgttttttccgtgg	Protospacer
    .****** ********** ****** *

375. spacer 1.10|1021152|30|NC_017045|CRISPRCasFinder matches to NZ_CP028863 (Borreliella garinii strain 20047 plasmid lp28-4, complete sequence) position: , mismatch: 9, identity: 0.7

gattttcagctaattaaattatttaataaa	CRISPR spacer
agtttacagctaataaaattatttatactt	Protospacer
..*** ******** **********

376. spacer 1.10|1021152|30|NC_017045|CRISPRCasFinder matches to NC_007773 (Clostridium perfringens plasmid pCPF5603, complete sequence) position: , mismatch: 9, identity: 0.7

gattttcagctaattaaattatttaataaa	CRISPR spacer
tcattttatctaattaaattatttaaattt	Protospacer
   ***.* *****************

377. spacer 1.22|1021153|30|NC_017045|PILER-CR matches to NZ_CP028863 (Borreliella garinii strain 20047 plasmid lp28-4, complete sequence) position: , mismatch: 9, identity: 0.7

gattttcagctaattaaattatttaataaa	CRISPR spacer
agtttacagctaataaaattatttatactt	Protospacer
..*** ******** **********

378. spacer 1.22|1021153|30|NC_017045|PILER-CR matches to NC_007773 (Clostridium perfringens plasmid pCPF5603, complete sequence) position: , mismatch: 9, identity: 0.7

gattttcagctaattaaattatttaataaa	CRISPR spacer
tcattttatctaattaaattatttaaattt	Protospacer
   ***.* *****************

379. spacer 2.6|1856000|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to CP052419 (Klebsiella pneumoniae strain C16KP0189 plasmid pC16KP0189-5, complete sequence) position: , mismatch: 9, identity: 0.7

cggcaacaaaagaaggagaagaacaaagca	CRISPR spacer
aacaaaaaaaagaagaagaagaacaaaaat	Protospacer
 .  ** ********.***********.

380. spacer 2.6|1856000|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to NZ_CP029435 (Klebsiella quasipneumoniae strain CAV2013 plasmid pCAV2013-156, complete sequence) position: , mismatch: 9, identity: 0.7

cggcaacaaaagaaggagaagaacaaagca	CRISPR spacer
aacaaaaaaaagaagaagaagaacaaaaat	Protospacer
 .  ** ********.***********.

381. spacer 2.6|1856000|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to NZ_CP029430 (Klebsiella quasipneumoniae strain CAV2018 plasmid pCAV2018-177, complete sequence) position: , mismatch: 9, identity: 0.7

cggcaacaaaagaaggagaagaacaaagca	CRISPR spacer
aacaaaaaaaagaagaagaagaacaaaaat	Protospacer
 .  ** ********.***********.

382. spacer 2.6|1856000|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to CP052482 (Klebsiella pneumoniae strain C16KP0050 plasmid pC16KP0050-6, complete sequence) position: , mismatch: 9, identity: 0.7

cggcaacaaaagaaggagaagaacaaagca	CRISPR spacer
aacaaaaaaaagaagaagaagaacaaaaat	Protospacer
 .  ** ********.***********.

383. spacer 2.6|1856000|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to NZ_CP029441 (Klebsiella quasipneumoniae strain CAV1947 plasmid pCAV1947-173, complete sequence) position: , mismatch: 9, identity: 0.7

cggcaacaaaagaaggagaagaacaaagca	CRISPR spacer
aacaaaaaaaagaagaagaagaacaaaaat	Protospacer
 .  ** ********.***********.

384. spacer 2.6|1856000|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to NZ_CP044041 (Klebsiella pneumoniae strain FDAARGOS_630 plasmid unnamed6) position: , mismatch: 9, identity: 0.7

cggcaacaaaagaaggagaagaacaaagca	CRISPR spacer
aacaaaaaaaagaagaagaagaacaaaaat	Protospacer
 .  ** ********.***********.

385. spacer 2.6|1856000|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to NZ_CP044379 (Klebsiella pneumoniae strain 2018S06-082 plasmid p2018S06-082-3, complete sequence) position: , mismatch: 9, identity: 0.7

cggcaacaaaagaaggagaagaacaaagca	CRISPR spacer
aacaaaaaaaagaagaagaagaacaaaaat	Protospacer
 .  ** ********.***********.

386. spacer 2.6|1856000|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to CP052475 (Klebsiella pneumoniae strain C16KP0053 plasmid pC16KP0053-7, complete sequence) position: , mismatch: 9, identity: 0.7

cggcaacaaaagaaggagaagaacaaagca	CRISPR spacer
aacaaaaaaaagaagaagaagaacaaaaat	Protospacer
 .  ** ********.***********.

387. spacer 2.6|1856000|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to MN694379 (Marine virus AFVG_250M394, complete genome) position: , mismatch: 9, identity: 0.7

cggcaacaaaagaaggagaagaacaaagca	CRISPR spacer
taaaaacaaaataaggagaagaaaaaatgg	Protospacer
... ******* *********** ***  .

388. spacer 2.7|1856066|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to NC_019746 (Gloeocapsa sp. PCC 7428 plasmid pGLO7428.01, complete sequence) position: , mismatch: 9, identity: 0.7

agcaacatatacgaaaatccagaaatctta	CRISPR spacer
agcaacgtctacgaaaatccagatggtact	Protospacer
******.* ************** . . .

389. spacer 2.13|1856462|30|NC_017045|CRISPRCasFinder,PILER-CR,CRT matches to AP014357 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S39-C89, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 9, identity: 0.7

taagaactttgtagatgaaagtggtaatct	CRISPR spacer
actatactttgtatatgaaagtggtatttg	Protospacer
   . ******** ************ *.

390. spacer 1.1|1020459|30|NC_017045|CRISPRCasFinder matches to MT028297 (Proteus phage Privateer, complete genome) position: , mismatch: 10, identity: 0.667

tatctgcacaggagaaaatagagtcaatca	CRISPR spacer
tatctgcacaagagaaaataggaaagtctg	Protospacer
**********.**********..  . ...

391. spacer 1.1|1020459|30|NC_017045|CRISPRCasFinder matches to MT740244 (Proteus phage 3H10_20, partial genome) position: , mismatch: 10, identity: 0.667

tatctgcacaggagaaaatagagtcaatca	CRISPR spacer
tatctgcacaagagaaaataggaaagtctg	Protospacer
**********.**********..  . ...

392. spacer 1.13|1020460|30|NC_017045|PILER-CR matches to MT028297 (Proteus phage Privateer, complete genome) position: , mismatch: 10, identity: 0.667

tatctgcacaggagaaaatagagtcaatca	CRISPR spacer
tatctgcacaagagaaaataggaaagtctg	Protospacer
**********.**********..  . ...

393. spacer 1.13|1020460|30|NC_017045|PILER-CR matches to MT740244 (Proteus phage 3H10_20, partial genome) position: , mismatch: 10, identity: 0.667

tatctgcacaggagaaaatagagtcaatca	CRISPR spacer
tatctgcacaagagaaaataggaaagtctg	Protospacer
**********.**********..  . ...

394. spacer 2.17|1856726|31|NC_017045|CRISPRCasFinder,CRT matches to NZ_CP033045 (Bacillus foraminis strain Bac44 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.677

tcacaaacggaaaaatatgtttattccgttg	CRISPR spacer
gagggttcggaaaaatattttaattccgtta	Protospacer
  . .  *********** ** ********.

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

94713 : 136712

Riemerella_phage(96.61%)

tail,terminase,capsid,portal,integrase

attL 94538:94556|attR 121551:121569

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
94538:94556	attL	NA	NA	NA	NA
WP_014411186.1\|94713_95661_+	thioredoxin-disulfide reductase	A0A2I2L5E1	Orpheovirus	6.1e-66	45.5
WP_004917802.1\|95817_96180_+	fluoride efflux transporter CrcB	A0A2H4PQR0	Staphylococcus_phage	3.0e-13	38.1
WP_004917806.1\|96425_97670_+\|integrase	tyrosine-type recombinase/integrase	F5A3G8	Riemerella_phage	8.2e-244	100.0
WP_004917808.1\|97708_97891_-	helix-turn-helix transcriptional regulator	F5A3G9	Riemerella_phage	6.5e-25	100.0
WP_004917809.1\|97890_98232_-	hypothetical protein	F5A3H0	Riemerella_phage	2.5e-62	100.0
WP_004917811.1\|98553_99165_-	hypothetical protein	F5A3H1	Riemerella_phage	3.5e-107	100.0
WP_004917814.1\|99530_99809_+	helix-turn-helix transcriptional regulator	F5A3H2	Riemerella_phage	3.1e-42	100.0
WP_004917816.1\|99830_100178_+	hypothetical protein	F5A394	Riemerella_phage	7.0e-60	100.0
WP_004917818.1\|100419_100974_-	N-acetylmuramoyl-L-alanine amidase	E7D0G0	Riemerella_phage	1.1e-104	100.0
WP_013447228.1\|100996_101575_-	hypothetical protein	F5A395	Riemerella_phage	4.4e-91	95.3
WP_004917822.1\|101564_102086_-	hypothetical protein	F5A396	Riemerella_phage	2.1e-92	100.0
WP_004917824.1\|102082_102415_-	hypothetical protein	F5A397	Riemerella_phage	1.5e-56	100.0
WP_004917828.1\|102398_102722_-	hypothetical protein	F5A398	Riemerella_phage	3.8e-52	100.0
WP_013447229.1\|102748_106642_-\|tail	phage tail protein	F5A399	Riemerella_phage	0.0e+00	74.6
WP_013447230.1\|106629_107733_-	galactose-binding protein	F5A3A0	Riemerella_phage	1.7e-123	66.2
WP_004917834.1\|107729_108161_-	hypothetical protein	F5A3A1	Riemerella_phage	1.1e-59	100.0
WP_004917835.1\|108217_108511_+	type II toxin-antitoxin system HigB family toxin	F5A3A2	Riemerella_phage	1.7e-51	100.0
WP_004917838.1\|108507_108870_+	helix-turn-helix domain-containing protein	F5A3A3	Riemerella_phage	4.7e-59	100.0
WP_013447231.1\|108872_113054_-	tape measure protein	F5A3A4	Riemerella_phage	0.0e+00	98.8
WP_013447232.1\|113239_113641_+	hypothetical protein	F5A3A6	Riemerella_phage	4.2e-08	47.6
WP_013447233.1\|113965_114841_-	Abi family protein	NA	NA	NA	NA
WP_013447234.1\|115079_115400_+	hypothetical protein	F5A3D5	Riemerella_phage	1.9e-51	96.2
WP_013447235.1\|115402_116116_+	phage antirepressor KilAC domain-containing protein	F5A3A8	Riemerella_phage	1.0e-105	89.6
WP_004917849.1\|116286_116472_-	hypothetical protein	F5A3A9	Riemerella_phage	8.9e-30	100.0
WP_004917850.1\|116489_116951_-	hypothetical protein	F5A3B0	Riemerella_phage	7.6e-78	100.0
WP_004917852.1\|117030_117537_-	hypothetical protein	F5A3B1	Riemerella_phage	1.5e-90	100.0
WP_004917854.1\|117564_117975_-	hypothetical protein	F5A3B2	Riemerella_phage	5.0e-73	100.0
WP_013447236.1\|117971_118415_-	hypothetical protein	F5A3B3	Riemerella_phage	1.7e-74	99.3
WP_013447237.1\|118405_118729_-	hypothetical protein	F5A3B4	Riemerella_phage	8.8e-57	97.2
WP_013447238.1\|118722_119046_-	hypothetical protein	F5A3B5	Riemerella_phage	2.6e-53	95.3
WP_013447239.1\|119045_120128_-\|capsid	major capsid protein	F5A3B6	Riemerella_phage	2.4e-199	98.1
WP_013447240.1\|120148_120514_-	hypothetical protein	F5A3B7	Riemerella_phage	6.0e-54	90.2
WP_013447241.1\|120517_121174_-	hypothetical protein	F5A3B8	Riemerella_phage	2.3e-80	96.7
WP_004917868.1\|121306_121573_+	hypothetical protein	F5A3B9	Riemerella_phage	2.5e-41	96.6
121551:121569	attR	NA	NA	NA	NA
WP_014411188.1\|121615_121816_+	hypothetical protein	F5A3C0	Riemerella_phage	3.8e-10	90.9
WP_013447243.1\|122100_122250_+	hypothetical protein	F5A3C1	Riemerella_phage	4.8e-18	98.0
WP_013447244.1\|122231_122435_+	hypothetical protein	F5A3C2	Riemerella_phage	1.0e-31	98.5
WP_013447245.1\|122429_123473_-	hypothetical protein	F5A3C5	Riemerella_phage	8.0e-192	95.4
WP_013447246.1\|123472_124831_-\|portal	phage portal protein	F5A3C6	Riemerella_phage	1.6e-245	97.5
WP_004917880.1\|124944_126243_-\|terminase	terminase	F5A3C7	Riemerella_phage	7.5e-248	100.0
WP_004917881.1\|126337_126820_-	hypothetical protein	F5A3C8	Riemerella_phage	1.9e-87	100.0
WP_004917883.1\|126809_127535_-	hypothetical protein	F5A3C9	Riemerella_phage	3.4e-109	100.0
WP_013447247.1\|127509_128214_-	phosphoadenosine phosphosulfate reductase family protein	F5A3D0	Riemerella_phage	2.8e-132	100.0
WP_004917890.1\|128386_128845_-	hypothetical protein	F5A3D1	Riemerella_phage	3.5e-83	100.0
WP_004917892.1\|128841_129270_-	recombination protein NinG	F5A3D2	Riemerella_phage	8.6e-76	100.0
WP_004917895.1\|129372_129687_-	DUF2693 domain-containing protein	F5A3D3	Riemerella_phage	2.1e-55	100.0
WP_004917897.1\|129749_130499_-	phage antirepressor Ant	F5A3D4	Riemerella_phage	3.8e-127	100.0
WP_004917900.1\|130501_130822_-	hypothetical protein	F5A3D5	Riemerella_phage	3.1e-54	100.0
WP_004917901.1\|131395_132220_-	hypothetical protein	F5A3D6	Riemerella_phage	3.7e-152	100.0
WP_013447248.1\|132227_132446_-	hypothetical protein	F5A3E0	Riemerella_phage	2.9e-27	93.5
WP_013447249.1\|132461_132641_-	hypothetical protein	F5A3E1	Riemerella_phage	1.1e-27	100.0
WP_013447250.1\|132670_132826_-	hypothetical protein	NA	NA	NA	NA
WP_004917912.1\|133009_133759_-	hypothetical protein	F5A3E2	Riemerella_phage	7.6e-144	100.0
WP_013447251.1\|133782_134028_-	DUF551 domain-containing protein	F5A3E3	Riemerella_phage	1.2e-42	96.3
WP_013447252.1\|134027_134483_-	hypothetical protein	NA	NA	NA	NA
WP_013447253.1\|134484_134781_-	MazG-like family protein	F5A3E4	Riemerella_phage	2.0e-47	100.0
WP_013447254.1\|134887_135034_-	hypothetical protein	F5A3E5	Riemerella_phage	4.4e-24	100.0
WP_013447255.1\|135037_135205_-	hypothetical protein	F5A3E5	Riemerella_phage	2.8e-22	100.0
WP_004917921.1\|135183_135369_-	hypothetical protein	F5A3E6	Riemerella_phage	1.5e-24	98.4
WP_004917923.1\|135425_136238_-	phosphoadenosine phosphosulfate reductase family protein	F5A3E7	Riemerella_phage	3.9e-154	100.0
WP_004917925.1\|136263_136551_-	class I SAM-dependent methyltransferase	F5A3E8	Riemerella_phage	3.9e-48	98.9
WP_004917927.1\|136547_136712_-	hypothetical protein	F5A3E9	Riemerella_phage	1.6e-11	92.7

DBSCAN-SWA_2

140430 : 144602

Riemerella_phage(88.89%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004917939.1\|140430_141003_-	ERF family protein	A0A1B1IP10	uncultured_Mediterranean_phage	5.9e-48	58.4
WP_004917941.1\|141117_141303_-	hypothetical protein	F5A3F9	Riemerella_phage	4.6e-10	94.4
WP_004917945.1\|141399_141714_-	hypothetical protein	F5A3G1	Riemerella_phage	2.0e-53	100.0
WP_004917947.1\|141769_141979_-	hypothetical protein	F5A3G2	Riemerella_phage	9.1e-31	100.0
WP_004917949.1\|141975_142155_-	hypothetical protein	F5A3G3	Riemerella_phage	1.4e-24	100.0
WP_004917952.1\|142274_142841_+	hypothetical protein	F5A3G4	Riemerella_phage	1.9e-86	99.4
WP_004917958.1\|143110_143869_+	hypothetical protein	F5A3G5	Riemerella_phage	2.5e-142	100.0
WP_004917960.1\|143883_144336_+	hypothetical protein	F5A3G6	Riemerella_phage	9.0e-84	100.0
WP_004917963.1\|144332_144602_+	hypothetical protein	F5A3G7	Riemerella_phage	6.4e-45	100.0

DBSCAN-SWA_3

949560 : 956564

Enterobacteria_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004918316.1\|949560_950166_-	LemA family protein	A0A1X9IGG1	Lactococcus_phage	2.1e-11	31.0
WP_004918315.1\|950246_950738_+	dihydrofolate reductase	A0A0H3UYW4	Geobacillus_virus	1.3e-32	44.0
WP_004918313.1\|950748_952053_-	30S ribosomal protein S12 methylthiotransferase RimO	NA	NA	NA	NA
WP_004918312.1\|952157_953015_-	glucose-1-phosphate thymidylyltransferase RfbA	H9NC64	Sphingomonas_phage	5.0e-99	62.5
WP_004918309.1\|953019_954102_-	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	2.1e-86	48.7
WP_013446885.1\|954112_954658_-	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	6.1e-42	49.1
WP_004918306.1\|954690_955275_-	sugar transferase	NA	NA	NA	NA
WP_013446886.1\|955430_956564_-	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	A0A0P0YLZ6	Yellowstone_lake_phycodnavirus	9.1e-16	22.9

Anti-CRISPR protein detection

Acr_ID: NC_017045.1|WP_004917809.1|97890_98232_-|hypothetical-protein

Click the colored protein region to show detailed information

Acr_ID: NC_017045.1|WP_004917811.1|98553_99165_-|hypothetical-protein

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

NC_017045.1|WP_004917809.1|97890_98232_-|hypothetical-protein

97890_98232_-

113 aa aa

94713-136712

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
NC_017045_1	Unclear	1.11\|1021229\|30\|NC_017045\|CRISPRCasFinder	1021229-1021258	30	134471-134442	0
NC_017045_1	Unclear	1.23\|1021230\|30\|NC_017045\|PILER-CR	1021230-1021259	30	134471-134442	0

1. spacer 1.11|1021229|30|NC_017045|CRISPRCasFinder matches to NC_017045 position: 134471-134442, mismatch: 0

gacaaaataaaacagatgtgcgatgggata	CRISPR spacer
gacaaaataaaacagatgtgcgatgggata	Protospacer
******************************

2. spacer 1.23|1021230|30|NC_017045|PILER-CR matches to NC_017045 position: 134471-134442, mismatch: 0

gacaaaataaaacagatgtgcgatgggata	CRISPR spacer
gacaaaataaaacagatgtgcgatgggata	Protospacer
******************************

NC_017045.1|WP_004917811.1|98553_99165_-|hypothetical-protein

98553_99165_-

203 aa aa

94713-136712

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
NC_017045_1	Unclear	1.11\|1021229\|30\|NC_017045\|CRISPRCasFinder	1021229-1021258	30	134471-134442	0
NC_017045_1	Unclear	1.23\|1021230\|30\|NC_017045\|PILER-CR	1021230-1021259	30	134471-134442	0

1. spacer 1.11|1021229|30|NC_017045|CRISPRCasFinder matches to NC_017045 position: 134471-134442, mismatch: 0

gacaaaataaaacagatgtgcgatgggata	CRISPR spacer
gacaaaataaaacagatgtgcgatgggata	Protospacer
******************************

2. spacer 1.23|1021230|30|NC_017045|PILER-CR matches to NC_017045 position: 134471-134442, mismatch: 0

gacaaaataaaacagatgtgcgatgggata	CRISPR spacer
gacaaaataaaacagatgtgcgatgggata	Protospacer
******************************

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_017045

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information