CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
NC_015580	Novosphingobium sp. PP1Y, complete genome	1 crisprs	DEDDh,csa3,cas3,DinG	3
NC_015582	Novosphingobium sp. PP1Y plasmid Spl, complete sequence	0 crisprs	NA	3
NC_015583	Novosphingobium sp. PP1Y plasmid Mpl, complete sequence	0 crisprs	DEDDh,csa3	2
NC_015579	Novosphingobium sp. PP1Y plasmid Lpl, complete sequence	0 crisprs	NA	14

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_015580_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_015580_1

1972209-1972303

Orphan

Consensus_repeat	Method
AAGAAGGCTCCGGCGAAGAAGGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_015580_1

>merge|NC_015580|1|1972209-1972303|CRISPRCasFinder
GAGGAGCCTGCCGCGAAGAAGGCTCCGGCGAAGAAGGCTGCCGCCAAGAAGGCGGACGACGCGGACGAAGCCGAAAAGCCGGCTGCCAAGAAGGC

>NC_015580|1|1|1972209-1972303|CRISPRCasFinder
GAGGAGCCTGCCGCGAAGAAGGC	TCCGGCGAAGAAGGCTGCCGCCAAGAAGGCGGACGACGCGGACGAAGCC
GAAAAGCCGGCTGCCAAGAAGGC

Protein	Signature genes	Signature genes Name	Protein_function
NC_015580.1\|WP_013833073.1\|1981536_1981932_+\|M67-family-metallopeptidase	unknown	unknown	gnl\|CDD\|163701
NC_015580.1\|WP_148275106.1\|1960555_1961746_-\|DUF418-domain-containing-protein	unknown	unknown	gnl\|CDD\|225193
NC_015580.1\|WP_013833068.1\|1974774_1975728_-\|cation-transporter	unknown	unknown	gnl\|CDD\|224151
NC_015580.1\|WP_013833064.1\|1966045_1967296_-\|dihydroorotase	unknown	unknown	gnl\|CDD\|236479
NC_015580.1\|WP_013833069.1\|1976102_1978577_+\|TonB-dependent-receptor	unknown	unknown	gnl\|CDD\|224544
NC_015580.1\|WP_007011633.1\|1960309_1960504_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|381078
NC_015580.1\|WP_013833066.1\|1968419_1970306_+\|signal-peptide-peptidase-SppA	unknown	unknown	gnl\|CDD\|273226
NC_015580.1\|WP_007011620.1\|1972627_1973296_+\|ATP-dependent-Clp-endopeptidase-proteolytic-subunit-ClpP	unknown	unknown	gnl\|CDD\|178955
NC_015580.1\|WP_013833071.1\|1979560_1980472_-\|RNA-polymerase-sigma-factor-RpoH	unknown	unknown	gnl\|CDD\|235838
NC_015580.1\|WP_148274985.1\|1964592_1965912_+\|SPOR-domain-containing-protein	unknown	unknown	gnl\|CDD\|276808
NC_015580.1\|WP_007011619.1\|1973429_1974692_+\|ATP-dependent-Clp-protease-ATP-binding-subunit-ClpX	unknown	unknown	gnl\|CDD\|235422
NC_015580.1\|WP_013833061.1\|1963227_1963947_+\|ParA-family-protein	unknown	unknown	gnl\|CDD\|349760
NC_015580.1\|WP_013833075.1\|1982804_1983509_+\|N-acetylmuramoyl-L-alanine-amidase	unknown	unknown	gnl\|CDD\|225567
NC_015580.1\|WP_013833074.1\|1982127_1982769_+\|histidine-phosphotransferase	unknown	unknown	gnl\|CDD\|227675
NC_015580.1\|WP_013833072.1\|1980561_1981518_-\|RluA-family-pseudouridine-synthase	unknown	unknown	gnl\|CDD\|161659
NC_015580.1\|WP_041558907.1\|1961835_1962948_-\|SPOR-domain-containing-protein	unknown	unknown	gnl\|CDD\|276807
NC_015580.1\|WP_013833062.1\|1963960_1964515_+\|hypothetical-protein	unknown	unknown	unknown
NC_015580.1\|WP_013833070.1\|1978658_1979438_-\|monofunctional-biosynthetic-peptidoglycan-transglycosylase	unknown	unknown	gnl\|CDD\|234603
NC_015580.1\|WP_013833065.1\|1967292_1968273_-\|aspartate-carbamoyltransferase-catalytic-subunit	unknown	unknown	gnl\|CDD\|234849
NC_015580.1\|WP_007011622.1\|1970323_1970485_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NC_015580.1\|WP_013833073.1\|1981536_1981932_+\|M67-family-metallopeptidase	gnl\|CDD\|163701	cd08070, MPN_like, Mpr1p, Pad1p N-terminal (MPN) domains with catalytic isopeptidase activity (metal-binding). This family contains archaeal and bacterial MPN (also known as Mov34, PAD-1, JAMM, JAB, MPN+)-like domains. These domains contain the signature JAB1/MPN/Mov34 metalloenzyme (JAMM) motif, EXnHS/THX7SXXD, which is involved in zinc ion coordination and provides the active site for isopeptidase activity for the release of ubiquitin from ubiquitinated proteins (thus having deubiquitinating (DUB) activity) that are tagged for degradation. The JAMM proteins likely hydrolyze ubiquitin conjugates in a manner similar to thermolysin, in which the zinc-polarized aqua ligand serves as the nucleophile, compared with the classical DUBs that do so with a cysteine residue in the active site.	3.89396e-31
NC_015580.1\|WP_148275106.1\|1960555_1961746_-\|DUF418-domain-containing-protein	gnl\|CDD\|225193	COG2311, COG2311, Predicted membrane protein [Function unknown].	1.83237e-57
NC_015580.1\|WP_013833068.1\|1974774_1975728_-\|cation-transporter	gnl\|CDD\|224151	COG1230, CzcD, Co/Zn/Cd efflux system component [Inorganic ion transport and metabolism].	1.43725e-92
NC_015580.1\|WP_013833064.1\|1966045_1967296_-\|dihydroorotase	gnl\|CDD\|236479	PRK09357, pyrC, dihydroorotase; Validated.	8.98397e-125
NC_015580.1\|WP_013833069.1\|1976102_1978577_+\|TonB-dependent-receptor	gnl\|CDD\|224544	COG1629, CirA, Outer membrane receptor proteins, mostly Fe transport [Inorganic ion transport and metabolism].	2.97075e-30
NC_015580.1\|WP_007011633.1\|1960309_1960504_-\|hypothetical-protein	gnl\|CDD\|381078	cd19945, Fer2_BFD, bacterioferritin-associated ferredoxin (BFD) [2Fe-2S]-binding domain. This family includes Escherichia coli and Pseudomonas aeruginosa bacterioferritin-associated ferredoxin BFD which binds an [2Fe-2S] cluster and appears to interact with bacterioferritin (E. coli BFR/YheA and P. aeruginosa BfrB), a dynamic regulator of intracellular iron levels. It has been suggested that BFD and bacterioferritin form an electron transfer complex which may participate in the iron storage or iron immobilization functions of bacterioferritin. For Pseudomonas aeruginosa, it has been shown that mobilization of Fe3+ stored in BfrB requires interaction with BFD, which transfers electrons to reduce Fe3+ in the internal cavity of BfrB for subsequent release of Fe2+. The stability of BFD may be aided by an anion-binding site found within this domain. In addition to BFD, the BFD-like [2Fe-2S]-binding domain is found in a variety of proteins such as the large subunit of NADH-dependent nitrite reductase and the Cu+ chaperone CopZ. It comprises a helix-turn-helix fold, and binds an [2Fe-2S] cluster via 4 highly-conserved Cys residues, found in loops between the alpha-helices. For the class of proteins having a BFD-like [2Fe-2S]-binding domain, the Cys residues are organized in a unique C-X2-C-X31-35-C-X2-9-C-arrangement. [2Fe-2S] clusters are sulfide-linked diiron centers, a primary role for which is electron transport.	3.55139e-06
NC_015580.1\|WP_013833066.1\|1968419_1970306_+\|signal-peptide-peptidase-SppA	gnl\|CDD\|273226	TIGR00705, Protease_4, signal peptide peptidase SppA, 67K type. This model represents the signal peptide peptidase A (SppA, protease IV) as found in E. coli, Treponema pallidum, Mycobacterium leprae, and several other species, in which it has a molecular mass around 67 kDa and a duplication such that the N-terminal half shares extensive homology with the C-terminal half. This enzyme was shown in E. coli to form homotetramers. E. coli SohB, which is most closely homologous to the C-terminal duplication of SppA, is predicted to perform a similar function of small peptide degradation, but in the periplasm. Many prokaryotes have a single SppA/SohB homolog that may perform the function of either or both. [Protein fate, Degradation of proteins, peptides, and glycopeptides].	3.60589e-142
NC_015580.1\|WP_007011620.1\|1972627_1973296_+\|ATP-dependent-Clp-endopeptidase-proteolytic-subunit-ClpP	gnl\|CDD\|178955	PRK00277, clpP, ATP-dependent Clp protease proteolytic subunit; Reviewed.	5.60086e-145
NC_015580.1\|WP_013833071.1\|1979560_1980472_-\|RNA-polymerase-sigma-factor-RpoH	gnl\|CDD\|235838	PRK06596, PRK06596, RNA polymerase factor sigma-32; Reviewed.	2.02093e-170
NC_015580.1\|WP_148274985.1\|1964592_1965912_+\|SPOR-domain-containing-protein	gnl\|CDD\|276808	sd00008, TPR_YbbN, C-terminal Tetratricopeptide repeat (TPR) region of YbbN and similar motifs. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. YbbN is a thioredoxin-like protein containing two tandem TPR repeats at the C-terminus, separated by two alpha helices. Its N-terminal thioredoxin-like domain is not a functional oxidoreductase. It functions in heat stress response and DNA synthesis as a chaperone or co-chaperone.	1.79421e-07
NC_015580.1\|WP_007011619.1\|1973429_1974692_+\|ATP-dependent-Clp-protease-ATP-binding-subunit-ClpX	gnl\|CDD\|235422	PRK05342, clpX, ATP-dependent Clp protease ATP-binding subunit ClpX.	0
NC_015580.1\|WP_013833061.1\|1963227_1963947_+\|ParA-family-protein	gnl\|CDD\|349760	cd02042, ParAB_family, partition proteins ParAB family. ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation. ParB binds to DNA sequences adjacent to the origin of replication and localizes to opposite cell poles shortly following the initiation of DNA replication. ParB regulates the ParA ATPase activity by promoting nucleotide exchange in a fashion reminiscent of the exchange factors of eukaryotic G proteins. ADP-bound ParA binds single-stranded DNA, whereas the ATP-bound form dissociates ParB from its DNA binding sites. Increasing the fraction of ParA-ADP in the cell inhibits cell division, suggesting that this simple nucleotide switch may regulate cytokinesis. ParA shares sequence similarity to a conserved and widespread family of ATPases which includes the repA protein of the repABC operon in Rhizobium etli symbiotic plasmid. This operon is involved in the plasmid replication and partition.	1.86763e-29
NC_015580.1\|WP_013833075.1\|1982804_1983509_+\|N-acetylmuramoyl-L-alanine-amidase	gnl\|CDD\|225567	COG3023, ampD, N-acetyl-anhydromuramyl-L-alanine amidase [Cell envelope biogenesis, outer membrane].	8.56187e-74
NC_015580.1\|WP_013833074.1\|1982127_1982769_+\|histidine-phosphotransferase	gnl\|CDD\|227675	COG5385, COG5385, Uncharacterized protein conserved in bacteria [Function unknown].	4.5588e-37
NC_015580.1\|WP_013833072.1\|1980561_1981518_-\|RluA-family-pseudouridine-synthase	gnl\|CDD\|161659	TIGR00005, Ribosomal_large_subunit_pseudouridine_synthase_D, pseudouridine synthase, RluA family. In E. coli, RluD (SfhB) modifies uridine to pseudouridine at 23S RNA U1911, 1915, and 1917, RluC modifies 955, 2504 and 2580, and RluA modifies U746 and tRNA U32. An additional homolog from E. coli outside this family, TruC (SP\|Q46918), modifies uracil-65 in transfer RNAs to pseudouridine. [Protein synthesis, tRNA and rRNA base modification].	1.35453e-118
NC_015580.1\|WP_041558907.1\|1961835_1962948_-\|SPOR-domain-containing-protein	gnl\|CDD\|276807	sd00010, SLR, Sel1-like repeat. Sel1-like repeats (SLRs) share similar alpha-helical conformations with Tetratricopeptide repeats (TPRs), but with different consensus sequence lengths and superhelical topologies. SLRs contain 36 to 44 amino acids and are present in bacteria and eukaryotes but not in archaea. SLR proteins are involved in a variety of functions, and many serve as adaptor proteins for the assembly of macromolecular complexes. The SLR family was named after the Caenorhabditis elegans Sel1 protein which is predicted to fold into 11 SLRs, a transmembrane domain, and an N-terminal signal sequence. The human Sel1L protein contains an additional fibronectin type-II domain and an N-terminal PEST sequence. Its downregulation is associated with the development of breast and pancreatic carcinomas.	4.83408e-22
NC_015580.1\|WP_013833070.1\|1978658_1979438_-\|monofunctional-biosynthetic-peptidoglycan-transglycosylase	gnl\|CDD\|234603	PRK00056, mtgA, monofunctional biosynthetic peptidoglycan transglycosylase; Provisional.	9.71771e-100
NC_015580.1\|WP_013833065.1\|1967292_1968273_-\|aspartate-carbamoyltransferase-catalytic-subunit	gnl\|CDD\|234849	PRK00856, pyrB, aspartate carbamoyltransferase catalytic subunit.	4.86091e-178

>NC_015580.1|WP_007011622.1|1970323_1970485_-|hypothetical-protein
MATQPGDVPANNPPETPVPPAEPTEPGQPAEAPPYSPDFDQPDEAPEEMPPQD
>NC_015580.1|WP_013833066.1|1968419_1970306_+|signal-peptide-peptidase-SppA
MQFARKVWKLLVAFKDALALLFLLLFFGLIYGALASRPTPGRVVDGALLLNLDGVVVEERSEVSPLRLLLSAEAPAGEYQARDIERALRGAAKDDHVKAVVLDMSRFLGGGMVHLQEIGRAIDEVRAAGKPVLTFANAYADDGVLLAAHASEVWVDPMGGAFVAGPGGTQTYYKGLFDRFKVNAHVYRAGTYKSYVEPYIRSDMSPAAREANEDLYGSIWATWKADVKQARPNSKVEQIAGDPMAWVEASMGDFAQGAKAAGLVDRIGDKTEFEKRVAEIAGKGAGGDGPAYAHTRLDTWLAANPARAEGASIGVITIAGEIVDGEAGPGKAGGDRIAQLLDDNIDEGFKALVVRVDSPGGSVMAAERIRRAIDRYKARKIPVVVSMANMAASGGYWVSTPAERIFAEPGTVTGSIGVFAVVTSFEKTLADFGVTSDGVRTTPLSGQPDILGGFTPEVERMLQASVDNIYGKFLGVVAKSRKTTPERIDRVAQGRVWPGAEAKELGLVDEMGDLDAALAYAAKQGGVGNGKWHAEYIGAQEGRFESMLRRMFAGPSDSEAVYDLTGLVAARQEARARRIAAQFADLTGSRGAQAYCLECPDLPSIDDPREAGQGLSLMARIGALAGLK
>NC_015580.1|WP_013833065.1|1967292_1968273_-|aspartate-carbamoyltransferase-catalytic-subunit
MTSPEFTYPEGSAAFPHRGLVGIAGLAPHEIMFLLDEAQQWVELNRHAQKRRDLLSGLTIINAFFENSTRTLLSFEIAGKRLGADVVNMAVATSSVKKGETLIDTAMTLNAMRADAIAIRHGSSGAVQLIADKVDCPVINAGDGQHEHPTQALLDALTIRQAKRAFNGLRVTICGDILHSRVARSNILCLTSLGAEVRVCAPPALMPADIERMNVQVFHDFDAALQNADVVMMLRLQLERMQGQFIPSPREYRHLYGLSLERLAKAESNALVMHPGPMNRGIEIDSNVADLVDRSMITTQVEMGVAIRMACLDVLTRKARGLEGWA
>NC_015580.1|WP_013833064.1|1966045_1967296_-|dihydroorotase
MSIHAPLTVTGGKLVLPDGRIEAGNIRCEGGFITAIGDVSPQAGDIVHQAGGKLVTPGLVDVAVFSIDKPAFHFGGVTRAALMPDQDPPLDVPARVRFAAQSGKPDFWVHPLAAATKNLEGDSLAEIALMRDAGARAVATGRSWIRDSGTMLRLLQYAGMLDMVVVTHAEDSGLVGKAVATAGEMATRLGLPSAPAEAEALAIARDIALAELAGAKIHFRKVTTAAGLELVRRAKERGAKITAGVSPAYFMLSDLALANFRTFAHLSPPLRSEADRKAVIAAIADGTIDMIGSGHDPRGPEDKRLPYTDSAPGMAGSETLLPLTMTLVRDGVISMNRAFELLSANPAKLLGVDAGRLAEGMEADIAVIDPDRPWIVDSDEMAAAAGNTPFDKQPMQGRVLALFKGGVAVKAKKPAA
>NC_015580.1|WP_148274985.1|1964592_1965912_+|SPOR-domain-containing-protein
MAVVMLSGCAGQSPFASSARAPVARGLNDADSGAAVARAEQRVARSPESASARTELAQAYLAAGRFDSAATTFEDAVTLGGDNARIGLGMALAYIGAGRNAEAISVLGRWRNDIPASDFGLALALAGQPEMGVAVLTDAVRSEDNNVKARQNLAYAYALQGQWMQARLIAGQDVPADQLDARLSDWASKARPDASRARVAGLLGAPLRADPGQPTALALGNKDDAARLARTDIPTPAFGQAPAGELPPVKTGESFWGGSDQADPAPAPAARPVERASLAAVNEVVEQHVETGPSSRFVAKPVIQKVAKSESNFQATFERMSTEKIAQPEKAKSSRSEIQAHLVQLGSFQSREGAERAWGIFVKRNPSLKDHTMRITEAVVNGARYYRVAAEGFDRASAHSLCSSVRNRGEGCLAYSESQSLPGALPKGGAVGAPLRARR
>NC_015580.1|WP_013833062.1|1963960_1964515_+|hypothetical-protein
MSEPRDFASLSPRLLARKGGARPAMRPQDTSKFTAGGIPIDPHKMDDLGWNDFGQGHGGGTGAASAPRPASRLTANRPTLAHSEQAPARNHDESGSVHEVPDVLRQIEQLAHRIHRSEPPARTMPEGRRAAFTLRLDAERHFRLKMAGVVLNRSAQVLVTEALDKYLSEMPELFALTGTARKPS
>NC_015580.1|WP_013833061.1|1963227_1963947_+|ParA-family-protein
MRVLALASQKGGSGKTTLSGHLAVQAQRAGAGPVVLIDIDPQGSLADWWNEREAEFPAFAQTTVARLASDLQVLRQQGFKLAVIDTPPAITMAIQSVISVAELIVVPTRPSPHDLRAVGATVDLCERSGKPLIFVVNAATPKARITAEAAVALSQHGTVAPVTLHQRTDFAASMIDGRTVMEVDPNGRSSQEVTALWNYVADRLEKNFRRTVFSAPMGAPMVQGNHRPVGGFGRRVAGS
>NC_015580.1|WP_041558907.1|1961835_1962948_-|SPOR-domain-containing-protein
MKKFLRFFRNLGLCATLFTLMAAPALADVKAGVDAWSAGDYAAAVREWKPLAAAGDPDAQFNLAQAYKMGRGVPEDIAKAKDLYGKAAAQGHIQASDIYGLLLFQDGEQAKAMPYLESSAARGDPRAQYIIGVAHFNGDYVAKDWVRAYALVSLAQQAGLQQATNALKQMDEHIALEDRQKSVALASRIAADAQATRERESATAQLGNGTLPTSTSGGNVRPPQIVAAENAVAEAVRATGSASPATAGADYTRKSVPAPAMPSASGTNAKVLANPAPARPVETARPAPAHAPATGGPWRVQLGAFGVAGNADKLWSRVGRRPELAGRAKMLVPEGRLTKLQAGGFASKSEADAACSRLSAGGFACLPVRN
>NC_015580.1|WP_148275106.1|1960555_1961746_-|DUF418-domain-containing-protein
MLGILAINIAGFAGPSINSITPSLPHQAGLADEAAWAFGFIFFEGKMRALFAILFGASLSLFCERIEAIGGNGELLQVRRLSWLMLFGTLHYLLLWWGDILFVYATCGIVALLSRQLSTRLILGLALAILATTHIWEIMAALPVVHAEEAVRLGTATIAQQQAVLARLDLYWDESARELALYTSSYLDIVIAKLRDDPFWLFTMASSTYGEILPLMMLGMAMHRHGFFAGDWPAHRMKAVAICCTTSGLALTLAALVWAWPRHFPPIAMYMLISHGLVVPHVLCAIGYGAILALATPALARSRIGQRLIAAGRMAFSNYICTSVVMTAIFYGWGLDLFGRVGPAEQWLFVVLGWTLMLAWSEPWLHHCRQGPLEWLWRSLVMRKLLENRRNSAISK
>NC_015580.1|WP_007011633.1|1960309_1960504_-|hypothetical-protein
MYVCICNAIKETDLRAAARCCQGNAETLYAALGRTPQCRQCLEEAEEIIADELCGDRSAAMTAH
>NC_015580.1|WP_007011620.1|1972627_1973296_+|ATP-dependent-Clp-endopeptidase-proteolytic-subunit-ClpP
MLDLFGASGAQGKFTTDPVTGALVPMVVEQTSRGERSFDIYSRLLRERIVFVTGEVEDHMASLIVAQLLFLESENPSKDISMYINSPGGVVTAGMAIHDTMQYIKPRVSTVCIGQAASMGSFLLAAGEPGMRIALPNARIMVHQPSGGARGMASDIEIQAREILRMRKRLNDLYVKYTGKSLDEIEQAMDRDTFLEAEEALAFGLVDKVFETRPDAEKQTEG
>NC_015580.1|WP_007011619.1|1973429_1974692_+|ATP-dependent-Clp-protease-ATP-binding-subunit-ClpX
MTKLSGSDAKSTLYCSFCGKSQHEVRKLIAGPTVFICDECVELCNDIIREETKAGIAGKKDGGVPSPREICETLNDYVIGQDRAKRVLSVAVHNHYKRLKHSGKQGDVELSKSNILLVGPTGSGKTLLAQTLAKTFDVPFTMADATTLTEAGYVGEDVENIILKLLQASDYNVEKAQHGIVYIDEIDKISRKAENPSITRDVSGEGVQQALLKLMEGTTASVPPQGGRKHPQQEFLQVDTTNILFICGGAFAGLEKIIADRLQKRSIGFGAHVADPDKRRVGELLQKSEPEDLLKFGLIPEFVGRLPVIATLEDLDIAALVKILKEPKNALIKQYRKLFELEDVELTFTDEALEAIAQKAIDRKTGARGLRSIVEGLLLDTMYDLPTETDIAEVVVDKEVVDGRKEPVRVLKGDKAEAAA
>NC_015580.1|WP_013833068.1|1974774_1975728_-|cation-transporter
MGSGHHHGHDHSHGHSHGHHHHAPPPPGNASKAFAIAVALNIGFVIAEVVAGLISGSMALLADAGHNLSDVLSLMLAWAASVLAARPPSDRFTYGLKSSSILASIANAALLWVAIGAILVETIQRFSDPAPVAGMTMIVVAAIGIAVNALSALLFAKGSKSDLNLRAAFVHLMADAAVSAGVVLAGLAIYWTGAAVIDPITSLLITAVIAWSSWGLLRDSLRMGMLAVPDHIDVAKVRAFLEKQPGVMRVHDLHIWPMSTTETALTAHLVMPGISREGAFLRQLAHDLEREFSIGHPTLQVETDPDAPCALESEKVI
>NC_015580.1|WP_013833069.1|1976102_1978577_+|TonB-dependent-receptor
MKFQTALNTATSMLAVGAAFLSVPALAQSTGSVDFEDDTIIVTGRIDRSVAGVELPDTPKAKQVLTQEFISRGTPGQTINETINLIPGVNFQNYDGFGSSGGNLMIRGFDDTRISQTFDGIPANDTGSYALYTNQNLDPELIEQVNVNLGTTDVDSPTASATGSTVNYRSLTPTHEFGARMVGTVGDQSKMRIFGMINTGDLNDSGTRAYFAASRDTYDALFGGFGEIKKTQFNAKIYQPLGDNGDFIAVSGHLNNNRNNMSSDWKLTTTDGIPLTKSERDDYVVERCTIPAGIGGVEDVADKYGCGSLWEYRYNPSKTGNIRINSRFTLSDSLVLTVDPYFQYTSANGGGTSVGYEGTFSDTITSGYIGGSPYFGGVDLNGDSDTRDSVLVSTPSQTVTNRIGVIASLRYDLGDNNRVRLAYTYDRGRHRQTGEVGFLKANGLAEHYFNNKNPLTDAAGNVLEKRDRLSYAILNQVSGEYAGDFANDSLHVVAGVRVPFFRRNLTQNCLTTSSSGYVDCFATNSADEATRAAENPGYGAPDNRVFNYNRVLPTAGFTYDFTPEASLYFNYSKGVQVPGTDNLYNSFYYAPGTEGARSAKPETSDNFDLGLRFRSGMIQGSFGGWYTIFANRLSSAYNPETDRTTYTNLGTVDRYGLDGTLAVSPDSHFKAYIFASYLWSKIRDDVQTGTDSFAETSGNMEGGVPKYTFGGRVEGNAGPVSIGVEAKRTGSRYYNSLNTPALNKAGDQIWAAKVPGYTVVNLDARLDLGFLGMGDKTYLQANVTNLFDEFYYGSFDDAGVSETATTYAYLGAPRTFSASINFQF
>NC_015580.1|WP_013833070.1|1978658_1979438_-|monofunctional-biosynthetic-peptidoglycan-transglycosylase
MPVQRGAFPAATRSLVDHRGRGAFASGHHPVFRSLAPLLRILAKTVVWFVAISVGLTVLYRFVPPPVTVTMVLDGNGITKDWEPLSRIDRNMVAAVVAAEDGKFCSHSGFDTEAIEKALERNARGGRLRGGSTISQQTAKNVFLWQGEGWTRYLRKGLEVWFTFLIENLWDKRRIMEVYLNVAETGIGTYGVEAGAQRYFGKSAANLTPTEAARMAAALPSPKTRAVKSPSGFTRRYGNTIAARIGTVKRDGYDACVYQ
>NC_015580.1|WP_013833071.1|1979560_1980472_-|RNA-polymerase-sigma-factor-RpoH
MNVSNNERNLPAVPTLGGEQSLNRYMSEIRKFPVLSAEQEYMLAKRYKEHEDPEAAAQLVTSHLRLVAKIAMGYRGYGLPVSELISEGNIGLMQGVKKFEPDRGFRLATYAMWWIKASIQEFILRSWSLVKMGTTAAQKKLFFNLRRMKKNLDAYEDTDLHPDDVAKIATTLGVSETEVVNMNRRMMMGGDASLNVSLREEGEGQWMDILADDRPLQDETVADAEEASVRHDMLVEAMDSLNDRERDILTERRLTDDPKTLEELSQVYHVSRERVRQIEVRAFEKLQKAMNRIAGEKRLMPAT
>NC_015580.1|WP_013833072.1|1980561_1981518_-|RluA-family-pseudouridine-synthase
MGASSNITEDLIEGCIGPGGGRLDKTLAEASGLSRERVKALLGDGRVTLDGKSATQASLKVSEGTPFTIRVPAAVPAEAVAQDIPLNVVFEDEYLIVIDKPAGLVVHPAAGNLDGTLVNALLHHCRGQLSGIGGVARPGIVHRIDKDTSGLLVVAKTDRAHEGLAAQFADHSIERAYKAIVGGHPLPITGTVTGAIGRSSSNRKKMAIVEEGRGKHAVTHYRTIERLRNAALVECRLETGRTHQVRVHMSSIGHPLLGDPVYGRTPSALRPILQRLQFSRQALHAAELGFIHPVKKEKVHFVSPVPADMAALIDELQN
>NC_015580.1|WP_013833073.1|1981536_1981932_+|M67-family-metallopeptidase
MVVEVTSAVLARLLEEAQKAAPCECCGVLMGQGTRIDEVRAAANLAPEPERQFEIDPLVLLASHKEARAGGRQVVGYYHSHPVGHPVPSATDCEHASGDRRVWAIVAGEQVALWMDAAEGFERIEMRVTEA
>NC_015580.1|WP_013833074.1|1982127_1982769_+|histidine-phosphotransferase
MTISPVELASLLCSRLCHDMLSPVGALTNGLELLADEKDPEMRQRCFELLDQSARVSADKLKFFRLAFGAAGGFGEMIPVNEARALIDALVASNARISVNWALASDVMPKPAIKTLLNFGLIGIEALPRGGTIDFAAELRDGASEIVVRSAGPRIAFDRDIGRALEGSLPEGELSSRTAPAAMLHQLAQDAGGGLQFALAEDALVLGAVLPGA
>NC_015580.1|WP_013833075.1|1982804_1983509_+|N-acetylmuramoyl-L-alanine-amidase
MNRWLVNHVVASPNCNMRKRPISMVVLHYTGMKSAQEALERMCDPQAEVSAHYMIDEDGVVTNLVPEEKRAWHAGRSYWRGEVDVNSASIGIELVNPGHEFGYRPFPEPQMDALLPLLADIMDRHDIPRANVVGHSDVAPARKQDPGEYFDWVRLGELGLALDIPKAKMNLFYDNPGAFYLALERFGYDITDGRAAVRAFQRRWRPEIIDGEIDGEIGGILFELLLERDTGRAR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

328728 : 403875

Burkholderia_phage(20.0%)

portal,integrase,protease,plate,capsid,tail,terminase,head

attL 349987:350006|attR 388183:388202

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_148275072.1\|328728_329904_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_041559195.1\|329900_330815_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_013831730.1\|330811_331816_+\|integrase	tyrosine-type recombinase/integrase	A0A2L1IV36	Escherichia_phage	1.2e-11	35.0
WP_013831731.1\|331877_333743_+	strawberry notch C-terminal domain-containing protein	A0A076FMQ0	Aureococcus_anophage	4.7e-17	30.8
WP_013831732.1\|333754_334798_+	toprim domain-containing protein	NA	NA	NA	NA
WP_013831733.1\|335116_336061_+	DUF2493 domain-containing protein	NA	NA	NA	NA
WP_148274917.1\|336292_336982_-	cyclic nucleotide-binding domain-containing protein	NA	NA	NA	NA
WP_041558667.1\|337024_337936_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_013831736.1\|337932_339498_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_013831737.1\|339841_340525_-	RES family NAD+ phosphorylase	NA	NA	NA	NA
WP_013831738.1\|340528_340927_-	DUF2384 domain-containing protein	NA	NA	NA	NA
WP_013831739.1\|341365_341686_+	DUF736 family protein	NA	NA	NA	NA
WP_013831740.1\|341937_342345_+	DUF2513 domain-containing protein	NA	NA	NA	NA
WP_013831741.1\|342385_343174_-	HNH endonuclease	NA	NA	NA	NA
WP_013831742.1\|343190_345692_-	S8 family peptidase	NA	NA	NA	NA
WP_013831743.1\|345697_346693_-	ATP-binding protein	R4TQL5	Phaeocystis_globosa_virus	6.3e-13	30.4
WP_013831744.1\|346812_347295_-	type II toxin-antitoxin system MqsA family antitoxin	NA	NA	NA	NA
WP_013831745.1\|347366_348647_-\|integrase	site-specific integrase	NA	NA	NA	NA
349987:350006	attL	NA	NA	NA	NA
WP_013831747.1\|350091_350301_-	AlpA family phage regulatory protein	NA	NA	NA	NA
WP_148274918.1\|350456_350693_-	hypothetical protein	NA	NA	NA	NA
WP_013831749.1\|350889_351153_-	DUF2312 domain-containing protein	B0VK10	Azospirillum_phage	2.7e-16	60.6
WP_148274919.1\|351173_351407_-	hypothetical protein	NA	NA	NA	NA
WP_148274920.1\|351403_351613_-	hypothetical protein	NA	NA	NA	NA
WP_041558672.1\|351723_352032_-	ogr/Delta-like zinc finger family protein	NA	NA	NA	NA
WP_051009998.1\|352031_352523_-	hypothetical protein	NA	NA	NA	NA
WP_051009999.1\|352968_353442_+	hypothetical protein	NA	NA	NA	NA
WP_158511839.1\|353897_354302_-	hypothetical protein	NA	NA	NA	NA
WP_041558675.1\|354532_354946_-	hypothetical protein	NA	NA	NA	NA
WP_041558676.1\|355818_356073_-	hypothetical protein	NA	NA	NA	NA
WP_013831757.1\|356437_357460_-	phage late control protein	E5FFG3	Burkholderia_phage	1.6e-72	44.2
WP_041559200.1\|357456_357870_-\|tail	phage tail protein	Q9ZXJ9	Pseudomonas_virus	3.4e-29	46.0
WP_013831759.1\|357883_360397_-\|tail	phage tail tape measure protein	V9IQL1	Stenotrophomonas_phage	8.0e-89	50.5
WP_041558677.1\|360396_360528_-\|tail	GpE family phage tail protein	A0A0F7LCR6	Escherichia_phage	1.4e-05	64.7
WP_013831760.1\|360536_360842_-\|tail	phage tail assembly protein	Q9ZXK2	Pseudomonas_virus	9.0e-19	55.1
WP_013831761.1\|360904_361417_-\|tail	phage major tail tube protein	V9IQX1	Stenotrophomonas_phage	2.9e-46	54.2
WP_013831762.1\|361460_362633_-\|tail	phage tail sheath subtilisin-like domain-containing protein	F1BUU3	Erwinia_phage	6.3e-121	58.7
WP_013831763.1\|362649_363000_-	GPW/gp25 family protein	V9IQW0	Stenotrophomonas_phage	9.6e-25	53.5
WP_013831764.1\|362999_363536_-\|plate	phage baseplate assembly protein V	V9IQH1	Stenotrophomonas_phage	1.0e-25	58.7
WP_013831765.1\|363618_364824_-	hypothetical protein	NA	NA	NA	NA
WP_013831767.1\|364928_365735_-	DNA adenine methylase	A0A291AUP9	Sinorhizobium_phage	3.5e-86	58.8
WP_041558678.1\|365911_366169_-	hypothetical protein	NA	NA	NA	NA
WP_013831768.1\|366182_366566_-\|tail	tail protein	A0A291LAV4	Bordetella_phage	2.2e-14	39.4
WP_013831770.1\|369115_369670_-\|tail	phage tail protein I	V9IQK7	Stenotrophomonas_phage	1.2e-45	50.8
WP_013831771.1\|369666_370560_-\|plate	baseplate J/gp47 family protein	R4JDM0	Burkholderia_phage	2.9e-73	52.7
WP_013831772.1\|370884_373245_-	SIR2 family protein	NA	NA	NA	NA
WP_013831773.1\|373533_374205_-	phage virion morphogenesis protein	A0A2H4J927	uncultured_Caudovirales_phage	2.4e-08	51.6
WP_013831774.1\|374201_374720_-\|tail	phage tail protein	E5FFH7	Burkholderia_phage	4.0e-19	39.8
WP_041558679.1\|374703_374901_-	hypothetical protein	NA	NA	NA	NA
WP_013831775.1\|374845_375241_-	hypothetical protein	NA	NA	NA	NA
WP_041558680.1\|375237_375690_-	hypothetical protein	A0A1B1IRA1	uncultured_Mediterranean_phage	3.3e-33	49.7
WP_013831776.1\|375694_376027_-	hypothetical protein	NA	NA	NA	NA
WP_013831777.1\|376031_376256_-\|tail	tail protein X	A0A2H4J946	uncultured_Caudovirales_phage	5.8e-07	44.1
WP_013831778.1\|376255_376738_-\|head	head completion/stabilization protein	A4PE32	Ralstonia_virus	2.0e-25	42.8
WP_013831779.1\|376858_377653_-\|terminase	terminase	A0A077K804	Ralstonia_phage	9.2e-31	42.3
WP_013831780.1\|377707_378799_-\|capsid	phage major capsid protein, P2 family	Q9ZXM3	Pseudomonas_virus	4.9e-83	49.7
WP_013831781.1\|378850_379660_-\|capsid	GPO family capsid scaffolding protein	K4PAW2	Burkholderia_phage	2.6e-49	44.5
WP_013831782.1\|379835_381689_+\|terminase	terminase	A4JWU9	Burkholderia_virus	2.3e-178	54.4
WP_041558681.1\|381688_382738_+\|portal	phage portal protein	E5E3X1	Burkholderia_phage	2.2e-104	58.6
WP_013831784.1\|382915_383695_-	hypothetical protein	NA	NA	NA	NA
WP_013831785.1\|383687_385025_-	DNA cytosine methyltransferase	A0A191SAU1	Nostoc_phage	1.1e-39	31.7
WP_013831786.1\|385071_385509_-	DNA mismatch endonuclease Vsr	I6NSG0	Burkholderia_phage	4.1e-33	47.2
WP_041558682.1\|385935_386733_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_148274922.1\|386686_388036_-\|integrase	integrase arm-type DNA-binding domain-containing protein	Q8W6M6	Sinorhizobium_phage	4.5e-78	43.0
WP_158511840.1\|388426_388573_+	hypothetical protein	NA	NA	NA	NA
388183:388202	attR	NA	NA	NA	NA
WP_013831789.1\|388606_389410_-	crotonase/enoyl-CoA hydratase family protein	NA	NA	NA	NA
WP_013831790.1\|389714_391028_+	Ppx/GppA family phosphatase	NA	NA	NA	NA
WP_007012491.1\|391024_391684_+	RlmE family RNA methyltransferase	NA	NA	NA	NA
WP_013831791.1\|391882_392515_-	cytochrome c family protein	NA	NA	NA	NA
WP_013831792.1\|392634_393528_+	prephenate dehydratase	NA	NA	NA	NA
WP_051010106.1\|393663_394332_+	hypothetical protein	NA	NA	NA	NA
WP_013831794.1\|394328_395666_+	hypothetical protein	NA	NA	NA	NA
WP_013831795.1\|395662_396637_+	MoxR family ATPase	NA	NA	NA	NA
WP_013831796.1\|396641_397970_+	DUF58 domain-containing protein	NA	NA	NA	NA
WP_013831797.1\|397966_399007_+	stage II sporulation protein M	NA	NA	NA	NA
WP_041558684.1\|399003_399927_+	RDD family protein	NA	NA	NA	NA
WP_013831799.1\|399926_400394_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_041558685.1\|400489_401008_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_013831801.1\|401015_402026_-	zinc transporter ZntB	NA	NA	NA	NA
WP_041558686.1\|402143_403268_+	flavodoxin-dependent (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase	NA	NA	NA	NA
WP_013831803.1\|403338_403875_+\|protease	TIGR02281 family clan AA aspartic protease	NA	NA	NA	NA

DBSCAN-SWA_2

2429137 : 2448439

Stx2-converting_phage(25.0%)

integrase,transposase

attL 2443643:2443668|attR 2450351:2450376

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_041559390.1\|2429137_2429593_+\|transposase	transposase	NA	NA	NA	NA
WP_041558956.1\|2429589_2429943_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_041558957.1\|2430013_2431645_+\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	6.5e-116	49.2
WP_013833413.1\|2432219_2433581_-	NAD(P)-binding protein	NA	NA	NA	NA
WP_013833414.1\|2433846_2434050_+	hypothetical protein	NA	NA	NA	NA
WP_013833415.1\|2434333_2436865_+	plasma-membrane proton-efflux P-type ATPase	M1IAU8	Acanthocystis_turfacea_Chlorella_virus	1.3e-51	24.6
WP_148274999.1\|2438305_2439124_-	cyclic nucleotide-binding domain-containing protein	NA	NA	NA	NA
WP_083835219.1\|2439782_2439971_+	DUF2933 domain-containing protein	NA	NA	NA	NA
WP_013833419.1\|2440026_2440323_+	hypothetical protein	NA	NA	NA	NA
WP_013833420.1\|2440745_2441789_+	type II glyceraldehyde-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_041558958.1\|2441938_2442268_-	hypothetical protein	NA	NA	NA	NA
WP_013833422.1\|2442557_2443340_-	slipin family protein	NA	NA	NA	NA
2443643:2443668	attL	NA	NA	NA	NA
WP_013833423.1\|2443936_2444713_-\|transposase	IS110 family transposase	A0A1S7J231	Thermus_phage	1.0e-10	30.9
WP_013833425.1\|2444844_2446074_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_013833426.1\|2446070_2447438_+\|integrase	tyrosine-type recombinase/integrase	S5MNZ2	Brevibacillus_phage	8.7e-05	28.6
WP_013833427.1\|2447434_2448439_+\|integrase	site-specific integrase	NA	NA	NA	NA
2450351:2450376	attR	NA	NA	NA	NA

DBSCAN-SWA_3

3718810 : 3740509

Feldmannia_irregularis_virus(10.0%)

portal,tRNA,protease,capsid,tail,head

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013834406.1\|3718810_3719221_+\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA
WP_041559141.1\|3719236_3719449_-	hypothetical protein	NA	NA	NA	NA
WP_038575945.1\|3719457_3719847_-	DUF4112 domain-containing protein	NA	NA	NA	NA
WP_013834408.1\|3719915_3721454_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_007012877.1\|3721570_3721936_-	PilZ domain-containing protein	NA	NA	NA	NA
WP_013834409.1\|3722084_3722543_-	RNA polymerase-binding protein DksA	NA	NA	NA	NA
WP_007012875.1\|3722840_3723179_+	sel1 repeat family protein	NA	NA	NA	NA
WP_013834410.1\|3723210_3724347_-	N-acetyltransferase	NA	NA	NA	NA
WP_013834411.1\|3724343_3725141_-	glycerophosphoryl diester phosphodiesterase	NA	NA	NA	NA
WP_013834412.1\|3725112_3725577_-	RidA family protein	NA	NA	NA	NA
WP_013834413.1\|3725573_3726248_-	hypothetical protein	NA	NA	NA	NA
WP_052117964.1\|3726244_3726478_-	DUF3572 domain-containing protein	NA	NA	NA	NA
WP_007012869.1\|3726585_3726948_+	response regulator	Q6XM27	Feldmannia_irregularis_virus	3.5e-06	30.2
WP_007012868.1\|3727061_3727301_+	acyl carrier protein	NA	NA	NA	NA
WP_041559143.1\|3727324_3728560_+	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	D2TEZ5	Emiliania_huxleyi_virus	7.1e-38	31.1
WP_013834415.1\|3728620_3729178_-	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	5.3e-17	38.5
WP_013834416.1\|3729256_3729532_-	usg protein	NA	NA	NA	NA
WP_013834417.1\|3729680_3730319_-	DedA family protein	NA	NA	NA	NA
WP_041559144.1\|3730505_3731006_+	hypothetical protein	NA	NA	NA	NA
WP_013834418.1\|3730992_3732318_+	DNA-packaging protein	A0A1V0DY66	Dinoroseobacter_phage	9.2e-76	42.1
WP_013834419.1\|3732342_3733503_+\|portal	phage portal protein	W8ECU7	Geobacillus_phage	1.0e-46	36.4
WP_013834420.1\|3733502_3733811_+	hypothetical protein	K4I011	Acidithiobacillus_phage	1.1e-08	45.3
WP_013834421.1\|3733807_3734206_+\|head,protease	HK97 family phage prohead protease	A0A0U2BX10	Paracoccus_phage	1.0e-14	39.2
WP_013834422.1\|3734263_3735400_+\|capsid	phage major capsid protein	A0A2D1GNH4	Pseudomonas_phage	2.3e-83	46.9
WP_013834423.1\|3735460_3736009_+\|head,tail	phage head-tail connector protein	NA	NA	NA	NA
WP_041559145.1\|3736005_3736188_+	hypothetical protein	NA	NA	NA	NA
WP_013834424.1\|3736191_3736581_+	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_013834425.1\|3736616_3737024_+\|tail	phage major tail protein, TP901-1 family	NA	NA	NA	NA
WP_013834426.1\|3737020_3737353_+	gene transfer agent family protein	NA	NA	NA	NA
WP_041559146.1\|3737349_3737544_+\|tail	phage tail assembly chaperone	NA	NA	NA	NA
WP_013834427.1\|3737536_3738112_+	hypothetical protein	D6PEW0	uncultured_phage	1.5e-06	32.2
WP_013834428.1\|3738178_3740509_+	DUF2460 domain-containing protein	A0A0K1LLZ8	Rhodobacter_phage	2.6e-33	42.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NC_015579

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 8661

Emiliania_huxleyi_virus(14.29%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_041557974.1\|899_2999_+	ParB/RepB/Spo0J family partition protein	G8DH78	Emiliania_huxleyi_virus	8.1e-34	31.1
WP_013831269.1\|3100_4153_+	toprim domain-containing protein	A0A0K1Y762	Rhodobacter_phage	2.1e-06	31.9
WP_013831270.1\|4470_5394_+	DUF2493 domain-containing protein	B0VK20	Azospirillum_phage	3.6e-10	31.9
WP_039286522.1\|5885_6173_-	HigA family addiction module antidote protein	M9MUN2	Rhodococcus_phage	1.4e-10	38.6
WP_013831273.1\|6184_6466_-	type II toxin-antitoxin system RelE/ParE family toxin	A0A222YWE2	Escherichia_phage	9.1e-10	44.3
WP_013831274.1\|6763_7705_-	Abi family protein	A0A059NT88	Lactococcus_phage	4.3e-11	22.7
WP_013831275.1\|8042_8270_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
WP_013831276.1\|8271_8661_+	type II toxin-antitoxin system death-on-curing family toxin	A0A1B3AYM0	Gordonia_phage	7.0e-08	43.4

DBSCAN-SWA_2

15961 : 16666

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013831288.1\|15961_16666_+	lytic transglycosylase domain-containing protein	A0A2H4J9N7	uncultured_Caudovirales_phage	3.4e-13	38.9

DBSCAN-SWA_3

21430 : 22204

Aeromonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013831293.1\|21430_22204_+	autoinducer binding domain-containing protein	A0A1I9KF49	Aeromonas_phage	2.8e-08	27.9

DBSCAN-SWA_4

27524 : 30110

Acinetobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013831300.1\|27524_30110_+	TonB-dependent receptor	A0A0P0I887	Acinetobacter_phage	5.6e-21	37.8

DBSCAN-SWA_5

48079 : 53041

Wolbachia_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013831319.1\|48079_50143_-	recombinase family protein	A0A1B2LRQ3	Wolbachia_phage	5.2e-09	23.6
WP_013831322.1\|51013_52048_+	GDP-mannose 4,6-dehydratase	M1I1J0	Paramecium_bursaria_Chlorella_virus	3.1e-103	55.4
WP_041558003.1\|52144_53041_+	GDP-mannose 4,6-dehydratase	A0A222YY99	Synechococcus_phage	6.3e-20	29.4

DBSCAN-SWA_6

64466 : 65138

Phaeocystis_globosa_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013831334.1\|64466_65138_-	ABC transporter ATP-binding protein	R4TX06	Phaeocystis_globosa_virus	1.9e-05	28.2

DBSCAN-SWA_7

77430 : 79660

Lactococcus_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013831348.1\|77430_78159_-	ATP-binding protein	A0A059NT77	Lactococcus_phage	1.3e-34	38.8
WP_013831349.1\|78145_79660_-\|transposase	IS21 family transposase	A0A2L1IVA1	Escherichia_phage	1.2e-15	25.6

DBSCAN-SWA_8

86440 : 87634

Macacine_betaherpesvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013831353.1\|86440_87634_+	AAA family ATPase	A0A2I6B2X3	Macacine_betaherpesvirus	2.2e-44	35.9

DBSCAN-SWA_9

100464 : 104943

Paramecium_bursaria_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013831367.1\|100464_104943_+	UDP-forming cellulose synthase catalytic subunit	M1I277	Paramecium_bursaria_Chlorella_virus	9.7e-37	33.6

DBSCAN-SWA_10

122494 : 128619

Enterobacteria_phage(25.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013831391.1\|122494_124021_+\|transposase	IS21 family transposase	U5N3F9	Enterobacteria_phage	9.4e-24	28.6
WP_013831392.1\|124010_124790_+	ATP-binding protein	A0A059NT77	Lactococcus_phage	9.9e-30	33.1
WP_013831393.1\|124909_125179_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_013831394.1\|125242_125719_+	Hsp20 family protein	A0A0C5AE28	Cyanophage	2.3e-21	42.4
WP_148274761.1\|126424_126844_+	SPW repeat protein	NA	NA	NA	NA
WP_013831397.1\|127295_127727_-	phasin family protein	NA	NA	NA	NA
WP_013831398.1\|127896_128619_-	acetoacetyl-CoA reductase	F2NZ40	Diadromus_pulchellus_ascovirus	2.1e-13	28.7

DBSCAN-SWA_11

152971 : 157024

Acanthocystis_turfacea_Chlorella_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013831430.1\|152971_154876_+	potassium transporter Kup	M1IAJ4	Acanthocystis_turfacea_Chlorella_virus	5.4e-61	30.3
WP_013831431.1\|154901_156347_+	DUF4118 domain-containing protein	NA	NA	NA	NA
WP_013831432.1\|156343_157024_+	response regulator transcription factor	W8CYM9	Bacillus_phage	1.1e-27	33.5

DBSCAN-SWA_12

161788 : 168497

uncultured_Caudovirales_phage(66.67%)

integrase

attL 149186:149199|attR 169328:169341

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
149186:149199	attL	NA	NA	NA	NA
WP_013831439.1\|161788_162076_+	BrnA antitoxin family protein	A0A2H4J5Y5	uncultured_Caudovirales_phage	2.7e-09	62.8
WP_041558059.1\|162448_163303_-	hypothetical protein	NA	NA	NA	NA
WP_013831441.1\|163302_164946_-	AAA family ATPase	K7PHD1	Enterobacteria_phage	1.0e-39	28.9
WP_013831442.1\|165521_166766_-	hypothetical protein	NA	NA	NA	NA
WP_007014466.1\|167141_167444_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_013831443.1\|167446_167692_-	type II toxin-antitoxin system ParD family antitoxin	NA	NA	NA	NA
WP_013831444.1\|167864_168497_+\|integrase	tyrosine-type recombinase/integrase	A0A2H4J6I5	uncultured_Caudovirales_phage	6.0e-09	34.2
169328:169341	attR	NA	NA	NA	NA

DBSCAN-SWA_13

179375 : 180068

Wolbachia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_041558071.1\|179375_180068_-	helix-turn-helix transcriptional regulator	A0A1B2LRS2	Wolbachia_phage	3.4e-05	31.4

DBSCAN-SWA_14

185358 : 186327

Caulobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013831460.1\|185358_186327_+	DUF1738 domain-containing protein	A0A1V0EEV1	Caulobacter_phage	8.2e-42	36.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NC_015583

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

347681 : 355133

Trichoplusia_ni_ascovirus(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_148274792.1\|347681_349100_+	cytochrome P450	A0A2I2L481	Orpheovirus	9.6e-15	22.4
WP_013836548.1\|349112_349445_+	2Fe-2S iron-sulfur cluster binding domain-containing protein	NA	NA	NA	NA
WP_013836549.1\|349485_350274_-	glucose 1-dehydrogenase	Q06VL0	Trichoplusia_ni_ascovirus	2.2e-16	30.6
WP_013836550.1\|350405_351260_+	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	1.7e-14	30.8
WP_013836551.1\|351256_351682_+	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_013836552.1\|351678_352488_+	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	1.8e-13	31.3
WP_013836553.1\|352484_353402_+	NAD-dependent epimerase/dehydratase family protein	NA	NA	NA	NA
WP_013836554.1\|353421_354354_+	alpha/beta hydrolase	A0A0G2YDK2	Acanthamoeba_polyphaga_mimivirus	3.5e-37	33.1
WP_013836555.1\|354377_355133_-	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	9.0e-20	33.2

DBSCAN-SWA_2

805532 : 868800

Ralstonia_phage(12.5%)

integrase,transposase

attL 792296:792310|attR 875442:875456

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
792296:792310	attL	NA	NA	NA	NA
WP_013836911.1\|805532_806609_-\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.3e-06	28.6
WP_013836912.1\|807167_808526_-	MFS transporter	NA	NA	NA	NA
WP_148274834.1\|808522_810766_-	glycoside hydrolase family 3 C-terminal domain-containing protein	NA	NA	NA	NA
WP_148274835.1\|811040_813293_+	TonB-dependent receptor	NA	NA	NA	NA
WP_051009949.1\|813405_814443_+	hypothetical protein	NA	NA	NA	NA
WP_148274836.1\|814503_815598_-	substrate-binding domain-containing protein	C6ZCU4	Enterobacteria_phage	1.8e-29	29.4
WP_013836917.1\|815947_816445_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_013836918.1\|816541_817939_-	aldehyde dehydrogenase	NA	NA	NA	NA
WP_013836919.1\|817972_818452_-	aromatic-ring-hydroxylating dioxygenase subunit beta	NA	NA	NA	NA
WP_013836920.1\|818444_819803_-	Rieske 2Fe-2S domain-containing protein	NA	NA	NA	NA
WP_013836921.1\|819888_821691_-	TonB-dependent receptor	NA	NA	NA	NA
WP_013836923.1\|822490_823456_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_013836926.1\|824643_825903_-	MFS transporter	NA	NA	NA	NA
WP_013836927.1\|825924_826869_-	ketopantoate reductase family protein	NA	NA	NA	NA
WP_013836928.1\|826988_828704_+	thiamine pyrophosphate-requiring protein	NA	NA	NA	NA
WP_013836932.1\|831115_833194_-	acetate--CoA ligase family protein	NA	NA	NA	NA
WP_148274837.1\|833190_834018_-	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_148274838.1\|834045_835365_-	MFS transporter	NA	NA	NA	NA
WP_013836935.1\|835523_837539_-	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_013836936.1\|837570_838779_-	3-oxoadipyl-CoA thiolase	NA	NA	NA	NA
WP_051009954.1\|838854_840000_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_013836938.1\|839996_842018_-	glycoside hydrolase family 3 protein	NA	NA	NA	NA
WP_013836940.1\|842222_843119_+	transcriptional regulator GcvA	Q6JIH3	Burkholderia_virus	5.3e-19	27.6
WP_148274840.1\|843230_843644_+	cupin domain-containing protein	NA	NA	NA	NA
WP_051009956.1\|844283_845171_-	hypothetical protein	NA	NA	NA	NA
WP_013836945.1\|845185_846490_-	MSMEG_0569 family flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_041558385.1\|846513_846801_-	MSMEG_0570 family nitrogen starvation response protein	NA	NA	NA	NA
WP_013836946.1\|846793_847768_-	sll0787 family AIR synthase-like protein	NA	NA	NA	NA
WP_013836947.1\|847764_848307_-	histone acetyltransferase	NA	NA	NA	NA
WP_148274841.1\|848306_849431_-	MSMEG_0568 family radical SAM protein	NA	NA	NA	NA
WP_013836949.1\|849366_850413_-	Nit6803 family nitriliase	NA	NA	NA	NA
WP_013836950.1\|850426_850909_-	MSMEG_0572 family nitrogen starvation response protein	NA	NA	NA	NA
WP_013836951.1\|851206_852586_+	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
WP_051009958.1\|852771_855006_+	TonB-dependent receptor	NA	NA	NA	NA
WP_083835174.1\|856491_856794_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_041558388.1\|856892_857261_+\|transposase	transposase	NA	NA	NA	NA
WP_065762387.1\|857290_857557_+	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	2.8e-24	60.9
WP_013833472.1\|861187_861367_-	hypothetical protein	NA	NA	NA	NA
WP_013836956.1\|861903_862542_+	plasmid pRiA4b ORF-3 family protein	A0A2H4PDG5	Mycobacterium_phage	7.9e-17	30.3
WP_041558588.1\|862560_862818_-	type II toxin-antitoxin system ParD family antitoxin	NA	NA	NA	NA
WP_148274889.1\|864829_865720_+\|integrase	tyrosine-type recombinase/integrase	A0A1B1P7C7	Bacillus_phage	3.3e-05	24.7
WP_013836959.1\|865719_866625_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_013836960.1\|866621_867611_+\|integrase	tyrosine-type recombinase/integrase	A0A1P8DJ76	Virus_Rctr85	1.1e-12	31.0
WP_041558390.1\|867891_868800_-\|integrase	site-specific integrase	A0A1P8DJJ6	Virus_Rctr41k	5.6e-32	31.2
875442:875456	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NC_015582

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 5070

Rhizobium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_148274745.1\|824_1157_-	hypothetical protein	NA	NA	NA	NA
WP_041557936.1\|2846_3224_+	DUF3768 domain-containing protein	L7TKV8	Rhizobium_phage	5.7e-15	40.7
WP_013836216.1\|3291_5070_+	ParB/RepB/Spo0J family partition protein	G8DH78	Emiliania_huxleyi_virus	2.0e-38	30.2

DBSCAN-SWA_2

10877 : 16372

Escherichia_phage(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_083835136.1\|10877_12098_-	site-specific DNA-methyltransferase	G8I4P9	Mycobacterium_phage	5.2e-09	38.9
WP_013836219.1\|12006_12777_-	site-specific DNA-methyltransferase	H6W8D6	Escherichia_phage	4.1e-12	36.7
WP_013836220.1\|12835_13168_-	HigA family addiction module antidote protein	A0A2L1IV52	Escherichia_phage	2.1e-05	31.2
WP_013836221.1\|13177_13468_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_148274746.1\|13532_13997_+	hypothetical protein	NA	NA	NA	NA
WP_013836223.1\|14224_14803_+	recombinase family protein	E5FFF9	Burkholderia_phage	1.5e-38	47.6
WP_013836224.1\|15117_15456_+	single-stranded DNA-binding protein	NA	NA	NA	NA
WP_013836225.1\|15703_16372_+	ParA family protein	A0A0A8IL09	Aurantimonas_phage	3.1e-40	46.6

DBSCAN-SWA_3

20947 : 24627

Salmonella_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013836235.1\|20947_23917_-\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	9.5e-198	39.7
WP_013836236.1\|24057_24627_+	recombinase family protein	A0A219Y9V9	Aeromonas_phage	3.1e-33	46.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_015580

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NC_015579

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NC_015583

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

4. NC_015582

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection