CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NC_016109	Kitasatospora setae KM-6054, complete genome	9 crisprs	cas1,cas6e,cas5,cas7,cse2gr11,cas8e,WYL,cas3,csa3,DEDDh,PD-DExK,RT,DinG,cas2,cas4	4	78	1	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_016109_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_016109_1

591400-591479

Orphan

Consensus_repeat	Method
GAGTTGGAGGAGACCAACCGGGGCGT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_016109_1

>merge|NC_016109|1|591400-591479|CRISPRCasFinder
GAGTTGGAGGAGACCAACCGGGGCGTCCTGGCGCTGTACTCGGAGCTGTCGGAGGAGCTGGAGGAGACCAACCGGGGCGT

>NC_016109|1|1|591400-591479|CRISPRCasFinder
GAGTTGGAGGAGACCAACCGGGGCGT	CCTGGCGCTGTACTCGGAGCTGTCGGAG
GAGCTGGAGGAGACCAACCGGGGCGT

Protein	Signature genes	Signature genes Name	Protein_function
NC_016109.1\|WP_063747488.1\|585503_585875_+\|STAS-domain-containing-protein	unknown	unknown	gnl\|CDD\|132914
NC_016109.1\|WP_014133681.1\|589184_589601_+\|anti-sigma-regulatory-factor	unknown	unknown	gnl\|CDD\|340411
NC_016109.1\|WP_014133685.1\|594396_594753_+\|anti-sigma-factor-antagonist	unknown	unknown	gnl\|CDD\|132914
NC_016109.1\|WP_014133673.1\|582424_583627_-\|cobalamin-dependent-protein	unknown	unknown	gnl\|CDD\|227345
NC_016109.1\|WP_014133679.1\|587974_588814_+\|STAS-domain-containing-protein	unknown	unknown	gnl\|CDD\|132912
NC_016109.1\|WP_033259693.1\|587298_587772_+\|DNA-starvation/stationary-phase-protection-protein	unknown	unknown	gnl\|CDD\|153102
NC_016109.1\|WP_014133680.1\|588810_589188_+\|STAS-domain-containing-protein	unknown	unknown	gnl\|CDD\|132912
NC_016109.1\|WP_014133687.1\|595535_596546_-\|YihY/virulence-factor-BrkB-family-protein	unknown	unknown	gnl\|CDD\|224214
NC_016109.1\|WP_014133686.1\|594759_595539_-\|phosphatase-PAP2-family-protein	unknown	unknown	gnl\|CDD\|239486
NC_016109.1\|WP_014133688.1\|596545_598222_-\|phosphatase-PAP2-family-protein	unknown	unknown	gnl\|CDD\|224513
NC_016109.1\|WP_033259686.1\|600784_602260_-\|SulP-family-inorganic-anion-transporter	unknown	unknown	gnl\|CDD\|223732
NC_016109.1\|WP_014133674.1\|583623_585237_-\|SpoIIE-family-protein-phosphatase	unknown	unknown	gnl\|CDD\|369272
NC_016109.1\|WP_014133689.1\|598338_599556_+\|cardiolipin-synthase-B	unknown	unknown	gnl\|CDD\|234967
NC_016109.1\|WP_014133684.1\|592646_594284_+\|fused-response-regulator/phosphatase	unknown	unknown	gnl\|CDD\|369272
NC_016109.1\|WP_014133690.1\|599628_599898_+\|hypothetical-protein	unknown	unknown	unknown
NC_016109.1\|WP_014133693.1\|602558_602921_-\|hypothetical-protein	unknown	unknown	unknown
NC_016109.1\|WP_051055090.1\|586610_587036_-\|SsgA-family-sporulation/cell-division-regulator	unknown	unknown	gnl\|CDD\|377399
NC_016109.1\|WP_014133682.1\|589597_590842_+\|SpoIIE-family-protein-phosphatase	unknown	unknown	gnl\|CDD\|340411
NC_016109.1\|WP_014133691.1\|599937_600759_+\|DUF1206-domain-containing-protein	unknown	unknown	gnl\|CDD\|377695
NC_016109.1\|WP_014133676.1\|585949_586363_+\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|340413

Protein	Function_ID	Function_description	E-value
NC_016109.1\|WP_063747488.1\|585503_585875_+\|STAS-domain-containing-protein	gnl\|CDD\|132914	cd07043, STAS_anti-anti-sigma_factors, Sulphate Transporter and Anti-Sigma factor antagonist) domain of anti-anti-sigma factors, key regulators of anti-sigma factors by phosphorylation. Anti-anti-sigma factors play an important role in the regulation of several sigma factors and their corresponding anti-sigma factors. Upon dephosphorylation they bind the anti-sigma factor and induce the release of the sigma factor from the anti-sigma factor. In a feedback mechanism the anti-anti-sigma factor can be inactivated via phosphorylation by the anti-sigma factor. Well studied examples from Bacillus subtilis are SpoIIAA (regulating sigmaF and sigmaC which play an important role in sporulation) and RsbV (regulating sigmaB involved in the general stress response). The STAS domain is also found in the C- terminal region of sulphate transporters and stressosomes.	4.7861e-19
NC_016109.1\|WP_014133681.1\|589184_589601_+\|anti-sigma-regulatory-factor	gnl\|CDD\|340411	cd16934, HATPase_RsbT-like, Histidine kinase-like ATPase domain of the anti sigma-B factor Bacillus subtilis serine/threonine-protein kinase RsbT, and related domains. This family includes the histidine kinase-like ATPase (HATPase) domain of Bacillus subtilis serine/threonine-protein kinase RsbT, a component of the stressosome signaling complex of Bacillus subtilis. The stressosome is formed from multiple copies of three proteins, a sensor protein RsbR, a scaffold protein RsbS, and RsbT, and responds to environmental changes by initiating a protein partner switching cascade. Stress perception increases the phosphorylation of RsbR and RsbS, by RsbT. Subsequent dissociation of RsbT from the stressosome activates the sigma-B cascade, leading to the release of the alternative sigma factor, sigma-B.	4.85918e-39
NC_016109.1\|WP_014133685.1\|594396_594753_+\|anti-sigma-factor-antagonist	gnl\|CDD\|132914	cd07043, STAS_anti-anti-sigma_factors, Sulphate Transporter and Anti-Sigma factor antagonist) domain of anti-anti-sigma factors, key regulators of anti-sigma factors by phosphorylation. Anti-anti-sigma factors play an important role in the regulation of several sigma factors and their corresponding anti-sigma factors. Upon dephosphorylation they bind the anti-sigma factor and induce the release of the sigma factor from the anti-sigma factor. In a feedback mechanism the anti-anti-sigma factor can be inactivated via phosphorylation by the anti-sigma factor. Well studied examples from Bacillus subtilis are SpoIIAA (regulating sigmaF and sigmaC which play an important role in sporulation) and RsbV (regulating sigmaB involved in the general stress response). The STAS domain is also found in the C- terminal region of sulphate transporters and stressosomes.	5.02152e-21
NC_016109.1\|WP_014133673.1\|582424_583627_-\|cobalamin-dependent-protein	gnl\|CDD\|227345	COG5012, COG5012, Predicted cobalamin binding protein [General function prediction only].	9.15737e-20
NC_016109.1\|WP_014133679.1\|587974_588814_+\|STAS-domain-containing-protein	gnl\|CDD\|132912	cd07041, STAS_RsbR_RsbS_like, Sulphate Transporter and Anti-Sigma factor antagonist domain of the "stressosome" complex proteins RsbS and RsbR, regulators of the bacterial stress activated alternative sigma factor sigma-B by phosphorylation. The STAS (Sulphate Transporter and Anti-Sigma factor antagonist) domain of proteins related to RsbS and RsbR which are part of the "stressosome" complex that plays an important role in the regulation of the bacterial stress activated alternative sigma factor sigma-B. During stress conditions RsbS and RsbR are phosphorylated which leads to the release of RsbT, an activator of of the RsbU phosphatase, which in turn activates RsbV which leads to the release and activation of sigma factor B. RsbS is a single domain protein (STAS domain), while RsbR-like proteins have a well-conserved C-terminal STATS domain and a variable N-terminal domain. The STAS domain is also found in the C- terminal region of sulphate transporters and anti-anti-sigma factors.	4.0427e-42
NC_016109.1\|WP_033259693.1\|587298_587772_+\|DNA-starvation/stationary-phase-protection-protein	gnl\|CDD\|153102	cd01043, DPS, DPS protein, ferritin-like diiron-binding domain. DPS (DNA Protecting protein under Starved conditions) domain is a member of a broad superfamily of ferritin-like diiron-carboxylate proteins. Some DPS proteins nonspecifically bind DNA, protecting it from cleavage caused by reactive oxygen species such as the hydroxyl radicals produced during oxidation of Fe(II) by hydrogen peroxide. These proteins assemble into dodecameric structures, some form DPS-DNA co-crystalline complexes, and possess iron and H2O2 detoxification capabilities. Expression of DPS is induced by oxidative or nutritional stress, including metal ion starvation. Members of the DPS family are homopolymers formed by 12 four-helix bundle subunits that assemble with 23 symmetry into a hollow shell. The DPS ferroxidase site is unusual in that it is not located in a four-helix bundle as in ferritin, but is shared by 2-fold symmetry-related subunits providing the iron ligands. Many DPS sequences (e.g., E. coli) display an N-terminal extension of variable length that contains two or three positively charged lysine residues that extends into the solvent and is thought to play an important role in the stabilization of the complex with DNA. DPS Listeria Flp, Bacillus anthracis Dlp-1 and Dlp-2, and Helicobacter pylori HP-NAP which lack the N-terminal extension, do not bind DNA. DPS proteins from Helicobacter pylori, Treponema pallidum, and Borrelia burgdorferi are highly immunogenic.	7.31418e-45
NC_016109.1\|WP_014133680.1\|588810_589188_+\|STAS-domain-containing-protein	gnl\|CDD\|132912	cd07041, STAS_RsbR_RsbS_like, Sulphate Transporter and Anti-Sigma factor antagonist domain of the "stressosome" complex proteins RsbS and RsbR, regulators of the bacterial stress activated alternative sigma factor sigma-B by phosphorylation. The STAS (Sulphate Transporter and Anti-Sigma factor antagonist) domain of proteins related to RsbS and RsbR which are part of the "stressosome" complex that plays an important role in the regulation of the bacterial stress activated alternative sigma factor sigma-B. During stress conditions RsbS and RsbR are phosphorylated which leads to the release of RsbT, an activator of of the RsbU phosphatase, which in turn activates RsbV which leads to the release and activation of sigma factor B. RsbS is a single domain protein (STAS domain), while RsbR-like proteins have a well-conserved C-terminal STATS domain and a variable N-terminal domain. The STAS domain is also found in the C- terminal region of sulphate transporters and anti-anti-sigma factors.	6.07073e-31
NC_016109.1\|WP_014133687.1\|595535_596546_-\|YihY/virulence-factor-BrkB-family-protein	gnl\|CDD\|224214	COG1295, Rbn, Ribonuclease BN family enzyme [Replication, recombination, and repair].	3.59479e-44
NC_016109.1\|WP_014133686.1\|594759_595539_-\|phosphatase-PAP2-family-protein	gnl\|CDD\|239486	cd03392, PAP2_like_2, PAP2_like_2 proteins. PAP2 is a super-family of phosphatases and haloperoxidases. This subgroup, which is specific to bacteria, lacks functional characterization and may act as a membrane-associated lipid phosphatase.	2.30168e-35
NC_016109.1\|WP_014133688.1\|596545_598222_-\|phosphatase-PAP2-family-protein	gnl\|CDD\|224513	COG1597, LCB5, Sphingosine kinase and enzymes related to eukaryotic diacylglycerol kinase [Lipid metabolism / General function prediction only].	8.33047e-47
NC_016109.1\|WP_033259686.1\|600784_602260_-\|SulP-family-inorganic-anion-transporter	gnl\|CDD\|223732	COG0659, SUL1, Sulfate permease and related transporters (MFS superfamily) [Inorganic ion transport and metabolism].	3.49234e-83
NC_016109.1\|WP_014133674.1\|583623_585237_-\|SpoIIE-family-protein-phosphatase	gnl\|CDD\|369272	pfam07228, SpoIIE, Stage II sporulation protein E (SpoIIE). This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.	1.11574e-35
NC_016109.1\|WP_014133689.1\|598338_599556_+\|cardiolipin-synthase-B	gnl\|CDD\|234967	PRK01642, cls, cardiolipin synthetase; Reviewed.	4.94478e-85
NC_016109.1\|WP_014133684.1\|592646_594284_+\|fused-response-regulator/phosphatase	gnl\|CDD\|369272	pfam07228, SpoIIE, Stage II sporulation protein E (SpoIIE). This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.	2.23816e-38
NC_016109.1\|WP_051055090.1\|586610_587036_-\|SsgA-family-sporulation/cell-division-regulator	gnl\|CDD\|377399	pfam04686, SsgA, Streptomyces sporulation and cell division protein, SsgA. The precise function of SsgA is unknown. It has been found to be essential for spore formation, and to stimulate cell division.	1.76568e-27
NC_016109.1\|WP_014133682.1\|589597_590842_+\|SpoIIE-family-protein-phosphatase	gnl\|CDD\|340411	cd16934, HATPase_RsbT-like, Histidine kinase-like ATPase domain of the anti sigma-B factor Bacillus subtilis serine/threonine-protein kinase RsbT, and related domains. This family includes the histidine kinase-like ATPase (HATPase) domain of Bacillus subtilis serine/threonine-protein kinase RsbT, a component of the stressosome signaling complex of Bacillus subtilis. The stressosome is formed from multiple copies of three proteins, a sensor protein RsbR, a scaffold protein RsbS, and RsbT, and responds to environmental changes by initiating a protein partner switching cascade. Stress perception increases the phosphorylation of RsbR and RsbS, by RsbT. Subsequent dissociation of RsbT from the stressosome activates the sigma-B cascade, leading to the release of the alternative sigma factor, sigma-B.	1.85606e-30
NC_016109.1\|WP_014133691.1\|599937_600759_+\|DUF1206-domain-containing-protein	gnl\|CDD\|377695	pfam06724, DUF1206, Domain of Unknown Function (DUF1206). This region consists of two a pair of transmembrane helices and occurs three times in each of the family member proteins.	1.26133e-09
NC_016109.1\|WP_014133676.1\|585949_586363_+\|ATP-binding-protein	gnl\|CDD\|340413	cd16936, HATPase_RsbW-like, Histidine kinase-like ATPase domain of RsbW, an anti sigma-B factor and serine-protein kinase involved in regulating sigma-B during stress in Bacilli, and related domains. This family includes histidine kinase-like ATPase (HATPase) domain of RsbW, an anti sigma-B factor as well as a serine-protein kinase involved in regulating sigma-B during stress in Bacilli. The alternative sigma factor sigma-B is an important regulator of the general stress response of Bacillus cereus and B. subtilis. RsbW is an anti-sigma factor while RsbV is an anti-sigma factor antagonist (anti-anti-sigma factor). RsbW can also act as a kinase on RsbV. In a partner-switching mechanism, RsbW, RsbV, and sigma-B participate as follows: in non-stressed cells, sigma-B is present in an inactive form complexed with RsbW; in this form, sigma-B is unable to bind to RNA polymerase. Under stress, RsbV binds to RsbW, forming an RsbV-RsbW complex, and sigma-B is released to bind to RNA polymerase. RsbW may then act as a kinase on RsbV, phosphorylating a serine residue; RsbW is then released to bind to sigma-B, hence blocking its ability to bind RNA polymerase. A phosphatase then dephosphorylates RsbV so that it can again form a complex with RsbW, leading to the release of sigma-B.	7.13869e-14

>NC_016109.1|WP_014133682.1|589597_590842_+|SpoIIE-family-protein-phosphatase
MTPPAAPAVALGEDTVWLRHSDSLPAAARNAARQLAHRIGLLPERAAEVALAVSEAATNLRRHAVDGAMVLRVVRTDAEAALEFLTVDSGPGMADVPAALADGYSSGPTLGIGLGAVSRLADAFDLHSLPGRGTVLAARFWNRTPSGRAAAAAGEPVAAGLTRPMSGQELCGDAWAVRPAGGPPPPAADRRPVAAAHLDWAVLTNRAPRTHSPAGPRTEAARTEATSTGAGPAGGDGRRGGGGAGDGAFLLMFCDGLGHGPLAARAAAEAVAAFHRTSAHRPEEVLAELHRALRSGRGGAVAVALVEPAEARLVFCGVGNVSAFVVDPVGGTRRALPSSPGIVGHQLPTAHIVRQQLAPGSAVVLHSDGLTDRWRAPDVPGLFSHLPVTAAALLLREAGVRRDDAGVLVAKGAW
>NC_016109.1|WP_014133681.1|589184_589601_+|anti-sigma-regulatory-factor
MTGPRVEDEQRVPIGSNDDVVRARQTVRTYAQQCGLSLVDQTKLVTAASELARNTLVYGGGGLMRCATVRSGARVGVHAVFEDSGPGIPDLDLALTDGWTSGGGLGLGLSGARRLVDEFELHSEPGAGTKVSVTKWAR
>NC_016109.1|WP_014133680.1|588810_589188_+|STAS-domain-containing-protein
MSDRVPVLKIGQVLLVSIQVDLEDQVVLDLQDDLAERIVATGANGVVIDITALEIVDSFVGRMLANTAAISRMLDAETVVVGMRPAVAITLVELGLSLGGVRTALTLEKGLALLERDRTARTGRP
>NC_016109.1|WP_014133679.1|587974_588814_+|STAS-domain-containing-protein
MAVEQASERLVELLTRDDAVQDQWVNAVAAALGARISRAELERELSDLYQALLQALDKGGLDWQGEAYSEVRALLVELSRSRARYGFTPTETAVSVFACKDVLEPTSISTPEDITAYLQLTRLLDALGLFTIEAYARTREEIISAQAEQLLELSTPVVKLWEDVVAVPLVGTLDSARTQVVMEKLLQSLVDSGSEHAIIDITGVPAVDTEVAQHLLKTVVAARLMGAECTISGIRPQIAQTLVALGVQFGDIVTKATLADALRHVLQLSGAQAPAGGAR
>NC_016109.1|WP_033259693.1|587298_587772_+|DNA-starvation/stationary-phase-protection-protein
MDIADGSPLNAHDRETAGEALQGALVDLVDLSLVGKQAHWNLYGPRFRSVHLHLDEVVATARDYADQVAERAAAIGVSPDGRAATVAAGGLPGAPAGWQADTAVVEWLVEALGTVVGRMRERIAKTGDADPVTQDLLIGVTAALEEHSWMFRAENRG
>NC_016109.1|WP_051055090.1|586610_587036_-|SsgA-family-sporulation/cell-division-regulator
MGTRMPAAVFRSFSVTLPESAYPDTRVAARLRFDPALPYGVELAFPPHRPGGEEITWRFGRDLLAEGRLTPAGEGDVRVAPGPDGRILITLGALGPQAERALISTPDTAVAAFLAEAYTEVPPGTETAHLDLAPGLARLLA
>NC_016109.1|WP_014133676.1|585949_586363_+|ATP-binding-protein
MSGAETDLTQRPGLPARPPVRTAAEARAAVTEALARCFPVGGRLHGDACLAATELVTNAIRHAGGVTGFAVRADRAAGLTIEVEDAADAGPSGDAAHLDDPTRLGGRGWPLVRLVSSHWEVEPLPGGGKRIRITLTG
>NC_016109.1|WP_063747488.1|585503_585875_+|STAS-domain-containing-protein
MTDHTHGAAGTGRRADVETVRARGELDWEDAQDFGQRLAAALDRRPRLLVVDFAEVTFADSSVLHGLLVARRRMAEDGGRLVLAGPLRAAVRRLIDLAAAGSHLPVAPDMAAALRGDVPGSPV
>NC_016109.1|WP_014133674.1|583623_585237_-|SpoIIE-family-protein-phosphatase
MASSISSAAITDGDFLAGSPYPVALLGPDGRILHASDRARRLLADRDGTPGWLRRAHLALPDDGPRPRPVRHTDPMAGPVEAHPTRRPDGSAVWWFVSREDRPAGPSPADGGGPHDWELLARLSGLLLSSLNADRVLETAARQAALHLADAAVLVAPGSGRVLRLVTCLRGADPAHAQVRADPAEVPGLAEALRGFPPVPSRWIDPGAAPHWLVPDGFGRVGSVLVTPLPGHGVPAGALVLLRTPAAGPFDPAEESFARMFAVRAGAAVSAAVMYSEQAAVTDLLMRELLPPRLEHLDGVDFAGGYRASGDRDRIGGDFYDVHPAAEPGGETLALLGDVSGKGLEAAVMTGKVRNTLHALLPLADDHQRVLHLLNRALLTSRHTRFASLVLASVRREDDRVRVRLSAAGHPAPMVVRADGRVTESTTLGSIVGVLPEATTRTDTVLLDPGEACVLYSDGITEAKGGPTGREQFGDHRLRRALAECAGLPAEAIVERVQMLAAQWLRENRHDDMAVMVIAAPPRGHVPVIGRQRGLPE
>NC_016109.1|WP_014133673.1|582424_583627_-|cobalamin-dependent-protein
MNDRASTATLGPETGTGPGTGTGAGPATGTGPEAGPVDRTEELWEAVLGGDQARAAALAVAALERGLHPEELLLDVIGALQARIGREWAADRITVIQEHAATAVNERVVAVVTGHPAFAAATAPRRPGRIAVACVEGEWHAFPARLLAEVLTLRGWRVDYLGAQCPTPHLIAHLHRTAPDVLALSAALPTRLPAAHSAITAAQAAGVPVVVGGAAFGPDGRHARLLGADAWAPDARAAARRLARGLPLPASPHRPVDDLPHLADQEYTLVGRDPRAPAAAVLAALADRHPAVRAYTGAQREHTLDDLTQIVEHLAVALYTGDAELFTAFTDWTRHVLLARSVPDALLTSALSVLREHLRDLPRSVAILTAALAAAPPATPLTAAAPPRTDTARPTTGTPA
>NC_016109.1|WP_014133684.1|592646_594284_+|fused-response-regulator/phosphatase
MTPTSPDAGPATVLVLDDNDTTRYVVGSWLRRSGHTVVEAVDGAQALALLERSPATELPELAVVDISLPDMTGFEVCERIKGAPRTAALPVVHISATAIEASDRTQGLHRGADAYLTEPIDPAELQATVTAVLRYTRARRRAERLAARVAALHRSTLALYGATDPDALAGSAALGAVRLGAARATAIALGPDRDTLHLAHHDPGLPDGPEVRLFEAPPVLLDLLAHHTLGDATGAGTALLDAEAWSAVLADHGLAGTGLPTGPVAVVTARTKPGRPPLAVVVDGDALAAPDERDLLPQLTQAAALALEAQRSQAEEHALALTLQRSFLPGRLPAVPGVELAVRYEPASARSEIGGDFYEAIDTPDGLLLAIGDVAGHSLEAAMAMGELRHALRAYAIEGHDPQTLLHRLDTLLTRLRPGLTATVCLVLIAPDRRSVRIANAGHLPPLLRLPDGSARYLSEHGILLGLNVPQPPTTEYPVPPGSTLLLVTDGLIEVPGEHLQTGLDTLRDAFADAPPELDRAGDLLLSAFARAQTDDIALLIARLD
>NC_016109.1|WP_014133685.1|594396_594753_+|anti-sigma-factor-antagonist
MPEYDLTIDVRRHPVGATVVVLAGELDYHTAPRLHRAVERTAEALPLVLDLTLLRFCDSLGVAELIFAFRRTRAAGTSLALVGTTPDVGRLLAMTGLDRLLPRHESVDAALGALRPDG
>NC_016109.1|WP_014133686.1|594759_595539_-|phosphatase-PAP2-family-protein
MTRRHLTRPRAADPRAADLRLGERLLAAVAAFAVAAVPAALLLVLVEANWAPLHRLDAGAARRLHAVVREHPAVLAVLRVLSDRVWDPTTMRLLVAAAVAWLLWRRAWRLAVWAAATVTASGLLGWAVKAAVARARPALPDPVAHAPGFSFPSGHAMTAATCAAVLLLAASPALRPAWRLAARTVAGLSVLGVGFTRVALGVHWVSDVLGGWLLGLALVAATARAFEGWRRDTGRPVPPPFADGLEPELAPGGPARPEG
>NC_016109.1|WP_014133687.1|595535_596546_-|YihY/virulence-factor-BrkB-family-protein
MGTASRVRPGSEHLSADEAVGTLRRREWWALARDAFVRFRYADGFSHARALAFQVVLALVPFTIAVVGLAGSLHGGPVGRLVAAVIERMVPEPSSDLVREVLDRGREHTGGTFALWFGALFALANLVTAMSQIERGANRIYGIERDRPFDRKYGRSLLMAAGAGLPLGAGFLVLVAGPQLAAAADEVFGLGPRTATAWTLLRWPVGVLLTLTSAAVIFRRAPRRRQPGYSWLAFGAGLYLVLWLAATWLLSLYLRLSGSFDAVYGPLSAVFSLLVWAYLTAIALFLGLSFAAQLEAVRTARPGPIRPDPLAPSEQGSEQGSEHESEQGSEPGEEDR
>NC_016109.1|WP_014133688.1|596545_598222_-|phosphatase-PAP2-family-protein
MTRTKRRAPLLGALAAATVQGLLLFAMGVLVTHPPGGWWDPREETLVRRLAEHRTPALTTLSSWLSGLAFTPAIVAVTAAAAALLLLRRRPRPAALLAGAVALQATLFVTAAHLVGRARPDVLRLDGALPTSSFPSGHVGAATALYGGLGLLALRAPRGRWRVPLCALAWTVPVLVAASRLYRGMHHPSDVLAGALNGAAALWVVWRALPPRAPRTPARHPARTDAPARADAPPTALVYNPLAVDDALLERLSAVLVAHGHRPPSRLPGDPDDCGRAAAERALADGARLVAACGGDGTVTACAEALAGTGATLAVVPCGTGNLLARNLGLPVEPVAALAAALDGRTRRIDLIRAEGDGLPARAAATMAGMGLDAAVMADTAPALKRRLGWPAYLLAAVRHLADRRFAVTVRVDDAPPLRRRVRTAVVGNVGRLQGGVRLLPAARPDDGVLDLVLIGPHGFLGWWRTLLSLLTGKPPAGPDAPLEHHRGHRIELTATRPRPRECDGDPVGPGRTLVLTARPAALLVRVPGPAGPEPAAGARTAGTEPAAGARTARTEAA
>NC_016109.1|WP_014133689.1|598338_599556_+|cardiolipin-synthase-B
MTTTETAPVPAPVPAPDPLPADRGRALRRRLEGLLGIAATEGNLLTPLRNGDEIFPAMLEAVDGARRTVDLMTFVYWRGDIARLFAQALARKAAEGLRVRLLLDGFGCRLIEPDLLELMESAGVRICWFRRPVRLSPFKQNHRCHRKVLVVDGRTAFTGGVGIAEEWCGDARNPGEWRDTHVRVVGPAVDGIAAAFAQNWAECAPGALYDAADRFEEHEQPGDSVVQVVRGSAAVGWQDLQTLMRVVISSAERRLRLATAYFAPDDYFVDLLCAAGRRGVAVDLLVPGEHTDKRVCQLAGERHFGRLAEAGVRVWRYGPTMMHAKVLTVDGTAALVGSANFNRRSLDHDEEVVLAVVDPEFTAVLDRHFDEDLARSEAVVPARWSRRGLGLRALEAATAPIRHFL
>NC_016109.1|WP_014133690.1|599628_599898_+|hypothetical-protein
MRRTTSVISVVAHAIAAILVIWILLDLFEANPDNSLVHWFHTAADWLAGWSRGLFTVSNRTAQILLDYGLPAVVYVVVGNLVTRGRALD
>NC_016109.1|WP_014133691.1|599937_600759_+|DUF1206-domain-containing-protein
MTATGTATGTGPGGGTSARAVRAAGRSGFVARGVVYALVGVLALRIAFGTGGEDADRQGALHQVALRPFGAVLLWVLAAGFLGMALWRAWTAVFGEAGERKTGSRVLSAGRAVFYASVAWGTAAYAAGSGGGSDSDAASRDWTATVLGWPGGRWLVGAAGLALAGVGVAIGVRALQRRFLRKLDTSGMRPRTRTAVTGTGVSGNLARGVLYAAAGAFAAVAAVRFDPGRAKGMDDTLRALATSPAGPWLLAVVAAGLVLYGVFSFLSARWRRF
>NC_016109.1|WP_033259686.1|600784_602260_-|SulP-family-inorganic-anion-transporter
MLRRAFVHWRHDLPASLVVFLVAVPLCVGVAVASGVPAERGLVTGIVGGLVVGLLPGSSLQVSGPAAGLTVLVFDAVQRFGLESLGVLVLAAGLLQVAMGLLRTGRWFRAISLSVVHGMLAGIGLILILGQLYAVSGRTAPGSGGGKIAGLPGLLGDWFTGRAATTALLMGAATVVLLTLWKKLPGPVRAVPAPLAAVALAAAATAVFGLDVPRVRVDGLLDAVALPTRDGLAAVTGLAGLGTVLAFALIASAESLFSAAAVDRMHHGPRTDYDRELTAQGIGNTLSGLLGALPLTAVIVRSAANVQAGARSKTARVLHGLWLLLFAALLPAVLGLIPLAVLGGVLVHAGAKLIPVAPTVTLWRGHRGELAVMAVTTAAIVFTTLFEGVLVGVALAVAKSAWQTSQLHIDLTDTGPGGPLRISLSGNATFLRLPRLLDTLEALPAGRAVELDWTGLRHLDHACHTALHTWAARHSAHDPTTVSWEPPLSVT
>NC_016109.1|WP_014133693.1|602558_602921_-|hypothetical-protein
MTGRGAAWGGRFAVLLAVALAAVLAVLTAGPPAQARMPRPPAASVAEEHVECGHQHEAQVPTGRAAGRHRANGGPPARTGARPDEDAATGVPRAPLPAGPVPAAGGSRPAALARIQVFRC

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_016109_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_016109_2

613078-613838

TypeI-E

Consensus_repeat	Method
GGAGCAACCCCCGCGAGCGCGGGGCCGAG	CRT
GAGCAACCCCCGCGAGCGCGGGGCCGAG	CRISPRCasFinder
GAGCAACCCCCGCGAGCGCGGGGCCGAG	PILER-CR

12 spacers

cas2,cas1,cas6e,cas5,cas7,cse2gr11,cas8e

The CRISPR arrays of NC_016109_2

>merge|NC_016109|2|613078-613838|CRT,CRISPRCasFinder,PILER-CR
GGAGCAACCCCCGCGAGCGCGGGGCCGAGGCCGTCGACGGCCTGACCGACGACGAGGGCGCGGAGCAACCCCCGCGAGCGCGGGGCCGAGACCACGCCCGCCCGTCGTCGCCCCAGATGTCCGGAGCAACCCCCGCGAGCGCGGGGCCGAGCCGACAACCCGGGGGAAGACGGCGCGACGCCGAGAGCAACCCCCGCGAGCGCGGGGCCGAGCGACCTGGACGCGGTGCGCGCCGCGTTCGCCGCGAGCAACCCCCGCGAGCGCGGGGCCGAGCAGCACTGCGTCCTGACCTACAGGGTCAACCTGGAGCAACCCCCGCGAGCGCGGGGCCGAGCTGGTGTCGATCAGGTCGGCAGCCTCGCCGAGGGAGCAACCCCCGCGAGCGCGGGGCCGAGTGCTGTGGAACTGCTGCGGCACCCACGGCTGGAGAGCAACCCCCGCGAGCGCGGGGCCGAGGGCGTCGGTGGCGAGGAGTTCGGTGGGGGTGAGGAGCAACCCCCGCGAGCGCGGGGCCGAGTCGGCGAGGGTGTGCTGGGCGTCGGCGTAGGCGGAGCAACCCCCGCGAGCGCGGGGCCGAGATCACGCCGCGGGTCCGCAGCTCCGCGAGCAGGGAGCAACCCCCGCGAGCGCGGGGCCGAGCCCACTAGAGCGAGCACGACTTCGCGGTCCCGGGAGCAACCCCCGCGAGCGCGGGGCCGAGATGACGACCGGGTCGGCCAGCGACCCGGATCCGGAGCAACCCCCGCGAGCGCGGGGCCGAG

>NC_016109|2|1|613078-613838|CRT
GGAGCAACCCCCGCGAGCGCGGGGCCGAG	GCCGTCGACGGCCTGACCGACGACGAGGGCGC
GGAGCAACCCCCGCGAGCGCGGGGCCGAG	ACCACGCCCGCCCGTCGTCGCCCCAGATGTCC
GGAGCAACCCCCGCGAGCGCGGGGCCGAG	CCGACAACCCGGGGGAAGACGGCGCGACGCCG
AGAGCAACCCCCGCGAGCGCGGGGCCGAG	CGACCTGGACGCGGTGCGCGCCGCGTTCGCCG
CGAGCAACCCCCGCGAGCGCGGGGCCGAG	CAGCACTGCGTCCTGACCTACAGGGTCAACCT
GGAGCAACCCCCGCGAGCGCGGGGCCGAG	CTGGTGTCGATCAGGTCGGCAGCCTCGCCGAG
GGAGCAACCCCCGCGAGCGCGGGGCCGAG	TGCTGTGGAACTGCTGCGGCACCCACGGCTGG
AGAGCAACCCCCGCGAGCGCGGGGCCGAG	GGCGTCGGTGGCGAGGAGTTCGGTGGGGGTGA
GGAGCAACCCCCGCGAGCGCGGGGCCGAG	TCGGCGAGGGTGTGCTGGGCGTCGGCGTAGGC
GGAGCAACCCCCGCGAGCGCGGGGCCGAG	ATCACGCCGCGGGTCCGCAGCTCCGCGAGCAG
GGAGCAACCCCCGCGAGCGCGGGGCCGAG	CCCACTAGAGCGAGCACGACTTCGCGGTCCCG
GGAGCAACCCCCGCGAGCGCGGGGCCGAG	ATGACGACCGGGTCGGCCAGCGACCCGGATCC
GGAGCAACCCCCGCGAGCGCGGGGCCGAG

>NC_016109|2|2|613079-613838|CRISPRCasFinder
GAGCAACCCCCGCGAGCGCGGGGCCGAG	GCCGTCGACGGCCTGACCGACGACGAGGGCGCG
GAGCAACCCCCGCGAGCGCGGGGCCGAG	ACCACGCCCGCCCGTCGTCGCCCCAGATGTCCG
GAGCAACCCCCGCGAGCGCGGGGCCGAG	CCGACAACCCGGGGGAAGACGGCGCGACGCCGA
GAGCAACCCCCGCGAGCGCGGGGCCGAG	CGACCTGGACGCGGTGCGCGCCGCGTTCGCCGC
GAGCAACCCCCGCGAGCGCGGGGCCGAG	CAGCACTGCGTCCTGACCTACAGGGTCAACCTG
GAGCAACCCCCGCGAGCGCGGGGCCGAG	CTGGTGTCGATCAGGTCGGCAGCCTCGCCGAGG
GAGCAACCCCCGCGAGCGCGGGGCCGAG	TGCTGTGGAACTGCTGCGGCACCCACGGCTGGA
GAGCAACCCCCGCGAGCGCGGGGCCGAG	GGCGTCGGTGGCGAGGAGTTCGGTGGGGGTGAG
GAGCAACCCCCGCGAGCGCGGGGCCGAG	TCGGCGAGGGTGTGCTGGGCGTCGGCGTAGGCG
GAGCAACCCCCGCGAGCGCGGGGCCGAG	ATCACGCCGCGGGTCCGCAGCTCCGCGAGCAGG
GAGCAACCCCCGCGAGCGCGGGGCCGAG	CCCACTAGAGCGAGCACGACTTCGCGGTCCCGG
GAGCAACCCCCGCGAGCGCGGGGCCGAG	ATGACGACCGGGTCGGCCAGCGACCCGGATCCG
GAGCAACCCCCGCGAGCGCGGGGCCGAG

>NC_016109|2|1|613140-613838|PILER-CR
GAGCAACCCCCGCGAGCGCGGGGCCGAG	ACCACGCCCGCCCGTCGTCGCCCCAGATGTCCG
GAGCAACCCCCGCGAGCGCGGGGCCGAG	CCGACAACCCGGGGGAAGACGGCGCGACGCCGA
GAGCAACCCCCGCGAGCGCGGGGCCGAG	CGACCTGGACGCGGTGCGCGCCGCGTTCGCCGC
GAGCAACCCCCGCGAGCGCGGGGCCGAG	CAGCACTGCGTCCTGACCTACAGGGTCAACCTG
GAGCAACCCCCGCGAGCGCGGGGCCGAG	CTGGTGTCGATCAGGTCGGCAGCCTCGCCGAGG
GAGCAACCCCCGCGAGCGCGGGGCCGAG	TGCTGTGGAACTGCTGCGGCACCCACGGCTGGA
GAGCAACCCCCGCGAGCGCGGGGCCGAG	GGCGTCGGTGGCGAGGAGTTCGGTGGGGGTGAG
GAGCAACCCCCGCGAGCGCGGGGCCGAG	TCGGCGAGGGTGTGCTGGGCGTCGGCGTAGGCG
GAGCAACCCCCGCGAGCGCGGGGCCGAG	ATCACGCCGCGGGTCCGCAGCTCCGCGAGCAGG
GAGCAACCCCCGCGAGCGCGGGGCCGAG	CCCACTAGAGCGAGCACGACTTCGCGGTCCCGG
GAGCAACCCCCGCGAGCGCGGGGCCGAG	ATGACGACCGGGTCGGCCAGCGACCCGGATCCG
GAGCAACCCCCGCGAGCGCGGGGCCGAG

Protein	Signature genes	Signature genes Name	Protein_function
NC_016109.1\|WP_014133707.1\|614122_615157_-\|type-I-E-CRISPR-associated-endonuclease-Cas1	cas1	cd09719_cas1_CAS-I-E	gnl\|CDD\|274693
NC_016109.1\|WP_148283049.1\|611030_611300_+\|hypothetical-protein	unknown	unknown	unknown
NC_016109.1\|WP_014133712.1\|618575_620288_-\|type-I-E-CRISPR-associated-protein-Cse1/CasA	cas8e	pfam09481_cas8e_CAS-I-E	gnl\|CDD\|378189
NC_016109.1\|WP_014133708.1\|615160_615928_-\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	cas6e	pfam08798_cas6e_CAS-I-E:CAS-IV	gnl\|CDD\|378050
NC_016109.1\|WP_014133710.1\|616769_617918_-\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	cas7	pfam09344_cas7_CAS-I-E	gnl\|CDD\|378153
NC_016109.1\|WP_014133715.1\|626393_627044_+\|DUF91-domain-containing-protein	unknown	unknown	gnl\|CDD\|224552
NC_016109.1\|WP_157850088.1\|611837_612137_+\|transposase	unknown	unknown	gnl\|CDD\|225511
NC_016109.1\|WP_014133709.1\|615936_616770_-\|type-I-E-CRISPR-associated-protein-Cas5/CasD	cas5	cd09756_cas5_CAS-I-E	gnl\|CDD\|378243
NC_016109.1\|WP_081539805.1\|629248_629728_+\|HIT-domain-containing-protein	unknown	unknown	gnl\|CDD\|238607
NC_016109.1\|WP_014133696.1\|605018_606293_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340887
NC_016109.1\|WP_014133701.1\|608490_608847_+\|hypothetical-protein	unknown	unknown	unknown
NC_016109.1\|WP_014133705.1\|612133_613006_+\|IS3-family-transposase	unknown	unknown	gnl\|CDD\|222853
NC_016109.1\|WP_193365912.1\|627874_628273_-\|hypothetical-protein	unknown	unknown	unknown
NC_016109.1\|WP_014133700.1\|608016_608487_+\|hypothetical-protein	unknown	unknown	unknown
NC_016109.1\|WP_148283048.1\|603292_603718_+\|hypothetical-protein	unknown	unknown	unknown
NC_016109.1\|WP_014133706.1\|613847_614126_-\|type-I-E-CRISPR-associated-endoribonuclease-Cas2	cas2	pfam09707_cas2_CAS-I-E	gnl\|CDD\|378244
NC_016109.1\|WP_014133711.1\|617983_618586_-\|type-I-E-CRISPR-associated-protein-Cse2/CasB	cse2gr11	cd09670_cse2gr11_CAS-I-E	gnl\|CDD\|378191
NC_016109.1\|WP_014133699.1\|607643_607898_+\|hypothetical-protein	unknown	unknown	unknown
NC_016109.1\|WP_014133695.1\|603828_605022_+\|PLP-dependent-cysteine-synthase-family-protein	unknown	unknown	gnl\|CDD\|223110
NC_016109.1\|WP_014133693.1\|602558_602921_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NC_016109.1\|WP_014133710.1\|616769_617918_-\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	gnl\|CDD\|378153	pfam09344, Cas_CT1975, CT1975-like protein. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family is represented by CT1975 of Chlorobium tepidum.	7.61176e-147
NC_016109.1\|WP_014133712.1\|618575_620288_-\|type-I-E-CRISPR-associated-protein-Cse1/CasA	gnl\|CDD\|378189	pfam09481, CRISPR_Cse1, CRISPR-associated protein Cse1 (CRISPR_cse1). Clusters of short DNA repeats with non-homologous spacers, which are found at regular intervals in the genomes of phylogenetically distinct prokaryotic species, comprise a family with recognisable features. This family is known as CRISPR (short for Clustered, Regularly Interspaced Short Palindromic Repeats). A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This entry, represented by CT1972 from Chlorobaculum tepidum, is found in the CRISPR/Cas subtype Ecoli regions of many bacteria (most of which are mesophiles), and not in Archaea. It is designated Cse1.	1.31959e-96
NC_016109.1\|WP_014133707.1\|614122_615157_-\|type-I-E-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|274693	TIGR03638, cas1_ECOLI, CRISPR-associated endonuclease Cas1, subtype I-E/ECOLI. The CRISPR-associated protein Cas1 is virtually universal to CRISPR systems. CRISPR, an acronym for Clustered Regularly Interspaced Short Palindromic Repeats, is prokaryotic immunity system for foreign DNA, mostly from phage. CRISPR systems belong to different subtypes, distinguished by both nature of the repeats, the makeup of the cohort of associated Cas proteins, and by molecular phylogeny within the more universal Cas proteins such as this one. This model is of type EXCEPTION and provides more specific information than the EQUIVALOG model TIGR00287. It describes the Cas1 protein particular to the ECOLI subtype of CRISPR/Cas system.	5.16162e-127
NC_016109.1\|WP_014133709.1\|615936_616770_-\|type-I-E-CRISPR-associated-protein-Cas5/CasD	gnl\|CDD\|378243	pfam09704, Cas_Cas5d, CRISPR-associated protein (Cas_Cas5). CRISPR is a term for Clustered, Regularly Interspaced Short Palindromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This small Cas family is represented by CT1134 of Chlorobium tepidum.	9.48863e-44
NC_016109.1\|WP_014133696.1\|605018_606293_+\|MFS-transporter	gnl\|CDD\|340887	cd17329, MFS_MdtH_MDR_like, Multidrug resistance protein MdtH and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This family is composed of Escherichia coli MdtH and similar multidrug resistance (MDR) transporters from bacteria and archaea, many of which remain uncharacterized. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. MdtH confers resistance to norfloxacin and enoxacin. MdtH-like MDR transporters belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.66605e-53
NC_016109.1\|WP_014133711.1\|617983_618586_-\|type-I-E-CRISPR-associated-protein-Cse2/CasB	gnl\|CDD\|378191	pfam09485, CRISPR_Cse2, CRISPR-associated protein Cse2 (CRISPR_cse2). Clusters of short DNA repeats with non-homologous spacers, which are found at regular intervals in the genomes of phylogenetically distinct prokaryotic species, comprise a family with recognisable features. This family is known as CRISPR (short for Clustered, Regularly Interspaced Short Palindromic Repeats). A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family of proteins, represented by CT1973 from Chlorobaculum tepidum, is encoded by genes found in the CRISPR/Cas subtype Ecoli regions of many bacteria (most of which are mesophiles), and not in Archaea. It is designated Cse2.	1.12915e-34
NC_016109.1\|WP_014133705.1\|612133_613006_+\|IS3-family-transposase	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	1.08896e-72
NC_016109.1\|WP_081539805.1\|629248_629728_+\|HIT-domain-containing-protein	gnl\|CDD\|238607	cd01276, PKCI_related, Protein Kinase C Interacting protein related (PKCI): PKCI and related proteins belong to the ubiquitous HIT family of hydrolases that act on alpha-phosphates of ribonucleotides. The members of this subgroup have a conserved HxHxHxx motif (x is a hydrophobic residue) that is a signature for this family. No enzymatic activity has been reported however, for PKCI and its related members.	2.66628e-20
NC_016109.1\|WP_014133708.1\|615160_615928_-\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	gnl\|CDD\|378050	pfam08798, CRISPR_assoc, CRISPR associated protein. This domain forms an anti-parallel beta strand structure with flanking alpha helical regions.	1.44837e-72
NC_016109.1\|WP_014133706.1\|613847_614126_-\|type-I-E-CRISPR-associated-endoribonuclease-Cas2	gnl\|CDD\|378244	pfam09707, Cas_Cas2CT1978, CRISPR-associated protein (Cas_Cas2CT1978). This entry represents a minor branch of the Cas2 family of CRISPR-associated protein which are found in IPR003799. Cas proteins are found adjacent to a characteristic short, palindromic repeat cluster termed CRISPR, a probable mobile DNA element.	2.0773e-40
NC_016109.1\|WP_157850088.1\|611837_612137_+\|transposase	gnl\|CDD\|225511	COG2963, COG2963, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	8.32092e-07
NC_016109.1\|WP_014133695.1\|603828_605022_+\|PLP-dependent-cysteine-synthase-family-protein	gnl\|CDD\|223110	COG0031, CysK, Cysteine synthase [Amino acid transport and metabolism].	1.86729e-91
NC_016109.1\|WP_014133715.1\|626393_627044_+\|DUF91-domain-containing-protein	gnl\|CDD\|224552	COG1637, COG1637, Predicted nuclease of the RecB family [DNA replication, recombination, and repair].	5.44298e-08

>NC_016109.1|WP_014133705.1|612133_613006_+|IS3-family-transposase
MTLHPFIEAEKRGGHNVKRACELLKVSRAAFYARRTADPGPRAVRDAELAEKITEVHSASRDSCGAPRIHAALRRDGDRCGRRRIARLMRQAGLEGRHRKRRHRTTIPDLQAAGRPDLVLRDFTPDRAGLDARWCGDITYIPTGEGRLYLATVIDIASRRVVGWAAADHLRAELVADALRTACQTRRPSGTALFHSDRGCQYTSREFAIMASEFGIRLSVGRTGQCWDNALAESFLATLKRELPGDRPWPSRAAARTAIFEWIEGWYNIRRLHSSLGYRSPAEYEAALAA
>NC_016109.1|WP_157850088.1|611837_612137_+|transposase
MGKKKPRPRRAFAPEFKAEIVELCRRGDRSVGQVAKDFDLTETAVRDWIRQGEVDAGERDGLTSDEREELARLRRENRRLREDVDILRRATAFFAKETR
>NC_016109.1|WP_148283049.1|611030_611300_+|hypothetical-protein
MRLPIRDARTHGSILRIVARQLRQNKNLVALATTSATCALKGQPATITPEQITGLVIVIIILIALSTITYKPNGWLRPNPTGTRSTRRR
>NC_016109.1|WP_014133701.1|608490_608847_+|hypothetical-protein
MSEHESTAPPLNLGEQLLEQFLTAGRTLDPRDAPRFAEQYARALGLGSAAVYLAVLRRPIRYREHSDSEQGSRSDSEDHQDRADGPPIMPSTCANGLLNGCCRRNGPLARHHADGFAA
>NC_016109.1|WP_014133700.1|608016_608487_+|hypothetical-protein
MLVLCLGVMAGYLLGGLVTARAVFRQERERFLRAGGARTATDAADGGLVRRFERQERQQTEAFALCAGALWPVALPLLALHGLFGAVALDRGRTGVAARPDPAAVAARIDELERELRLDAPAFPLPSPAPPSGGFRRTERTEQPAGAARARPRGSD
>NC_016109.1|WP_014133699.1|607643_607898_+|hypothetical-protein
MTVDAVVLAAESSGPPLLVVIVPALIVAVLLIGAFVWGSRRWNRRRPPAGPGPAAGRADSWRTPDDREPERGTRPHGADDPSER
>NC_016109.1|WP_014133696.1|605018_606293_+|MFS-transporter
MRALWRQTRSFGPTARLLMANQFAINLAFYMLMPYLAAHLAGDLGLAAWTVGLVLGVRNLSQQGMFLVGGTLADRFGYRAPIIAGCLLRTAGFALLGWVDSLPALLAASAATGFAGALFNPAVRAYLAAEAGERRVDAFAAFHVYYQAGMLLGPLVGLALLAADFTAVCTAAAAVFAALTALQWRALPPRRERPEPARAGVLGQWRTVVANRPFLLFSGAMIGSYVLTFQVYLALPLAAGLALDRNGGNGGAGAAATSGLFTVSAAVAVTGQLRLTAWAKRVWTPSGALVRGLAAMGAAFLPLLAFPWAGTAARLAALGLAVAVLAAAGAVVYPFEMDTVVALSGGRLVATHYGLYNTVSGLGITAGNLAVGALWDYGARHDALLLPWLALGATGLAGAAAVHRLSRAGLLRPSPAPEPALTGA
>NC_016109.1|WP_014133695.1|603828_605022_+|PLP-dependent-cysteine-synthase-family-protein
MPQHTLPGPHPADPPAPSAAPDARYARSARTPAGLVGDTPVLWVGEPFTAPGRGFWAKLEGRNPGGIKDRPALHMVRAARERGELRAGARIVESTSGTLGLGLALAGVVYGHPVTVVTDPGIEPLVTGLLAAHGAETVVVDAPHPVGGWQQARRAKVRELLAAHPGAWCPDQYNNPDNVAAYRPLALELVAQLGRIDTLVVSVGTGGHSAGIAGVLRGRFPELRVVGVDTTGSTIFGQPALPRLMRGLGSSIHPRNVAYGLFDEVHWVAAPEAVWAARALAVSRYASGGWSVGAVALVARWLAATGSPEDRIAAVFPDGPQRYVGTVFDDPWCQAHGLLGHRPPERPDEIAHPGERVVTRWTRCRTVLDPLARRPLTETETEAGSGAGAGAETEAAR
>NC_016109.1|WP_148283048.1|603292_603718_+|hypothetical-protein
MTGRCGARSERRLGYVLAVLLAALLHALVCAHGPLTGGATAADTLPAAAAHCAPTAVEDGTGRHTGHRAACADTDQPVTDRWQASPLTAPAELDGAAALPASAARPPSGAPRRSPAAGADSGAGAGAGGGRGRAALGTWRT
>NC_016109.1|WP_014133693.1|602558_602921_-|hypothetical-protein
MTGRGAAWGGRFAVLLAVALAAVLAVLTAGPPAQARMPRPPAASVAEEHVECGHQHEAQVPTGRAAGRHRANGGPPARTGARPDEDAATGVPRAPLPAGPVPAAGGSRPAALARIQVFRC
>NC_016109.1|WP_014133706.1|613847_614126_-|type-I-E-CRISPR-associated-endoribonuclease-Cas2
MTVIVLIAAPEGLRGHLTRWMVEVHAGVFVGNPSRRIRDRLWDLLATRIGTGQAILVEPATNEQGWTVRTAGTDRWKPVDFDGLILSARPTR
>NC_016109.1|WP_014133707.1|614122_615157_-|type-I-E-CRISPR-associated-endonuclease-Cas1
MADIWWKAHPHDLHRLSDRVSSVYVERSHIDRDENAVVVINKRETVRIPAAMVAVVLLGPGTRITHGAVNLLADSGTTVCWVGEQGVRMYAAGLGPSRGAGLLNRQAWLVSRTKERLAVARAMYRMRFPGEDVDTATMQQLRGREGARIRKLYQAHARRTGVPWNGRVYQPGDAHAAGDDLNRLLSAANAALYGICHAVITGLGASPGLGFVHTGLATSFVLDIADLYKADYTIPLAFDLTARGHTEERDARLGLRDRIAEDRLLGRIVRDVKALLTPDGIDLDDQDVNQLWDEKVGTVQGGVNWSAESAGSVLRAIDPGMGDENEHLAIIGPEFDNDPKQPPR
>NC_016109.1|WP_014133708.1|615160_615928_-|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE
MTYLSRVRINPLRAASRTLLANPRALHGAVQAGVPDQAPGDRILWRLDTDQPRRPQLLVLTPGKPDWTHLVEQAGWPDAEGEHYAVRDYSPLLAQLALGREYAFRLTASPVQNTSKPTGGSTHRTRTAEELQHRSYRLPHRTAAHQLAWFLDRTTRWGFTVPEARTDTPAPGLGTPDGDGEAAREVRITDRDRRTFTKPGTRTPVTLTTATFEGHLRISDPDLLKTALLEGIGPSKAYGCGLLTLAPLPGTGTAR
>NC_016109.1|WP_014133709.1|615936_616770_-|type-I-E-CRISPR-associated-protein-Cas5/CasD
MPADTTPQGDRAVLLLRLAGPLQSWGDRSAFNRRDTTPQPTKSGVVGLLAAAAGRPREADLTDLVGLRLGVRVDQPGTLLRDYHTVSDYRGLPLPQAGVNAKGVQKPTSPSKHTHVTHRYYLQDAVFLVAVEGPAELVTALGEAVTRPAFPLALGRRSCTPTQPLSLGVRRGTPLETALAEEPWQANEPTRKAHERQAKRGQAPRRTDRVDLAASFDDPHGDDTCRDVPLSFDPRRRGFGTRKVRHAWLSVPTGLRAALPTEPPADGGHDPFALLGW
>NC_016109.1|WP_014133710.1|616769_617918_-|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC
MPSRPRLYIDVHILQTVPPANLNRDDNGSPKEAYFGGKRRSRVSSQAWKRATRLHFAERYEPQDLGTRTKRIAGKLAERLAARAGAALSAEDAQRVAGALLKPMGIAAGKKAGDTAYLLFYGRRQLEGIVDLVAADAAELAALDDQQLEERVKNLPVREQLQQGHPVDVALFGRMVADIPGLNVDAATQVAHALSTHATELEFDYYTAVDDETGDEETGAGMIGTIGFNSATLYRYATVGLHQLTDNLGEEKTAVEAVDLFVDSFARSMPTGYGNSFAHRTRPSLVAVVVRTDQPVNLVSAYENAVPAGDGILAESARRLAAEYRTATSQWGDEPLHTAICHTLDAASPETAALAEAFGANRTFAELREGLRTALTERTATR
>NC_016109.1|WP_014133711.1|617983_618586_-|type-I-E-CRISPR-associated-protein-Cse2/CasB
MTTDQPTARRRYWDEYTAPDHGWRIDGPSKQPRRPPGEELAALRSGLGRPVMDSPKMWPYYSTEVGDVLALRDRVSDEQQAEHAALALYGLHQQGQSRPMHRSGVKLGRALRELRRDGKYSENALDARVAQLAAATSVPALLVHLRGLVTQLRTVGQPLDYDHLMADIRAWHQSERRPQVRLKWALGYRAWQSKTPDDDE
>NC_016109.1|WP_014133712.1|618575_620288_-|type-I-E-CRISPR-associated-protein-Cse1/CasA
MPKYNLVDEPWLAPRPLDGGPPVHLGIAEALTRADEFDGLSVDFATQLPAVLRQVLLPVLVAALGAPATAAAQGERLARGEFSAQEKERLLAYLAAHRARFELFDESAPFAQVAGLRTAKDETKGTAALVATAASGNNVPLFASRSDADPLDLTPAQAAHWLLHTHCWDTAAIKTGVVGDDQAKAGKTTGNPTGPLGQLGVIVPMGRTLYETLQLNIPVTAAANLGKPQWERPPATPAWEQRPADGLLDLWTWQARRVRLIPEQDEAGGTKVTRVVISAGDRLPATPEWEPHTAWTFTPPAKKASSRAPERRPRRHAQGKAAWRGLEALLAPVRQNDGGVFETSVLLDQIGALQEDGRLAADYPLRVETFGMVYGTQSAVVEDVVHDAIPLPLLALHQDGETRLFLLDVAEQAEQLARALNNLSADLRRAVGTDPIPWDKGQRPGELLLHVLDGLVRRVLAGAREAGGDEDRLERGRFAWEEAAAWRTWEHADALLAVAPASAFAGRTVSQTGKPGKTHTFSLGTAADSFSREAARILPRHAHTARTAVRDRAGAPEDTVKTPSGARVDH
>NC_016109.1|WP_014133715.1|626393_627044_+|DUF91-domain-containing-protein
MTGLRLFRVDGGSAEEVAGSEVELERHLQTLIEQNMGTMLGVRFLASEYSTGPVHGGRIDSLGLDEDGSPVVIEYKRSRSENVINQALFYSAWLRDHKAEFEALVARQLGTEAADGVDWSGLRIICVASGYSRYDVHAIGEMNRRIDLVRYQQFEGDILALELHASVSSGPSALTRSQVDGNSRATGGPGRKTVREAIERASLGSVVKVILGNGSW
>NC_016109.1|WP_193365912.1|627874_628273_-|hypothetical-protein
MNVTELLRPPQAEHDETAARADCPREQIDQLTTALAETEARLAEIVTTGKVIDDLALPGHEPAPAETATVYQRIVTASNEHPRQVFRVREPHELLGLPTDEPSINVTRSRLGRLVRQGILDQPGRGRYQKRT
>NC_016109.1|WP_081539805.1|629248_629728_+|HIT-domain-containing-protein
MSQQSQLRWFANWLTSTSAASPAPPAWAGRSAKDRCIVTTSAPQAPKVSDFYCDEALNGRTPVKVVEETDSVLAFEHTRPSYPVHIVVVPKKHIPSLVNLGDGTEEDLVDVFRVVRAVAARVREEYGAACVVTNEGVYQESKHLHVHVLFRGDLPEGLA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_016109_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_016109_3

623530-625875

TypeI-E

Consensus_repeat	Method
GAGCAACCCCCGCGAGCGCGGGGCCGAG	PILER-CR
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	CRISPRCasFinder
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	CRT

38 spacers

cas8e,cse2gr11,cas7,cas5,cas6e,cas1,cas2

The CRISPR arrays of NC_016109_3

>merge|NC_016109|3|623530-625875|PILER-CR,CRISPRCasFinder,CRT
CTCGGCCCCGCGCTCGCGGGGGTTGCTCTTGACGTGGATTCCATCAGACGTGTGTCGACGTCTCGGCCCCGCGCTCGCGGGGGTTGCTCCGGGACGGCCGAGGGGAGGACGTCGTGTCCCTCCTCGGCCCCGCGCTCGCGGGGGTTGCTCCGGTCGTGGTGCCGGAGACGGTGATGCTGGGGGCTCGGCCCCGCGCTCGCGGGGGTTGCTCCCAGCAGGCGGCCGGAGCCGAGCGCGACGCCTACTCGGCCCCGCGCTCGCGGGGGTTGCTCACGTGTCCAGCGTAGGCCCAACTGGGTTGTGATCTCGGCCCCGCGCTCGCGGGGGTTGCTCCTGCCGTTGCAGGCGTAGCACGGGGGTTCGTCGCTCGGCCCCGCGCTCGCGGGGGTTGCTCCCGGCTGCCGCCGCTGGTGAAGGTGAAGCCGATCTCGGCCCCGCGCTCGCGGGGGTTGCTCGACCGACATGGCCCGTGAGTTCGCAGTCCGGCACTCGGCCCCGCGCTCGCGGGGGTTGCTCGCAACCGGGGCGGTTGTCGTGACGGAGAAACGTCTCGGCCCCGCGCTCGCGGGGGTTGCTCCCGGCCCGGGATCCACGTCGAGGACATCGTGAACTCGGCCCCGCGCTCGCGGGGGTTGCTCCCGGGACAGCGGCGGCCGGGGCTGCGGGCTGCTCTCGGCCCCGCGCTCGCGGGGGTTGCTCGTCGGCCGAACACCGCGCGGCCACCGGCAAGGACTCGGCCCCGCGCTCGCGGGGGTTGCTCGTTCGACCACCACCCTCAGGTAGCGGCTGCCGGCTCGGCCCCGCGCTCGCGGGGGTTGCTCGCCGAAGCCGCGCTCATCGCCGCCCACCGCCTCCTCGGCCCCGCGCTCGCGGGGGTTGCTCGGGCGTGTACCCGGAGGCCGGGCTGCAGATGTCCTCGGCCCCGCGCTCGCGGGGGTTGCTCCCGGGAGCCGCGGCAGGAGATGGTCAGCCGGGCCTCGGCCCCGCGCTCGCGGGGGTTGCTCTCGCTGCTGGCGGCGCGGCGATTCAACCCACCGCTCGGCCCCGCGCTCGCGGGGGTTGCTCGGGCGTGTACCCGGAGGCCGGGCTGCAGATGTCCTCGGCCCCGCGCTCGCGGGGGTTGCTCCCGGGAGCCGCGGCAGGAGATGGTCAGCCGGGCCTCGGCCCCGCGCTCGCGGGGGTTGCTCGGGTCTCGCGATCCTGGCCAGGATCGGACTCGTCTCGGCCCCGCGCTCGCGGGGGTTGCTCCCGGCCCGGGGCGCCCGCCGCCGGGGCGGAGAGCTCGGCCCCGCGCTCGCGGGGGTTGCTCTTCTGTCACACAGATGGCATATTCGCGGGGCATCTCGGCCCCGCGCTCACGGGGGTTGCTCCTCGGCGAGGCGGGCGGACGTCATGCGGACGAGCTCGGCCCCGCGCTCGCGGGGGTTGCTCCGCGGTGGACAGGCTGACCACGCTGGTGGGTGACTCGGCCCCGCGCTCGCGGGGGTTGCTCGCGGGGCACGACCCCGGCCGAGGACAAGGCGTACTCGGCCCCGCGCTCGCGGGGGTTGCTCTCGCCCGGCGCCACGCTCAAGGACCTGCTGCTGCTCGGCCCCGCGCTCGCGGGGGTTGCTCCCGCTGGACCGGGCTCACCGGCGCGCGCCCCGGCTCGGCCCCGCGCTCGCGGGGGTTGCTCTTCTGGGCGTGCCGGTCTGCCCGACCCATTCCGCTCGGCCCCGCGCTCGCGGGGGTTGCTCTCGGGAGAGTTGGGGCCGGGCGACCGGCTCCCGCTCGGCCCCGCGCTCGCGGGGGTTGCTCCCCATCCCCGACGGCCGCGCGCTGTTCCTGGCCCTCGGCCCCGCGCTCGCGAGGGTTGCTCGATCGGCCTCGGCGGGATCGGCGACACCCTGAACTCGGCCCCGCGCTCGCGGGGGTTGCTCAGCGGGCCCGCCCCATCCATCCGGTGGACCGCACTCGGCCCCGCGCTCGCGGGGGTTGCTCCGATGAGGGCCTGGCGCTCAGCCGGGCTACGGGCTCGGCCCCGCGCTCGCGGGGGTTGCTCCGGACGAGGGCCCGTGCGGCAACGCCACCCACCCTCGGCCCCGCGCTCGCGGGGGTTGCTCTACGAACCGAGTAGCGTGACCGGGATGCACCAGCTCGGCCCCGCGCTCGCGGGGGTTGCTCCACCGACTTGACGAGGTCGGTCTCGTTGACGTCCTCGGCCCCGCGCTCGCGGGGGTTGCTCCCGTGGCCGGCTCTTGTCCGGCATCACCCAGGCCTCGGCCCTGCGCTCGCGGGGGTTGCTCCATCTCCTCTTGCTCGTGACGAGTGGTCAGGCCCTCGGCCCCGCGCTCGCGGGGGTTGGTC

>NC_016109|3|2|623530-625814|PILER-CR
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	TTGACGTGGATTCCATCAGACGTGTGTCGACGT
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	CGGGACGGCCGAGGGGAGGACGTCGTGTCCCTC
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	CGGTCGTGGTGCCGGAGACGGTGATGCTGGGGG
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	CCAGCAGGCGGCCGGAGCCGAGCGCGACGCCTA
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	ACGTGTCCAGCGTAGGCCCAACTGGGTTGTGAT
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	CTGCCGTTGCAGGCGTAGCACGGGGGTTCGTCG
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	CCGGCTGCCGCCGCTGGTGAAGGTGAAGCCGAT
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	GACCGACATGGCCCGTGAGTTCGCAGTCCGGCA
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	GCAACCGGGGCGGTTGTCGTGACGGAGAAACGT
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	CCGGCCCGGGATCCACGTCGAGGACATCGTGAA
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	CCGGGACAGCGGCGGCCGGGGCTGCGGGCTGCT
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	GTCGGCCGAACACCGCGCGGCCACCGGCAAGGA
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	GTTCGACCACCACCCTCAGGTAGCGGCTGCCGG
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	GCCGAAGCCGCGCTCATCGCCGCCCACCGCCTC
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	GGGCGTGTACCCGGAGGCCGGGCTGCAGATGTC
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	CCGGGAGCCGCGGCAGGAGATGGTCAGCCGGGC
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	TCGCTGCTGGCGGCGCGGCGATTCAACCCACCG
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	GGGCGTGTACCCGGAGGCCGGGCTGCAGATGTC
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	CCGGGAGCCGCGGCAGGAGATGGTCAGCCGGGC
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	GGGTCTCGCGATCCTGGCCAGGATCGGACTCGT
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	CCGGCCCGGGGCGCCCGCCGCCGGGGCGGAGAG
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	TTCTGTCACACAGATGGCATATTCGCGGGGCAT
CTCGGCCCCGCGCTCACGGGGGTTGCTC	CTCGGCGAGGCGGGCGGACGTCATGCGGACGAG
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	CGCGGTGGACAGGCTGACCACGCTGGTGGGTGA
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	GCGGGGCACGACCCCGGCCGAGGACAAGGCGTA
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	TCGCCCGGCGCCACGCTCAAGGACCTGCTGCTG
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	CCGCTGGACCGGGCTCACCGGCGCGCGCCCCGG
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	TTCTGGGCGTGCCGGTCTGCCCGACCCATTCCG
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	TCGGGAGAGTTGGGGCCGGGCGACCGGCTCCCG
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	CCCATCCCCGACGGCCGCGCGCTGTTCCTGGCC
CTCGGCCCCGCGCTCGCGAGGGTTGCTC	GATCGGCCTCGGCGGGATCGGCGACACCCTGAA
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	AGCGGGCCCGCCCCATCCATCCGGTGGACCGCA
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	CGATGAGGGCCTGGCGCTCAGCCGGGCTACGGG
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	CGGACGAGGGCCCGTGCGGCAACGCCACCCACC
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	TACGAACCGAGTAGCGTGACCGGGATGCACCAG
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	CACCGACTTGACGAGGTCGGTCTCGTTGACGTC
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	CCGTGGCCGGCTCTTGTCCGGCATCACCCAGGC
CTCGGCCCTGCGCTCGCGGGGGTTGCTC

>NC_016109|3|3|623530-625875|CRISPRCasFinder
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	TTGACGTGGATTCCATCAGACGTGTGTCGACGT
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	CGGGACGGCCGAGGGGAGGACGTCGTGTCCCTC
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	CGGTCGTGGTGCCGGAGACGGTGATGCTGGGGG
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	CCAGCAGGCGGCCGGAGCCGAGCGCGACGCCTA
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	ACGTGTCCAGCGTAGGCCCAACTGGGTTGTGAT
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	CTGCCGTTGCAGGCGTAGCACGGGGGTTCGTCG
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	CCGGCTGCCGCCGCTGGTGAAGGTGAAGCCGAT
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	GACCGACATGGCCCGTGAGTTCGCAGTCCGGCA
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	GCAACCGGGGCGGTTGTCGTGACGGAGAAACGT
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	CCGGCCCGGGATCCACGTCGAGGACATCGTGAA
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	CCGGGACAGCGGCGGCCGGGGCTGCGGGCTGCT
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	GTCGGCCGAACACCGCGCGGCCACCGGCAAGGA
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	GTTCGACCACCACCCTCAGGTAGCGGCTGCCGG
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	GCCGAAGCCGCGCTCATCGCCGCCCACCGCCTC
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	GGGCGTGTACCCGGAGGCCGGGCTGCAGATGTC
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	CCGGGAGCCGCGGCAGGAGATGGTCAGCCGGGC
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	TCGCTGCTGGCGGCGCGGCGATTCAACCCACCG
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	GGGCGTGTACCCGGAGGCCGGGCTGCAGATGTC
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	CCGGGAGCCGCGGCAGGAGATGGTCAGCCGGGC
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	GGGTCTCGCGATCCTGGCCAGGATCGGACTCGT
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	CCGGCCCGGGGCGCCCGCCGCCGGGGCGGAGAG
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	TTCTGTCACACAGATGGCATATTCGCGGGGCAT
CTCGGCCCCGCGCTCACGGGGGTTGCTC	CTCGGCGAGGCGGGCGGACGTCATGCGGACGAG
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	CGCGGTGGACAGGCTGACCACGCTGGTGGGTGA
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	GCGGGGCACGACCCCGGCCGAGGACAAGGCGTA
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	TCGCCCGGCGCCACGCTCAAGGACCTGCTGCTG
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	CCGCTGGACCGGGCTCACCGGCGCGCGCCCCGG
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	TTCTGGGCGTGCCGGTCTGCCCGACCCATTCCG
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	TCGGGAGAGTTGGGGCCGGGCGACCGGCTCCCG
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	CCCATCCCCGACGGCCGCGCGCTGTTCCTGGCC
CTCGGCCCCGCGCTCGCGAGGGTTGCTC	GATCGGCCTCGGCGGGATCGGCGACACCCTGAA
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	AGCGGGCCCGCCCCATCCATCCGGTGGACCGCA
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	CGATGAGGGCCTGGCGCTCAGCCGGGCTACGGG
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	CGGACGAGGGCCCGTGCGGCAACGCCACCCACC
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	TACGAACCGAGTAGCGTGACCGGGATGCACCAG
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	CACCGACTTGACGAGGTCGGTCTCGTTGACGTC
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	CCGTGGCCGGCTCTTGTCCGGCATCACCCAGGC
CTCGGCCCTGCGCTCGCGGGGGTTGCTC	CATCTCCTCTTGCTCGTGACGAGTGGTCAGGCC
CTCGGCCCCGCGCTCGCGGGGGTTGGTC

>NC_016109|3|2|623530-625875|CRT
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	TTGACGTGGATTCCATCAGACGTGTGTCGACGT
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	CGGGACGGCCGAGGGGAGGACGTCGTGTCCCTC
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	CGGTCGTGGTGCCGGAGACGGTGATGCTGGGGG
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	CCAGCAGGCGGCCGGAGCCGAGCGCGACGCCTA
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	ACGTGTCCAGCGTAGGCCCAACTGGGTTGTGAT
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	CTGCCGTTGCAGGCGTAGCACGGGGGTTCGTCG
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	CCGGCTGCCGCCGCTGGTGAAGGTGAAGCCGAT
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	GACCGACATGGCCCGTGAGTTCGCAGTCCGGCA
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	GCAACCGGGGCGGTTGTCGTGACGGAGAAACGT
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	CCGGCCCGGGATCCACGTCGAGGACATCGTGAA
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	CCGGGACAGCGGCGGCCGGGGCTGCGGGCTGCT
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	GTCGGCCGAACACCGCGCGGCCACCGGCAAGGA
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	GTTCGACCACCACCCTCAGGTAGCGGCTGCCGG
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	GCCGAAGCCGCGCTCATCGCCGCCCACCGCCTC
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	GGGCGTGTACCCGGAGGCCGGGCTGCAGATGTC
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	CCGGGAGCCGCGGCAGGAGATGGTCAGCCGGGC
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	TCGCTGCTGGCGGCGCGGCGATTCAACCCACCG
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	GGGCGTGTACCCGGAGGCCGGGCTGCAGATGTC
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	CCGGGAGCCGCGGCAGGAGATGGTCAGCCGGGC
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	GGGTCTCGCGATCCTGGCCAGGATCGGACTCGT
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	CCGGCCCGGGGCGCCCGCCGCCGGGGCGGAGAG
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	TTCTGTCACACAGATGGCATATTCGCGGGGCAT
CTCGGCCCCGCGCTCACGGGGGTTGCTC	CTCGGCGAGGCGGGCGGACGTCATGCGGACGAG
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	CGCGGTGGACAGGCTGACCACGCTGGTGGGTGA
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	GCGGGGCACGACCCCGGCCGAGGACAAGGCGTA
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	TCGCCCGGCGCCACGCTCAAGGACCTGCTGCTG
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	CCGCTGGACCGGGCTCACCGGCGCGCGCCCCGG
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	TTCTGGGCGTGCCGGTCTGCCCGACCCATTCCG
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	TCGGGAGAGTTGGGGCCGGGCGACCGGCTCCCG
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	CCCATCCCCGACGGCCGCGCGCTGTTCCTGGCC
CTCGGCCCCGCGCTCGCGAGGGTTGCTC	GATCGGCCTCGGCGGGATCGGCGACACCCTGAA
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	AGCGGGCCCGCCCCATCCATCCGGTGGACCGCA
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	CGATGAGGGCCTGGCGCTCAGCCGGGCTACGGG
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	CGGACGAGGGCCCGTGCGGCAACGCCACCCACC
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	TACGAACCGAGTAGCGTGACCGGGATGCACCAG
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	CACCGACTTGACGAGGTCGGTCTCGTTGACGTC
CTCGGCCCCGCGCTCGCGGGGGTTGCTC	CCGTGGCCGGCTCTTGTCCGGCATCACCCAGGC
CTCGGCCCTGCGCTCGCGGGGGTTGCTC	CATCTCCTCTTGCTCGTGACGAGTGGTCAGGCC
CTCGGCCCCGCGCTCGCGGGGGTTGGTC

Protein	Signature genes	Signature genes Name	Protein_function
NC_016109.1\|WP_014133710.1\|616769_617918_-\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	cas7	pfam09344_cas7_CAS-I-E	gnl\|CDD\|378153
NC_016109.1\|WP_148283049.1\|611030_611300_+\|hypothetical-protein	unknown	unknown	unknown
NC_016109.1\|WP_014133721.1\|629740_630835_-\|UDP-N-acetylglucosamine--N-acetylmuramyl--(pentapeptide)-pyrophosphoryl-undecaprenol-N-acetylglucosamine-transferase	unknown	unknown	gnl\|CDD\|234825
NC_016109.1\|WP_014133712.1\|618575_620288_-\|type-I-E-CRISPR-associated-protein-Cse1/CasA	cas8e	pfam09481_cas8e_CAS-I-E	gnl\|CDD\|378189
NC_016109.1\|WP_014133707.1\|614122_615157_-\|type-I-E-CRISPR-associated-endonuclease-Cas1	cas1	cd09719_cas1_CAS-I-E	gnl\|CDD\|274693
NC_016109.1\|WP_106437840.1\|634772_635411_-\|PIG-L-family-deacetylase	unknown	unknown	gnl\|CDD\|225031
NC_016109.1\|WP_014133724.1\|634029_634776_-\|WbqC-family-protein	unknown	unknown	gnl\|CDD\|378083
NC_016109.1\|WP_014133709.1\|615936_616770_-\|type-I-E-CRISPR-associated-protein-Cas5/CasD	cas5	cd09756_cas5_CAS-I-E	gnl\|CDD\|378243
NC_016109.1\|WP_014133723.1\|632905_634033_-\|glycosyltransferase-family-4-protein	unknown	unknown	gnl\|CDD\|340831
NC_016109.1\|WP_081539805.1\|629248_629728_+\|HIT-domain-containing-protein	unknown	unknown	gnl\|CDD\|238607
NC_016109.1\|WP_014133711.1\|617983_618586_-\|type-I-E-CRISPR-associated-protein-Cse2/CasB	cse2gr11	cd09670_cse2gr11_CAS-I-E	gnl\|CDD\|378191
NC_016109.1\|WP_014133727.1\|636011_636566_-\|hydrolase	unknown	unknown	gnl\|CDD\|234753
NC_016109.1\|WP_014133706.1\|613847_614126_-\|type-I-E-CRISPR-associated-endoribonuclease-Cas2	cas2	pfam09707_cas2_CAS-I-E	gnl\|CDD\|378244
NC_016109.1\|WP_193365912.1\|627874_628273_-\|hypothetical-protein	unknown	unknown	unknown
NC_016109.1\|WP_014133708.1\|615160_615928_-\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	cas6e	pfam08798_cas6e_CAS-I-E:CAS-IV	gnl\|CDD\|378050
NC_016109.1\|WP_106437839.1\|631238_632888_-\|proline--tRNA-ligase	unknown	unknown	gnl\|CDD\|236405
NC_016109.1\|WP_014133705.1\|612133_613006_+\|IS3-family-transposase	unknown	unknown	gnl\|CDD\|222853
NC_016109.1\|WP_014133726.1\|635454_636015_-\|deoxycytidine-triphosphate-deaminase	unknown	unknown	gnl\|CDD\|234753
NC_016109.1\|WP_157850088.1\|611837_612137_+\|transposase	unknown	unknown	gnl\|CDD\|225511
NC_016109.1\|WP_014133715.1\|626393_627044_+\|DUF91-domain-containing-protein	unknown	unknown	gnl\|CDD\|224552

Protein	Function_ID	Function_description	E-value
NC_016109.1\|WP_014133710.1\|616769_617918_-\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	gnl\|CDD\|378153	pfam09344, Cas_CT1975, CT1975-like protein. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family is represented by CT1975 of Chlorobium tepidum.	7.61176e-147
NC_016109.1\|WP_014133721.1\|629740_630835_-\|UDP-N-acetylglucosamine--N-acetylmuramyl--(pentapeptide)-pyrophosphoryl-undecaprenol-N-acetylglucosamine-transferase	gnl\|CDD\|234825	PRK00726, murG, undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional.	6.3618e-101
NC_016109.1\|WP_014133712.1\|618575_620288_-\|type-I-E-CRISPR-associated-protein-Cse1/CasA	gnl\|CDD\|378189	pfam09481, CRISPR_Cse1, CRISPR-associated protein Cse1 (CRISPR_cse1). Clusters of short DNA repeats with non-homologous spacers, which are found at regular intervals in the genomes of phylogenetically distinct prokaryotic species, comprise a family with recognisable features. This family is known as CRISPR (short for Clustered, Regularly Interspaced Short Palindromic Repeats). A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This entry, represented by CT1972 from Chlorobaculum tepidum, is found in the CRISPR/Cas subtype Ecoli regions of many bacteria (most of which are mesophiles), and not in Archaea. It is designated Cse1.	1.31959e-96
NC_016109.1\|WP_014133707.1\|614122_615157_-\|type-I-E-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|274693	TIGR03638, cas1_ECOLI, CRISPR-associated endonuclease Cas1, subtype I-E/ECOLI. The CRISPR-associated protein Cas1 is virtually universal to CRISPR systems. CRISPR, an acronym for Clustered Regularly Interspaced Short Palindromic Repeats, is prokaryotic immunity system for foreign DNA, mostly from phage. CRISPR systems belong to different subtypes, distinguished by both nature of the repeats, the makeup of the cohort of associated Cas proteins, and by molecular phylogeny within the more universal Cas proteins such as this one. This model is of type EXCEPTION and provides more specific information than the EQUIVALOG model TIGR00287. It describes the Cas1 protein particular to the ECOLI subtype of CRISPR/Cas system.	5.16162e-127
NC_016109.1\|WP_106437840.1\|634772_635411_-\|PIG-L-family-deacetylase	gnl\|CDD\|225031	COG2120, COG2120, Uncharacterized proteins, LmbE homologs [Function unknown].	2.4659e-20
NC_016109.1\|WP_014133724.1\|634029_634776_-\|WbqC-family-protein	gnl\|CDD\|378083	pfam08889, WbqC, WbqC-like protein family. This family of proteins are functionally uncharacterized. However it is found in an O-antigen gene cluster in E. coli and other bacteria suggesting a role in O-antigen production. Feng et al. suggest that wbnG may code for a glycine transferase.	1.51668e-72
NC_016109.1\|WP_014133709.1\|615936_616770_-\|type-I-E-CRISPR-associated-protein-Cas5/CasD	gnl\|CDD\|378243	pfam09704, Cas_Cas5d, CRISPR-associated protein (Cas_Cas5). CRISPR is a term for Clustered, Regularly Interspaced Short Palindromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This small Cas family is represented by CT1134 of Chlorobium tepidum.	9.48863e-44
NC_016109.1\|WP_014133723.1\|632905_634033_-\|glycosyltransferase-family-4-protein	gnl\|CDD\|340831	cd03801, GT4_PimA-like, phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.	3.28316e-35
NC_016109.1\|WP_014133711.1\|617983_618586_-\|type-I-E-CRISPR-associated-protein-Cse2/CasB	gnl\|CDD\|378191	pfam09485, CRISPR_Cse2, CRISPR-associated protein Cse2 (CRISPR_cse2). Clusters of short DNA repeats with non-homologous spacers, which are found at regular intervals in the genomes of phylogenetically distinct prokaryotic species, comprise a family with recognisable features. This family is known as CRISPR (short for Clustered, Regularly Interspaced Short Palindromic Repeats). A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family of proteins, represented by CT1973 from Chlorobaculum tepidum, is encoded by genes found in the CRISPR/Cas subtype Ecoli regions of many bacteria (most of which are mesophiles), and not in Archaea. It is designated Cse2.	1.12915e-34
NC_016109.1\|WP_014133727.1\|636011_636566_-\|hydrolase	gnl\|CDD\|234753	PRK00416, dcd, deoxycytidine triphosphate deaminase; Reviewed.	6.44964e-32
NC_016109.1\|WP_014133706.1\|613847_614126_-\|type-I-E-CRISPR-associated-endoribonuclease-Cas2	gnl\|CDD\|378244	pfam09707, Cas_Cas2CT1978, CRISPR-associated protein (Cas_Cas2CT1978). This entry represents a minor branch of the Cas2 family of CRISPR-associated protein which are found in IPR003799. Cas proteins are found adjacent to a characteristic short, palindromic repeat cluster termed CRISPR, a probable mobile DNA element.	2.0773e-40
NC_016109.1\|WP_081539805.1\|629248_629728_+\|HIT-domain-containing-protein	gnl\|CDD\|238607	cd01276, PKCI_related, Protein Kinase C Interacting protein related (PKCI): PKCI and related proteins belong to the ubiquitous HIT family of hydrolases that act on alpha-phosphates of ribonucleotides. The members of this subgroup have a conserved HxHxHxx motif (x is a hydrophobic residue) that is a signature for this family. No enzymatic activity has been reported however, for PKCI and its related members.	2.66628e-20
NC_016109.1\|WP_014133708.1\|615160_615928_-\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	gnl\|CDD\|378050	pfam08798, CRISPR_assoc, CRISPR associated protein. This domain forms an anti-parallel beta strand structure with flanking alpha helical regions.	1.44837e-72
NC_016109.1\|WP_106437839.1\|631238_632888_-\|proline--tRNA-ligase	gnl\|CDD\|236405	PRK09194, PRK09194, prolyl-tRNA synthetase; Provisional.	2.3641e-101
NC_016109.1\|WP_014133705.1\|612133_613006_+\|IS3-family-transposase	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	1.08896e-72
NC_016109.1\|WP_014133726.1\|635454_636015_-\|deoxycytidine-triphosphate-deaminase	gnl\|CDD\|234753	PRK00416, dcd, deoxycytidine triphosphate deaminase; Reviewed.	2.31661e-36
NC_016109.1\|WP_157850088.1\|611837_612137_+\|transposase	gnl\|CDD\|225511	COG2963, COG2963, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	8.32092e-07
NC_016109.1\|WP_014133715.1\|626393_627044_+\|DUF91-domain-containing-protein	gnl\|CDD\|224552	COG1637, COG1637, Predicted nuclease of the RecB family [DNA replication, recombination, and repair].	5.44298e-08

>NC_016109.1|WP_014133712.1|618575_620288_-|type-I-E-CRISPR-associated-protein-Cse1/CasA
MPKYNLVDEPWLAPRPLDGGPPVHLGIAEALTRADEFDGLSVDFATQLPAVLRQVLLPVLVAALGAPATAAAQGERLARGEFSAQEKERLLAYLAAHRARFELFDESAPFAQVAGLRTAKDETKGTAALVATAASGNNVPLFASRSDADPLDLTPAQAAHWLLHTHCWDTAAIKTGVVGDDQAKAGKTTGNPTGPLGQLGVIVPMGRTLYETLQLNIPVTAAANLGKPQWERPPATPAWEQRPADGLLDLWTWQARRVRLIPEQDEAGGTKVTRVVISAGDRLPATPEWEPHTAWTFTPPAKKASSRAPERRPRRHAQGKAAWRGLEALLAPVRQNDGGVFETSVLLDQIGALQEDGRLAADYPLRVETFGMVYGTQSAVVEDVVHDAIPLPLLALHQDGETRLFLLDVAEQAEQLARALNNLSADLRRAVGTDPIPWDKGQRPGELLLHVLDGLVRRVLAGAREAGGDEDRLERGRFAWEEAAAWRTWEHADALLAVAPASAFAGRTVSQTGKPGKTHTFSLGTAADSFSREAARILPRHAHTARTAVRDRAGAPEDTVKTPSGARVDH
>NC_016109.1|WP_014133711.1|617983_618586_-|type-I-E-CRISPR-associated-protein-Cse2/CasB
MTTDQPTARRRYWDEYTAPDHGWRIDGPSKQPRRPPGEELAALRSGLGRPVMDSPKMWPYYSTEVGDVLALRDRVSDEQQAEHAALALYGLHQQGQSRPMHRSGVKLGRALRELRRDGKYSENALDARVAQLAAATSVPALLVHLRGLVTQLRTVGQPLDYDHLMADIRAWHQSERRPQVRLKWALGYRAWQSKTPDDDE
>NC_016109.1|WP_014133710.1|616769_617918_-|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC
MPSRPRLYIDVHILQTVPPANLNRDDNGSPKEAYFGGKRRSRVSSQAWKRATRLHFAERYEPQDLGTRTKRIAGKLAERLAARAGAALSAEDAQRVAGALLKPMGIAAGKKAGDTAYLLFYGRRQLEGIVDLVAADAAELAALDDQQLEERVKNLPVREQLQQGHPVDVALFGRMVADIPGLNVDAATQVAHALSTHATELEFDYYTAVDDETGDEETGAGMIGTIGFNSATLYRYATVGLHQLTDNLGEEKTAVEAVDLFVDSFARSMPTGYGNSFAHRTRPSLVAVVVRTDQPVNLVSAYENAVPAGDGILAESARRLAAEYRTATSQWGDEPLHTAICHTLDAASPETAALAEAFGANRTFAELREGLRTALTERTATR
>NC_016109.1|WP_014133709.1|615936_616770_-|type-I-E-CRISPR-associated-protein-Cas5/CasD
MPADTTPQGDRAVLLLRLAGPLQSWGDRSAFNRRDTTPQPTKSGVVGLLAAAAGRPREADLTDLVGLRLGVRVDQPGTLLRDYHTVSDYRGLPLPQAGVNAKGVQKPTSPSKHTHVTHRYYLQDAVFLVAVEGPAELVTALGEAVTRPAFPLALGRRSCTPTQPLSLGVRRGTPLETALAEEPWQANEPTRKAHERQAKRGQAPRRTDRVDLAASFDDPHGDDTCRDVPLSFDPRRRGFGTRKVRHAWLSVPTGLRAALPTEPPADGGHDPFALLGW
>NC_016109.1|WP_014133708.1|615160_615928_-|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE
MTYLSRVRINPLRAASRTLLANPRALHGAVQAGVPDQAPGDRILWRLDTDQPRRPQLLVLTPGKPDWTHLVEQAGWPDAEGEHYAVRDYSPLLAQLALGREYAFRLTASPVQNTSKPTGGSTHRTRTAEELQHRSYRLPHRTAAHQLAWFLDRTTRWGFTVPEARTDTPAPGLGTPDGDGEAAREVRITDRDRRTFTKPGTRTPVTLTTATFEGHLRISDPDLLKTALLEGIGPSKAYGCGLLTLAPLPGTGTAR
>NC_016109.1|WP_014133707.1|614122_615157_-|type-I-E-CRISPR-associated-endonuclease-Cas1
MADIWWKAHPHDLHRLSDRVSSVYVERSHIDRDENAVVVINKRETVRIPAAMVAVVLLGPGTRITHGAVNLLADSGTTVCWVGEQGVRMYAAGLGPSRGAGLLNRQAWLVSRTKERLAVARAMYRMRFPGEDVDTATMQQLRGREGARIRKLYQAHARRTGVPWNGRVYQPGDAHAAGDDLNRLLSAANAALYGICHAVITGLGASPGLGFVHTGLATSFVLDIADLYKADYTIPLAFDLTARGHTEERDARLGLRDRIAEDRLLGRIVRDVKALLTPDGIDLDDQDVNQLWDEKVGTVQGGVNWSAESAGSVLRAIDPGMGDENEHLAIIGPEFDNDPKQPPR
>NC_016109.1|WP_014133706.1|613847_614126_-|type-I-E-CRISPR-associated-endoribonuclease-Cas2
MTVIVLIAAPEGLRGHLTRWMVEVHAGVFVGNPSRRIRDRLWDLLATRIGTGQAILVEPATNEQGWTVRTAGTDRWKPVDFDGLILSARPTR
>NC_016109.1|WP_014133705.1|612133_613006_+|IS3-family-transposase
MTLHPFIEAEKRGGHNVKRACELLKVSRAAFYARRTADPGPRAVRDAELAEKITEVHSASRDSCGAPRIHAALRRDGDRCGRRRIARLMRQAGLEGRHRKRRHRTTIPDLQAAGRPDLVLRDFTPDRAGLDARWCGDITYIPTGEGRLYLATVIDIASRRVVGWAAADHLRAELVADALRTACQTRRPSGTALFHSDRGCQYTSREFAIMASEFGIRLSVGRTGQCWDNALAESFLATLKRELPGDRPWPSRAAARTAIFEWIEGWYNIRRLHSSLGYRSPAEYEAALAA
>NC_016109.1|WP_157850088.1|611837_612137_+|transposase
MGKKKPRPRRAFAPEFKAEIVELCRRGDRSVGQVAKDFDLTETAVRDWIRQGEVDAGERDGLTSDEREELARLRRENRRLREDVDILRRATAFFAKETR
>NC_016109.1|WP_148283049.1|611030_611300_+|hypothetical-protein
MRLPIRDARTHGSILRIVARQLRQNKNLVALATTSATCALKGQPATITPEQITGLVIVIIILIALSTITYKPNGWLRPNPTGTRSTRRR
>NC_016109.1|WP_014133715.1|626393_627044_+|DUF91-domain-containing-protein
MTGLRLFRVDGGSAEEVAGSEVELERHLQTLIEQNMGTMLGVRFLASEYSTGPVHGGRIDSLGLDEDGSPVVIEYKRSRSENVINQALFYSAWLRDHKAEFEALVARQLGTEAADGVDWSGLRIICVASGYSRYDVHAIGEMNRRIDLVRYQQFEGDILALELHASVSSGPSALTRSQVDGNSRATGGPGRKTVREAIERASLGSVVKVILGNGSW
>NC_016109.1|WP_193365912.1|627874_628273_-|hypothetical-protein
MNVTELLRPPQAEHDETAARADCPREQIDQLTTALAETEARLAEIVTTGKVIDDLALPGHEPAPAETATVYQRIVTASNEHPRQVFRVREPHELLGLPTDEPSINVTRSRLGRLVRQGILDQPGRGRYQKRT
>NC_016109.1|WP_081539805.1|629248_629728_+|HIT-domain-containing-protein
MSQQSQLRWFANWLTSTSAASPAPPAWAGRSAKDRCIVTTSAPQAPKVSDFYCDEALNGRTPVKVVEETDSVLAFEHTRPSYPVHIVVVPKKHIPSLVNLGDGTEEDLVDVFRVVRAVAARVREEYGAACVVTNEGVYQESKHLHVHVLFRGDLPEGLA
>NC_016109.1|WP_014133721.1|629740_630835_-|UDP-N-acetylglucosamine--N-acetylmuramyl--(pentapeptide)-pyrophosphoryl-undecaprenol-N-acetylglucosamine-transferase
MNRKIGITGGASAGHVVPALAVAAELRRAECELVYFGRAGSIEADLAAKAGIRLAAVPSAGLQRFRSWSNLAMPLTVARGVFAAWRALRRERPDVVFSKGSYVSVPVGIAAWLTRIPLAIHESDHTLGLANRILARFATSVFLAEDTPGLPRWLSRKTVVTGLPLRDDLADGRPEDFRARLGIPAGPPVLLVFCGSSGSQRVNAAVRRQLGGLTRHFSVVHICGRGNLDPALASAPGYWQQEYLHGDMVDALTLADLVIGRAGATTLAELHALAKPAVLVPLPASVSRGDQLDNAKAYARHATCLVVADEEMADGTPLLRACEQLLPALGGNRRRPAPEAVRRTARDIAARTIALARPRGRHAR
>NC_016109.1|WP_106437839.1|631238_632888_-|proline--tRNA-ligase
MFASRLFPTPRPRATDPTAPTKDLLEHLGLVGRTDTTGVHTLLPLGLRVRDQLDRITRDAFERNGFNSLALPTLQSRTLWEESGRWKVYTAEGALVTTRVGGADMCLAPTSEEMATATVRSHLRSHRDLPVRLTLNTTKFRDELSPRGGLMRGREFTMADAYTFDPDRAGMLESVRLLNRACTDALTGIGLHGVFQAPADGGAISAGPTTEHLVLADFGQSSILACDHCGHRGDGTVLTAAFPRTAPRGEPVVNVIVFAVTGPDDATRPTAVCIRSDLTISVRKLTAALGSGHHVELLDPDELPALLGKAAGTLTPWDCTGIDVLHDHSVTHLERFTIADGPDGLRTGASWTGATGLAPLALYPADVHTAADGLDCGRCSAGRYRATEAVEVAHVFELGTQYSGKMHLTFTDDNGIQRTPYMGCSGIGLTRCIQTLAGIHRDANGLRWKPGTGPADVHLVVLRSDQAEQQERTDRTARRLQQLGLRLLIDDRPLPAGEKFHYAQALGVPTALVLSPQRADGELEAIDRWTGRRSTITSDQLHTLLRSAA
>NC_016109.1|WP_014133723.1|632905_634033_-|glycosyltransferase-family-4-protein
MSATARLRITTGIDLPLAPSCGSMIFCSDLYREMADRARTTFLALPPADPAWQHGFEETVFATAAKAPYGPGFAAYVDALTGEVRRHLDRARPDVIHAQHLGFGLSLAFVRAAQGTPVVAIAHGTDVIAADADPLARDVLTEIVAGATTVVAPNHALAERIGDLTGHRYRDKMALVPWGIPLARAARTVPATHTDTRPLRLLHAGRLDANKSTRTAVEAMALTDHRHELTVIGSGPEQDALQQQARDLGLTGRVRFEPFAPRDALWQRFADFDAFVFTTSGLEAFGLVAIEAQAHALPVIYSDVAGMTRTLGAAGLPYTPGDAADLAQVIDKLAADRTLRAELSTAGLANGSCYGIVHSAHRLDQVTRDAIGAAA
>NC_016109.1|WP_014133724.1|634029_634776_-|WbqC-family-protein
MNNRLYIEQPPFAPWLGFCEALFACSTVALYDNVQYEDGGFQNRNRIKTPDGVKWLTVPVVKNHGQLIKDVRIADAFDPNKILRQVRLAYGRSRHLDEVLQVLAPVLGAGHRWLLDLNLDLSTGLVAALGAPARLTLTSRLPIEPTADRASRIARICQAAGADELWAGSGTRGYLDPADLAADGIAVTWNEYLPRHPVYEQAWPQQGFTPNLSVLDTASAIGWAGTSALLRNGLAAYLDSLQQEGQPA
>NC_016109.1|WP_106437840.1|634772_635411_-|PIG-L-family-deacetylase
MCYGTLLRYREQGAAVTVVVVTTGINGVSLADRGLGVSLTGRERTDESAASYAGSGIDLVTLGFTDGALVPDRELVSHIEAELARLGCTVLITHSLHAGPDHQDHLAAAQAAVNAATRIGTCATILHGQPHAPRGDFHPTVLVDITDLLPDKVKALAAHRSQAGRWYLGAEFTRHRAAEAGWSLAPVRAAAGRRFEAFETSLISLLAPEGDR
>NC_016109.1|WP_014133726.1|635454_636015_-|deoxycytidine-triphosphate-deaminase
MILTGPQIGAEVEEGRIAISPFDASLLSPNSYDFQLSSDIGWYARHWWGGHTLDCRRPNPFVRATIPEEGMVLRPGRIYLASTAETIGSEHFVPIIRARSSTARTGLFVHCTADLIDLGSLGRLTLQFHAVQPVRVYPGQRIGQVTFWVPTGRRELYRGKYQGSTLPEPSQIWRDFRAEDPRGSSA
>NC_016109.1|WP_014133727.1|636011_636566_-|hydrolase
MILTGSAIADAVQAGHITIEPFLPQHTNPNSHGYRLGDTLKVFTRTPVDPRTSPPTRTVTIPARGYRLRPGRVYLGSTVERIGSDRYVTSLIGRSSVGRLGLFTQISADLAQLGAVHRWTLEIVVTQPLRVYAGMVIGQVSFWDAVGDHMPYGGYYGTLSDPSPFAPHALAGGAAVPFPEVSAA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_016109_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_016109_4

1931784-1931936

Orphan

Consensus_repeat	Method
CGAAGAGGCCGACCCGACCAAGGGCCGCCTGGTCAAGGTCCCGCCGCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_016109_4

>merge|NC_016109|4|1931784-1931936|CRISPRCasFinder
CGAAGAGGCCGACCCGACCAAGGGCCGCCTGGTCAAGGTCCCGCCGCCGGACTTCAACCCCTTCGCACCCCCGGCCCCCAGCACCACCACCCCCGCCGAGGCCCCCGAAGAGGCCGACCCGACCAAGGGCCGCCTGGTCAAGGTCCCCCCGCC

>NC_016109|4|4|1931784-1931936|CRISPRCasFinder
CGAAGAGGCCGACCCGACCAAGGGCCGCCTGGTCAAGGTCCCGCCGCC	GGACTTCAACCCCTTCGCACCCCCGGCCCCCAGCACCACCACCCCCGCCGAGGCCCC
CGAAGAGGCCGACCCGACCAAGGGCCGCCTGGTCAAGGTCCCCCCGCC

Protein	Signature genes	Signature genes Name	Protein_function
NC_016109.1\|WP_106437627.1\|1940172_1940484_-\|LapA-family-protein	unknown	unknown	gnl\|CDD\|377648
NC_016109.1\|WP_014134885.1\|1938440_1939352_-\|glutamate-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270408
NC_016109.1\|WP_063747510.1\|1919936_1920944_-\|galactose-mutarotase	unknown	unknown	gnl\|CDD\|185696
NC_016109.1\|WP_014134882.1\|1936108_1936771_-\|spermidine-synthase	unknown	unknown	gnl\|CDD\|223498
NC_016109.1\|WP_014134879.1\|1933082_1933490_+\|DUF4259-domain-containing-protein	unknown	unknown	gnl\|CDD\|372905
NC_016109.1\|WP_051055139.1\|1928058_1928457_-\|hypothetical-protein	unknown	unknown	unknown
NC_016109.1\|WP_106437626.1\|1928545_1929097_+\|NUDIX-domain-containing-protein	unknown	unknown	gnl\|CDD\|240053
NC_016109.1\|WP_014134880.1\|1933562_1933889_-\|hypothetical-protein	unknown	unknown	unknown
NC_016109.1\|WP_033260374.1\|1939363_1940092_-\|amino-acid-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224051
NC_016109.1\|WP_014134881.1\|1934284_1936099_+\|fibronectin-type-III-domain-containing-protein	unknown	unknown	gnl\|CDD\|119365
NC_016109.1\|WP_014134869.1\|1924441_1925422_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|173835
NC_016109.1\|WP_014134868.1\|1921146_1924104_-\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|379062
NC_016109.1\|WP_014134884.1\|1937781_1938426_-\|amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223836
NC_016109.1\|WP_063747509.1\|1925452_1925818_-\|SHOCT-domain-containing-protein	unknown	unknown	gnl\|CDD\|378276
NC_016109.1\|WP_014134878.1\|1932613_1933042_+\|DUF4259-domain-containing-protein	unknown	unknown	gnl\|CDD\|372905
NC_016109.1\|WP_014134876.1\|1929216_1929981_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NC_016109.1\|WP_033260104.1\|1925837_1926266_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377730
NC_016109.1\|WP_106437887.1\|1926799_1928002_-\|serine-hydrolase	unknown	unknown	gnl\|CDD\|365903
NC_016109.1\|WP_014134872.1\|1926427_1926754_+\|hypothetical-protein	unknown	unknown	unknown
NC_016109.1\|WP_014134883.1\|1936927_1937785_-\|amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223836

Protein	Function_ID	Function_description	E-value
NC_016109.1\|WP_014134885.1\|1938440_1939352_-\|glutamate-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270408	cd13690, PBP2_GluB, Substrate binding domain of ABC glutamate transporter; the type 2 periplasmic binding protein fold. This group includes periplasmic glutamate-binding domain GluB from Corynebacterium efficiens and its related proteins. The GluB domain belongs to the type 2 periplasmic binding protein fold superfamily (PBP2), whose many members are involved in chemotaxis and uptake of nutrients and other small molecules from the extracellular space as a primary receptor. The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two receptor cytoplasmically-located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	3.06661e-98
NC_016109.1\|WP_063747510.1\|1919936_1920944_-\|galactose-mutarotase	gnl\|CDD\|185696	cd09019, galactose_mutarotase_like, galactose mutarotase_like. Galactose mutarotase catalyzes the conversion of beta-D-galactose to alpha-D-galactose. Beta-D-galactose is produced by the degradation of lactose, a disaccharide composed of beta-D-glucose and beta-D-galactose. This epimerization reaction is the first step in the four-step Leloir pathway, which converts galactose into metabolically important glucose. This epimerization step is followed by the phosophorylation of alpha-D-galactose by galactokinase, an enzyme which can only act on the alpha anomer. A glutamate and a histidine residue of the galactose mutarotase have been shown to be critical for catalysis, the glutamate serves as the active site base to initiate the reaction by removing the proton from the C-1 hydroxyl group of the sugar substrate, and the histidine as the active site acid to protonate the C-5 ring oxygen. Galactose mutarotase is a member of the aldose-1-epimerase superfamily.	1.64634e-138
NC_016109.1\|WP_014134882.1\|1936108_1936771_-\|spermidine-synthase	gnl\|CDD\|223498	COG0421, SpeE, Spermidine synthase [Amino acid transport and metabolism].	1.99825e-14
NC_016109.1\|WP_014134879.1\|1933082_1933490_+\|DUF4259-domain-containing-protein	gnl\|CDD\|372905	pfam14078, DUF4259, Domain of unknown function (DUF4259). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria and eukaryotes. Proteins in this family are typically between 118 and 145 amino acids in length.	2.3526e-32
NC_016109.1\|WP_106437627.1\|1940172_1940484_-\|LapA-family-protein	gnl\|CDD\|377648	pfam06305, LapA_dom, Lipopolysaccharide assembly protein A domain. This family includes a domain found in lipopolysaccharide assembly protein A (LapA). LapA functions along with LapB in the assembly of lipopolysaccharide (LPS). Domains in this family are also found in some uncharacterized bacterial proteins.	0.0002801
NC_016109.1\|WP_106437626.1\|1928545_1929097_+\|NUDIX-domain-containing-protein	gnl\|CDD\|240053	cd04697, Nudix_Hydrolase_38, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.	6.10748e-37
NC_016109.1\|WP_033260374.1\|1939363_1940092_-\|amino-acid-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224051	COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism].	1.48428e-154
NC_016109.1\|WP_014134881.1\|1934284_1936099_+\|fibronectin-type-III-domain-containing-protein	gnl\|CDD\|119365	cd06548, GH18_chitinase, The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.	1.43007e-120
NC_016109.1\|WP_014134869.1\|1924441_1925422_+\|hypothetical-protein	gnl\|CDD\|173835	cd00687, Terpene_cyclase_nonplant_C1, Non-plant Terpene Cyclases, Class 1. This CD includes terpenoid cyclases such as pentalenene synthase and aristolochene synthase which, using an all-trans pathway, catalyze the ionization of farnesyl diphosphate, followed by the formation of a macrocyclic intermediate by bond formation between C1 with either C10 (aristolochene synthase) or C11 (pentalenene synthase), resulting in production of tricyclic hydrocarbon pentalenene or bicyclic hydrocarbon aristolochene. As with other enzymes with the 'terpenoid synthase fold', they have two conserved metal binding motifs, proposed to coordinate Mg2+ ion-bridged binding of the diphosphate moiety of FPP to the enzymes. Metal-triggered substrate ionization initiates catalysis, and the alpha-barrel active site serves as a template to channel and stabilize the conformations of reactive carbocation intermediates through a complex cyclization cascade. These enzymes function in the monomeric form and are found in fungi, bacteria and Dictyostelium.	7.02888e-18
NC_016109.1\|WP_014134868.1\|1921146_1924104_-\|ATP-binding-protein	gnl\|CDD\|379062	pfam13191, AAA_16, AAA ATPase domain. This family of domains contain a P-loop motif that is characteristic of the AAA superfamily.	4.6347e-13
NC_016109.1\|WP_063747509.1\|1925452_1925818_-\|SHOCT-domain-containing-protein	gnl\|CDD\|378276	pfam09851, SHOCT, Short C-terminal domain.	4.75999e-05
NC_016109.1\|WP_014134878.1\|1932613_1933042_+\|DUF4259-domain-containing-protein	gnl\|CDD\|372905	pfam14078, DUF4259, Domain of unknown function (DUF4259). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria and eukaryotes. Proteins in this family are typically between 118 and 145 amino acids in length.	5.11251e-30
NC_016109.1\|WP_014134876.1\|1929216_1929981_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	1.6608e-12
NC_016109.1\|WP_033260104.1\|1925837_1926266_-\|hypothetical-protein	gnl\|CDD\|377730	pfam06897, DUF1269, Protein of unknown function (DUF1269). This family consists of several bacterial and archaeal proteins of around 200 residues in length. The function of this family is unknown. The family carries a repeated glycine-zipper sequence- motif, GxxxGxxxG, where the x following the G is frequently found to be an alanine. As glycine-zippers occur in membrane proteins, this family is likely to be found spanning a membrane.	0.000378264
NC_016109.1\|WP_106437887.1\|1926799_1928002_-\|serine-hydrolase	gnl\|CDD\|365903	pfam00144, Beta-lactamase, Beta-lactamase. This family appears to be distantly related to pfam00905 and PF00768 D-alanyl-D-alanine carboxypeptidase.	7.15477e-55
NC_016109.1\|WP_014134884.1\|1937781_1938426_-\|amino-acid-ABC-transporter-permease	gnl\|CDD\|223836	COG0765, HisM, ABC-type amino acid transport system, permease component [Amino acid transport and metabolism].	3.23511e-58
NC_016109.1\|WP_014134883.1\|1936927_1937785_-\|amino-acid-ABC-transporter-permease	gnl\|CDD\|223836	COG0765, HisM, ABC-type amino acid transport system, permease component [Amino acid transport and metabolism].	2.01288e-56

>NC_016109.1|WP_014134876.1|1929216_1929981_+|TetR/AcrR-family-transcriptional-regulator
MASRTPSATPRAAERAPRRRLSVDERREQLIAVALQLFSDRAPEDVSIDDIAAAAGASRPLVYHYFPGKQALYEEALRRAGRELAGRFEEPGEGPLSERLLRVMGRYLDFVESHAAGFTALLRGGSVTASPDADAVIDQVRRAAQQQILLHLGVPDPSPSLRRTVRAWIANAEISSLDWLADKPVPVETLQLQLVQELVAALAVAATRDPELAALLGGFFATEEPDGPTALLLRDLLATFTAPELAAPLLRLTR
>NC_016109.1|WP_106437626.1|1928545_1929097_+|NUDIX-domain-containing-protein
MENPENPALPDAPATDLDEILDVVDEHDRVLRTAPRSEVYRDGLIHRCVFVLVRDPRGRIFTHRRTDTKAFAPGAHDCFVGGVVGAGESYAEAAVREAEEELGVSGVRTRPLFRFLYSDGDRYSWWSDIHEAVWDGPVDPQRSEVAWYDWLTEDELADRLATWEFVPDGREAYRRYLALRPAD
>NC_016109.1|WP_051055139.1|1928058_1928457_-|hypothetical-protein
MTRTDRQSPFRGAELKNRAAVLSVAAALVALATALPASAAPAPGSGSASAGRSVRSGLDCTTWIHNNDPLYGGVDCTNNTGSPVTFHADIVCGWAPDVTGNSVTAYPGQTQESSGHCAIYSSGIGHIGWTVE
>NC_016109.1|WP_106437887.1|1926799_1928002_-|serine-hydrolase
MADGFEPVREAFAGNFRLYGELGAAFALYLDGRPVVDLWGGDARPEVGARPAPAVGWEEGTAQVLRSVTKGLTAAAALHLAQRGLLDLDAPVASYWPEFARAGKERVPVRWLLSHQAGLPALDVPLRIEDVLAWEPAAAAVAAQAPAWEPGTAHGYHPLTFGWLVGEVVRRAGGRSVGRYFAEEIADPLGLDLWIGLPAAASGRVGRLVDLPAPEAAKLAPGGMRMRPKQSVLDAYRDPRSLTARSFGAVRSSVDLNDPAVQAVEVPGAGGIGTARSLARFYAALIGAADRADAPGQRLPALFAPETLAEAAGPSVQGPDRVLIVNTAFGQGFFRHGGTSPMASPASFGHPGRGGSLGFADPELGLGFGYVTNGMQPGVTGDIRSRALIAAVRQCLAARG
>NC_016109.1|WP_014134872.1|1926427_1926754_+|hypothetical-protein
MTIAVDKLSDPAVRRLLGAVNAGDRDAFFAALTEDATMSDDGSARDLADWVDREIFSSHGHIEVQTEKSGGRALVADYRNDTWGEMRTAWRFTVTPDGRVSHFETGQA
>NC_016109.1|WP_033260104.1|1925837_1926266_-|hypothetical-protein
MGPAELLVLTFPEATISTEAATALVRLRDAAGVRVIDSLAVVRDAEGDATYAELADFDHLRGVEGLDAEELPLIGPEDAQEVAELLEPGSAALIVLIEHLWAEEAAAALRAVGGRIASGVRIPPENIEEAVRAAEARVAAGE
>NC_016109.1|WP_063747509.1|1925452_1925818_-|SHOCT-domain-containing-protein
MRPIRPVRVVRPVGRPLARGLLVGGAAYAAGRAGARRAANEQGQDEAIAELQAEQQQQAVQQQQQAYAPPPQPVAPQPVAPVASGGGGEDVASKLNQLAQLVQQGLLTPEEFAAAKARLLS
>NC_016109.1|WP_014134869.1|1924441_1925422_+|hypothetical-protein
MGKSTELWLETMGFAADAERRQRLLAIGAHEFVCRIAKDADGTTGLELASQWLCSMLTLDDEWDTGGLSRDPSRVLTIAATLLAVINSTQSHPGETDLYVASVRDVFDRARSWAPALSVKRWADSQLESFMGAATIVAYRTERRPMTLSEYLTIGPLDRGSRSCIEIIEVCERTAIPQSQLDSPRVHALTEAAKFLVLVAADVYSFRREDDHGALESNIVDALQRHLGCDQERALQEAAALHDRTMCLFLRLADRTSRRAGAELRRYINQLSNLVSGNLEWGFTSARYTERPPGGLPVAVRAERPADGRLTPPPYPEIAWWWDQLW
>NC_016109.1|WP_014134868.1|1921146_1924104_-|ATP-binding-protein
MAEEQNGPQGREAGADEVGHRLWEREQELRSVEQAVEKLCREFAAGGLKIGELLVFSGSPGIGKTSMLEQVRRIAGARQDSTVLFARGSERQRKEPFRVLRQLLLPVLSDLDEAEHKEVFGSWENIVAPAVGLAPPSDEVERMLDPQSVRDGLDFVITQLAPRRAPLVVIVDDLHAVDQESLTWLASFAVRARELPVLLVFAYRHEFEEEARPLAAQIAERAARKHELLPLNPVSVAAIVHGEFAEADDAFCRQVWAVTAGAPYDTVALLREVRDQNLEPVEENSPRLRDLAAAARGQGRDYWLDKLGITVIRFAWAAALLGTEIREDVAAAICAQGPAQADESVRVLRRMRVLTSQPDGRLEFVHPLIATSIYQSIPPSTRTGMHGMAATVIENSGGSLLTASRHLLETHPGEGDDAMVRKLRRAAAENLAIGAPEAARRCLERALNEPPDEEDQAEVLFELACASLLTDPGATANQLRRAIDMEPGLSPDLRVEAVFRLSEVIAHSGDLSTAAALCLDESERAPAGPGRVRLLVAHLLYTALQRDEENGPERAARVRRLVEEVDPDSEAARPVRALYAWDLTLQGGSSTEALRAADAALVDGRLPRSLGWTNTTWNFELPALLGLCFAYNDELGRAEKLFSSAILEFEIAGWSGGHRGFAYFLMGYARLRRGFLPEAEDFLRRGLRIADRMGTGLPLTWNLAGALIDTLLSRGRDHEAWEVAVKYRFLPPYHQTALLLPDVATIYGKLLISRGDHAMAVEVLAETGTRLDKRGWRSTVHAPWAGYLAVAMAGLDLPSARKNGDDAVARARESGSPSAIGTALRLAASVWEGAHAVELLQESVGWLGRSPASYEHAHALIDLGAALVQVGRSLEAEEHLYQGMELAKHCGADGLEVRARNVLASAGLRPSRPQSPAKDTLNPQELAVARLAVRALPPQRIAEELQLPLGVVKQRLAAVHRKLGTGPEGLADALGFPADGPGQGG
>NC_016109.1|WP_063747510.1|1919936_1920944_-|galactose-mutarotase
MGLERWTLRSGPIEASVITLGAALHTLTAPDRHGTPAQLLLTSEDVGTLLGPAKHYGVTVGRYANRIAGSRITVDGVDHPLLPTGHGVTLHGGPDSFSHRVWDAEEIPGGVRMHLHSPDGDQGFPGALDVWVEFTLTGSDLAVSYRAVTSKPTVLNLTNHAYFNLAGEGRGDVLGHLLTVDADAYTPVDDRQVPYGPYEPVADTPFDFTTARAIGERIRDGHPQLKLSRGYDHNWVLRERPADGPPVRAALLADPGSGRTLEVLTTEPGLQVYTANGFDGAVTGPSGTAYGPYAGVALETQHHPDSPHQPSYPSTELRPGQEFRSTTVLRLGTAG
>NC_016109.1|WP_014134878.1|1932613_1933042_+|DUF4259-domain-containing-protein
MGSWDTGPFDNDDAADLGDELDEAAPERRAALVRAALTRALRKSDCLEHGDGLRAVAAAALVASHCPGGTPVTTAHGPRQPLPPLADLRPLAARAVARALGPDSELTEGWYAFAAYQTWRNELEHLQTVLRDPPPPTQATLF
>NC_016109.1|WP_014134879.1|1933082_1933490_+|DUF4259-domain-containing-protein
MGAWDTGHFDNDTAADFSGTLDDTAPEERAALLRETLAEAAAVAADDYLDSDVACTALAAAALVASHCPGGTPVTTAYGPQQPLPPLADLRPLAFAAVERVLAEESELAELWDETELSADWRAAVTALRTTLLPV
>NC_016109.1|WP_014134880.1|1933562_1933889_-|hypothetical-protein
MLEREIELLGQLLEEFGDLRFPPGWYDREPGGISLVTLATTLAGCTAATLDGPLDDRHREHLRQRRVLLADLLPEVAADPYATRYFITLYRMAVLAEEVDDGRAGVSG
>NC_016109.1|WP_014134881.1|1934284_1936099_+|fibronectin-type-III-domain-containing-protein
MVASQSGAGRASVSWTASSDNVRVAGYDVYAGAAKVSTVTGDDTAVTIGGLAEGRHTFTVVPFDTSANRSAASAPVTVDIVPPPPDFEPPSAPGTPIGTSAGTTTIGLAWGAATDNVGVTAYDVYNGGTPALSVAAPATSATVSGLSPDTPYTFTVRARDAAGNTSPASSPVTARTGRVNPRTGLTIGYFTQWSVYARGYSVKRLDTSGSAAKLDYLNYAFANIHPSTKQCFLTDKAAGNDSDPNADDGAGDAWADFGRGWDSGTSVAGTTDTWDQKLAGNFNQLKQLKAKYPNLKVQISLGGWSYSKWFSDAAATDASRKALVSSCVDLYIKGNLPVIDGRGGAGSAAGIFDGIDLDWEWPNSEGHLGNVIRPADKANYTLLAQEFRRRLDTLGATTGKHYTLSAFLPADPAKIIAGIDVPGLFAAFDFATVQGYDYHGAWETTTNQQSALKVAADDPSAPDRRFSSEIAVQAYLDGGAPKSKLTLGVPFYGRGWTGVPRGSTNGLFQPATGPAPGSYENGFEDYHKLKEKLASGGYTLYRDPVAGHAYLYDGTVLYTYDDPTEISRKAAWIKEQGLAGAMIWSFDGDTANGELMTALANGLK
>NC_016109.1|WP_014134882.1|1936108_1936771_-|spermidine-synthase
MDEAEVLDRRRSASGEVVLRRRGGHCEVIVNGCFLMDTVDGRSERLLVAAAAAELAGVRRPSVLIGGLGVGFSLAHAAAEPRWGRIAVVEREEAVIDWHRTGPLGAFSAGALDDPRVEVLHTDLVAYLAAAGERYDALCLDIDNGPDWTVGAENDRLYGPVGLAAAAARLNSGGVLAIWSAQPSAAFERALRAAGFTGVRSEEIAVERGVPDVVHLARRA
>NC_016109.1|WP_014134883.1|1936927_1937785_-|amino-acid-ABC-transporter-permease
MTVESSALYDVPGPKALARHRLYGWLALLAIAAVLGWVVYMLFHTEQFTYQKWMPFEYKGVQELLLRGLGNTLRAFGWTVLFALPFGALFAAGRLSEHRAVRWVSTVVVEFFRAMPLLVMIFFIFVALKAPPMWALVAGLALYNGSVLAEVFRAGVLAVPRGQKEAAYALGLRKTQVMAYVLVPQANRAMLPAIVSQLVVALKDTSLGFLITYEEFLHAGKLIATNLDYDLPFIPVVMVIAPVYIGMCLLLSWFAKWLERRGRRDPKVRGGAPVAPTGLTPDPQG
>NC_016109.1|WP_014134884.1|1937781_1938426_-|amino-acid-ABC-transporter-permease
MRVLTDNWSTYWHGFLGTLWLTLVSAVLALVLGAVVAGFRVSPVKPLRVFGTGWVTVLRNTPLTLLFFIVVLGLPRFDITLPFFTFAVLALGCYTSAFVCETLRSGVNTVPTGQGEAARSLGLTFGQTLRLVVLPQAYRSVVAPLGSVMIALAKNTAIAGSFSVVELLGTYRTINELGYDIVWTFVWIAAGYLVLTLAISALFNLLERRVAVSR
>NC_016109.1|WP_014134885.1|1938440_1939352_-|glutamate-ABC-transporter-substrate-binding-protein
MRRRVGALLLALLTGAGAGGVAGCGKEGTPPPKGPQAGALPSYQVRGGDAVTGSPTLDAARARGHLVVGAKEDQPYLGQKNPATGEYSGFDIEIARMVGADLGFAPERIEFRTIASANRETALQNGQVDYYVGTYTINDNRKKLVGFAGPYFVAGQSLLVRKNETKIDGPQDLAGRKVCSAAGSTPYQRIQKNYPQAKLIGYDTYSACVDNLITGQVDAVTTDNAILQGYAAKVPDELRIAGQPFSEEPYGIGVPKGDTALRLALDDALERHERDGDWKKAYDATLGLSGVPAPEPPAVDRYR
>NC_016109.1|WP_033260374.1|1939363_1940092_-|amino-acid-ABC-transporter-ATP-binding-protein
MIELRGVNKHFGQLHVLRDIDLAVGRGEVVVVIGPSGSGKSTLCRAINRLETVESGSILIEGRPLPAEGKGLARLRAEVGMVFQSFNLFAHKTVLQNVTLAPVKVRKRGKAAAEATGRQLLERVGLAAHADKYPAQLSGGQQQRVAIARALAMDPKALLFDEPTSALDPEMINEVLEVMRALAAEGMTMVVVTHEMGFARSAANRVVFMADGRIVEDRAPEEFFADPRSERARDFLSKILKH
>NC_016109.1|WP_106437627.1|1940172_1940484_-|LapA-family-protein
MGGGGGVARRPGGGGRAQTAGVTKTSGGSPSGTQRNEIAGIPTRYIGIGVIVVLAVWFLFANLDKVKIQFWVFTVTCPLWIALLATLLAGTALGWLLKGRRSR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_016109_5

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_016109_5

2749054-2749177

Orphan

Consensus_repeat	Method
TACGGCTACCCGCCCCCGCAGCAGGGCTACGGCTACCCGCCGCAAC	CRISPRCasFinder

1 spacers

PD-DExK

The CRISPR arrays of NC_016109_5

>merge|NC_016109|5|2749054-2749177|CRISPRCasFinder
TACGGCTACCCGCCCCCGCAGCAGGGCTACGGCTACCCGCCGCAACAGCCCCCGCAGCAGCAGCCCGGCGGCTACGGCTACCCGCAGCCCGCCGCCGCCCAGGGCTACGGCTACCCGCCCCCGC

>NC_016109|5|5|2749054-2749177|CRISPRCasFinder
TACGGCTACCCGCCCCCGCAGCAGGGCTACGGCTACCCGCCGCAAC	AGCCCCCGCAGCAGCAGCCCGGCGGCTACGGC
TACCCGCAGCCCGCCGCCGCCCAGGGCTACGGCTACCCGCCCCCGC

Protein	Signature genes	Signature genes Name	Protein_function
NC_016109.1\|WP_014135604.1\|2750323_2751478_+\|DUF2637-domain-containing-protein	unknown	unknown	gnl\|CDD\|378511
NC_016109.1\|WP_014135597.1\|2742721_2742937_+\|zinc-ribbon-domain-containing-protein	unknown	unknown	gnl\|CDD\|274226
NC_016109.1\|WP_014135608.1\|2756138_2756714_-\|TerD-family-protein	unknown	unknown	gnl\|CDD\|376767
NC_016109.1\|WP_193365920.1\|2734531_2735404_+\|hypothetical-protein	unknown	unknown	unknown
NC_016109.1\|WP_193365921.1\|2740926_2741106_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|237951
NC_016109.1\|WP_106437650.1\|2741429_2742695_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|274008
NC_016109.1\|WP_014135610.1\|2757550_2757988_-\|DUF3052-domain-containing-protein	unknown	unknown	gnl\|CDD\|378615
NC_016109.1\|WP_033259359.1\|2749363_2750107_-\|Tellurium-resistance	unknown	unknown	gnl\|CDD\|226595
NC_016109.1\|WP_041293896.1\|2739727_2740342_-\|transposase	unknown	unknown	gnl\|CDD\|315923
NC_016109.1\|WP_014135601.1\|2746712_2747885_-\|HpcH/HpaI-aldolase/citrate-lyase-family-protein	unknown	unknown	gnl\|CDD\|379744
NC_016109.1\|WP_014135607.1\|2753668_2756074_+\|PQQ-binding-like-beta-propeller-repeat-protein	unknown	unknown	gnl\|CDD\|270916
NC_016109.1\|WP_014135374.1\|2740251_2740791_-\|winged-helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|379282
NC_016109.1\|WP_014135606.1\|2752701_2753277_-\|TerD-family-protein	unknown	unknown	gnl\|CDD\|376767
NC_016109.1\|WP_014135611.1\|2758455_2761206_+\|pyruvate-dehydrogenase-(acetyl-transferring),-homodimeric-type	unknown	unknown	gnl\|CDD\|236500
NC_016109.1\|WP_014135592.1\|2733320_2734265_+\|hypothetical-protein	PD-DExK	mkCas0090_PD-DExK_CAS-I:CAS-III	unknown
NC_016109.1\|WP_014135594.1\|2735451_2739681_+\|caspase-family-protein	unknown	unknown	gnl\|CDD\|238121
NC_016109.1\|WP_014135612.1\|2761361_2762960_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|129794
NC_016109.1\|WP_014135598.1\|2743052_2743871_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|319822
NC_016109.1\|WP_014135609.1\|2756865_2757324_-\|peroxiredoxin	unknown	unknown	gnl\|CDD\|239316
NC_016109.1\|WP_014135605.1\|2751558_2752641_-\|DUF475-domain-containing-protein	unknown	unknown	gnl\|CDD\|237583

Protein	Function_ID	Function_description	E-value
NC_016109.1\|WP_014135604.1\|2750323_2751478_+\|DUF2637-domain-containing-protein	gnl\|CDD\|378511	pfam10935, DUF2637, Protein of unknown function (DUF2637). This family of proteins has no known function.	3.33055e-14
NC_016109.1\|WP_014135597.1\|2742721_2742937_+\|zinc-ribbon-domain-containing-protein	gnl\|CDD\|274226	TIGR02605, CxxC_CxxC_SSSS, putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (SP:Q50229, ). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors. [Regulatory functions, DNA interactions].	5.24231e-11
NC_016109.1\|WP_014135608.1\|2756138_2756714_-\|TerD-family-protein	gnl\|CDD\|376767	pfam02342, TerD, TerD domain. The TerD domain is found in TerD family proteins that include the paralogous TerD, TerA, TerE, TerF and TerZ proteins It is found in a stress response operon with TerB and TerC. TerD has a maximum of two calcium-binding sites depending on the conservation of aspartates. It has various fusions to nuclease domains, RNA binding domains, ubiquitin related domains, and metal binding domains. The ter gene products lie at the centre of membrane-linked metal recognition complexes with regulatory ramifications encompassing phosphorylation-dependent signal transduction, RNA-dependent regulation, biosynthesis of nucleoside-like metabolites and DNA processing linked to novel pathways.	2.94838e-123
NC_016109.1\|WP_193365921.1\|2740926_2741106_+\|hypothetical-protein	gnl\|CDD\|237951	PRK15347, PRK15347, two component system sensor kinase.	0.00788324
NC_016109.1\|WP_106437650.1\|2741429_2742695_+\|hypothetical-protein	gnl\|CDD\|274008	TIGR02168, Chromosome_partition_protein_Smc, chromosome segregation protein SMC, common bacterial type. SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins].	1.31919e-06
NC_016109.1\|WP_014135610.1\|2757550_2757988_-\|DUF3052-domain-containing-protein	gnl\|CDD\|378615	pfam11253, DUF3052, Protein of unknown function (DUF3052). This family of proteins with unknown function appears to be restricted to Actinobacteria.	2.08374e-65
NC_016109.1\|WP_033259359.1\|2749363_2750107_-\|Tellurium-resistance	gnl\|CDD\|226595	COG4110, COG4110, Uncharacterized protein involved in stress response [General function prediction only].	3.20523e-45
NC_016109.1\|WP_041293896.1\|2739727_2740342_-\|transposase	gnl\|CDD\|315923	pfam13358, DDE_3, DDE superfamily endonuclease. This family of proteins are related to pfam00665 and are probably endonucleases of the DDE superfamily. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	2.37543e-28
NC_016109.1\|WP_014135601.1\|2746712_2747885_-\|HpcH/HpaI-aldolase/citrate-lyase-family-protein	gnl\|CDD\|379744	pfam15617, C-C_Bond_Lyase, C-C_Bond_Lyase of the TIM-Barrel fold. This family of TIM-Barrel fold C-C bond lyase is related to citrate-lyase. These genes are found in the biosynthetic operon, with other enzymatic domains, associated with the Ter stress response operon and are predicted to be involved in the biosynthesis of a ribo-nucleoside involved in stress response.	3.57995e-169
NC_016109.1\|WP_014135607.1\|2753668_2756074_+\|PQQ-binding-like-beta-propeller-repeat-protein	gnl\|CDD\|270916	cd14014, STKc_PknB_like, Catalytic domain of bacterial Serine/Threonine kinases, PknB and similar proteins. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This subfamily includes many bacterial eukaryotic-type STKs including Staphylococcus aureus PknB (also called PrkC or Stk1), Bacillus subtilis PrkC, and Mycobacterium tuberculosis Pkn proteins (PknB, PknD, PknE, PknF, PknL, and PknH), among others. S. aureus PknB is the only eukaryotic-type STK present in this species, although many microorganisms encode for several such proteins. It is important for the survival and pathogenesis of S. aureus as it is involved in the regulation of purine and pyrimidine biosynthesis, cell wall metabolism, autolysis, virulence, and antibiotic resistance. M. tuberculosis PknB is essential for growth and it acts on diverse substrates including proteins involved in peptidoglycan synthesis, cell division, transcription, stress responses, and metabolic regulation. B. subtilis PrkC is located at the inner membrane of endospores and functions to trigger spore germination. Bacterial STKs in this subfamily show varied domain architectures. The well-characterized members such as S. aureus and M. tuberculosis PknB, and B. subtilis PrkC, contain an N-terminal cytosolic kinase domain, a transmembrane (TM) segment, and mutliple C-terminal extracellular PASTA domains. The PknB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.	1.36779e-84
NC_016109.1\|WP_014135374.1\|2740251_2740791_-\|winged-helix-turn-helix-domain-containing-protein	gnl\|CDD\|379282	pfam13592, HTH_33, Winged helix-turn helix. This helix-turn-helix domain is often found in transferases and is likely to be DNA-binding.	1.395e-18
NC_016109.1\|WP_014135606.1\|2752701_2753277_-\|TerD-family-protein	gnl\|CDD\|376767	pfam02342, TerD, TerD domain. The TerD domain is found in TerD family proteins that include the paralogous TerD, TerA, TerE, TerF and TerZ proteins It is found in a stress response operon with TerB and TerC. TerD has a maximum of two calcium-binding sites depending on the conservation of aspartates. It has various fusions to nuclease domains, RNA binding domains, ubiquitin related domains, and metal binding domains. The ter gene products lie at the centre of membrane-linked metal recognition complexes with regulatory ramifications encompassing phosphorylation-dependent signal transduction, RNA-dependent regulation, biosynthesis of nucleoside-like metabolites and DNA processing linked to novel pathways.	2.18205e-112
NC_016109.1\|WP_014135611.1\|2758455_2761206_+\|pyruvate-dehydrogenase-(acetyl-transferring),-homodimeric-type	gnl\|CDD\|236500	PRK09405, aceE, pyruvate dehydrogenase subunit E1; Reviewed.	0
NC_016109.1\|WP_014135594.1\|2735451_2739681_+\|caspase-family-protein	gnl\|CDD\|238121	cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.	8.63129e-69
NC_016109.1\|WP_014135612.1\|2761361_2762960_-\|MFS-transporter	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	7.82007e-68
NC_016109.1\|WP_014135598.1\|2743052_2743871_-\|hypothetical-protein	gnl\|CDD\|319822	cd07520, HAD_like, uncharacterized family of the haloacid dehalogenase-like (HAD) hydrolase superfamily. The haloacid dehalogenase-like (HAD) hydrolases are a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members include 2-L-haloalkanoic acid dehalogenase (C-Cl bond hydrolysis), azetidine hydrolase (C-N bond hydrolysis); phosphonoacetaldehyde hydrolase (C-P bond hydrolysis), phosphoserine phosphatase and phosphomannomutase (CO-P bond hydrolysis), P-type ATPases (PO-P bond hydrolysis) and many others. Members are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	3.8958e-10
NC_016109.1\|WP_014135609.1\|2756865_2757324_-\|peroxiredoxin	gnl\|CDD\|239316	cd03018, PRX_AhpE_like, Peroxiredoxin (PRX) family, AhpE-like subfamily; composed of proteins similar to Mycobacterium tuberculosis AhpE. AhpE is described as a 1-cys PRX because of the absence of a resolving cysteine. The structure and sequence of AhpE, however, show greater similarity to 2-cys PRXs than 1-cys PRXs. PRXs are thiol-specific antioxidant (TSA) proteins that confer a protective role in cells through their peroxidase activity in which hydrogen peroxide, peroxynitrate, and organic hydroperoxides are reduced and detoxified using reducing equivalents derived from either thioredoxin, glutathione, trypanothione and AhpF. The first step of catalysis is the nucleophilic attack by the peroxidatic cysteine on the peroxide leading to the formation of a cysteine sulfenic acid intermediate. The absence of a resolving cysteine suggests that functional AhpE is regenerated by an external reductant. The solution behavior and crystal structure of AhpE show that it forms dimers and octamers.	5.68911e-76
NC_016109.1\|WP_014135605.1\|2751558_2752641_-\|DUF475-domain-containing-protein	gnl\|CDD\|237583	PRK14013, PRK14013, hypothetical protein; Provisional.	5.69962e-163

>NC_016109.1|WP_014135601.1|2746712_2747885_-|HpcH/HpaI-aldolase/citrate-lyase-family-protein
MRHFGHLADDVRSRLFHEQPAPFDRDSEAAVLATALGATLYSPATRTTLARDVRKQAARGVVSMVLCLEDAIADHEVDGAERNLVAQLTELAGQDADADLPLLFVRVRAAEQITDLAARLGPALRLLSGFVVPKFTEDSGLPFLEALTAAEERTGQRLFVMPVLESPELAHLESRREQLHGIARLLDKHRSRVLAVRLGVTDLCSAYGLRRSPDLTAYDVALVAGVIGDVVNVLGRADGTGHTVTGPVWEYFPLQERMFKPQLRRTPFAEVTPPADRVRQQLIEHDLDGLIREIELDRANGLLGKTCIHPSHVAAVHALSVVTHEELCDARDILQQHRGGGGVSRSAYTNKMNEAKPHRAWAERVLLRAEVFGVARPEVTFAELLSACIG
>NC_016109.1|WP_014135598.1|2743052_2743871_-|hypothetical-protein
MPQFLVASDLDRTLVYSNRALALDVPDRLAPRLLAVEVHDGKALSFMTEQAAALLAEIAALAPVVPVTTRTRAQYERIHLPGPTADWIPPYAVCANGGHLLVDGVSDQDWQREIRARLGEHSAPLAEVVEHLALTADPEWTHKRRVADELFVYLVVERADLPAGWIDDLTAWSAARGWTVSLQGRKVYAVPAPLSKGAALEEVRRRTGAATVLAAGDSLLDADLLRTADLGWRPGHGELAETGWTADGVTALTETGVHAGEEILRQMLKHLG
>NC_016109.1|WP_014135597.1|2742721_2742937_+|zinc-ribbon-domain-containing-protein
MPRYDFRCRSCGATFELNRPMARANDPAVCPEGHPDTVKLLSAVAVTGATASAPAGGGGGGGGCCGGGCCG
>NC_016109.1|WP_106437650.1|2741429_2742695_+|hypothetical-protein
MVRVAGGGGGGRGGWWGGGNRRDGARADARAAREAAQESFYELDSAQRDALLAVETVKSAGDPAAARRVEGEFADLTARIDQVTVAYLGALDAVDLESAESDPGAVARARQQLDQAKRELDAKRAELGTFVSRLQPVLEQAEAQLIRVTPAVERARQALLGATTALERAREAGLRADDLAARLAELAPELTRLNQGVAQHGVPATLRRAEDVARRAEEIRAEAAQLPERATEIDHRVASLRTRIDALENRAPTVDPALSELRRRFSTSCWQDLQQVPAQTADAVRTARGKLAEAVRARDEQRWADATAAIGTVRALLDTAGGAVTAVNERLRQLNEVQHDPQREIERARFAIRDAQRLAMAGRQAPDPRHAGPLDAAVARLDRAVAALEESGRHPDYWRFLTELAAVRETAAEVVTLIRGH
>NC_016109.1|WP_193365921.1|2740926_2741106_+|hypothetical-protein
MDTYGHLWPDRLDEVSDRLDTQRTKALAKARQKAEKAARKARQLAEQLAALEAGGHAAA
>NC_016109.1|WP_014135374.1|2740251_2740791_-|winged-helix-turn-helix-domain-containing-protein
MRYAQGGGLTDAGRAARERLRLQAVERFEGGQKNGEIAAGLRVSERSVERWRRAWRERGEAGVLSKGSPGRPRLSDKQIARLERELERGPLVHGWADQRWTLARVKTLIGRLFHVSYTVEGTWRLLKRHGWSWQQPARRAIERDDAAVELWKKETWPLVRAPRRPSAPGSSSRTRPGSR
>NC_016109.1|WP_041293896.1|2739727_2740342_-|transposase
MEEGDLAVGKSTAAALGAWVVFEDEAGQSMTPPRARTWGRIGRTPVVRVRGRGSGRVSMAGMACYKPGERSRLIYAIREYRGRKGEPKGFGWRDFRDLVVRARVQLGGPLVLVWDNARIHLVPPLRAFFEANAHWLTVFQLPTYAPDLNPQEGIWSLVKRDIGNLAAADLGQLTRAVKRKLKMIQYRPHLVDGCLVGTGLIMDG
>NC_016109.1|WP_014135594.1|2735451_2739681_+|caspase-family-protein
MADYPQNREWDRPGLAQARERVVELFTTTLGYRLHDPLPLSPTKQELTNALRRFCAAPERREDDLLALYLSCHGEILGDGEEHVLLTADTDPEDLAYTALPTAELTRVLLRGTRIRRVLLMLDACYVGQGGNEMAAAALERVGALWGKGTGSGLVVVSSAQPHQPALAGAFPQLLEDAVASLPVAGHGPQALSVNALVQHMNDSTDRPGYQRIGLTMVGLDGEAPPFFPNPRHDVRLTEVDLALQQTAAFDEQDRRRETELVSRLLVRAMGYHRTADEDVDPAWWFSGRHTALRDLAAWLNHPADHRDAACRVVTAAPGSGKTAVLGLIAALSHPERHRTVPTHTLGLPTDLVQPGTIDAAVYAQRLSDSDVLDALNAAARTRATTVGELLEALTLRPRPLTVLIDALDEAASPDTLTAGLLRPLIEHSQGRIRLLLGTRPYLLPRLGTTPEQAIDLDDDRYADPQAITAYAIRTLLEAHRRSPYRRRPSRLRPVAEAVAEAADRSFLVARITAATLAATPTIPDPGDPHWRASLPRYAGDAMHRDLHRRLGPDAQRAIDLLRPLAYAQGQGLPWEDIWAPLATETSGRPCTDDDILWLRHQAGSYVVEATENGRSAYRLYHEAMAEYLRQDTDPQGIHAAYTHVLTSRVPYRADATRDWSRAHPYALAHIAYHAAQAGLLDQVLTDTEYLVHADPRGLTPHLHHADSPEARLNAAVYRTGLHLHHEGAPSVRRQVLALNAASAGATDLHNDLTHRIPVGTWTPRWATGSAFSPALRHTLTGHNNSVTAVACTALDGRPVAVTTSHDETVRVWDLATGQPLGQPLTGHTANVLAVACTALDGRPVAVTTGVDRTVRVWDLATGQPLGQPLTGHTDEVAAVACTALDGRPVAVTSSHDKTVRVWDLATGQPLGQPLTGHTETVYRVACTELDGRPVAVTASWDETVRVWDLATGQPFGEPLTGHLDEVLAVACTALDGRPVAVTTGADSTVRVWDLATGQPLGQPLTGHLDEVLAVACTALDGRPVAVTTGADSTVRVWDLATGQPLGQPLTGHTANVLAVACTVFDGRTVAVTTSHDKTVRVWNLATGQPLGQPLTGHPNNVTAVTCTLLDSRPVAVTTSWDGTVRVWDLATGQPLGEPLTGHTRNMYAVACTELDGRPVAVTAGWDDDVWVWDLATGRPVGEPLTDHTGAVPGVACTELDGRPVAVTAAWDNNVRVWNLVTRQLLGKPLTGHTSNVNAVACTELNGRPVAVTGSADQTVRVWDLATGRPVGEPLADHTGAVLAVACTVLDGRPVAVTTGADSTVRVWDLATGQPLGKPLTDHTGTVLAVACTVLDGRTVAVTTSRDNTVRVWDLATQKAAATIPINSPGGVAITAAGDLIVSLHSDVAHYRRRLSQAGYPPRVDNPGE
>NC_016109.1|WP_193365920.1|2734531_2735404_+|hypothetical-protein
MARVVCVHGMGQQVQGEDRLRSVWFPALSDGLRRAEFEGLLSESDVAMGFYGDLFRPAGQLLAAGDPPYTAGDVEAGFEQELLAAWWQAAAETDPAVVAPDADGTLVATPRSVQAALRALSGSKFFANLALRAVVADLKQVRAYLTDQQVRERARERVMARIGPETRVVVAHSLGSVVAYEALCALPGHGVRALVTIGSPLGIPNLVVHRLQPAPGQEGKAVRGAWPGGEQLVWTNLAATGDVVALVKDLRPVFGERLRSAVLSNGTHAHDATSYLTDALCGKAIAEGLA
>NC_016109.1|WP_014135592.1|2733320_2734265_+|hypothetical-protein
MPEQHDLMTFFDREAQELTHEYERIRRTHQGDNGTAGDQGEENWATLLRGWLPAGYHVITKGALLSSNGSLFPTVEGKASPQIDIVILPPSYPVGMINKGRKVYLADAVVAAFECKLTLTGADLIKAARNAKTLRSMTRRLQDDPYHFLFGSPIYGVLAHSHTWAGAGSAMDKIDEYLQKGLDEIDLPHEMLDMACVSDVGTWTAWKLPLVGRPGEDWTTVSARIGRIHHSSRKDAEQINPLYSMMTTLLRRMAWADPTLRPIASYFEAVKGGGMGGPERVWDQSIYPKQLREQIRGSRDARQRQWEPWSTVLL
>NC_016109.1|WP_033259359.1|2749363_2750107_-|Tellurium-resistance
MVSVWEFLKGDRGDSFDTGGQFKVTLTKSQPHHAITGSAATTGYLYINLHWSTRSAERPSAASALRRFFDPRILRPLDTAAGGAAPVGVDLDLACMYELADGTRGVVQPLGRLFGDLNKPPYIKLSGDDVSGAPSGETMHINLEKKDQFKRLLVFVYIYDDTPAFDRTQAVLTIVPQSGPRIEIKLDERAPAARSCAVVLIENDGEGKLTIRREVRYVHGFQSDLDRLYGFGMQWERGYKSPSAPGN
>NC_016109.1|WP_014135604.1|2750323_2751478_+|DUF2637-domain-containing-protein
MNLSSIQLVWAVVGGAALLFTAILVAFLRFKNNRPDEASGDSWERSEERRRRKEAIYGGASYVLLFCCAGVAAALSFHGLVGFGQQNLNLSGGWEYLVPFGLDGAAMFCSVLAVREASHGDAALGSRMLVWLFAVASAWFNWVHAPRGGAHDGAPQFFAGMSISAAVLFDRALKQTRRAALREQGLVPRPLPQIRVVRWLRAPRETYAAWSLMLLENVRSLDEAVEEVREERQAKMDAKLRARSADRRERAEMKAIARQGGMLARARHARQVPALAAAGSDASSATEPALAPEETTLDRVGASALEPAALNAGRRPRAAVESTGSSASSSSSSHSSSYSSSDDSSPYGSSYSSSVDLTMDEDTLSMPKLDSLERKLRAIEQQLG
>NC_016109.1|WP_014135605.1|2751558_2752641_-|DUF475-domain-containing-protein
MFLRTFGWSFAITIAGLIAAGLIWGAEGFGVVLILSILEISLSFDNAVVNATVLKRMNAFWQKLFLTVGVLIAVFGMRLVFPLLVVGLTAHLSPGTVIELALDSSKTHDGHTYAEYLDLANPAIAAFGGIFLLMIFLDFIFEEKDFNWLRWLEKPLEKIGKLDALSSVVALVVLALSSRFFAGDRAETVLLAGICGLATYLAVNGLSEVFESGLEQQQEAEDAAERSGKSIVQVGGKAAFFLFIYLEVLDASFSFDGVVGAFAISQDIFQITLGLGIGAMYIRSLTVFLVRKGTLDDYVYLEHGAHYAIGALALILLASIKYHIPEIVTGLIGVAFIGAALATSIVRNKRHQEVPEAAEG
>NC_016109.1|WP_014135606.1|2752701_2753277_-|TerD-family-protein
MSVTLAKGGNVSLTKAAPNLTQVQIGLGWDARSTTGAPFDLDASALLCSGGRVASDEYFVFYNNLRSPEGSVEHQGDNLTGDGDGDDEVVQVHLDLVPVQIDKVVFAVSIYDADARLQSFGQVSNAYIRVVNLEDGSEIARYDLSEDASSETAMIFGELYRYQGEWKFRAVGQGYASGLRGIALDFGVNVQ
>NC_016109.1|WP_014135607.1|2753668_2756074_+|PQQ-binding-like-beta-propeller-repeat-protein
MPFEPLDRTDPESVGPYHLLARLGVGGMGRVYLARSAGGRTVAVKVVRADLAGDADFRERFRREVSAAQSVGGTFTAPVVDADRDGPSPWLATAYVLGPALDDAVRAHGPLPVGAVRTLGVGLAQALAAIHAAGLVHRDLKPSNVLLAADGPRVIDFGIARALDGDRMTSTGVVVGSPGFMSPEQAAGRRLGPAGDVFSLGSVLVYAATGHGPFDQAEDGGAPSAASLLYRVVHDRPDLSGLPEPLLAAVTACLAKDPGDRPTPAELGALLDEPVAPARAGWLPAALASEIATHAAEVMDLEAPVRPADPRAAAAVPTPTEVTAPAADPGTVRLRATDPAPAPVPAPDGAAALAGHPTALSGHPTAPVAPSRPSRRALLFGGGAVALAGAGGLAAWALGGGKPAPAPRPAPPTGTGTTSPSGPSPSPSPTPSRAPGMPPAPLWTYRTEASNVGSVGLAFSPGLLHIGNADLVTVDLTDGRQKWITKDAMAYHLACAGGTVSYGTVADLITVDAATGTVLWKYRSEPPKPNGVQIASDTVLAADDRAVYAMCAYLKLDDKGITDAGAKTEKGIMALSRKDGSMLWNQHRQQTADYTVSSVLTADTLLYTDSKENLVARSLADGTQSWFATTNSRSAYQPEVQDGLVFCSSEPNGIQGVRVSDGKQVWAKPSDRSTRMWYAAPAAGNHVLYTVLGGMTLTYQGTTYTPTAPTRVVAFNAADGTELWHLELPSEVSMDTNPVLVKDTLFVPTADRGIYAVDVVNHKVRWVFQTNAGAELPWHLAGNGELLIAVQGNQVMALPPV
>NC_016109.1|WP_014135608.1|2756138_2756714_-|TerD-family-protein
MGVSLSKGGNVSLTKEAPGLTAVVVGLGWDVRTTTGTDFDLDASALLCTEQGKVRSDADFIFFNNLKSADGSVEHTGDNLTGEGEGDDEQVKVDLANVPAEITKIVFPVSIYDAENRQQSFGQVRNAFIRVLNQAGGAEIARYDLSEDASTETAMVFGELYRNGAEWKFRAIGQGYASGLRGIAQDFGVNV
>NC_016109.1|WP_014135609.1|2756865_2757324_-|peroxiredoxin
MTVEIGTQAPDFELRDQHGESVKLSDFRGEKNVVLVFYPFAFTGVCTGEVCEIQKELPRLQNDEVQVLAVSNDAPFSLRVFGDQQGLEYPLLSDFWPHGEVSRAYGVFNEEKGCAVRGTFVIDKEGVVRWSVVNGLPDARDTKEYLAALGAL
>NC_016109.1|WP_014135610.1|2757550_2757988_-|DUF3052-domain-containing-protein
MSATADPADKSNPALRLGFEQGQIIQELGYDEDSDQDLREGIEELTGTELVDEDYDDVADGVLLWHRDEDGDLTDALVDALEYLAEGGLIWLLTPKTGRDGHVEAHEIADAAKTAGLSQTSSVAIAKDWAGTRLATPKATKAGKR
>NC_016109.1|WP_014135611.1|2758455_2761206_+|pyruvate-dehydrogenase-(acetyl-transferring),-homodimeric-type
MASGSDRNPIIIGGLPSQVPDFDPEETAEWLESLDAAIDERGRERARYLMLRLIERAREKRVAVPEMRSTDYVNTIATKDEPFFPGNEEIERKILNATRWNAAVMVSRAQRPGIGVGGHIATFASSASLYDVGFNYFFRGKDADGESGDQVFFQGHASPGIYARAFLLDRLTEQQLDAFRQEKSKAPFGLSSYPHPRLMPDFWEFPTVSMGLGPLGAIYQARMNRYLEHRGIKDTSDSQVYAFLGDGEMDEPESLGQLSLAAREGLDNLTFVVNCNLQRLDGPVRGNGKIIQELESQFRGAGWNVIKLVWDRSWDPLLAQDRDGVLVNKLNTTPDGQFQTYATETGAYIREHFFGGDLRLRAMVENMTDHQIQHLGRGGHDHRKVYAAFKAAREHKGQPTVILAQTVKGWTLGPNFEGRNATHQMKKLTVEDLKRFRDRLHLPITDKQLDEGYPPYYHPGRNSEEIQYMHDRREELGGYVPTRKVRPRKLELPGDDAYKAVKKGSGNQTIATTMAFVRVLKDLMRDKGIGNRFVPIAPDEYRTFGMDSLFPSAKIYNPLGQTYESVDRELLLAYKESPAGQMLHDGISEAGCTASLIAAGSSYATHGEPLIPVYVFYSMFGFQRTGDQFWQMADQLARGFVIGATAGRTTLTGEGLQHADGHSHLLASTNPGVVAYDPAYGYEIAHIMQDGLRRMYGSSAEHPHGEDVFYYVTVYNEPIKMPAEPENVDVDGILKGLYKLSDGTAGQIPAQLLASGVAVPWALEAQRILAEEWNVKADVWSATSWNELRRDAVAAEEFNLLHPEEPQRVPYVTAKLSGAEGPFVAVSDWMRAVPDQISRWVPGQYQSLGADGFGFADTRGAARRFFHIDAQSIVLGTLTELAKQGKIDRSALKDAIDRYQLLDVAAADPGSAGGEA
>NC_016109.1|WP_014135612.1|2761361_2762960_-|MFS-transporter
MSQSVVLDKEAAPAAGGRLRGHPWLTLLTVAVGVMMVALDGTVVAIANPAIAKDLNASPSDIQWVTSGYLLALAVFLITAGKIGDRFGHKTTFLVGAVGFAATSAAIGFAGSIQQVILFRVLQGLFGALLQPAALGLLRGAFPTDKLNMAIGIWGGVIGASTAAGPIVGGLLVEHVNWESVFYINVPVGLIALVLGLLVLKDVRAENAAKSFDIPGIVLLSGAMFMLVWGIIKAPSWGWGDPLTLLFLGGALLALVFFAVWQKYAKEPLIPLSLFRSVPLSAGTLLMVLMAFAFFGGIFFVTFYLQNVHGMAPVDAGVHLLPMTGMMIVGAPVAGFLIGKVGPRIPIVGGMLLTTAAMIGMSTLDIHSGNGVMSLWFLLMGLGLSPVMVGATDVIVGNAPLELSGVAGGLQQAAMQVGGSLGTAVLGAVMASKVTSELPGKWQAVTGGPLPAGEQGELLKQGAQLGIAPQAGDLGPAATPEFARGVADAVHSSFVSGMGVAFVVAAVVALAAAGLGLLTRRGVNETGPSVHI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_016109_6

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_016109_6

3238386-3238517

Orphan

Consensus_repeat	Method
GGTCAGCTCTCGCGCTGCTTGCGCCACCGGATGCCGGCCTCGATG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_016109_6

>merge|NC_016109|6|3238386-3238517|CRISPRCasFinder
GGTCAGCTCTCGCGCTGCTTGCGCCACCGGATGCCGGCCTCGATGCTGTGCTCGATCTTCATCTCAGCCGGCCTCCTCCTGCGGCGCGGTCAGCTCTCGCGCTGCTTGCGCCACCGGATGCCGGCTTCGATG

>NC_016109|6|6|3238386-3238517|CRISPRCasFinder
GGTCAGCTCTCGCGCTGCTTGCGCCACCGGATGCCGGCCTCGATG	CTGTGCTCGATCTTCATCTCAGCCGGCCTCCTCCTGCGGCGC
GGTCAGCTCTCGCGCTGCTTGCGCCACCGGATGCCGGCTTCGATG

Protein	Signature genes	Signature genes Name	Protein_function
NC_016109.1\|WP_014136012.1\|3237169_3237859_-\|cell-division-ATP-binding-protein-FtsE	unknown	unknown	gnl\|CDD\|225438
NC_016109.1\|WP_014136006.1\|3228724_3231025_-\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|226482
NC_016109.1\|WP_014136018.1\|3246070_3251008_-\|NAD-glutamate-dehydrogenase	unknown	unknown	gnl\|CDD\|377452
NC_016109.1\|WP_014136008.1\|3232463_3233834_-\|NarK/NasA-family-nitrate-transporter	unknown	unknown	gnl\|CDD\|225133
NC_016109.1\|WP_106437932.1\|3257187_3258378_-\|ATP-grasp-domain-containing-protein	unknown	unknown	gnl\|CDD\|235010
NC_016109.1\|WP_014136011.1\|3236252_3237158_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|225088
NC_016109.1\|WP_051055222.1\|3253000_3253609_-\|HAD-family-hydrolase	unknown	unknown	gnl\|CDD\|223620
NC_016109.1\|WP_014136016.1\|3241015_3242896_-\|serine/threonine-protein-kinase	unknown	unknown	gnl\|CDD\|270916
NC_016109.1\|WP_014136023.1\|3255897_3257157_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340863
NC_016109.1\|WP_014136013.1\|3238119_3238308_+\|hypothetical-protein	unknown	unknown	unknown
NC_016109.1\|WP_014136015.1\|3239612_3240863_-\|serine/threonine-protein-kinase	unknown	unknown	gnl\|CDD\|270916
NC_016109.1\|WP_014136004.1\|3226211_3226493_-\|HU-family-DNA-binding-protein	unknown	unknown	gnl\|CDD\|259859
NC_016109.1\|WP_014136022.1\|3254576_3255755_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|225371
NC_016109.1\|WP_014136021.1\|3253715_3254543_-\|aldo/keto-reductase	unknown	unknown	gnl\|CDD\|381357
NC_016109.1\|WP_051055220.1\|3235055_3236201_-\|PDZ-domain-containing-protein	unknown	unknown	gnl\|CDD\|223864
NC_016109.1\|WP_014136017.1\|3243249_3245979_+\|FHA-domain-containing-protein	unknown	unknown	gnl\|CDD\|274858
NC_016109.1\|WP_014136007.1\|3231128_3232289_-\|uroporphyrinogen-III-synthase	unknown	unknown	gnl\|CDD\|235981
NC_016109.1\|WP_014136005.1\|3226922_3228398_-\|NAD-dependent-malic-enzyme	unknown	unknown	gnl\|CDD\|223358
NC_016109.1\|WP_014136019.1\|3251300_3252917_-\|aldehyde-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|143441
NC_016109.1\|WP_014136009.1\|3234528_3235011_-\|SsrA-binding-protein-SmpB	unknown	unknown	gnl\|CDD\|376590

Protein	Function_ID	Function_description	E-value
NC_016109.1\|WP_014136012.1\|3237169_3237859_-\|cell-division-ATP-binding-protein-FtsE	gnl\|CDD\|225438	COG2884, FtsE, Predicted ATPase involved in cell division [Cell division and chromosome partitioning].	1.07162e-124
NC_016109.1\|WP_014136006.1\|3228724_3231025_-\|AAA-family-ATPase	gnl\|CDD\|226482	COG3973, COG3973, Superfamily I DNA and RNA helicases [General function prediction only].	7.24341e-61
NC_016109.1\|WP_051055222.1\|3253000_3253609_-\|HAD-family-hydrolase	gnl\|CDD\|223620	COG0546, Gph, Predicted phosphatases [General function prediction only].	1.31468e-19
NC_016109.1\|WP_014136008.1\|3232463_3233834_-\|NarK/NasA-family-nitrate-transporter	gnl\|CDD\|225133	COG2223, NarK, Nitrate/nitrite transporter [Inorganic ion transport and metabolism].	8.65538e-117
NC_016109.1\|WP_106437932.1\|3257187_3258378_-\|ATP-grasp-domain-containing-protein	gnl\|CDD\|235010	PRK02186, PRK02186, argininosuccinate lyase; Provisional.	1.3753e-24
NC_016109.1\|WP_014136011.1\|3236252_3237158_-\|ABC-transporter-permease	gnl\|CDD\|225088	COG2177, FtsX, Cell division protein [Cell division and chromosome partitioning].	6.06538e-54
NC_016109.1\|WP_014136009.1\|3234528_3235011_-\|SsrA-binding-protein-SmpB	gnl\|CDD\|376590	pfam01668, SmpB, SmpB protein.	7.6819e-85
NC_016109.1\|WP_014136023.1\|3255897_3257157_-\|MFS-transporter	gnl\|CDD\|340863	cd06173, MFS_MefA_like, Macrolide efflux protein A and similar proteins of the Major Facilitator Superfamily of transporters. This family is composed of Streptococcus pyogenes macrolide efflux protein A (MefA) and similar transporters, many of which remain uncharacterized. Some members may be multidrug resistance (MDR) transporters, which are drug/H+ antiporters (DHAs) that mediate the efflux of a variety of drugs and toxic compounds, conferring resistance to these compounds. MefA confers resistance to 14-membered macrolides including erythromycin and to 15-membered macrolides. It functions as an efflux pump to regulate intracellular macrolide levels. The MefA-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.14699e-57
NC_016109.1\|WP_014136017.1\|3243249_3245979_+\|FHA-domain-containing-protein	gnl\|CDD\|274858	TIGR03924, T7SS_EccC_a, type VII secretion protein EccCa. This model represents the N-terminal domain or EccCa subunit of the type VII secretion protein EccC as found in the Actinobacteria. Type VII secretion is defined more broadly as including secretion systems for ESAT-6-like proteins in the Firmicutes as well as in the Actinobacteria, but this family does not show close homologs in the Firmicutes. [Protein fate, Protein and peptide secretion and trafficking].	7.00612e-50
NC_016109.1\|WP_014136015.1\|3239612_3240863_-\|serine/threonine-protein-kinase	gnl\|CDD\|270916	cd14014, STKc_PknB_like, Catalytic domain of bacterial Serine/Threonine kinases, PknB and similar proteins. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This subfamily includes many bacterial eukaryotic-type STKs including Staphylococcus aureus PknB (also called PrkC or Stk1), Bacillus subtilis PrkC, and Mycobacterium tuberculosis Pkn proteins (PknB, PknD, PknE, PknF, PknL, and PknH), among others. S. aureus PknB is the only eukaryotic-type STK present in this species, although many microorganisms encode for several such proteins. It is important for the survival and pathogenesis of S. aureus as it is involved in the regulation of purine and pyrimidine biosynthesis, cell wall metabolism, autolysis, virulence, and antibiotic resistance. M. tuberculosis PknB is essential for growth and it acts on diverse substrates including proteins involved in peptidoglycan synthesis, cell division, transcription, stress responses, and metabolic regulation. B. subtilis PrkC is located at the inner membrane of endospores and functions to trigger spore germination. Bacterial STKs in this subfamily show varied domain architectures. The well-characterized members such as S. aureus and M. tuberculosis PknB, and B. subtilis PrkC, contain an N-terminal cytosolic kinase domain, a transmembrane (TM) segment, and mutliple C-terminal extracellular PASTA domains. The PknB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.	1.25395e-83
NC_016109.1\|WP_014136004.1\|3226211_3226493_-\|HU-family-DNA-binding-protein	gnl\|CDD\|259859	cd14435, SPO1_TF1_like, Bacteriophage SPO1-encoded TF1 binds and bends DNA. This group contains proteins related to bacillus phage SPO1-encoded transcription factor 1 (TF1), a type II DNA-binding protein related to the DNA sequence specific (IHF) and non-specific (HU) domains. Type II DNA-binding proteins bind and bend DNA as dimers. Like IHF, TF1 binds DNA specifically and bends DNA sharply. Bacteriophage SPO1-encoded TF1 recognizes SPO1 phage DNA containing 5-(hydroxymethyl)-2'-deoxyuridine as opposed to thymine, Related family members includes integration host factor (IHF) and HU, also called type II DNA-binding proteins (DNABII), which are small dimeric proteins that specifically bind the DNA minor groove, inducing large bends in the DNA and serving as architectural factors in a variety of cellular processes such as recombination, initiation of replication/transcription and gene regulation. IHF binds DNA in a sequence specific manner while HU displays little or no sequence preference. IHF homologs are usually heterodimers, while HU homologs are typically homodimers (except HU heterodimers from E. coli and other enterobacteria). HU is highly basic and contributes to chromosomal compaction and maintenance of negative supercoiling, thus often referred to as histone-like protein. IHF is an essential cofactor in phage lambda site-specific recombination, having an architectural role during assembly of specialized nucleoprotein structures (snups).	1.99619e-33
NC_016109.1\|WP_014136022.1\|3254576_3255755_-\|MFS-transporter	gnl\|CDD\|225371	COG2814, AraJ, Arabinose efflux permease [Carbohydrate transport and metabolism].	8.69832e-94
NC_016109.1\|WP_014136021.1\|3253715_3254543_-\|aldo/keto-reductase	gnl\|CDD\|381357	cd19131, AKR_AKR5C2, Escherichia coli 2,5-diketo-D-gluconic acid reductase A (DkgA/YqhE) and similar proteins. Escherichia coli DkgA/YqhE is a founding member of aldo-keto reductase family 5 member C2 (AKR5C2). DkgA/YqhE (EC 1.1.1.274), also called 2,5-DKG reductase A, or 2,5-DKGR A, or 25DKGR-A, or AKR5C, catalyzes the reduction of 2,5-diketo-D-gluconic acid (25DKG) to 2-keto-L-gulonic acid (2KLG). It is also capable of stereoselective -keto ester reductions on ethyl acetoacetate and other 2-substituted derivatives.	3.02317e-154
NC_016109.1\|WP_051055220.1\|3235055_3236201_-\|PDZ-domain-containing-protein	gnl\|CDD\|223864	COG0793, Prc, Periplasmic protease [Cell envelope biogenesis, outer membrane].	1.55867e-68
NC_016109.1\|WP_014136018.1\|3246070_3251008_-\|NAD-glutamate-dehydrogenase	gnl\|CDD\|377452	pfam05088, Bac_GDH, Bacterial NAD-glutamate dehydrogenase. This family consists of several bacterial proteins which are closely related to NAD-glutamate dehydrogenase found in Streptomyces clavuligerus. Glutamate dehydrogenases (GDHs) are a broadly distributed group of enzymes that catalyze the reversible oxidative deamination of glutamate to ketoglutarate and ammonia.	0
NC_016109.1\|WP_014136007.1\|3231128_3232289_-\|uroporphyrinogen-III-synthase	gnl\|CDD\|235981	PRK07239, PRK07239, bifunctional uroporphyrinogen-III synthetase/response regulator domain protein; Validated.	7.87441e-176
NC_016109.1\|WP_014136005.1\|3226922_3228398_-\|NAD-dependent-malic-enzyme	gnl\|CDD\|223358	COG0281, SfcA, Malic enzyme [Energy production and conversion].	1.24397e-171
NC_016109.1\|WP_014136019.1\|3251300_3252917_-\|aldehyde-dehydrogenase-family-protein	gnl\|CDD\|143441	cd07123, ALDH_F4-17_P5CDH, Delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH families 4 and 17. Delta(1)-pyrroline-5-carboxylate dehydrogenase (EC=1.5.1.12 ), families 4 and 17: a proline catabolic enzyme of the aldehyde dehydrogenase (ALDH) protein superfamily. Delta(1)-pyrroline-5-carboxylate dehydrogenase (P5CDH), also known as ALDH4A1 in humans, is a mitochondrial homodimer involved in proline degradation and catalyzes the NAD + -dependent conversion of P5C to glutamate. This is a necessary step in the pathway interconnecting the urea and tricarboxylic acid cycles. The preferred substrate is glutamic gamma-semialdehyde, other substrates include succinic, glutaric and adipic semialdehydes. Also included in this CD is the Aldh17 Drosophila melanogaster (Q9VUC0) P5CDH and similar sequences.	1.28027e-168
NC_016109.1\|WP_014136016.1\|3241015_3242896_-\|serine/threonine-protein-kinase	gnl\|CDD\|270916	cd14014, STKc_PknB_like, Catalytic domain of bacterial Serine/Threonine kinases, PknB and similar proteins. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This subfamily includes many bacterial eukaryotic-type STKs including Staphylococcus aureus PknB (also called PrkC or Stk1), Bacillus subtilis PrkC, and Mycobacterium tuberculosis Pkn proteins (PknB, PknD, PknE, PknF, PknL, and PknH), among others. S. aureus PknB is the only eukaryotic-type STK present in this species, although many microorganisms encode for several such proteins. It is important for the survival and pathogenesis of S. aureus as it is involved in the regulation of purine and pyrimidine biosynthesis, cell wall metabolism, autolysis, virulence, and antibiotic resistance. M. tuberculosis PknB is essential for growth and it acts on diverse substrates including proteins involved in peptidoglycan synthesis, cell division, transcription, stress responses, and metabolic regulation. B. subtilis PrkC is located at the inner membrane of endospores and functions to trigger spore germination. Bacterial STKs in this subfamily show varied domain architectures. The well-characterized members such as S. aureus and M. tuberculosis PknB, and B. subtilis PrkC, contain an N-terminal cytosolic kinase domain, a transmembrane (TM) segment, and mutliple C-terminal extracellular PASTA domains. The PknB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.	5.11827e-96

>NC_016109.1|WP_014136013.1|3238119_3238308_+|hypothetical-protein
MTCDQLVCANCNGRVSDGRCPVCRANRARLQQEQHGPFATLNPAVLLALLSAAVFTLALLLR
>NC_016109.1|WP_014136012.1|3237169_3237859_-|cell-division-ATP-binding-protein-FtsE
MIRFDNVSKTYPKQNRPALDNVSLEIEKGEFVFLVGSSGSGKSTFLRLCLREERPSTGAVHVLGKDLGKLSNWKVPHMRRQLGTVFQDFRLLPNKTVGQNVAFALEVIGKPKSAINKVVPEVLDLVGLGGKESRMPGELSGGEQQRVAIARAFVNRPMLLIADEPTGNLDPQNSVGIMKLLDRINRTGTTVLMATHDQAIVDQMRKRVIELDKGLLVRDQARGVYGYQS
>NC_016109.1|WP_014136011.1|3236252_3237158_-|ABC-transporter-permease
MRAQFVLSEIGVGLRRNLTMTIAVVVSVALSLALAGASLLVRDQVNSMKDYWYDKVEVSIYFCTKADHTSPQCAAGAATDDQVAQVKTDLAKMALVQTYTFESSSEAYQHFKQSNPDNPLLAAVGPEAMPQSWRVKLNDPTKFDVVQSAFAGKPGVKSVEDQRKILENLFGLLRGLQTAAFVIMVLMLFVALLLIVNTVRVSAFSRRRETGIMRLVGASNFYVQMPFIAEAAFAALLGSALASGLLLGGHFFVQHWLAKKVAFITFIGLSSVLAVIPLLIVVGMLMAGIAAFFTLRKYLKV
>NC_016109.1|WP_051055220.1|3235055_3236201_-|PDZ-domain-containing-protein
MPTAPRVRQGMTLGLVFGAVLFAGAASGAWGEPEGSPRAPSSSDAHPLGPDPAGADLTPQQARQLVGSSGDRWAAYLSPQQYADLTGGRYAGVGLSVDREAGGPTTVAEVLPGSPAARAGIAPGERLVSVDGTPAEQLPVTELVSRLRGGPAGSAVAVGVRDEAGPVRQLTLTRTELAAREVESDRPAPGVARIAVHAFTEGVADQVRAAAAGARGVVLDLRGNSGGLVAEAVATASVFLDGGPVASYQERGEHRRLDAAPGGDTAVPLVVLVDGGTMSAAELLAGALQDRSRAVLVGSRTFGKGTVQQPSRLADGSVLELTVGRYQTPAGRSPDGTGFQPDVPAAGEDPGALALRVLEGLSAPAAPAAAPAATPAAPAAR
>NC_016109.1|WP_014136009.1|3234528_3235011_-|SsrA-binding-protein-SmpB
MAKETGKKLVAQNKKARHEYTILDTYECGMVLTGTEVKSLREGRANLVDGYAYVQGGEAWIDNVFIPEYAQGTWTNHSARRKRKLLLHKMEIRKIESKVKETGHTLVPLSLYFKDGRAKLELALAVGKKLYDKRQTLRERQDRRESDRAVAAARRRSGQG
>NC_016109.1|WP_014136008.1|3232463_3233834_-|NarK/NasA-family-nitrate-transporter
MDGTTTNGRTGGRWIQQWDPEDPAFWEATGRRVARRNLAFSVLSEHIGFSIWSLWSVMVLFMGKEYGIDPAGKFFLVAMPTLVGSFVRIPYTVAVARFGGRNWTVVSALLLILPALAAAYVMRPGTSYTAFMLVAALTGLGGGNFASSMTNINAFYPARHKGWALGLNAGGGNIGVPVIQLVALGVIAGAGAGHPRLVLAVYLPLIVVAAACAALFMDNLAPVRADTGSLAAVAREKHTWLMSVLYVGTFGSFIGFSFAFGLVLQNQFGRTPLQAAQLTFLGPLLGSVVRPLGGKLADRFGGARITLWNFAAMAAAASVVTYASSIRSLPVFLTGFVALFALAGLGNGSTYKMIPGIFDAKAQDRIAAGATAEEAAAWSRRMSGAAIGVIGAVGALGGLFINLAFRESFLVAKSGTPAFVSFLAAYAVCSALTWAVYLRRPAGAADTADTPALAQV
>NC_016109.1|WP_014136007.1|3231128_3232289_-|uroporphyrinogen-III-synthase
MADPTRRPQDEPEPAEPEPAETGPLAGWTIGVTAARRAEELAALLQRRGAGVLRAPALRIVPLADDTDLHGATRALIADPPDLAVATTGIGFRGWLEAADGWDLGDGLRAALGRASVLARGPKAKGAIRAAGLRESYSAATESSAEVLSHLLEEGVDGLRIAVQLHGAPLPGFVESLRTAGADVVEVPVYRWLPPADLGPLDRLLDATCAGALDAVTFTSAPAAISLLDRAARRGRTGELLHALRRDVLAVCVGPVTSAPLDALDVPTVWPERMRLGAMVQTLTAALPARARRLPVAGHTLELRGQAALVDGRLRPVPPAGMALLRTLARHPGWVVPRADLLRALPGSGDDEHAVETAMARLRQALGAPRLITTVVKRGYRLTLDH
>NC_016109.1|WP_014136006.1|3228724_3231025_-|AAA-family-ATPase
MGAHGSAEHRSDTVRDREIAGEQCHLDTVYRRLEEKLAEAEYILEDAAKRVQVGTPGALAERDAQVYRAGAHLQRLNNEFEDFLFGRIDLQRADAPEEHGIPSQTPMDPADPVVAESLHIGRLGVLDAEFGPLVIDWRAPAAAPFYRATPLEPGRVLRRRVIRSKGRKVIGVEDDLLRPDLTPVLGGEELPVVGDGALMATLGRARGHSMRDIVSSIQREQDEVIRAAAAGATLVTGGPGTGKTAVALHRAAFLLYQDRRRYAGGILVVSPTALLVSYTEGVLPALGEEGQVAIRAVGSLVDGVEASRYDSPEVSRIKGSARMVQLLRRAARAALELGAPTELRVFARGRALRLDAGRLKAVRGNVVGGGGTPLNLLRPRARRLLLDALWSEAVRDLPKPGTYAEREQRQEERESFDEYVSDEAPFLDFLDAWWPAVTPRRVLATLRQHRHTNRIARRAVTPEEARLLAASWRHLDERGAGGLSAHDVALLDELQVLLGEPARSKVREVDAVDLLTGLDEVTTYGERAYRQRERERVAEERREYAHVIVDEAQDLTPMQWRMIGRRSRMATWTIVGDPAQSSWPFPAEAQAAMDEVLAGKPRRRHTLTVNYRNPAEIAEVAAKVLELAAPGTPSPSAVRSTGAHPRFAAVREPDPAAFAAAARAELERLLGEVDGTVAVVVPMDRRAEAAGWTAGLGERVVALGSLEAKGLEYDATVVADPTGIAGESEAGLRVLYVALTRATQRLTVLSGPDDLPDAAGVPALLK
>NC_016109.1|WP_014136005.1|3226922_3228398_-|NAD-dependent-malic-enzyme
MATVPSVSNSITVRLEVPATGNAVSSITTAVESSGGSVTGLDVTASGLEALRIDVTVAASSVAHGEEIVEKLRTIDGVSIGKVSDRTFLMHLGGKIEMSSKLPIRNRDDLSMIYTPGVARVCMAIAENPDDARRLTIKRNSVAVVTDGSAVLGLGNIGPKAALPVMEGKAALFKRFAGIDAWPLCLDTQDADEIVAIVKAIAPGFAGINLEDISAPRCFEIEARLREALDIPVFHDDQHGTAIVVLAALTNALKVVGKEIGEIRVVMSGAGAAGTAILKLLMAAGVSHATVADVRGVVHEGRDDLNDSLRWIAENTNRSGRTGTLKEAVADADVFIGVSAPNVLDGDDLATMAKDAVVFALANPDPEVDPAVARQTAAVVATGRSDFPNQINNVLVFPGVFRGLLDAQSASVDTEMMLAAARALATTVTDDELNPNYIIPSVFHPNVAKTVAAAVREAAVAARGGAEAGPETPTRGIVGTLDTGAFPAVRL
>NC_016109.1|WP_014136004.1|3226211_3226493_-|HU-family-DNA-binding-protein
MNRSELVAALAERAEVTRKDADAVLAAFAEITGEVVAKGDEKVTIPGFLTFERTLRAARTARNPQTGEPIQIAEGFSVKVSAGSKLKEAAKGK
>NC_016109.1|WP_014136015.1|3239612_3240863_-|serine/threonine-protein-kinase
MARKIGSRYTVHQVIGRGSAGTVWLGEGPDGPVAVKLLREDLAADQVLVGRFVQERAALTGLDHPHVVGVHDMVVDGSDLALVMDLVQGSDLRTRLERDGVLSPLLAASVIADVADGLAAAHAAGIVHRDVKPENVLLDLAAPPGPGGAPRAKLTDFGIARLVDAPRRTRATRIIGTPDYLAPEIIEGLEPRAAVDIYATATVLYELLTGATPFGGGHTGAVLRRHVTENVPPVEGMPDGLWRIISECLAKAPASRLRAAELAARLRALLPELAGLGPLAVPEQRTAAEEVPTPGEAVYAEADAPAGGAHRRRRGPAVALVPGPQPDSTRDTHTSLRRPSAQELASYAEESRAQRERPAAGHRRTRAQMIRRRRTLAVLIAVVLLLAGAAAAWTAFAAEPPGKPAETVHAPWHPRL
>NC_016109.1|WP_014136016.1|3241015_3242896_-|serine/threonine-protein-kinase
MRPVGSKYVLEDSLGRGATGTVWRGRVREDAAVPGLVPGQAVAVKVLREELAADPDVVMRFLRERSVLLRLTHPNIVRTRDLVVEGELLALVMDLVDGPDLYRYLRESGPLSPIAGALLMAQIADALAASHADGVVHRDLKPANVLLATLAVDGDERMHPMLTDFGIARLADSPGITRTHEFVGTPVYVAPESAEGRPQTAAVDVYGAGIMLYELVTGRPPFQGDNPLAVLQAHLAQEPQRPRTMPEPLWTVVERCLRKDPAQRPTAVSLARALRVVAAGVGVHAAPAAVDAALAVGDLLLPDPALATAAAAGPGAGPHEATLAGVGYDPAAATQVMAHQTGAPATPGAPGAEDRTQLMSPQPPAGPPADRTRVMPSVPPGAPAQQPPGQQPPAQPEGPHPWQTQLRAARDRNAQTRIGSFEPDELGEPQVAPRPYQAGQYPQQGRQGQYGQQQPRPYPPQDGRYAPQQGPYRPQQPQQGRPQYPQPGQGQYPQQGQGQGGRPPVAPPPYQAQQPPQPAPPAAYSGQPQGYGAPQRRPEPAPQHRPEPPYREPEPAREAPREREPRRRSPNRMRIPGLGCLKGCLLVLVVLALGCLALWNFTPLPHYWDNVVGWYDSARDWVTSHT
>NC_016109.1|WP_014136017.1|3243249_3245979_+|FHA-domain-containing-protein
MQIRLTVLRPRGGPASPGSSGATDVLVTAPPGTVLGAVATALAGAVGVRGARSATHVHLYDGERRLDEQTPLGHPPLVDGAVLALGEPDPDAEGGDGPAAAELRVVGGPDAGGVHRLHGERIRIGRSTEADVPLDDPDVSRLHLALHLAADGRATVRDLGSTNGTRLDEQWLREDAADLAPGALLRIGESTLQLAPATDPGIAARPTAPDGEGRIRLAPRTGARAALGRPAAPPAAPEPDPQPAAGRGGRWLRRGKAEPPADDPGRQHDGARLRQAAHQRERWPDPAALLLTALGTGPRLWERGPDHPDALTLRLGTADLPGGAGTAPGSLLPAVPVTVDLQTAGSLGLTGPRHRLAGLARAVLAQLATLHPPSGLALVVVAADAPAGDWAWAQWLPHLRPAHGQGCRLLFGLGPEQAEARLAELAAATAGPPATVVLVDGDPGTEAGRHALGLLLRQGPAAGVFTLCLAETPEELPTGIGALGQVTGEVSTRLTLDRPTAGARERLTDVALDAVSPAWAERLARTLAPLAEADSASAAGAPPRGPLPEALRLLDLLRAESLSPARLAENWQSLPAGAGAAAGLLGTARGADGEEDCAVDLAEDGDHLLIGGGPGSGKSELLRSLAASLAVAERPDRLALITVDGDHAEDGGLAGCADLPHVTAHVNAAEDPRGALLAAERITDELAHREALFDGLTFTEWHTGRALAKTPALVGGPAADPAGRVRVVEPRRSPDAPPADAAPPRLVVLVDDYDALLGPASPGGRPLARALASVAVHGARLGVHVIATTGSPEGTAGTELDEAAQLRIALRTELPGDSDLLVHLPDAAALPGATPGRGYLRRPDGAVTAFQGARVSGRIPRTATLRPTVVAQRLEDHGAAPSPRPVRELGNGPTDLALLASALRRATES
>NC_016109.1|WP_014136018.1|3246070_3251008_-|NAD-glutamate-dehydrogenase
MQTKLDAAKADLLRKAAAAAENSQVGGAAPGEGLSNGALAAYLHHYYLHTAPEDLISRDPVDVYGAAASHYRLGLKRPQGTAEVRVYTPTVEENGWSCGHTVVEVVTDDMPFLVDSVTNELTRLDRAIHLVVHPQLAVRRDITGKLLEILDVDACNRAQAAGTDWPADAVVESWMHIEIDRETDREDLRMLEAGLRRVLGDVREVVEDWSKMRDSALRLADELAEEPPAHLPEQEVGEAWELMRWLADDHFTFLGYREYDLVEHEGEEVLKAVAGTGLGVLRADPLSHDTDHHPVSEAFGRLSAPVRAKAHEKKLLVLTKANSRATVHRTAYLDYVGVKKFDAAGEPVGERRFLGLFSSAAYTESVTRIPVVRRKVQEVMTGAGFSGDSHDGRDLLQIMETFPRDEMFQTAAAELQSIATSVLYLQERRRLRLFLRQDEYGRYYSAYVYLPRDRYTTRIRLALTEILKTELGGDTIDYTVYATESVLTRLHFVIRVAPGTELPQLTDSDIERIENRLAEAARFWMDGFNDQLGTEFGEERAAELSHKYATAFPDGYRADFPPRTAVADLKQIESLSGEGDFRLNLYQPVGAGDDERRFKIYRVGGPISLTEVLPVLQRLGVEVLDEHPYALRRTDGSTAWVVDFGLRLREGTDLTEEDRERFQDTFSATWRGEAENDGFNGLVLTAKLTWRQAVVLRAYAKYLRQAGSTFSQDYMEDALRNNTHTTRLLVNLFEARLSPSHRSGSEELTEGILEELSGALDEVVSLDEDRILRSFLHLIKATLRTNFFQHDAEGHRHSYVSMKFDPQAIPDLPAPRPAFEIWVYSPSVEGVHLRFGKVARGGLRWSDRREDFRTEILGLVKAQMVKNTVIVPVGAKGGFVAKQLPDPSVDRDAWLAEGIASYKTFISALLDITDNLVAGEVVHPVDVVRHDEDDTYLVVAADKGTATFSDIANGVAQQYGFWLGDAFASGGSAGYDHKGMGITARGAWESVKRNFRELGVDTQSEDFTVIGIGDMSGDVFGNGMLLSEHIRLVAAFDHRHIFLDPNPDAAASFAERRRLFDLPRSSWDDYDKSLISAGGGVYPRSAKSIQLSAQVRERLGVDAAKLTPAELMKAILQAPVDLFWNGGIGTYVKSSAETNAEVGDKANDAIRVNGGDVRARVIGEGGNLGCTQLGRIEFAASGGPQGAGGWIDTDAIDNSAGVDTSDHEVNIKILLNQVVADGDLTLKQRNALLAEMTDEVGHLVLRNNYAQNVVLANAVAQAASMVDVHSRMINRLEADGRLDRALEYLPTEKQIRDRQQAGRGLSQPELSVLLAYTKITLADELLATELPDDPYFRDVLHQYFPSALRARFAEQIDHHPLRREIITTLIVNDTINRGGCTFAFRLREETGATMEEVARTHAAARAVFGLEQIWDQVERLDNRVAARVQTKMRLHARRLVERATRWMLNNRQPLDIADTIAFFHDRVHQVWDALPKPLTGEDLAWFESVHQELAAAGVPDELATRIAGLSSAFPTLDIVGVADRSDTDVMEVAELYYDLGDRLQISHLLDRVIDLPRTDRWSSMARAAIREDLFAAHAALTADVLAAGPAGSSPEERYSAWAALNGTLLSRARTTLDDIRGSDKYELSSLSVAMRVIRTLLRNGR
>NC_016109.1|WP_014136019.1|3251300_3252917_-|aldehyde-dehydrogenase-family-protein
MPTEDDPAADPQPAPGSAPAPEPALGYAPGSAERARLAARLAERAGAPPVSLAAVIGGERRLGGGVRVEVVRPDRRASVLGVLGEATADDARAAVDAALAAADGWRRLPAEERAAVFLRAADLLAGPWRETLVAATMLGQSKSVRQAETDACALADAWRQDAHAAGRLLAGRSRPVPGGRVRAEHRPLDGFVCALTPFHSTAAAGSLSGTPALLGNTVVWRPAPAQTPAAHLTLLLLEEAGLPPGVVNLLPGDGPAATGALLRDPALAGAHFAGPAAGLRRLWREVGANIARYRGHPRIAGTADAPGFLLAHPSADPAAVRTALIRGAFEHQGQGRSALSRAYLPEGLWRRVRDDLLGEVDELPVGDVTDPGTFLGALVDAPAYARAVGAIERAKADPGVVAAAGGQYDDAIGWFVRPTVLLGAAGEDAAGRAGRYADLPGPVLAVRVYGDGHWEEALERAAREAPGGGAVFARDRRAIAVAVARSGFGTGDLRVNGDPSAAPAPPRDPAHWTAARTVRETFIPPTDYVHPHMEWSPE
>NC_016109.1|WP_051055222.1|3253000_3253609_-|HAD-family-hydrolase
MAAVVGASNAAFATVGLAPITLEEYRAHYEIPIPRFYERLMGRVPTAGEWTVLDDAFDAKYSELFPDCGLTPGVEGLLAGWNEAGRSQSVLSMYGHDKLVPAVDAFGITRYFTRVDGRRGESGGRKAGHLALHLDALGAGIDRGRTVLIGDAADDAEAALSSGIKSVLYTGGSHTREKLVHLGVPVVDSLAEAVAVAEELTR
>NC_016109.1|WP_014136021.1|3253715_3254543_-|aldo/keto-reductase
MSTTVPTVTLNNGVQMPQLGFGVFQVPDEQTTAAVTAALEAGYRSIDTAAVYGNERGVGKALAASGLPREELFVTTKLWNADQGYDATLRAYDASLDKLGLEYADLYLIHWPTPARDLYAESWRAIEKLVADGRLRAAGVSNFQPAHLTRLIEAGGLVPAVNQVELHPGLQQAEVRAFDAAHGIATEAWSPLAQGAVLDDPAITAAAARTGRSPAQVVLRWHLQLGNVVIPKSVTPARIRQNLDVLDFTLTDAEMAAIAAGDRGLRTGPDPDQFN
>NC_016109.1|WP_014136022.1|3254576_3255755_-|MFS-transporter
MTLALLALAIGAFGIGTTEFVIMGLLPEVAADFGVGIPTAGLLVTGYAVGVVVGAPLMTVLGTRISRKRMLMLLMVLFTAGNLLSALAPGFGAMLAGRIVASLAHGAFFGIGSVVAAELVAPDKKAGAIATMFTGLTVANIVGVPLGTFVGEQVGWRATFAAVAALGVVGLLGIARLVPELPRPEGAHLRRELAAFKNAQVVLAMGMTVLGFGGVFAAITYIKPMMTEVAGFSAGAVTWLLVLLGLGMFLGNLLGGRFADRRLMPMLFTTLGGLTAVLALFTVTAHNRVTAAATLLLIGALGFATVPPLQKRVLDQAHGAPTLASAVNIGAFNLGNALAAWLGGAVISAGLGYTAPNWVGALLAGSALVLALVSAALERRAPALARTPVPAH
>NC_016109.1|WP_014136023.1|3255897_3257157_-|MFS-transporter
MTTTAAGPERREDAPAASAFGVRAFRQVFAASAASTLGTQISYLAVPLLAVTVLDASPGQVSALAALGTAAFLLIGLPAGAWTDRMRKRRLQITADLVRALLFGSVPVAWALDALTIGQLYAVVLLSGLATVFFDVANQSFLPHVVGRELLGEANAKLVGMQAVNQVAGRSAGGYLVQLLGAPLAVALNAVTYLWSALCLLRVRASEPKPERRPDTHLGREILEGTRFVLGHPMLRPLALDGALTNMALQMIVTVLPVLFVRELGLSEFAFGTFLAMAGLGVFLGSLAARRLGRRLGAGRSMWLVGLCVAPAGFVLPLLDRGPMLWAAGAAYLLMTFKVGTDNVVKVTFRQQATPAHLLGRMNATFRFLLTGSLAIGSVLSGVLAETVGIRAVLWTGAAVLSLSWTVVFCSPHRRAGAP
>NC_016109.1|WP_106437932.1|3257187_3258378_-|ATP-grasp-domain-containing-protein
MGIDVVLVHEEGLYEPSIAAHCERIVHAPITDGAAILEVLRPLHAQRPFDRVLTTSEPAGVAVGRVVDALGLTGVGEDTARTLKDKALTRRALDRHGLSPVLHRVVDGPDAALAFLAEVGGPIVLKPVDGAASRHVHRAEDAAGVADAWRAMAADGLTVALAEEYLEGPVVSVDSFSHAGRHLPIGCSEYQVNERHVEWAVSTPSRVAAPHWDALRELTVRLLDAVGLVEGPSHSEFVLTPKGPRVLESHARLGGHALPELVRRAYGPDLARMMLTVPLGLEELPAAPPEPVGGAAIRFFTPTPGVIREVAVDPDNPALVKRLAPGELEGVYLPLLAELAALEIGAVVAKNPGDTVPPLNTLADCSSGYVLASGRDAADAEALCLETEQKIHFRTA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_016109_7

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_016109_7

4788771-4788866

Orphan

Consensus_repeat	Method
TTCGACGGCCCGCAGGTCACGACC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_016109_7

>merge|NC_016109|7|4788771-4788866|CRISPRCasFinder
TTCGACGGCCCGCAGGTCACGACCCAGCCGCACCTGCTCACCCCGGACGAGGCGGCGCGCGTCCCGGGCCCGTTCGACGGCCCGCAGGTCACCACC

>NC_016109|7|7|4788771-4788866|CRISPRCasFinder
TTCGACGGCCCGCAGGTCACGACC	CAGCCGCACCTGCTCACCCCGGACGAGGCGGCGCGCGTCCCGGGCCCG
TTCGACGGCCCGCAGGTCACCACC

Protein	Signature genes	Signature genes Name	Protein_function
NC_016109.1\|WP_148283139.1\|4775815_4776262_+\|hypothetical-protein	unknown	unknown	unknown
NC_016109.1\|WP_014137416.1\|4791829_4792198_+\|hypothetical-protein	unknown	unknown	unknown
NC_016109.1\|WP_081539542.1\|4794734_4795985_+\|SpoIIE-family-protein-phosphatase	unknown	unknown	gnl\|CDD\|369272
NC_016109.1\|WP_033260167.1\|4793111_4794449_+\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|224172
NC_016109.1\|WP_081539540.1\|4786695_4787490_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|366102
NC_016109.1\|WP_051055301.1\|4774272_4775532_-\|PrsW-family-intramembrane-metalloprotease	unknown	unknown	gnl\|CDD\|379143
NC_016109.1\|WP_051055306.1\|4789129_4790947_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|283837
NC_016109.1\|WP_014137414.1\|4790943_4791519_+\|hypothetical-protein	unknown	unknown	unknown
NC_016109.1\|WP_014137407.1\|4780611_4782714_+\|hypothetical-protein	unknown	unknown	unknown
NC_016109.1\|WP_014137417.1\|4792322_4792895_+\|hypothetical-protein	unknown	unknown	unknown
NC_016109.1\|WP_014137415.1\|4791683_4791827_+\|hypothetical-protein	unknown	unknown	unknown
NC_016109.1\|WP_014137408.1\|4782850_4783363_+\|universal-stress-protein	unknown	unknown	gnl\|CDD\|366180
NC_016109.1\|WP_014137420.1\|4801907_4802828_+\|mycothiol-synthase	unknown	unknown	gnl\|CDD\|132489
NC_016109.1\|WP_014137409.1\|4783454_4784150_+\|DsbA-family-oxidoreductase	unknown	unknown	gnl\|CDD\|239322
NC_016109.1\|WP_014137406.1\|4778532_4779948_-\|hypothetical-protein	unknown	unknown	unknown
NC_016109.1\|WP_081539538.1\|4784225_4786376_-\|sigma-70-family-RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|224511
NC_016109.1\|WP_081539891.1\|4776281_4777034_-\|tRNA-(guanosine(46)-N7)-methyltransferase-TrmB	unknown	unknown	gnl\|CDD\|234649
NC_016109.1\|WP_014137405.1\|4777217_4778450_-\|L-2-hydroxyglutarate-oxidase	unknown	unknown	gnl\|CDD\|183292
NC_016109.1\|WP_106437990.1\|4803437_4805582_+\|RNA-degradosome-polyphosphate-kinase	unknown	unknown	gnl\|CDD\|235469
NC_016109.1\|WP_014137422.1\|4805673_4806753_+\|CHAD-domain-containing-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NC_016109.1\|WP_081539542.1\|4794734_4795985_+\|SpoIIE-family-protein-phosphatase	gnl\|CDD\|369272	pfam07228, SpoIIE, Stage II sporulation protein E (SpoIIE). This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.	1.08588e-46
NC_016109.1\|WP_033260167.1\|4793111_4794449_+\|FAD-dependent-oxidoreductase	gnl\|CDD\|224172	COG1252, Ndh, NADH dehydrogenase, FAD-containing subunit [Energy production and conversion].	1.32687e-88
NC_016109.1\|WP_081539540.1\|4786695_4787490_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|366102	pfam00440, TetR_N, Bacterial regulatory proteins, tetR family.	1.11919e-10
NC_016109.1\|WP_051055301.1\|4774272_4775532_-\|PrsW-family-intramembrane-metalloprotease	gnl\|CDD\|379143	pfam13367, PrsW-protease, Protease prsW family. This is a family of putative peptidases, possibly belonging to the MEROPS M79 family. PrsW, appears to be a member of a widespread family of membrane proteins that includes at least one previously known protease. PrsW appears to be responsible for Site-1 cleavage of the RsiW anti-sigma factor, the cognate anti-sigma factor, and it senses antimicrobial peptides that damage the cell membrane and other agents that cause cell envelope stress, The three acidic residues, E75, E76 and E95 in Aflv_1074, appear to be crucial since their mutation to alanine renders the protein inactive. Based on predictions of the bioinformatics programme TMHMM it is likely that these residues are located on the extracytoplasmic face of PrsW placing them in a position to act as a sensor for cell envelope stress.	2.17719e-34
NC_016109.1\|WP_014137405.1\|4777217_4778450_-\|L-2-hydroxyglutarate-oxidase	gnl\|CDD\|183292	PRK11728, PRK11728, L-2-hydroxyglutarate oxidase.	0
NC_016109.1\|WP_014137408.1\|4782850_4783363_+\|universal-stress-protein	gnl\|CDD\|366180	pfam00582, Usp, Universal stress protein family. The universal stress protein UspA is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. UspA enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae UspA reveals an alpha/beta fold similar to that of the Methanococcus jannaschii MJ0577 protein, which binds ATP, though UspA lacks ATP-binding activity.	1.60306e-22
NC_016109.1\|WP_014137420.1\|4801907_4802828_+\|mycothiol-synthase	gnl\|CDD\|132489	TIGR03448, mycothiol_MshD, mycothiol synthase. Members of this family are MshD, the acetyltransferase that catalyzes the final step of mycothiol biosynthesis in various members of the Actinomyctes, Mycothiol replaces glutathione in these species. [Biosynthesis of cofactors, prosthetic groups, and carriers, Glutathione and analogs].	3.56321e-109
NC_016109.1\|WP_014137409.1\|4783454_4784150_+\|DsbA-family-oxidoreductase	gnl\|CDD\|239322	cd03024, DsbA_FrnE, DsbA family, FrnE subfamily; FrnE is a DsbA-like protein containing a CXXC motif. It is presumed to be a thiol oxidoreductase involved in polyketide biosynthesis, specifically in the production of the aromatic antibiotics frenolicin and nanaomycins.	2.65272e-80
NC_016109.1\|WP_081539538.1\|4784225_4786376_-\|sigma-70-family-RNA-polymerase-sigma-factor	gnl\|CDD\|224511	COG1595, RpoE, DNA-directed RNA polymerase specialized sigma subunit, sigma24 homolog [Transcription].	1.45537e-22
NC_016109.1\|WP_081539891.1\|4776281_4777034_-\|tRNA-(guanosine(46)-N7)-methyltransferase-TrmB	gnl\|CDD\|234649	PRK00121, trmB, tRNA (guanine-N(7)-)-methyltransferase; Reviewed.	1.26529e-76
NC_016109.1\|WP_051055306.1\|4789129_4790947_+\|hypothetical-protein	gnl\|CDD\|283837	pfam06259, Abhydrolase_8, Alpha/beta hydrolase. Members of this family are predicted to have an alpha/beta hydrolase fold. They contain a predicted Ser-His-Asp catalytic triad, in which the serine is likely to act as a nucleophile.	3.37834e-33
NC_016109.1\|WP_106437990.1\|4803437_4805582_+\|RNA-degradosome-polyphosphate-kinase	gnl\|CDD\|235469	PRK05443, PRK05443, polyphosphate kinase; Provisional.	0

>NC_016109.1|WP_081539540.1|4786695_4787490_-|TetR/AcrR-family-transcriptional-regulator
MAEQDQLAGRAPATGFGRTAVDVVPEQRGPDGRERYAFPSGEQQAEGGRGANSRLRVDARRNLESVLRAAREVFGELGYGAPMEEVARRAGVGVGTVYRRFPSKEVLVQRIAAEEVSWLTAQARESLYGGLTGPWDALAGFLQRAAASGAGRLLPPEAFRYAEEIGRVPEQRGTELRAFGGAPVAEGEQGADPRLLLQLLAALVARAGAAGELRPGVSVADVVLVLTAAVPVHASAAVPVREGDPEGGAGHRLLQILLQGLRAA
>NC_016109.1|WP_081539538.1|4784225_4786376_-|sigma-70-family-RNA-polymerase-sigma-factor
MPFFARGWSHCPVAHRDRRRLRGAVPTVRRAPGRCQVNPDEQGDPGESGSGLETPGQVPDQGGSPARESLHGRVPGQAAAGRGGVAPEAFIGEEFPVRAVVPAPADPVDGERPPSDSELTARVRAGDDAAYEEIYRRHADAVRRYARTCCRDSFTAEDLAGEVFARTLQALKAGKGPEFAVRAYLLTAVRNVAAAWARSDRREQLIDDFTGFAEASAATVEFDLADPGADAWALALADQRMVMRAYAELPEDDRVVLWHTEVERESPKTVAVMLGKTANATAVQAHRARDRLAAAFLQAHVSGSQESGCAGYANRLGAYARGSLRKRASAEVGKHVQDCARCTAAYLELADINHSLRAVLPGGALLWIGTGWFTVAAAAVGGAAVTGAVVGGAAVAGGGAAATAGGTTAGTAGAAGGAGSSGGGAAGAAGEGLGTAAKAGIAAGIAVVAAAVAAFALTGSPEPAPPEAAPPAVSAVPEAPLPPAPAPRPSPTPPPAPTPSPSPTPSPTPSRPPSPSPSPSPSAKRVPPPAASPDPVPTPVPTPVPTPAPTPTPSPTPTPTPTPSPSPTVAPARQFWLDEVPLNRGHRDAAGTPSIRGGGQVLQRPSAWLSGTRYQHVLAARVPSRVTVDLNRPCRSFDAVAGLDDFGVTYGEVVFSVQDEDGRVLWSSPALSAGDRPVAVHVPLDGLSSIRLVVTPVRGSLPVIDLGDWAQARITC
>NC_016109.1|WP_014137409.1|4783454_4784150_+|DsbA-family-oxidoreductase
MKVEIYSDIACPWCYVGKRRFEQALDRFEGKDGVEVVYRPYQLVPDAPEQARPHREWLAERYGPQSLAMDDRITEVGKGIGIDYDFDTAVEVNTFRAHRLLHLAETEYGPAVQAALKERLLKAHFSEGVNVGDVEALAGLAAETGIDRERAAAYLAGDEGAAETRAALDEARAIGVTAVPTFVFEGKWAVQGGQEAETFLQVLRQVEAETAQRITPLAPPAATCEDGSCAI
>NC_016109.1|WP_014137408.1|4782850_4783363_+|universal-stress-protein
MTATLPVHAAPPPPGAAILVGCDGSDAALWALDRAMAEAEAHRLPLHVLAVVNPSPTGYPPGMADLVQESVERLTASMSDGLRRAVDTVQSARARPYAGRLTLHVVLGNVVDVLLRAADGRHTLVVGTRGNGGFSRLLLGSVSTAAVHHATCPVLVVPAPAAETAEAARP
>NC_016109.1|WP_014137407.1|4780611_4782714_+|hypothetical-protein
MRWLTGWSGLTAADPALAAVRPLAGTLLWGGPNPLWAVGDWRPDELRLAVLRPGGPAAVRGGLDPRHAADDADHDTPATLRLAVAGRCGATDRELADGLAAARGGALRHLTHWPGSYTVVLRTGTRSTVLLADLSGAQPAFHTPFAGGTAYATAALPLADLVGAPVDAAHLAARLAVPDTPEALGDRTPYRGVRRVPPGHALGIRGGRADHTPYDDHRDEPAAERGEAPAVRELTRALLAAVRCRVRATAPADRPRLGVDLSYGTASATVALLAAAVPLPAGGGGGGGGAGGDSRPAARSGAVRGSWARRAEPPEPEPLPAVTLGEQDAPVLAVHAPRLRHLVLPPVVPYAGLADPLAGPLTDEPGPALVDAARYAAAHRAGGADHLTGHGARQVLDGHPARLADLVRAGRPLDLLAPLAALAGADRATAGALTGTLHTPVTVLRAARRLARTRYADALDDLALKLTLRQEPSQQRTVGRALAADLAWHRPGPAAHLLADEPLAALAQHLRTAARAGAPTEPPGARRARLALHRHAAHYRTLVQATEQHGQRLHAPFLDNQVVRAARLLPDDLRLQPGARPALLAAVLAGAGRTDLPAGWGRTPGPDPHDPARRGLRAAAPALTELLDRPLLGEAGLLDAPAARKTLAAATDPGQSAPPGTLAALADLLAVELWLRRLAARRPGSSWTGLPAPRRTALET
>NC_016109.1|WP_014137406.1|4778532_4779948_-|hypothetical-protein
MTVSSRGPNDRLGALLALAQISNAGLARRVNDLGAQRGLTLRYDKTSVARWVTKGMVPQRPVPHLIATALGNKLGRPVPLEEIGLADSHPTPELGLEFPREVPEAVRSATELWRVDLDLRRGPGGGRWSDSLAGTFSVAAYATPVSRWLITPADGSVAREAVPDLTGYRVGHADAAKLREAAQEARRWDSKYGGGDWRSSMVPECLRVEAAPLLLASYSDAVGRALFGATAELTRLAGWMAFDTGQHEAAQRYYIQALRLARAAGDVPLGGYVLASMSLQAAYRSFPDEAVDLAQAALERNRGLATARTMSFFHLVEARAHAKAGNAAACGTALAAAETALDRSRPGDPDPAWIDFFAYDRLAADAAECFRDLGVPSKVRQFTREALARPTEGYVRSHGLRLVVSAMAEAEAGDLDAAVAAGERAVEVAGRISSHRSREYVVELLRRLEPYQNEQRVRELTERARLVLATS
>NC_016109.1|WP_014137405.1|4777217_4778450_-|L-2-hydroxyglutarate-oxidase
MEHDVEVLVVGGGIVGLSTAYALTREHPGTRVAVLEKESAPAAHQTGRNSGVIHSGVYYRPGSLKAAYATGGAREMVAFCREQGIAHEVTGKLIVATDRAELPRLAALAERGRANGIPLVELDPAGIRGYEPEVTGIAGLHLATTGICDYPEVARRYAALAGERGAELRLNTPVLDIARRPDGVTVTTPHGEVRCAVLVNCAGLHSDRIARLAGDDPGVRIVPFRGEYYELAEERRKLVRGLVYPVPDPAFPFLGVHLTRGVHGDVHVGPNAVPALAREGYDWRTLNVRDLAETARFPGTWTIARRHWRYELGELRRSLSKRAFTAAVRRLLPAVTEADLVPATAGVRAQAVARDGTLLDDFAFAGFDPADPRSPRRTVHVLNAPSPAATASLGIGREVARRAVAALRAG
>NC_016109.1|WP_081539891.1|4776281_4777034_-|tRNA-(guanosine(46)-N7)-methyltransferase-TrmB
MYPHKATEAQHREQRIRSFQPRRGRMTKAQASALDRGWERFGLAIDGTPLDLPTLFEGRPVTLEIGFGMGDTTAAMAAADPTAGILAADVHTPGHGNLLQFLERDGSENVRLAAGDAVILLRDMLPDASLAGLRVYFPDPWPKPKHHKRRLIQSSFLELVLPRLAPGALVHCATDWEPYAEQMVQVLEASPELENLHPEGDGSDWLEPAEHPAGTRPGYAPRPDWRPVTKFERTGLAKGHVVHDLLFRRR
>NC_016109.1|WP_148283139.1|4775815_4776262_+|hypothetical-protein
MQPAVEPGAVPGVEPTATVAELRLPVWFFGFEGLLAGAFDLLRAAPGCWPALVALGAVNLAVSLTLMRGRLRLARLLWRGRGTRKVAFGLVGLRVGSHLVLGLLGAAVTGALGHVLFALAMGAVTVALLAHVQRTALGALVAAGKATA
>NC_016109.1|WP_051055301.1|4774272_4775532_-|PrsW-family-intramembrane-metalloprotease
MSSPPGGEAPPGPPGVAAATAAGSPTPPTGARSLPEPTARRSGGLLPEPSRRPPQPAPPALRGRIPGQQGGGTPRPPGPGRVRSLGRRLWPLRRPALSSAVAALALAGSGVLILRLVQRQTGTTGLLVGLGLALLPLPFVLGALAWLNQTARVPVRHSLFCLAWGACAATTMAILANGWASDFLIAHRGARGETLGAEFATPLIEELAKGAALLVLLLPLRRRHRCEEGRPCGRLRRLLWHRPGRPAHFRPSPAGRVRARSRPRTLAAGVVLGGVTACGFAFTENALYLGRAFTADRQARLDAIGLGESPSLRDFDGTVHTFVLRALLSPFAHPLFTALTGLGLALTLATGRRWLARLGAPIGLLLAMGLHGVWNAAAGLGTDGFLLVYGLVMVPCFAALVCFAVWAQTRRTRQPSRPD
>NC_016109.1|WP_051055306.1|4789129_4790947_+|hypothetical-protein
MDIKTLQDGRYDGMFAAADAYDRIGSAFADHSSTWNNGVQGRARNSGWTGQAADKADASLSETGIKVQAAAGELCSIAPVLREGAEAFMLAQNKLAALLTDAKADGYQVGADGSVSWQPATPTAPDQGITIDQMFQQQAREMQATAYGMQIEQVLKEAEHADQVISERLRALTDDARTGKGLTRIAGGLNAMRNLRKEDLVDSAIPKQGSSPTQVNAWWKGLPPEEQQRLLQNHPQQIGNLDGIPSPVRDQANRANLDRTISQLENRGQLSAAEQEQLTGFRAIKQRVASEDEAHRKMPESNPQPYLLAIDTVGQGRAAISFGNPDTATDVVSYVPGLGTKIGGAGGGDADRAKDLWTASKAADPSKDVASITWIGYDAPQLEGATLDSLAVAGTERAERGGASYQTFVQGLRATHEGEPAHMTALGHSYGSFTVGQAAQRPGGLPVDDIILVGSPGTGAQRADQLGIDPKHVWVGAAENDPVTHLPSGAESTGMGVGGYIGAAAGAGFGPLGLITGAVVGGGGGYGVGHLVDEHELWFGQDPASREFGGNRFAVEPGPELSADSHSDYWDFRDERQKKDPSASLANMAEIVTGNGGNATKQSPR
>NC_016109.1|WP_014137414.1|4790943_4791519_+|hypothetical-protein
MSPRTPFAAFAAVLLAVTLTAGCSGSEDLGPLGDPAAAQQRIDSLIDGTLKAITPAVPPRQDWWYRYREERNGINNNTGYTEVERQSYLEERIAEGKQRVLLGQAEKYWSDQGCTVGAEKSDSLRVYVSATCADKAVAVVEIGKDGVALVKALVEKTKLGSGPSPFPNTLSPRPTASETPVGKRDHPYWSH
>NC_016109.1|WP_014137415.1|4791683_4791827_+|hypothetical-protein
MYGRDPVNGGFGANVLPTASGVGHFDYWNSDGASPRTKGRVITGGLD
>NC_016109.1|WP_014137416.1|4791829_4792198_+|hypothetical-protein
MRHLRHLRHLRLITIPAAALLLASCGLTHDQLKPTITRAEGALNTRFPNGKPEGNKAVFDAFEQKVRARGFTEKWRDSSAVMYQNAADGFAIGLIESSDSSKLLTLSVSSPCVWPDGTPPKK
>NC_016109.1|WP_014137417.1|4792322_4792895_+|hypothetical-protein
MRTRTPFAAFATVLLAVTLTAGCSGSEDLGPLGDPTAAQQRIDSLIAGTAKAITPAVTLTPYVGFTYAEERNVVGNNTGYAEVEREDSLEERIAEGKKDALLDQVEKDWTAQGCTVDTKEPDDRRKYTAATCPDKAHVMVDAEGSAVVIRAWVSKTKFRSGGNPFPDTQTPLPLASHHPAGQQDHSYWSH
>NC_016109.1|WP_033260167.1|4793111_4794449_+|FAD-dependent-oxidoreductase
MRVLIIGGGCAGLSAALRLQQLLRARLRDRRVELTIVEPQPYLTFQPLLAEVAAGSIDPRHVVVPLRAALPDCRVLTARVTRIDHATRTAWVDAAPRGELRLPTEVRYDVLVMAPGSVSRTAPVPGLAEHGMGFATVGEAVALRNHVLEQLDLASSTRDPELRHAALTFVFVGAGYAGVGALAELEDMARTATKGYHNLDPDDLRWILVEAKDRILGEETPELATHTLAELRERNIDVRLSTTLESATDRLMLLSDGSRFAARTLVWTAGIRPAPVLSLTDLPLDGAGRITCLPTLRIAAPDGTPLPDAWAAGDCASVPDLTGEPCAPNAQHALAQARLLAENLAAELAGQPLADYRPDQPACSTSLGLRRAVAHTRRGTRLTGRRAWWLHRARQLRRLPTRERRIRVLTDWLFGGLFQREIVSLGTIEHPRAEFESGFTSGPGT
>NC_016109.1|WP_081539542.1|4794734_4795985_+|SpoIIE-family-protein-phosphatase
MNLMRWSARLTGATWRATPATADESVTVPGPRDPAAPCHDPRDAEQPYDLHDVLRRLPAPVALTHGPQHHLGYANQAYRELFGARTPGRPAAESLPELATLGVLPLLDQVLRSGRPRSVKSRCILGLGGNRYYNIACVPLGPDEHAAPAGVLVFATEVTDQVQSAGRLREAERRQREAAVTLQHSLLPQKLEQPDTLHVAATYQPGGADAAVGGDWYDVIGLGGGRTALVIGDVMGRGLRAAAVMGQLRTAVRAYARLDLPPHEVMTLLDGLAMEIDANQIATCTYAVWDPAATTLVYASAGHLPLLLRGPDGTVLRGEEQNGPPLGTGGAGHLSHTLRLLPGTTGVLYTDGLVERRDQDIDQGIDHLARTLTSPVGTPDTVCSRLLRALGVTAEHDDDVAVLVFQVPLDPEPTGV
>NC_016109.1|WP_014137420.1|4801907_4802828_+|mycothiol-synthase
MRTSENTSGAGRIERIEALAPEQAGAVRELLAAAAGADGREAVSEAGRLRVRPDSPRAGVRHLVQSVDGAVVGYAQLEGERPGTVELTVAPAERGRGLGGALVDAVLAEGAGGLDFWAHGGLPAARHLAERHGAVLVRELRQMRRTAAAPDAVPLPAGVELRTFEPGRDEAAWLALNALAFAHHPEQGSWTERDLAERIAEPWFDPKGFFLAERDGRLVGFHWTKVQPDGLGEVYVVGVDPAEQGNGLGKALTAAGLRHLILERGLPTVMLYVDADNAAAVRVYERLGFAVHEVDLMYRWAPSGER
>NC_016109.1|WP_106437990.1|4803437_4805582_+|RNA-degradosome-polyphosphate-kinase
MPAAVSAAFAAGTLSPVAGGADEEELPQGRFLDRERSWLAFNERVLELAEDPNIPLLERAKFLAIFASNLDEFFMVRVAGLKRRIATGVAQRSASGLQPREVLDQIWRRSRELMARHAATFQQEVLPDLAAEGVELVRWPDLAETEQARLHTLFRQQIFPVLTPLAVDPAHPFPYISGLSLNLAVVVRNPVSGHKHFARVKVPQSLSRFLEASPQRYVPLEDVMGAHLEELFPGMEVLAHHAFRVTRNEDLEVEEDDTENILKALEKELMRRRFGPPVRLEVEESIDPYILDLLVRELNITEAEVFPLPGPLDLTGLFGIADLDRPELKYPKFVAGTARGLTDVESATLPDIFGAMRERDVLLHHPYDSFSTSVQAFLEQAAADPHVLAIKQTLYRTSGDSPIVDALIDAAESGKQVLVLVEIKARFDEQANIKWARKLEESGCHVVYGLVGLKTHCKLSLVVRQEGDTLRRYSHVGTGNYHPKTARLYEDLGLLTADPQVGADLSDLFNRLSGYSRRESYRRLLTAPRGLRDGLVARINGEIAHHRAGRPAFVRIKVNSIVDEVVIDALYRASQAGVPVDVWVRGICAIRPGVPGLSENIRVRSILGRFLEHSRLFVFGNGGDPEVWIGSADMMHRNLDRRIEALVRVTDPAHRSELNGLLELGVSDETDSWHLGADGTWTRHSQDAEGRPLRHVQDLLIDSRRRNRGSAAAR
>NC_016109.1|WP_014137422.1|4805673_4806753_+|CHAD-domain-containing-protein
MTDAPTTAPVARAATAGEVLAGYLTAQAGAFLRALPQAVGEAGSRPGALPASAQAADDLLRAVRRVGGALHTFAAAFDPQWAQESRTELRWLLNLLAQEPGYQRRATRLLGALDSLADTSPDGAGMLAGHAGAPKARALLERQLTLARTRAHTALLQELRSARLHALADRMTLLAGEVPLAAPAEPAAALLPRAAAALAALVGAGERLPWQRSAQAYGGAGLHRLGPAEPAAPAGAPAAVPPARTAADADAALAADDAPWLRARILVKRARYALEVCGAPGEGLRELDGVLARHQEASDAAATVATAARTPRITPATAYVLGVVHADQRLEVESARYAFGRQWPAVAPGLVGPAAVLPA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_016109_8

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_016109_8

7220753-7220841

Orphan

Consensus_repeat	Method
GTGGGTGGGGTGGCCGTGCAGGCGGGGGA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_016109_8

>merge|NC_016109|8|7220753-7220841|CRISPRCasFinder
GTGGGTGGGGTGGCCGTGCAGGCGGGGGATCAGCAGGTCGTCCGTATCGGTGGCGACAGCGTGGGTGGGGTGGCTGTGCAGGCGGGGGA

>NC_016109|8|8|7220753-7220841|CRISPRCasFinder
GTGGGTGGGGTGGCCGTGCAGGCGGGGGA	TCAGCAGGTCGTCCGTATCGGTGGCGACAGC
GTGGGTGGGGTGGCTGTGCAGGCGGGGGA

Protein	Signature genes	Signature genes Name	Protein_function
NC_016109.1\|WP_014139486.1\|7214913_7219263_+\|LysM-peptidoglycan-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|198111
NC_016109.1\|WP_014139489.1\|7221043_7221451_-\|hypothetical-protein	unknown	unknown	unknown
NC_016109.1\|WP_014139478.1\|7208129_7209542_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|370676
NC_016109.1\|WP_106437766.1\|7209531_7211145_+\|CpaF-family-protein	unknown	unknown	gnl\|CDD\|227297
NC_016109.1\|WP_014139494.1\|7224763_7225327_-\|DUF4240-domain-containing-protein	unknown	unknown	gnl\|CDD\|379426
NC_016109.1\|WP_148283186.1\|7222084_7222549_-\|hypothetical-protein	unknown	unknown	unknown
NC_016109.1\|WP_014139481.1\|7212112_7213000_+\|hypothetical-protein	unknown	unknown	unknown
NC_016109.1\|WP_014139483.1\|7213566_7213929_+\|pilus-assembly-protein	unknown	unknown	gnl\|CDD\|377921
NC_016109.1\|WP_014139496.1\|7226993_7228097_+\|LD-carboxypeptidase	unknown	unknown	gnl\|CDD\|132883
NC_016109.1\|WP_033260142.1\|7221578_7221923_-\|hypothetical-protein	unknown	unknown	unknown
NC_016109.1\|WP_051056013.1\|7229427_7230438_+\|winged-helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238042
NC_016109.1\|WP_014139484.1\|7213970_7214417_+\|pilus-assembly-protein	unknown	unknown	gnl\|CDD\|227296
NC_016109.1\|WP_033260137.1\|7219379_7219691_-\|hypothetical-protein	unknown	unknown	unknown
NC_016109.1\|WP_014139482.1\|7213171_7213426_+\|hypothetical-protein	unknown	unknown	unknown
NC_016109.1\|WP_014139497.1\|7228090_7229368_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340887
NC_016109.1\|WP_014139492.1\|7223230_7223725_-\|VOC-family-protein	unknown	unknown	gnl\|CDD\|369157
NC_016109.1\|WP_014139495.1\|7225954_7226902_+\|zinc-binding-dehydrogenase	unknown	unknown	gnl\|CDD\|176206
NC_016109.1\|WP_063747511.1\|7214518_7214914_+\|hypothetical-protein	unknown	unknown	unknown
NC_016109.1\|WP_081539700.1\|7223892_7224693_+\|nucleotidyltransferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|366857
NC_016109.1\|WP_014139480.1\|7211144_7212116_+\|type-II-secretion-system-F-family-protein	unknown	unknown	gnl\|CDD\|227300

Protein	Function_ID	Function_description	E-value
NC_016109.1\|WP_014139486.1\|7214913_7219263_+\|LysM-peptidoglycan-binding-domain-containing-protein	gnl\|CDD\|198111	smart01043, BTAD, Bacterial transcriptional activator domain. Found in the DNRI/REDD/AFSR family of regulators. This region of AFSR along with the C terminal region is capable of independently directing actinorhodin production. This family contains TPR repeats.	1.73913e-14
NC_016109.1\|WP_106437766.1\|7209531_7211145_+\|CpaF-family-protein	gnl\|CDD\|227297	COG4962, CpaF, Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion].	6.90691e-61
NC_016109.1\|WP_014139478.1\|7208129_7209542_+\|hypothetical-protein	gnl\|CDD\|370676	pfam09770, PAT1, Topoisomerase II-associated protein PAT1. Members of this family are necessary for accurate chromosome transmission during cell division.	1.27463e-15
NC_016109.1\|WP_014139496.1\|7226993_7228097_+\|LD-carboxypeptidase	gnl\|CDD\|132883	cd07062, Peptidase_S66_mccF_like, Microcin C7 self-immunity protein determines resistance to exogenous microcin C7. Microcin C7 self-immunity protein (mccF): MccF, a homolog of the LD-carboxypeptidase family, mediates resistance against exogenously added microcin C7 (MccC7), a ribosomally-encoded peptide antibiotic that contains a phosphoramidate linkage to adenosine monophosphate at its C-terminus. The plasmid-encoded mccF gene is transcribed in the opposite direction to the other five genes (mccA-E) and is required for the full expression of immunity but not for production. The catalytic triad residues (Ser, His, Glu) of LD-carboxypeptidase are also conserved in MccF, strongly suggesting that MccF shares the hydrolytic activity with LD-carboxypeptidases. Substrates of MccF have not been deduced, but could likely be microcin C7 precursors. The possible role of MccF is to defend producer cells against exogenous microcin from re-entering after having been exported. It is suggested that MccF is involved in microcin degradation or sequestration in the periplasm.	1.06388e-89
NC_016109.1\|WP_014139483.1\|7213566_7213929_+\|pilus-assembly-protein	gnl\|CDD\|377921	pfam07811, TadE, TadE-like protein. The members of this family are similar to a region of the protein product of the bacterial tadE locus. In various bacterial species, the tad locus is closely linked to flp-like genes, which encode proteins required for the production of pili involved in adherence to surfaces. It is thought that the tad loci encode proteins that act to assemble or export an Flp pilus in various bacteria. All tad loci but TadA have putative transmembrane regions, and in fact the region in question is this family has a high proportion of hydrophobic amino acid residues.	1.43747e-05
NC_016109.1\|WP_014139484.1\|7213970_7214417_+\|pilus-assembly-protein	gnl\|CDD\|227296	COG4961, TadG, Flp pilus assembly protein TadG [Intracellular trafficking and secretion].	6.58602e-05
NC_016109.1\|WP_051056013.1\|7229427_7230438_+\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238042	cd00090, HTH_ARSR, Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to dissociate from DNA in the presence of metal ions.	6.8325e-11
NC_016109.1\|WP_014139497.1\|7228090_7229368_-\|MFS-transporter	gnl\|CDD\|340887	cd17329, MFS_MdtH_MDR_like, Multidrug resistance protein MdtH and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This family is composed of Escherichia coli MdtH and similar multidrug resistance (MDR) transporters from bacteria and archaea, many of which remain uncharacterized. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. MdtH confers resistance to norfloxacin and enoxacin. MdtH-like MDR transporters belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.05163e-33
NC_016109.1\|WP_014139494.1\|7224763_7225327_-\|DUF4240-domain-containing-protein	gnl\|CDD\|379426	pfam14024, DUF4240, Protein of unknown function (DUF4240). This presumed domain is functionally uncharacterized. This family of proteins is found in bacteria and eukaryotes. Proteins in this family are typically between 169 and 263 amino acids in length. This domain is often associated with the WGR domain pfam05406.	2.59949e-35
NC_016109.1\|WP_014139495.1\|7225954_7226902_+\|zinc-binding-dehydrogenase	gnl\|CDD\|176206	cd08244, MDR_enoyl_red, Possible enoyl reductase. Member identified as possible enoyl reductase of the MDR family. 2-enoyl thioester reductase (ETR) catalyzes the NADPH-dependent dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordination sites characteristic of the alcohol dehydrogenases in this family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site, and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. Candida tropicalis enoyl thioester reductase (Etr1p) catalyzes the NADPH-dependent reduction of trans-2-enoyl thioesters in mitochondrial fatty acid synthesis. Etr1p forms homodimers, with each subunit containing a nucleotide-binding Rossmann fold domain and a catalytic domain.	5.69015e-101
NC_016109.1\|WP_014139492.1\|7223230_7223725_-\|VOC-family-protein	gnl\|CDD\|369157	pfam06983, 3-dmu-9_3-mt, 3-demethylubiquinone-9 3-methyltransferase. This family represents a conserved region approximately 100 residues long within a number of bacterial and archaeal 3-demethylubiquinone-9 3-methyltransferases (EC:2.1.1.64). Note that some family members contain more than one copy of this region, and that many members are hypothetical proteins.	6.35211e-66
NC_016109.1\|WP_081539700.1\|7223892_7224693_+\|nucleotidyltransferase-domain-containing-protein	gnl\|CDD\|366857	pfam01909, NTP_transf_2, Nucleotidyltransferase domain. Members of this family belong to a large family of nucleotidyltransferases. This family includes kanamycin nucleotidyltransferase (KNTase) which is a plasmid-coded enzyme responsible for some types of bacterial resistance to aminoglycosides. KNTase in-activates antibiotics by catalyzing the addition of a nucleotidyl group onto the drug.	0.00167592
NC_016109.1\|WP_014139480.1\|7211144_7212116_+\|type-II-secretion-system-F-family-protein	gnl\|CDD\|227300	COG4965, TadB, Flp pilus assembly protein TadB [Intracellular trafficking and secretion].	2.29174e-07

>NC_016109.1|WP_033260137.1|7219379_7219691_-|hypothetical-protein
MSFDDQDDSRERTTATTTAATTTAASGWRRIALPVPPLGKLARGSGIADRLGTCTGSGLAGWVATGHTHGEATWATVVLAVAMIAAEAVRARRCACPAPRGLS
>NC_016109.1|WP_014139486.1|7214913_7219263_+|LysM-peptidoglycan-binding-domain-containing-protein
MAARGADDQHRKGRRARRPEPTAGTGTGTGRGGRRPVPSAAGRGGRRGTGSSVLAAFGALLALVLLLAGVPALLGYGTLAVAAMGDPVHGDLIAALTSPDDGSLFLWLLVGLGWIGWLCFLVSVLVEIPAQLRGRVARRIPAFGWSQRIAAGLVGSVIALLPVAGSAFAATPETAQRPAAVAQLQAAPAYAALPAGAPAAAPAADPQQAVYTVRDARPADSLWSIAERQLGSGERWTEIAKLNAGRPMDDSGTRFDADRPIQPGWQLLMPADAKPDANAPAAQPGTATPPAPPALPAGTSAQAGLPAHGSVTVHSGDSLSSIAQRELGDGDRWPELFDANKGATAPDGEKLTDPDVLAPGMVLTVPGANQAPAPESPAPATPAPATPTPPVEAPTPPPAAAPTPAPTAATPAPEQSPAAQSPAAQSPAVQSPAPQDSASAANLPAVREQHTAATGNGDYTVALAASGVGVLMAAALIALVARRRTDQQRARRPRHRIALPPAAAGRMESELKARQDEHGLELLDRALRTLSRNVVRGEKRLPALVAVRVTTVGTVELHLAAPAVPIAPFRAAHAPNVWWCPTDSTELLSAAQAAKHAAPYPALVTLGATPDGSTVLADLETVRLVHLSGHPDDAEDVLRSLAVELAHSPLADRLHLHLVGIATDLPTAGPAADRVHHHPTLEAALAALGPRTAKARATLIGANVGSPREARSRGSANEAWLPEIVLSAQPPAGTVPAELGRLLDGRPRTCLAVLTRAPERGAGPVARWTLPATGHAALPGLHLSVELQRLNREQYDRIGELVRSSGDFTQHPAPEWTLDGPHNGPEEDEELPLPVPALAAVGAAIGAVPAPFGTDAPSLGLSDTETRFDGTLDARLIALLGGPTGPEATAAGAASGAASGASIGTALAALTEAPAKTSLDKPGTGSSGAGAGGTNGGADGTGGGDAAGPRLLARVVPTGSSPFAGLVPTAPTNPYAVVPVLPVQPAAPAPGSAPVAESAPAVEDAAPVEPVENAPAEPRHAANGQARKVTTPPHGTPVDPRIAAALPADPAVPADSAVPAQSPNPPQDVLPPLATEFTPEPAAGSTPEPVVEPIAEPEPGWEPEPVADGGTRSFELAAPAPVEQQPVEWPVEQPFEQPAAPAGPPPAPEPLPVHDQAAAPDPRSPARPSARPGSGPARTDSDDLLAILRSPEAHHLRSAPRIRVLGPVDVLGAAGRTDPAGRPRLTELAAYLALRPGTEHTAIDRDIHPGAAHLDPRATAERLADPLPAKLAALAGWLGISPEGRGYLGAVPADTYALAPTVSCDWDEFRSLYRRGMRSTSSTADAALAHALALVRGAPFAEAPAGTYGWAEAERQDMLAAIVDTAHELAARRLQYGDHRTAEAAIFRALAVAPEVELLHRDLFYAYASAGARDQLVRSVNRLDALSRRTGRDLDPDTVALLRDLLTGS
>NC_016109.1|WP_063747511.1|7214518_7214914_+|hypothetical-protein
MVAITAVSLVAVVGLVLDFGGQLRSTERADALAQEAARVAGQQLDITKLRAGGGYQVDPKQAVSAGRAYLASQHVSGSVDFPRYPDLSEISVTVDTTYPTALLGAVGITSLSVQGHGKATLLHGITEGKTG
>NC_016109.1|WP_014139484.1|7213970_7214417_+|pilus-assembly-protein
MTARAVDFLRRDRGSFALEAAILVPVILSFALMAVAAGRVQTTGAVVDAAARAGARAASLARTPAGAEKEAAAAVRQALAFRQVECATEPTGVPEYGTLETDGGVLQTVTVQVSCTVPLADLLGLDGVPGSKTITGTFTSVLDRYRGN
>NC_016109.1|WP_014139483.1|7213566_7213929_+|pilus-assembly-protein
MTISLAIVFPAVLFMILLVVQAGLWWYAEQAALAAAREGVEAGRVNGAPTGAGEQRASEFVGRLGQLATLRQPPRQTGNDPDLYQLSVTVKPLTLIPFVDTTITKTAGAPREKFVPPGAP
>NC_016109.1|WP_014139482.1|7213171_7213426_+|hypothetical-protein
MARIRTVAAALLPLDLFKPLIEYRLAKLRIARGSGDRGAISIELALAVILLVGIAGAVVYAITQLGNTVKAKIPKDSPVGGTAP
>NC_016109.1|WP_014139481.1|7212112_7213000_+|hypothetical-protein
MISPWAILAGGAAAGGVALLFAELRPAPPDLGQALDRLHRVPEPRRAEDAEAVLPWYDRVGDRSTRLPGVRIPQQELALIGRSPARFMAHKLLFSFLGFALPGYLTVLAELIGDGLPLAVPLLVGPLLAGLFWFIPDGIVAGEAKEARTEYLHGIAAYLELVALERAADCGPAEALRRAASVGRGTVFRKIRDALERAATDRLPPWDGLDALAQELGLTPLQDVADIMRISGVDGAAVYDTLRARAKSLRGELLSEELAKANTDSERMVAPGSALTLLMTVLIAFPAIYQMLSTD
>NC_016109.1|WP_014139480.1|7211144_7212116_+|type-II-secretion-system-F-family-protein
MLMLYVLCGLAVAGGLVALAVGLTGRPEGEEQPRNPLEGRLHTLWYGAPGTASPGVARLRRIQLVLALIGAPGGWLFTRIPLVALLVPAAVFGLPWLFDATRSDTRRIERLEALAEWTQRLADVLLLGVGLNQAIMTSRRTAPAALETEITDLAARLQSRWRPEDALRAFGDQVADSTADKVLAALVLRAGDSGPGLARALADMAESVREEVRQRRAIEADRSKHRTTIRWMVGIILLVVVVGSFNAGYTAPYTTTIGQLVLGIVAVAFVAVIAWMRSLARHTPLPRVLEPDRRSKTGKLPGREQAAAEGAGSEDEPLVKEAR
>NC_016109.1|WP_106437766.1|7209531_7211145_+|CpaF-family-protein
MRANPYQGPLPQQAVNGQVAQGGSADAAGLPWAKPPLEQPYQQPQQPQQPYQPQPQPQVGPVAAAAAVPALPAAGARPVVDTQVARELKRQVAAELHQQLSRLAQASGSEADRATRRQRGRALIEEAVARWSDAYAQTHGIPPTREQDRLLAEAVYDLLFRAGRLQPYLDDPEIENILINGCDDVWISRVHQPLRQVPPVADTDEELVELLQDLARQHGGGERSLSTASPMLALRLEGGMRLQAMTEVTPRPYVAIRRHRVASATLSDLVQLGTVDTTLAAFLASAIRARKNVMITGTQGVGKTSLLRAMAAEIPPDERVGTLESEFELWLHTLGHLRQVVPMEAREGNGERVDGRLAGELTIGELIPAALRMTLSRIIVGEVRSAEVVPMLRVMTNGEGGSMCTLHARGPQMVVDRIAELCLEYGSHMTDTLAYRLTANAVDFIVHVTMVDETAVGGRRHRFVSHVLEVAGLGESGRPALNTVFGPRPEIGEVRAVPVTPPHCLDDLRRAGFDAGLLASPYGTWGAPLALRIGGTR
>NC_016109.1|WP_014139478.1|7208129_7209542_+|hypothetical-protein
MSVVAVLGGPGAPGATSSALALLLSWPLRPGRRVLLVECDPDGGAVLAGALEGRVEAVYGLRNLAVADRRGLLAETLWEQLLDVSPQGNGERLLLPGLTDPAQAPGLAYTWEPLVEALRALEPQGYDVLLDLGRSGASGPMAVLPRRADVVAATVRTTLRGLSAARPRIAALREDLDANGTGSDGLGLLLVTEGPYPESEVSRQFRLPVLGALTHAPRTARVLSDGGDTTDRRFIRSELMRTARSAADRIQDLVTTRRRRLGGPQGQPPPQPQLQQTQLQQPPQQQPQLQQPYQPQPVQPQPVAPQFAQPQPQPQPQPQPQPQPPQSSQRGYVQPPQYQQPLRQAPVPPQQVPPFVAGPVGGPQSYPQSQPYQAQPPYQQAQPYQQQQPYQQPQSPQQVSQEAGAGGQFTGEWPIRVEPPQISYAAPHIAPPVVPQPPVPAPFPGQGGAGGAVVDGEGGDGSREEGRHAR
>NC_016109.1|WP_014139489.1|7221043_7221451_-|hypothetical-protein
MGRRNALRYLGGELKAQTLVAFAKDTRTYESDQDHRGRLVVRGDGSRHTTQWGGIAGEWQYNGGVVSLLDGSRESDALTVGKVPETIAAGFSRTLPLASGWAEVGGDGDLDVQVTKDTIRLTFGGGQRVITCTRA
>NC_016109.1|WP_033260142.1|7221578_7221923_-|hypothetical-protein
MPARTVAAVRRFEAARLWPGAVADALHAYEGFLRQPGQYLYVPLSDCPCCDPLEARDTLELALRLLPRPAGAPLRAAVDRLDTEFRRRTLPDPRAAPAGAWHAAAWWRRRLTGS
>NC_016109.1|WP_148283186.1|7222084_7222549_-|hypothetical-protein
MTATATATTELPAGTDGPALTATVRARSPQDLHNVAYVAPLPPSAATDLDGDGYPDTVFEHLNPLVVPTPDTDTDTSPTDNDAQGHWTVTAPTPAPAPTPTPTPAPVPTPALSASGGDGRLPDTGTELGTQAALSAFLLSAGALAHGLGRRRKR
>NC_016109.1|WP_014139492.1|7223230_7223725_-|VOC-family-protein
MAQKITTFLWFDDQAEQAAEFYTSVFEFGRVTDVQRYSAAGPGEPGSVMLVSFELFGQEFLALNGGPQFTFNEAVSLQVDCADQAEVDRYWELLTADGGAPGPCGWLKDRYGLSWQIVPRRMTELLSDPDPERARRATAAMLRMGRLDIAALEAAADGADTDGG
>NC_016109.1|WP_081539700.1|7223892_7224693_+|nucleotidyltransferase-domain-containing-protein
MTLPESALPSAAAQEAEDAAQNALAAPLLALFADRLSAAVPVDALWAHGSLAHGDYRHGRSDLDLVAVLPAAPDEPVRERLAALHRELIADRPDAVRLHCAYVPRTGLADPAVAHFAFAQEEPMDRPVTAVTRRELLDGGRVLAGEAPSALLPPVDDAELHAHIRTDLREFWYPVTARPEPWQRDIWVDHGPVTAVRATVALREGRLISKREAISRLPALGAPAGLAADIAARRYGVPPALTPEARDERAERARLFTRELIERALA
>NC_016109.1|WP_014139494.1|7224763_7225327_-|DUF4240-domain-containing-protein
MDTDGFWTLVESSAAGDLPCTRADRLTDRLAGLPLPEVLDFQLRLDEARAPLDTPATLAVAKLVLRGRVSDDSLWYFHAWLIGLGQDAHHLAVHDPDALAGHPALRRLAALPYRRWENHDFPDWESVDYCAQEAYERLTGEEDGLEEAMEAIGHDSPCNAGFADPAWTSEESAARLPRLTALFADAG
>NC_016109.1|WP_014139495.1|7225954_7226902_+|zinc-binding-dehydrogenase
MRAVWLREFGGPEVLVPGAAPDPVPGEGQVLIDVAHANLTFVETQFRATGRGPFAGRLPMIPGNGVGGTVTALGPGADPGWLGRRVVSATGGSGGYAELAAVPAEGLHPVPDGLPLDAATALLADGRTARLLLETAAPAPGERVLVTAAAGGVGTLLVQLATAAGAHVVAAAGGPRKLALAAELGAPETADYLRPDWADRIAPVDAVLDGVGGALGRAAVDLLRDGGRLINHGLAGGAWTDLPADEAAARRLTVLALRPTPASTRAATGHVLAEARAHRLRPVIGRRFPLERAADAHRAIEARDTLGKTLLDVDG
>NC_016109.1|WP_014139496.1|7226993_7228097_+|LD-carboxypeptidase
MPDQSTSQPVRPLPPRPAHLPAYPPAYPPRPRPGDRIAIVSPGFAGPGAFPLPYELGLRRLREEFGLEPVEYPTTRKLGATPAERAADLHAAFADPTVTAVMASIGGDDQLTVVPHLDAELLRAHPKPYFGYSDNTNLLDFLHRQGIVSYHGAALMTQLGRPVAVHPLTAASLRAALFDGGTYELTAATDTSTANGRWEDPETFTREPATEPATGWHWHRPDRVVEGPSWGGNLEILHWMAAADRLRPAEAYAGGVLLIETSEELPSGTEVFRILRNLGERGLLRQFPAVLVGRAMAWSFEHPHDAAARAHYRAEQRAAVLRALAAYAPEATAVFDVDFGHTEPQLVIPYGGLVRVDGPARRITVTY
>NC_016109.1|WP_014139497.1|7228090_7229368_-|MFS-transporter
MNAVTTSPPLSPSSPPLSPPPSRSPVVRRLAALLLVNAVGNGLFLTVGALWFTRGLGFSAGVVGAALTAAGLCGVPAALPVGRLCDRWGAKPVLVVVHVVQAAATAVFACAGSLWLFVVLVCVTGTASRANGVARSTLYAHALPAGSRTRALAVLRALNNVGIGAGAALGALVTAHGGRVGLRAAVCASAAAYLLALLPLRAVPTGAAPAGGAAGPGAARPLRDVPFLGVAALNAVVNTLYVVLEVGLPLWTLGHTAAGPAVTGWLLLANTALVALAQVAAARRVAGLAGAARSFRRGGLLVGAACLALAGAAGRTPGVAVAVLVGAVVLLTAGEVLSQAGSWALSYGLAPEHAHGAYQGVLHTGVALGQALAPAALTVLVLPHGTAGWASLAAVFAAAALALPPVARRAAVGRGERPLLALSPQ
>NC_016109.1|WP_051056013.1|7229427_7230438_+|winged-helix-turn-helix-transcriptional-regulator
MRFRLRLADLAATSFGYSPLQEAVLSLRMWTHHAHRFPALRPAFAALRPAFERLDAHPLLTALVARRRYWVPDLLTPRPAVPAPALRDELAALRATDPARLRPGLEQTFHPLGEPVPPVLAAGLRHPDRLLADLADALETYWHTCLAPHWWPRARTVLTADLAHRARTLAEGGADALFHGISARLSWADDTLTIRRGGPWPSTPDDIPVDGRRLLLTPSCFADGVSTMLDRDAPPHIVYATRGLATLAERPPPPAPQALTGLLGATRARLLVLLADDGPATTTELAHRLAVTPAAVSRHLTALRTAALLERTRHGRHVHYRPTPLGAALRHGEPHP

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_016109_9

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_016109_9

7272977-7274053

TypeI-E

Consensus_repeat	Method
GTCCTCCCCGCGCGAGCGGGGGTCTACCGG	CRISPRCasFinder
GTCCTCCCCGCGCGAGCGGGGGTCTACCG	CRT
GTCCTCCCCGCGCGAGCGGGGGTCTACC	PILER-CR

17 spacers

cas2,cas1,cas6e,cas5,cas7,cse2gr11

The CRISPR arrays of NC_016109_9

>merge|NC_016109|9|7272977-7274053|CRISPRCasFinder,CRT,PILER-CR
GTCCTCCCCGCGCGAGCGGGGGTCTACCGCGTGCCGATCCGAAAATCATGGTCAGGTCTGCGTCCTCCCCGCGCGAGCGGGGGTCTACCGGCACAAGAGAGGGGCCGGCGGCTACCGGCCCCGTCCTCCCCGCGCGAGCGGGGGTCTACCGCCTGTCGTCAGAACGTGCATACCGTCCAACGGGTCCTCCCCGCGCGAGCGGGGGTCTACCGCGGTCGAACACGCCGTCGGTCTGCGCGCGCCGGTCCTCCCCGCGCGAGCGGGGGTCTACCGCAACTACCAAGCGGGCCACCGCACCCACGCCCGTCCTCCCCGCGCGAGCGGGGGTCTACCGTCAGCGGGCGACTTCCGCCCAGCATGTTGTCAGTCCTCCCCGCGCGAGCGGGGGTCTACCAGTGCAGCAGGCGGTCCGCGGTGCCGGGCGCGAGTCCTCCCCGCGCGAGCGGGGGTCTACCGGGGATCTGCGGGAGGCCGTCTATCCAGGTCTTGTCCTCCCCGCGCGAGCGGGGGTCTACCGGTAGTGATCACGAGGCCGAGCCAGGTGGTCATGTCCTCCCCGCGCGAGCGGGGGTCTACCGGCGATCCAGCGCATGCTGCGGTCGCCGCCGAGGCCCTGGGCCGTCCTCCCCGCGCGAGCGGGGGTCTACCGGGCATCGGCGGCGCGATGGAGCAGGAGCCCATGTCCTCCCCGCGTGAGCGGGGGTCTACCGGGATTGGGTGCGCCCCCCGGTATGCACCACAGGTCCTCCCCGCGCGAGCGGGGGTCTACCGGCGACGCCGCGGGTCCGGATCACCGCGACGTAGTCCTCCCCGCGCGAGCGGGGGTCTACCGGACGCCTACCGCACCGTCGCCGCCCAGCTCCGGTCCTCCCCGCGCGAGCGGGGGTCTACCGCACGTCCGGACGCTGGCGCACTCGACGTACAGGTCCTCCCCGCGCGAGCGGGGGTCTACCGTGCTCCAGCCAGTACGGCAGCCACTCGGAGAGGTCCTCCCCGCGCGAGTGGGGGTCTACCGACGCCGACCGCGCCCAGGAGGAGCTGGTCCGCGTCCTCCCCGCGTTAGCGGGGGCTGCGTTG

>NC_016109|9|9|7272977-7274053|CRISPRCasFinder
GTCCTCCCCGCGCGAGCGGGGGTCTACCGC	GTGCCGATCCGAAAATCATGGTCAGGTCTGC
GTCCTCCCCGCGCGAGCGGGGGTCTACCGG	CACAAGAGAGGGGCCGGCGGCTACCGGCCCC
GTCCTCCCCGCGCGAGCGGGGGTCTACCGC	CTGTCGTCAGAACGTGCATACCGTCCAACGG
GTCCTCCCCGCGCGAGCGGGGGTCTACCGC	GGTCGAACACGCCGTCGGTCTGCGCGCGCCG
GTCCTCCCCGCGCGAGCGGGGGTCTACCGC	AACTACCAAGCGGGCCACCGCACCCACGCCC
GTCCTCCCCGCGCGAGCGGGGGTCTACCGT	CAGCGGGCGACTTCCGCCCAGCATGTTGTCA
GTCCTCCCCGCGCGAGCGGGGGTCTACCAG	TGCAGCAGGCGGTCCGCGGTGCCGGGCGCGA
GTCCTCCCCGCGCGAGCGGGGGTCTACCGG	GGATCTGCGGGAGGCCGTCTATCCAGGTCTT
GTCCTCCCCGCGCGAGCGGGGGTCTACCGG	TAGTGATCACGAGGCCGAGCCAGGTGGTCAT
GTCCTCCCCGCGCGAGCGGGGGTCTACCGG	CGATCCAGCGCATGCTGCGGTCGCCGCCGAGGCCCTGGGCC
GTCCTCCCCGCGCGAGCGGGGGTCTACCGG	GCATCGGCGGCGCGATGGAGCAGGAGCCCAT
GTCCTCCCCGCGTGAGCGGGGGTCTACCGG	GATTGGGTGCGCCCCCCGGTATGCACCACAG
GTCCTCCCCGCGCGAGCGGGGGTCTACCGG	CGACGCCGCGGGTCCGGATCACCGCGACGTA
GTCCTCCCCGCGCGAGCGGGGGTCTACCGG	ACGCCTACCGCACCGTCGCCGCCCAGCTCCG
GTCCTCCCCGCGCGAGCGGGGGTCTACCGC	ACGTCCGGACGCTGGCGCACTCGACGTACAG
GTCCTCCCCGCGCGAGCGGGGGTCTACCGT	GCTCCAGCCAGTACGGCAGCCACTCGGAGAG
GTCCTCCCCGCGCGAGTGGGGGTCTACCGA	CGCCGACCGCGCCCAGGAGGAGCTGGTCCGC
GTCCTCCCCGCGTTAGCGGGGGCTGCGTTG

>NC_016109|9|3|7272977-7274052|CRT
GTCCTCCCCGCGCGAGCGGGGGTCTACCG	CGTGCCGATCCGAAAATCATGGTCAGGTCTGC
GTCCTCCCCGCGCGAGCGGGGGTCTACCG	GCACAAGAGAGGGGCCGGCGGCTACCGGCCCC
GTCCTCCCCGCGCGAGCGGGGGTCTACCG	CCTGTCGTCAGAACGTGCATACCGTCCAACGG
GTCCTCCCCGCGCGAGCGGGGGTCTACCG	CGGTCGAACACGCCGTCGGTCTGCGCGCGCCG
GTCCTCCCCGCGCGAGCGGGGGTCTACCG	CAACTACCAAGCGGGCCACCGCACCCACGCCC
GTCCTCCCCGCGCGAGCGGGGGTCTACCG	TCAGCGGGCGACTTCCGCCCAGCATGTTGTCA
GTCCTCCCCGCGCGAGCGGGGGTCTACCA	GTGCAGCAGGCGGTCCGCGGTGCCGGGCGCGA
GTCCTCCCCGCGCGAGCGGGGGTCTACCG	GGGATCTGCGGGAGGCCGTCTATCCAGGTCTT
GTCCTCCCCGCGCGAGCGGGGGTCTACCG	GTAGTGATCACGAGGCCGAGCCAGGTGGTCAT
GTCCTCCCCGCGCGAGCGGGGGTCTACCG	GCGATCCAGCGCATGCTGCGGTCGCCGCCGAGGCCCTGGGCC
GTCCTCCCCGCGCGAGCGGGGGTCTACCG	GGCATCGGCGGCGCGATGGAGCAGGAGCCCAT
GTCCTCCCCGCGTGAGCGGGGGTCTACCG	GGATTGGGTGCGCCCCCCGGTATGCACCACAG
GTCCTCCCCGCGCGAGCGGGGGTCTACCG	GCGACGCCGCGGGTCCGGATCACCGCGACGTA
GTCCTCCCCGCGCGAGCGGGGGTCTACCG	GACGCCTACCGCACCGTCGCCGCCCAGCTCCG
GTCCTCCCCGCGCGAGCGGGGGTCTACCG	CACGTCCGGACGCTGGCGCACTCGACGTACAG
GTCCTCCCCGCGCGAGCGGGGGTCTACCG	TGCTCCAGCCAGTACGGCAGCCACTCGGAGAG
GTCCTCCCCGCGCGAGTGGGGGTCTACCG	ACGCCGACCGCGCCCAGGAGGAGCTGGTCCGC
GTCCTCCCCGCGTTAGCGGGGGCTGCGTT

>NC_016109|9|3|7273038-7273990|PILER-CR
GTCCTCCCCGCGCGAGCGGGGGTCTACC	GGCACAAGAGAGGGGCCGGCGGCTACCGGCCCC
GTCCTCCCCGCGCGAGCGGGGGTCTACC	GCCTGTCGTCAGAACGTGCATACCGTCCAACGG
GTCCTCCCCGCGCGAGCGGGGGTCTACC	GCGGTCGAACACGCCGTCGGTCTGCGCGCGCCG
GTCCTCCCCGCGCGAGCGGGGGTCTACC	GCAACTACCAAGCGGGCCACCGCACCCACGCCC
GTCCTCCCCGCGCGAGCGGGGGTCTACC	GTCAGCGGGCGACTTCCGCCCAGCATGTTGTCA
GTCCTCCCCGCGCGAGCGGGGGTCTACC	AGTGCAGCAGGCGGTCCGCGGTGCCGGGCGCGA
GTCCTCCCCGCGCGAGCGGGGGTCTACC	GGGGATCTGCGGGAGGCCGTCTATCCAGGTCTT
GTCCTCCCCGCGCGAGCGGGGGTCTACC	GGTAGTGATCACGAGGCCGAGCCAGGTGGTCAT
GTCCTCCCCGCGCGAGCGGGGGTCTACC	GGCGATCCAGCGCATGCTGCGGTCGCCGCCGAGGCCCTGGGCC
GTCCTCCCCGCGCGAGCGGGGGTCTACC	GGGCATCGGCGGCGCGATGGAGCAGGAGCCCAT
GTCCTCCCCGCGTGAGCGGGGGTCTACC	GGGATTGGGTGCGCCCCCCGGTATGCACCACAG
GTCCTCCCCGCGCGAGCGGGGGTCTACC	GGCGACGCCGCGGGTCCGGATCACCGCGACGTA
GTCCTCCCCGCGCGAGCGGGGGTCTACC	GGACGCCTACCGCACCGTCGCCGCCCAGCTCCG
GTCCTCCCCGCGCGAGCGGGGGTCTACC	GCACGTCCGGACGCTGGCGCACTCGACGTACAG
GTCCTCCCCGCGCGAGCGGGGGTCTACC	GTGCTCCAGCCAGTACGGCAGCCACTCGGAGAG
GTCCTCCCCGCGCGAGTGGGGGTCTACC

Protein	Signature genes	Signature genes Name	Protein_function
NC_016109.1\|WP_014139536.1\|7278215_7281824_-\|cobaltochelatase-subunit-CobN	unknown	unknown	gnl\|CDD\|235663
NC_016109.1\|WP_014139524.1\|7265605_7266250_-\|GTP-cyclohydrolase-II	unknown	unknown	gnl\|CDD\|234745
NC_016109.1\|WP_014139535.1\|7276475_7278041_-\|apolipoprotein-N-acyltransferase	unknown	unknown	gnl\|CDD\|223885
NC_016109.1\|WP_014139529.1\|7270133_7270946_+\|type-I-E-CRISPR-associated-protein-Cas5/CasD	cas5	cd09756_cas5_CAS-I-E	gnl\|CDD\|273842
NC_016109.1\|WP_014139533.1\|7274747_7275671_+\|NADP-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|176191
NC_016109.1\|WP_014139527.1\|7268614_7268896_+\|type-I-E-CRISPR-associated-protein-Cse2/CasB	cse2gr11	pfam09485_cse2gr11_CAS-I-E	gnl\|CDD\|187862
NC_016109.1\|WP_051738438.1\|7266773_7268348_-\|CHAT-domain-containing-protein	unknown	unknown	gnl\|CDD\|378942
NC_016109.1\|WP_106438087.1\|7271673_7272597_+\|type-I-E-CRISPR-associated-endonuclease-Cas1	cas1	cd09719_cas1_CAS-I-E	gnl\|CDD\|274693
NC_016109.1\|WP_014139534.1\|7275667_7276444_+\|VOC-family-protein	unknown	unknown	gnl\|CDD\|319911
NC_016109.1\|WP_014139541.1\|7286886_7288110_+\|cobalt-precorrin-5B-(C(1))-methyltransferase	unknown	unknown	gnl\|CDD\|234615
NC_016109.1\|WP_081539932.1\|7282476_7283802_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|274131
NC_016109.1\|WP_014139540.1\|7286012_7286753_-\|cobalt-precorrin-6A-reductase	unknown	unknown	gnl\|CDD\|236144
NC_016109.1\|WP_014139538.1\|7283798_7284425_+\|precorrin-8X-methylmutase	unknown	unknown	gnl\|CDD\|181352
NC_016109.1\|WP_014139522.1\|7261311_7262379_-\|phosphotransferase	unknown	unknown	gnl\|CDD\|366736
NC_016109.1\|WP_014139530.1\|7270942_7271599_+\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	cas6e	pfam08798_cas6e_CAS-I-E:CAS-IV	gnl\|CDD\|378050
NC_016109.1\|WP_014139528.1\|7268970_7270137_+\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	cas7	pfam09344_cas7_CAS-I-E	gnl\|CDD\|378153
NC_016109.1\|WP_051055470.1\|7262375_7265195_-\|HAD-family-phosphatase	unknown	unknown	gnl\|CDD\|223635
NC_016109.1\|WP_014139532.1\|7272634_7272955_+\|type-I-E-CRISPR-associated-endoribonuclease-Cas2	cas2	pfam09707_cas2_CAS-I-E	gnl\|CDD\|378244
NC_016109.1\|WP_014139542.1\|7288183_7288594_-\|RidA-family-protein	unknown	unknown	gnl\|CDD\|100004
NC_016109.1\|WP_014139539.1\|7284421_7285993_+\|precorrin-2-C(20)-methyltransferase	unknown	unknown	gnl\|CDD\|381173

Protein	Function_ID	Function_description	E-value
NC_016109.1\|WP_014139536.1\|7278215_7281824_-\|cobaltochelatase-subunit-CobN	gnl\|CDD\|235663	PRK05989, cobN, cobaltochelatase subunit CobN; Reviewed.	0
NC_016109.1\|WP_014139524.1\|7265605_7266250_-\|GTP-cyclohydrolase-II	gnl\|CDD\|234745	PRK00393, ribA, GTP cyclohydrolase II RibA.	6.43158e-103
NC_016109.1\|WP_014139535.1\|7276475_7278041_-\|apolipoprotein-N-acyltransferase	gnl\|CDD\|223885	COG0815, Lnt, Apolipoprotein N-acyltransferase [Cell envelope biogenesis, outer membrane].	3.00349e-89
NC_016109.1\|WP_014139529.1\|7270133_7270946_+\|type-I-E-CRISPR-associated-protein-Cas5/CasD	gnl\|CDD\|273842	TIGR01868, hypothetical_protein, CRISPR-associated protein Cas5/CasD, subtype I-E/ECOLI. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family is part of the ECOLI subtype CRISPR/Cas locus, and now characterized as part of the CASCADE complex of that system. It shares a small N-terminal homology region with members of several other CRISPR/Cas subtypes, and we view the families that share this region as being Cas5.	2.10217e-50
NC_016109.1\|WP_014139533.1\|7274747_7275671_+\|NADP-dependent-oxidoreductase	gnl\|CDD\|176191	cd05289, MDR_like_2, alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases. Members identified as zinc-dependent alcohol dehydrogenases and quinone oxidoreductase. QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR actin the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction.	2.32271e-90
NC_016109.1\|WP_014139527.1\|7268614_7268896_+\|type-I-E-CRISPR-associated-protein-Cse2/CasB	gnl\|CDD\|187862	cd09731, Cse2_I-E, CRISPR/Cas system-associated protein Cse2. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Small alpha-helical protein; also known as Cse2/CasB/YgcK family; specific gene for I-E subtype;.	4.86597e-13
NC_016109.1\|WP_051738438.1\|7266773_7268348_-\|CHAT-domain-containing-protein	gnl\|CDD\|378942	pfam12770, CHAT, CHAT domain. These proteins appear to be related to peptidases in peptidase clan CD that includes the caspases. This domain has been termed the CHAT domain for Caspase HetF Associated with Tprs. This family has been identified as a sister group to the separins.	3.43854e-39
NC_016109.1\|WP_106438087.1\|7271673_7272597_+\|type-I-E-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|274693	TIGR03638, cas1_ECOLI, CRISPR-associated endonuclease Cas1, subtype I-E/ECOLI. The CRISPR-associated protein Cas1 is virtually universal to CRISPR systems. CRISPR, an acronym for Clustered Regularly Interspaced Short Palindromic Repeats, is prokaryotic immunity system for foreign DNA, mostly from phage. CRISPR systems belong to different subtypes, distinguished by both nature of the repeats, the makeup of the cohort of associated Cas proteins, and by molecular phylogeny within the more universal Cas proteins such as this one. This model is of type EXCEPTION and provides more specific information than the EQUIVALOG model TIGR00287. It describes the Cas1 protein particular to the ECOLI subtype of CRISPR/Cas system.	1.75e-131
NC_016109.1\|WP_014139534.1\|7275667_7276444_+\|VOC-family-protein	gnl\|CDD\|319911	cd07247, SgaA_N_like, N-terminal domain of Streptomyces griseus SgaA and similar domains. SgaA suppresses the growth disturbances caused by high osmolarity and a high concentration of A-factor, a microbial hormone, during the early growth phase in Streptomyces griseus. A-factor (2-isocapryloyl-3R-hydroxymethyl-gamma-butyrolactone) controls morphological differentiation and secondary metabolism in Streptomyces griseus. It is a chemical signaling molecule that at a very low concentration acts as a switch for yellow pigment production, aerial mycelium formation, streptomycin production, and streptomycin resistance. The structure and amino acid sequence of SgaA are closely related to a group of antibiotics resistance proteins, including bleomycin resistance protein, mitomycin resistance protein, and fosfomycin resistance proteins. SgaA might also function as a streptomycin resistance protein.	2.81783e-29
NC_016109.1\|WP_014139541.1\|7286886_7288110_+\|cobalt-precorrin-5B-(C(1))-methyltransferase	gnl\|CDD\|234615	PRK00075, cbiD, cobalt-precorrin-6A synthase; Reviewed.	1.77782e-159
NC_016109.1\|WP_081539932.1\|7282476_7283802_+\|hypothetical-protein	gnl\|CDD\|274131	TIGR02435, Precorrin-3B_synthase, precorrin-3B synthase. An iron-sulfur protein. An oxygen atom from dioxygen is incorporated into the macrocycle at C-20. In the aerobic cobalamin biosythesis pathway, four enzymes are involved in the conversion of precorrin-3A to precorrin-6A. The first of the four steps is carried out by EC 1.14.13.83, precorrin-3B synthase (CobG), yielding precorrin-3B as the product. This is followed by three methylation reactions, which introduce a methyl group at C-17 (CobJ; EC 2.1.1.131), C-11 (CobM; EC 2.1.1.133) and C-1 (CobF; EC 2.1.1.152) of the macrocycle, giving rise to precorrin-4, precorrin-5 and precorrin-6A, respectively. [Biosynthesis of cofactors, prosthetic groups, and carriers, Heme, porphyrin, and cobalamin].	1.53636e-48
NC_016109.1\|WP_014139540.1\|7286012_7286753_-\|cobalt-precorrin-6A-reductase	gnl\|CDD\|236144	PRK08057, PRK08057, cobalt-precorrin-6x reductase; Reviewed.	3.77071e-102
NC_016109.1\|WP_014139538.1\|7283798_7284425_+\|precorrin-8X-methylmutase	gnl\|CDD\|181352	PRK08285, cobH, precorrin-8X methylmutase; Reviewed.	1.08622e-125
NC_016109.1\|WP_014139522.1\|7261311_7262379_-\|phosphotransferase	gnl\|CDD\|366736	pfam01636, APH, Phosphotransferase enzyme family. This family consists of bacterial antibiotic resistance proteins, which confer resistance to various aminoglycosides they include: aminoglycoside 3'-phosphotransferase or kanamycin kinase / neomycin-kanamycin phosphotransferase and streptomycin 3''-kinase or streptomycin 3''-phosphotransferase. The aminoglycoside phosphotransferases inactivate aminoglycoside antibiotics via phosphorylation. This family also includes homoserine kinase. This family is related to fructosamine kinase pfam03881.	8.23078e-07
NC_016109.1\|WP_014139530.1\|7270942_7271599_+\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	gnl\|CDD\|378050	pfam08798, CRISPR_assoc, CRISPR associated protein. This domain forms an anti-parallel beta strand structure with flanking alpha helical regions.	3.83163e-57
NC_016109.1\|WP_014139528.1\|7268970_7270137_+\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	gnl\|CDD\|378153	pfam09344, Cas_CT1975, CT1975-like protein. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family is represented by CT1975 of Chlorobium tepidum.	3.08736e-140
NC_016109.1\|WP_051055470.1\|7262375_7265195_-\|HAD-family-phosphatase	gnl\|CDD\|223635	COG0561, Cof, Predicted hydrolases of the HAD superfamily [General function prediction only].	1.63811e-14
NC_016109.1\|WP_014139532.1\|7272634_7272955_+\|type-I-E-CRISPR-associated-endoribonuclease-Cas2	gnl\|CDD\|378244	pfam09707, Cas_Cas2CT1978, CRISPR-associated protein (Cas_Cas2CT1978). This entry represents a minor branch of the Cas2 family of CRISPR-associated protein which are found in IPR003799. Cas proteins are found adjacent to a characteristic short, palindromic repeat cluster termed CRISPR, a probable mobile DNA element.	2.28736e-41
NC_016109.1\|WP_014139542.1\|7288183_7288594_-\|RidA-family-protein	gnl\|CDD\|100004	cd00448, YjgF_YER057c_UK114_family, YjgF, YER057c, and UK114 belong to a large family of proteins present in bacteria, archaea, and eukaryotes with no definitive function. The conserved domain is similar in structure to chorismate mutase but there is no sequence similarity and no functional connection. Members of this family have been implicated in isoleucine (Yeo7, Ibm1, aldR) and purine (YjgF) biosynthesis, as well as threonine anaerobic degradation (tdcF) and mitochondrial DNA maintenance (Ibm1). This domain homotrimerizes forming a distinct intersubunit cavity that may serve as a small molecule binding site.	2.60982e-33
NC_016109.1\|WP_014139539.1\|7284421_7285993_+\|precorrin-2-C(20)-methyltransferase	gnl\|CDD\|381173	cd11646, Precorrin_3B_C17_MT, Precorrin-3B C(17)-methyltransferase (also named CobJ or CbiH). Precorrin-3B C(17)-methyltransferase participates in the pathway toward the biosynthesis of cobalamin (vitamin B12). There are two distinct cobalamin biosynthetic pathways. The aerobic pathway requires oxygen, and cobalt is inserted late in the pathway; the anaerobic pathway does not require oxygen, and cobalt insertion is the first committed step towards cobalamin synthesis. This model includes CobJ of the aerobic pathway and CbiH of the anaerobic pathway, both as stand-alone enzymes and when CobJ or CbiH form part of bifunctional enzymes, such as in Mycobacterium tuberculosis CobIJ where CobJ fuses with a precorrin-2 C(20)-methyltransferase domain, or Bacillus megaterium CbiH60, where CbiH is fused to a nitrite and sulfite reductase-like domain. In the aerobic pathway, once CobG has generated precorrin-3b, CobJ catalyzes the methylation of precorrin-3b at C-17 to form precorrin-4 (the extruded methylated C-20 fragment is left attached as an acyl group at C-1). In the corresponding anaerobic pathway, CbiH carries out this ring contraction, using cobalt-precorrin-3b as a substrate to generate a tetramethylated delta-lactone.	1.68202e-108

>NC_016109.1|WP_014139532.1|7272634_7272955_+|type-I-E-CRISPR-associated-endoribonuclease-Cas2
MASLTVLSMTAVPDHLRGALTRWLLEVTPQLYVGTVSAKVREELWSSVSNCIADGVAVLVHPAANEQGFALRTAGTQRRQPIDFDGLLLIAQTRATTPEGQEIAKP
>NC_016109.1|WP_106438087.1|7271673_7272597_+|type-I-E-CRISPR-associated-endonuclease-Cas1
MLPRIADSLSFLYLDLVRVVQDDTGVRAEINTTQRGTETVHLPTAALSCVLLGPGTSITARALATLARHGTTVLIAGSGGVRCYAATLPESLSTTWLEHQARAWADDQRRMAVAIAMYRRRFGDTDLPTDVNLDTLRGKEGQRVKAHYRLLAQQHRIGRFRRTYDPDSWDTQDPVNLALSAANTCLYGIVHAAILALGCSPALGFVHNGNQQAFVYDIADLYKAELTIPLAFSLHSSSEPEAEARRGFREGLRLFKLLPRIVTDIQRLLAPGTDIATPDPDEQLVDLWDPVLGAVPGGVNYSTGEAQ
>NC_016109.1|WP_014139530.1|7270942_7271599_+|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE
MTLWLTRIIPDQRHRDVHCDGDDAVNLHHRIMSLFPDDVPSTEPRRHLGILFRTETGRDGDQILLQSNREPDLAQLPAGYGSAATKPLTPLLDALRKGLPVRYRIAANAVRKPGATTRALYRLPEVVPLNGPHADEWWTRQAETSGLTLTTLHSTPLDAATGHRRQHQQRVHHARTLFEGTAHITDPDLLRTRIREGIGRGKAYGCGLLSIAPRREPS
>NC_016109.1|WP_014139529.1|7270133_7270946_+|type-I-E-CRISPR-associated-protein-Cas5/CasD
MSAEAGLLLHLAGPLQSWGERSKFNERDTAPFPTRSGVIGLLACALGRRRGEDIDDLARLSLTVRADRPGVLLRDLHTVGGGLPARHTVTTAEGKKRPAAAATLLSHRYYLADAVFTAALTGPADTLRTCAAALREPFWPPYLGRRSCPPEGPLLLGEFDDIHRRLVELPLARTRRGTADTVPVVFHGDRPLGGLAPAETGAPDGNEAAGQVNDQPLTFHPQRRAHQSRPRYQRTLHLPAERCHGLGTDYLHALAAYLAPHTPRPESSPA
>NC_016109.1|WP_014139528.1|7268970_7270137_+|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC
MAAKSGTGAVARFVDVHVVQSVPFANLNRDDNNSVKTVSYGGAERTRVSSQSWKRAARTYFQERMGEAALRTRRIGERVARLLEEERDWPATLAARAGQHVAAGSSIKFEVDGDSAAVTTNAMVYVPGSAVAELADLAEEFRGVLEAAKDVRKPSDKSALPKDRIDAVLRSRNGVINLFGRMLAEVDDAGVDGAVQVAHALTTHGTDIELDYFSAVDDVTDFWGDTTGSAHMGHAEFSAGVFYRFATIDLKELADNLGGDLAAARELAAGFTEAFVLSLPQAKKTATAPHTIPDLVHIAVRSDRPLSFAAAFEKPVRPGREGGYSEPSRDALAKYATAANTLLGNRGVVAAGWAGTDEKNPKELGERAVSFPALIDTAIAAAYPQVGQ
>NC_016109.1|WP_014139527.1|7268614_7268896_+|type-I-E-CRISPR-associated-protein-Cse2/CasB
MRESSAETRLNLLSRQSVDGLHRHLPGAVRQLREAGAPVDWAQLLVDLARWRRYGGEIKRRWLQDFYRERYRSGVRAALEVDDAEGVGADVGK
>NC_016109.1|WP_051738438.1|7266773_7268348_-|CHAT-domain-containing-protein
MERGDAPAALTGYRTAVDVLLPRLADRGLPRASRLAQIAQVPRLASDAAAAATAVGDLPGAVRLLEQGRSVIWSQLLQTRTDRTVLRERHSALAAEFDAICAALETGGPGPGGPGPVGRPGPGPEQGEQPWQLSERFDDVLTRIRRLDDFEHFLEPPTFGELRRVADDGPVAVINISAHRCDALILRSVPGVPPVALVPLAGVTAAEVDQRATEFLAAVERLSRVSPEPGPAEKVRLTKRIDDTLAWLWTEITRPVLAALGLDRPGATTPRLWWCPTGALAQLPLHAAGPKDGPRVIDLVVSSYTPTLNSLIRARARPATPRPHLLGVGVRQSAPGDGSTGAQPELPGVSVELAMLADLFGDRYSGRADRDAVLSGVLADLPAHPWVHFACHGVHSATDPAASHLALYDGPLPVAGVAEQDLSGAELAFLSACHTALGNRRLADEAVHLAAAFQLAGYQHVVGTLWALDDGPAPHVARDFYRSLETAGSAADSARALHDAVQRLRREPDHRAPLHWASYVHLGP
>NC_016109.1|WP_014139524.1|7265605_7266250_-|GTP-cyclohydrolase-II
MTATVIPEATVRTRVRVPLHFGDGYSVDSELVTFHGLADGLEHLAVVLGNPSATPVPLVRLHSECLTGDVFGSARCDCGPQLREAVEKITEHGGYLLYLRQEGRGIGLYNKLDAYRLQDLGHDTYAANTALGLPEDARDYTAAAQMLTALDATAVDLLSNNPDKSGQLQALGIQVHNRVPTGAHTTPHNLTYLRTKVRGTTDLPAHDLLASRIA
>NC_016109.1|WP_051055470.1|7262375_7265195_-|HAD-family-phosphatase
MSPRPASAAGPGEPPPQARAGPVRPADPRATVAELAGELGTTARAGDPLDAFLAAAGMLQAAEDRLAGGRTVPGRLVRHLREGGGSGGGPVGAAFDRTAAALAARAPALRPAALWTRLVADAVDDLAALVLRPAPLPSALYRRLDRLAARLTGTPVLRRVLGSAVRRPPSCFCGFDQYPDDLAELARRFDAARPLPADLPLLVVGVRTSGSYLGPLLAAALRQAGHRAVTAATVRPGQAVLAGRERELAWLLAAGGQALVVDEPPVTGGSPARVATGLCARGFPAGAVSVLVAVAREAPALPPHLVVALPEPDWRVRRLTAPDALEALVRRSVPGAADWPRVEVGPVRSPGRGLHRSAPVTGHPAGGPPVPLRVETVGLGALGRRAADYAALLPGLVPEVLAIEGGLMIRRELPTGVPALTEADPAEAAETVPAEAAARYVAARQRVLAVGVDRSGRPAGRGAVREEAGRLFAPLFGRAATVLRPLLADPVARRLTRAARPYLVDGRTSAGRWTGRDGRWVKTDWAEGAFGPLDLASYDAAWDLAGLAGSPAALEPPERADRADRAAEVRPAYERLTGERIGAARWCLARLVRAGHGGADGPAERNARRRELSQAVQEFLAEEYLAGLPAAGPRDGPGAGWCVLEVDGVLETDPLGFPAGSPLGMLALRALRAHGFRPLLATGRSLPELRDRCRAYGLAGGAAEYGAVAHLPGREPLPVADRDGAEVRALVGQSADLAVDPLARWTTRVSRRQPDGRYTGLDGRTAGRIAAATGTMPIAGEQQSDFLPPGAGKVAGVRALLAELGDPGAVPVFAVGGGPADLELLQWARHGAAPAQAPAELRAVARFSASPYQAGLAQAVAGLLGHRPGGCARCRPPRPSPAGRALLALLAVPEAGRAGRPARLAELAYRAAWLASAGEQRGAGEREAGERGAGERGGG
>NC_016109.1|WP_014139522.1|7261311_7262379_-|phosphotransferase
MTGRVPVRELLGVREVAGGLLLVPPGVAGRAADELRLRWAGRELGRGRWEAVARGCSDVLVARRRSAGGGPPVLVKCPRTGEAVRALVRERDAVAVLGAQLAPSGLRELLPQTLDSRLGARPPVLVQGVLPGLPGDVLLARRPGLSAALTASAFAVLDEVRGATGGSSRDGRLVDGWLGHRLAVLSDRVRWCRGAEGTAGLLALRALLRSELTGRPVEVAWTHGDFTPGNLLVREPGPHPLADPSRTTGSPEITGVVDWADALADGPAVVDRASFALALGRLLDGRSWGAQTVQALRAGVLHRPETGGIPLSGALLAWLWHVSGNLEKSRRLARNRHWLREVLVPVLRELAGTAG
>NC_016109.1|WP_014139533.1|7274747_7275671_+|NADP-dependent-oxidoreductase
MAKAFGFVAYGGPEQQEFLDRPTPAPGPGALRIRVVAAGVNPADWKKRQGLFGTDDAPPQVMGSEAAGVVTALGEGVRGFREGDEVFGTTIGGAFAEEALLPARATAHKPRTVGFAEAAALPVAAATAYDALDQLAALGLRAGQTLLVVGVAGGVGTAAAQIARGRGLTVLGTAGEGSAAHVRALGATPVRYGPGVADRLRAVAPDGVDAVLDLVGGDAVREVAGALRAPGRLVSTADPATAAELGGAYVRRDGTAAPLAALAELVAAGTLDPHISGRYPLERAAEAMAEVETGHARGKLILEMSRP
>NC_016109.1|WP_014139534.1|7275667_7276444_+|VOC-family-protein
MKTTNPSPGAPCWVELATKDPAAAKAFYHELFGWRAEVVPDEKAMGYTRLYLGEQLVAGLSALMHPEQPTAWTIGFHTPDTDITADEIADADGKLIVPPTDALDWGRFAVAADPTGAVFSTWQPDTLRGVDLRDEPGALGWVELATHEPGTAAEFYQRVFGWSVNSGDMYTRFGLGGSDFGGMTDMSDQFPAGTSPYWMPYFVVADTDLGAERAALLGATVTLPPTDVPDGPRLAVLRDPQGALFGLHVPEEREEREE
>NC_016109.1|WP_014139535.1|7276475_7278041_-|apolipoprotein-N-acyltransferase
MSLRTALTRPARYGALASGVLPVLTFPGAGLAWLAWAALVPGLLLMRAAGGAREAVVRGWWFGAGFILTGMYWLIPSIGPGLPVLAVLFGVLQAPFGLAAWWLLHGEPTLRRAAAALAVLPAVWVCAEYARSWNALGGPWALFGATQWEHPAVLGLASIGGVWLVSWALVAANTALAVLLCAHGSRVRALAGATALSSVLAGPLVFAAQAAPATSGSASVTLVQAGSTPDEQARLEANARITRSLAGRPTDLIVWGESSTTEDLDRRPETVARLAALSRLTGAQLLVGEDARKADGRISKDAVLVDGSGVLARYRKIRLVPFGEYIPLRPLLGWIAGVSAAAGENRAPGSSVHLLPVADRDGRALPVGALVCFESAFPDMSRTMARQGAALIVYQSATSTFQSTWAPAQHASLGALRAAETGRPVVQAALTGESVAYDAQGRRLVRLGTDGSGAVTADLALADPAARTWYVRLGDWVPMLSLAAVLAAAATAAGPALRERRRRRPGPPAASAPTDVPPARV
>NC_016109.1|WP_014139536.1|7278215_7281824_-|cobaltochelatase-subunit-CobN
MILLLSTSDTDLLSARAADGPVPFRWANPSRLSPEELPALLDGVELVVVRLLGGRRAWQEGLDALLAGPRPVVVLTGEQAPDAQLMELSTVPAGIAAEAHAYLAHGGPANLAELGAFLSDTVLLTGHGFASPASAPSWGPLEREARDAGGPVVAVLYYRAHHMSGNTAFVETLCRAVEDQGARARAYFCASLRGAEPELLAELGAADVIVTTVLAAGGTRPADAQAGGDEEAWDAGALAALDRPILQALCLTWSREQWEGSDDGLSPLDTATQVAVPEFDGRLITVPFSFKEVDEDGLTVYAADPERAARVAGIAVRHARLRHTPAAERRLALVLSAYPTKHARVGNAVGLDTPASAIRLLERLRAEGMDLGDSLPGFHTDAGGGHEGDALIHALIDAGGYDQAWLTEEQLARNPVRIPAADYRRWYATLPAALRERVEEHWGPAPGELYVDRSRNPDGDLVLAGIRSGNLLVLVQPPRGFGENPVAIYHDPDLPPSHHYLAAYRWIAADRADGGFGAHAVVHLGKHGNLEWLPGKTAALSAECGPDAALGDLPLVYPFLVNDPGEGTQAKRRAHATLVDHLVPPMARADSYGDIARLEQLLDEHSNIAAMDPAKLPAIRAQIWTLIQAAKLDHDLGLAERPEDDGFDDFLLHVDGWLCEVKDAQIRDGLHVLGQAPTGTDRVNIVLSILRARQIWGGVSALPGLREALGLDEAALTLGATDAAEAKARSLVEAMEAEDWNPAAVAKVAEGLPAAVAEVLSFAATQLVPRLAATTDELDAVLHALRGGFVPAGPSGSPLRGLVNVLPTGRNFYSVDPKAVPSRLAWETGQALAASLIERYRADNDGQFPPSVGLSLWGTSAMRTAGDDIAEAFALLGVRPVWDDASRRVTGLEAVPAEELGRPRIDVTLRISGFFRDAFPHVVALLDDAVRLAARQEEPAEQNFVRAHVQADLAEHGDERRATVRVFGSRPGTYGAGLLQLIDSRDWRTDADLAEVYTVWGGYAYGRGLDGRPAREEMESAYRRITVAAKNTDTREHDIADSDDYFQYHGGMVATVRALTGASPAAYIGDSTRPETVRTRTLTEEAARVFRARVVNPRWLEAMRRHGYKGAFEMAATVDYLFGYDATTGVVADWMYEKLTQEYVLDPVNREFFADANPWALHGIAERLLEAAGRGLWAEPDAALLDELRQVLLETEGELEGE
>NC_016109.1|WP_081539932.1|7282476_7283802_+|hypothetical-protein
MLAAMPPTPDATQAPSVGPDRGRADACPGALRLHAAEDGHLARLRLPGGQLTHRQMNAVADAADALGNGDIEITSRGNAQLRGLTAHCAADLAERLRAVGLLPSDTHERVRNIVASPLAGLDGHGTGGEQITDWVRELDLALCAAPWAAALSGKFLFALDDGRGDVAALDADVTLIAVGDGRALLRYGRAPRATAVDTTAGTPVAAALDAARRILDLAAGRAWHAREIQHALPAGDTPLPPPLGGGRTALGRLPGALSVAPRLGRASSAQWRLLAEALGPAAPDRARLTPWRGVVLPHADPDWLPRLAAAGFRTAPGGPWEGVTACTGLPGCAKSRADVRAQAARAVAAAPATGLPVHWSGCERRCGHPAGRWVDVLATPTGHRVTLDGATRDTAPDETAGAVAAARATQGASTESPTVQTSTAQSPTTVQSPTAPRRRPA
>NC_016109.1|WP_014139538.1|7283798_7284425_+|precorrin-8X-methylmutase
MIEYEKDGAAIYRQSFATIRAEANLAHLPADVARVAVRMIHACGMTDLVDDLLWSPNAVADARRALLAGAPILCDVNMVASGVTRKRLPADNEVLCTLTDPAVPELARAMGTTRSAAAMELWLPRLEGAVVAVGNAPTSLFRLLEMIEAGAPRPAAVIGVPVGFIGAAESKQALAEHPAALEHLVVRGRRGGSAIAAAAINAIASEEE
>NC_016109.1|WP_014139539.1|7284421_7285993_+|precorrin-2-C(20)-methyltransferase
MTDSQHTGKLYGVGVGPGDPSLLTVRAAELIGKADVIAYHCARHGRSHARAIAERYLTGRQIEERLMYPVTVETTDHPGGYRGALDDFYQEAAARLAAHLDAGRDVVVLAEGDPFFYGSYQHMHKRLAHRYPTEVVPGVTSISAAAARLGTPLVEAEEVLTVIPGTLPEEELTARLAATDSAVVMKLGRTFPAVRRALERAGRLDEARYVERATMDGERTGRLADVDPDGVPYFAVAVLPSRVAALDSAGRPFEAPDDSAEPAVGGAVGDAGQAPGEVVVVGTGPAGPLWLTPEARGALANATDLVGYTTYLDRVPVRAGQVRHGSDNKVEGVRAEFALELARRGRRVAVVSSGDPGVFAMATAVLEAACADPYREVPVRVLPGMTAAHAAASRAGAPLGHDYAVVSLSDRLKPWEVIARRLRAAAEADLVLALYNPGSKSRTTQVGSARDLLLEYRDPQTPVVMARDVGGPTERIRTVALAELDPAEVDMRTLLLVGSTQTQWVRRGADSEVVWTPRRYPEQ
>NC_016109.1|WP_014139540.1|7286012_7286753_-|cobalt-precorrin-6A-reductase
MHVLILGGTSEARRLADVLAADPALRVTSSLAGRVAQPRLPAGEVRIGGFGGPEGLAAWLRAHAVDALLDATHPFAERISRNAALAAAGTGTPLLALRRPSWEAREGDRWHPVPSLAAAAEALPGLGTRVFLTTGRQGIAAFAHLDGLVFLARSVEPPVAPMPAVTEVLLERGPFTLDGERELLRAHRIEVLVTKDSGSAATAPKLTAARELGLPVVVVERPPAPAGVRTAPDVAGAADWVRRLAG
>NC_016109.1|WP_014139541.1|7286886_7288110_+|cobalt-precorrin-5B-(C(1))-methyltransferase
MSDEAQGEQQGHGQEQEQEQEQEQGQGHERGQTPAQAPSGGRKGQLRSSGLRPGWTTGACATAATKAAYTALLGGGFPDPVVITLPKGERPAFALAVEELGEGWASAGVVKDAGDDPDVTHGALVRSTVRPGPPGSGVVFRAGPGVGTVTKPGLPLPVGEPAVNPVPRQLMREVIAEVARAYGGSGDVEVELSVDHGEEIARHTWNPRLGILGGLSILGTTGVVVPYSCSAWIDSIRRGIDVARAAGRTHVAGATGSTSEKVVVAEYGLPEDALLDMGDFAGAVLKYLRRHPVPRLTVCGGFAKLSKLAAGHLDLHSGRSQVDKAQLAALAREGGADEELTARVAAANTALEAVQSCAAAGVPLGDLVAERARATALGVLLGAPVTVDVICIDRAGTVVGRAAPEGP
>NC_016109.1|WP_014139542.1|7288183_7288594_-|RidA-family-protein
MSDKIEVRTDGAPAPAWVFSQGVRKGPILQVSGQGPQDPATGEYLYHGDVKAQTRRTLENVKAIVEAGGASIEDVVMFRVYLTKRADFPLMNEVYAQFIEENIAPGGVKPCRTTIFVELPQEPMLVEIDAQAVVTG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NC_016109.1	3733796-3733827	0	1.0
NC_016109_2	2.16\|613290\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613290-613322	33	NC_016109.1	3733795-3733827	0	1.0
NC_016109_3	3.9\|624046\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624046-624078	33	NC_016109.1	3709668-3709700	0	1.0
NC_016109_4	4.1\|1931832\|57\|NC_016109\|CRISPRCasFinder	1931832-1931888	57	NC_016109.1	1932246-1932302	1	0.982

1. spacer 2.4|613290|32|NC_016109|CRT matches to position: 3733796-3733827, mismatch: 0, identity: 1.0

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
cgacctggacgcggtgcgcgccgcgttcgccg	Protospacer
********************************

2. spacer 2.16|613290|33|NC_016109|CRISPRCasFinder,PILER-CR matches to position: 3733795-3733827, mismatch: 0, identity: 1.0

cgacctggacgcggtgcgcgccgcgttcgccgc	CRISPR spacer
cgacctggacgcggtgcgcgccgcgttcgccgc	Protospacer
*********************************

3. spacer 3.9|624046|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to position: 3709668-3709700, mismatch: 0, identity: 1.0

gcaaccggggcggttgtcgtgacggagaaacgt	CRISPR spacer
gcaaccggggcggttgtcgtgacggagaaacgt	Protospacer
*********************************

4. spacer 4.1|1931832|57|NC_016109|CRISPRCasFinder matches to position: 1932246-1932302, mismatch: 1, identity: 0.982

ggacttcaaccccttcgcacccccggcccccagcaccaccacccccgccgaggcccc	CRISPR spacer
ggacttcaaccccttcgcgcccccggcccccagcaccaccacccccgccgaggcccc	Protospacer
******************.**************************************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_016109_9	9.14\|7273810\|31\|NC_016109\|CRISPRCasFinder	7273810-7273840	31	NZ_CP007129	Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence	1039040-1039070	4	0.871
NC_016109_1	1.1\|591426\|28\|NC_016109\|CRISPRCasFinder	591426-591453	28	NZ_AP020329	Mycobacterium avium subsp. hominissuis strain JP-H-1 plasmid p3-JPH1, complete sequence	3399-3426	5	0.821
NC_016109_1	1.1\|591426\|28\|NC_016109\|CRISPRCasFinder	591426-591453	28	NZ_CP015271	Mycobacterium chimaera strain ZUERICH-2 plasmid unnamed 4, complete sequence	4038-4065	5	0.821
NC_016109_1	1.1\|591426\|28\|NC_016109\|CRISPRCasFinder	591426-591453	28	NZ_CP015277	Mycobacterium chimaera strain ZUERICH-1 plasmid unnamed 5, complete sequence	8338-8365	5	0.821
NC_016109_1	1.1\|591426\|28\|NC_016109\|CRISPRCasFinder	591426-591453	28	NZ_CP012888	Mycobacterium chimaera strain AH16 plasmid unnamed3, complete sequence	9867-9894	5	0.821
NC_016109_1	1.1\|591426\|28\|NC_016109\|CRISPRCasFinder	591426-591453	28	NZ_CP022225	Mycobacterium chimaera strain SJ42 plasmid unnamed2, complete sequence	5014-5041	5	0.821
NC_016109_1	1.1\|591426\|28\|NC_016109\|CRISPRCasFinder	591426-591453	28	NZ_CP045968	Mycobacterium chimaera strain AUSMDU00007395 plasmid pAUSMDU00007395_05, complete sequence	11746-11773	5	0.821
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	1626596-1626627	5	0.844
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	186665-186696	5	0.844
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NZ_LR594676	Variovorax sp. PBS-H4 plasmid 2	81466-81497	5	0.844
NC_016109_2	2.6\|613412\|32\|NC_016109\|CRT	613412-613443	32	NC_016655	Rhodococcus phage REQ1, complete genome	11296-11327	5	0.844
NC_016109_2	2.6\|613412\|32\|NC_016109\|CRT	613412-613443	32	NZ_CP032325	Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence	232614-232645	5	0.844
NC_016109_3	3.24\|624961\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624961-624993	33	NZ_CP017104	Rhizobium gallicum strain IE4872 plasmid pRgalIE4872c, complete sequence	60309-60341	5	0.848
NC_016109_3	3.24\|624961\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624961-624993	33	CP006879	Rhizobium gallicum bv. gallicum R602 plasmid pRgalR602b, complete sequence	63108-63140	5	0.848
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP040821	Paraoceanicella profunda strain D4M1 plasmid pD4M1C, complete sequence	172581-172612	5	0.844
NC_016109_9	9.7\|7273373\|31\|NC_016109\|CRISPRCasFinder	7273373-7273403	31	MN234205	Mycobacterium phage Veliki, complete genome	12240-12270	5	0.839
NC_016109_9	9.7\|7273373\|31\|NC_016109\|CRISPRCasFinder	7273373-7273403	31	MH727544	Mycobacterium phage Dalmuri, complete genome	12240-12270	5	0.839
NC_016109_9	9.7\|7273373\|31\|NC_016109\|CRISPRCasFinder	7273373-7273403	31	MH001453	Mycobacterium phage Adonis, complete genome	12212-12242	5	0.839
NC_016109_9	9.7\|7273373\|31\|NC_016109\|CRISPRCasFinder	7273373-7273403	31	JF704105	Mycobacterium phage Adephagia, complete sequence	12203-12233	5	0.839
NC_016109_9	9.7\|7273373\|31\|NC_016109\|CRISPRCasFinder	7273373-7273403	31	MN234182	Mycobacterium phage Geraldini, complete genome	12216-12246	5	0.839
NC_016109_9	9.7\|7273373\|31\|NC_016109\|CRISPRCasFinder	7273373-7273403	31	MN234198	Mycobacterium phage Zavala, complete genome	12181-12211	5	0.839
NC_016109_9	9.7\|7273373\|31\|NC_016109\|CRISPRCasFinder	7273373-7273403	31	MF140412	Mycobacterium phage Jeckyll, complete genome	12240-12270	5	0.839
NC_016109_9	9.7\|7273373\|31\|NC_016109\|CRISPRCasFinder	7273373-7273403	31	KY380102	Mycobacterium phage CREW, complete genome	12240-12270	5	0.839
NC_016109_9	9.7\|7273373\|31\|NC_016109\|CRISPRCasFinder	7273373-7273403	31	KX585253	Mycobacterium phage HedwigODU, complete genome	12203-12233	5	0.839
NC_016109_9	9.7\|7273373\|31\|NC_016109\|CRISPRCasFinder	7273373-7273403	31	MH536822	Mycobacterium phage Joy99, complete genome	12169-12199	5	0.839
NC_016109_9	9.7\|7273373\|31\|NC_016109\|CRISPRCasFinder	7273373-7273403	31	MF140428	Mycobacterium phage Slimphazie, complete genome	12204-12234	5	0.839
NC_016109_9	9.7\|7273373\|31\|NC_016109\|CRISPRCasFinder	7273373-7273403	31	KJ567045	Mycobacterium phage Emerson, complete genome	12200-12230	5	0.839
NC_016109_9	9.7\|7273373\|31\|NC_016109\|CRISPRCasFinder	7273373-7273403	31	MK460247	Mycobacterium phage YoureAdopted, complete genome	12173-12203	5	0.839
NC_016109_9	9.7\|7273373\|31\|NC_016109\|CRISPRCasFinder	7273373-7273403	31	JN185608	Mycobacterium virus JAWS, complete genome	12194-12224	5	0.839
NC_016109_9	9.7\|7273373\|31\|NC_016109\|CRISPRCasFinder	7273373-7273403	31	MN234231	Mycobacterium phage Rapunzel97, complete genome	12204-12234	5	0.839
NC_016109_9	9.7\|7273373\|31\|NC_016109\|CRISPRCasFinder	7273373-7273403	31	MN908692	Mycobacterium Phage BGlluviae, complete genome	12240-12270	5	0.839
NC_016109_9	9.7\|7273373\|31\|NC_016109\|CRISPRCasFinder	7273373-7273403	31	NC_023747	Mycobacterium phage BarrelRoll, complete genome	12192-12222	5	0.839
NC_016109_9	9.7\|7273373\|31\|NC_016109\|CRISPRCasFinder	7273373-7273403	31	MH536821	Mycobacterium phage Homura, complete genome	12240-12270	5	0.839
NC_016109_9	9.7\|7273373\|31\|NC_016109\|CRISPRCasFinder	7273373-7273403	31	MF668267	Mycobacterium phage Apocalypse, complete genome	12177-12207	5	0.839
NC_016109_9	9.7\|7273373\|31\|NC_016109\|CRISPRCasFinder	7273373-7273403	31	MH697578	Mycobacterium phage Belladonna, complete genome	12240-12270	5	0.839
NC_016109_9	9.7\|7273373\|31\|NC_016109\|CRISPRCasFinder	7273373-7273403	31	MH077577	Mycobacterium phage AlishaPH, complete genome	12199-12229	5	0.839
NC_016109_9	9.7\|7273373\|31\|NC_016109\|CRISPRCasFinder	7273373-7273403	31	MH509444	Mycobacterium phage BEEST, complete genome	12240-12270	5	0.839
NC_016109_9	9.7\|7273373\|31\|NC_016109\|CRISPRCasFinder	7273373-7273403	31	MN369742	Mycobacterium phage Spock, complete genome	12240-12270	5	0.839
NC_016109_9	9.7\|7273373\|31\|NC_016109\|CRISPRCasFinder	7273373-7273403	31	MK112537	Mycobacterium Phage Capricorn, complete genome	12240-12270	5	0.839
NC_016109_9	9.7\|7273373\|31\|NC_016109\|CRISPRCasFinder	7273373-7273403	31	MN369746	Mycobacterium phage Inky, complete genome	12240-12270	5	0.839
NC_016109_9	9.7\|7273373\|31\|NC_016109\|CRISPRCasFinder	7273373-7273403	31	MH051246	Mycobacterium phage ActinUp, complete genome	12203-12233	5	0.839
NC_016109_9	9.7\|7273373\|31\|NC_016109\|CRISPRCasFinder	7273373-7273403	31	MH513977	Mycobacterium phage Mynx, complete genome	12223-12253	5	0.839
NC_016109_9	9.7\|7273373\|31\|NC_016109\|CRISPRCasFinder	7273373-7273403	31	MN234197	Mycobacterium phage Ramen, complete genome	12203-12233	5	0.839
NC_016109_9	9.7\|7273373\|31\|NC_016109\|CRISPRCasFinder	7273373-7273403	31	MH371113	Mycobacterium phage Beezoo, complete genome	12216-12246	5	0.839
NC_016109_9	9.13\|7273749\|31\|NC_016109\|CRISPRCasFinder	7273749-7273779	31	NZ_CP011665	Streptomyces sp. Mg1 plasmid pSMg1-1, complete sequence	20478-20508	5	0.839
NC_016109_9	9.14\|7273810\|31\|NC_016109\|CRISPRCasFinder	7273810-7273840	31	NZ_CP049749	Rhodococcus fascians A21d2 plasmid pA21d2, complete sequence	58305-58335	5	0.839
NC_016109_9	9.16\|7273932\|31\|NC_016109\|CRISPRCasFinder	7273932-7273962	31	NZ_CP017756	Cupriavidus malaysiensis strain USMAA1020 isolate pure plasmid unnamed1, complete sequence	144049-144079	5	0.839
NC_016109_9	9.17\|7273993\|31\|NC_016109\|CRISPRCasFinder	7273993-7274023	31	NC_004808	Streptomyces rochei plasmid pSLA2-L DNA, complete sequence	25561-25591	5	0.839
NC_016109_9	9.17\|7273993\|31\|NC_016109\|CRISPRCasFinder	7273993-7274023	31	NC_023316	Streptomyces sp. 14R-10 plasmid pZL1, complete sequence	35729-35759	5	0.839
NC_016109_9	9.24\|7273372\|32\|NC_016109\|CRT	7273372-7273403	32	MN234205	Mycobacterium phage Veliki, complete genome	12239-12270	5	0.844
NC_016109_9	9.24\|7273372\|32\|NC_016109\|CRT	7273372-7273403	32	MH727544	Mycobacterium phage Dalmuri, complete genome	12239-12270	5	0.844
NC_016109_9	9.24\|7273372\|32\|NC_016109\|CRT	7273372-7273403	32	MH001453	Mycobacterium phage Adonis, complete genome	12211-12242	5	0.844
NC_016109_9	9.24\|7273372\|32\|NC_016109\|CRT	7273372-7273403	32	JF704105	Mycobacterium phage Adephagia, complete sequence	12202-12233	5	0.844
NC_016109_9	9.24\|7273372\|32\|NC_016109\|CRT	7273372-7273403	32	MN234182	Mycobacterium phage Geraldini, complete genome	12215-12246	5	0.844
NC_016109_9	9.24\|7273372\|32\|NC_016109\|CRT	7273372-7273403	32	MN234198	Mycobacterium phage Zavala, complete genome	12180-12211	5	0.844
NC_016109_9	9.24\|7273372\|32\|NC_016109\|CRT	7273372-7273403	32	MF140412	Mycobacterium phage Jeckyll, complete genome	12239-12270	5	0.844
NC_016109_9	9.24\|7273372\|32\|NC_016109\|CRT	7273372-7273403	32	KY380102	Mycobacterium phage CREW, complete genome	12239-12270	5	0.844
NC_016109_9	9.24\|7273372\|32\|NC_016109\|CRT	7273372-7273403	32	KX585253	Mycobacterium phage HedwigODU, complete genome	12202-12233	5	0.844
NC_016109_9	9.24\|7273372\|32\|NC_016109\|CRT	7273372-7273403	32	MH536822	Mycobacterium phage Joy99, complete genome	12168-12199	5	0.844
NC_016109_9	9.24\|7273372\|32\|NC_016109\|CRT	7273372-7273403	32	MF140428	Mycobacterium phage Slimphazie, complete genome	12203-12234	5	0.844
NC_016109_9	9.24\|7273372\|32\|NC_016109\|CRT	7273372-7273403	32	KJ567045	Mycobacterium phage Emerson, complete genome	12199-12230	5	0.844
NC_016109_9	9.24\|7273372\|32\|NC_016109\|CRT	7273372-7273403	32	MK460247	Mycobacterium phage YoureAdopted, complete genome	12172-12203	5	0.844
NC_016109_9	9.24\|7273372\|32\|NC_016109\|CRT	7273372-7273403	32	JN185608	Mycobacterium virus JAWS, complete genome	12193-12224	5	0.844
NC_016109_9	9.24\|7273372\|32\|NC_016109\|CRT	7273372-7273403	32	MN234231	Mycobacterium phage Rapunzel97, complete genome	12203-12234	5	0.844
NC_016109_9	9.24\|7273372\|32\|NC_016109\|CRT	7273372-7273403	32	MN908692	Mycobacterium Phage BGlluviae, complete genome	12239-12270	5	0.844
NC_016109_9	9.24\|7273372\|32\|NC_016109\|CRT	7273372-7273403	32	NC_023747	Mycobacterium phage BarrelRoll, complete genome	12191-12222	5	0.844
NC_016109_9	9.24\|7273372\|32\|NC_016109\|CRT	7273372-7273403	32	MH536821	Mycobacterium phage Homura, complete genome	12239-12270	5	0.844
NC_016109_9	9.24\|7273372\|32\|NC_016109\|CRT	7273372-7273403	32	MF668267	Mycobacterium phage Apocalypse, complete genome	12176-12207	5	0.844
NC_016109_9	9.24\|7273372\|32\|NC_016109\|CRT	7273372-7273403	32	MH697578	Mycobacterium phage Belladonna, complete genome	12239-12270	5	0.844
NC_016109_9	9.24\|7273372\|32\|NC_016109\|CRT	7273372-7273403	32	MH077577	Mycobacterium phage AlishaPH, complete genome	12198-12229	5	0.844
NC_016109_9	9.24\|7273372\|32\|NC_016109\|CRT	7273372-7273403	32	MH509444	Mycobacterium phage BEEST, complete genome	12239-12270	5	0.844
NC_016109_9	9.24\|7273372\|32\|NC_016109\|CRT	7273372-7273403	32	MN369742	Mycobacterium phage Spock, complete genome	12239-12270	5	0.844
NC_016109_9	9.24\|7273372\|32\|NC_016109\|CRT	7273372-7273403	32	MK112537	Mycobacterium Phage Capricorn, complete genome	12239-12270	5	0.844
NC_016109_9	9.24\|7273372\|32\|NC_016109\|CRT	7273372-7273403	32	MN369746	Mycobacterium phage Inky, complete genome	12239-12270	5	0.844
NC_016109_9	9.24\|7273372\|32\|NC_016109\|CRT	7273372-7273403	32	MH051246	Mycobacterium phage ActinUp, complete genome	12202-12233	5	0.844
NC_016109_9	9.24\|7273372\|32\|NC_016109\|CRT	7273372-7273403	32	MH513977	Mycobacterium phage Mynx, complete genome	12222-12253	5	0.844
NC_016109_9	9.24\|7273372\|32\|NC_016109\|CRT	7273372-7273403	32	MN234197	Mycobacterium phage Ramen, complete genome	12202-12233	5	0.844
NC_016109_9	9.24\|7273372\|32\|NC_016109\|CRT	7273372-7273403	32	MH371113	Mycobacterium phage Beezoo, complete genome	12215-12246	5	0.844
NC_016109_9	9.31\|7273809\|32\|NC_016109\|CRT	7273809-7273840	32	NZ_CP007129	Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence	1039040-1039071	5	0.844
NC_016109_9	9.47\|7273808\|33\|NC_016109\|PILER-CR	7273808-7273840	33	NZ_CP007129	Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence	1039040-1039072	5	0.848
NC_016109_1	1.1\|591426\|28\|NC_016109\|CRISPRCasFinder	591426-591453	28	NZ_LR134452	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 10, complete sequence	74446-74473	6	0.786
NC_016109_1	1.1\|591426\|28\|NC_016109\|CRISPRCasFinder	591426-591453	28	MT114163	Mycobacterium phage Settecandela, complete genome	132358-132385	6	0.786
NC_016109_1	1.1\|591426\|28\|NC_016109\|CRISPRCasFinder	591426-591453	28	MK937592	Mycobacterium phage Phrappuccino, complete genome	123511-123538	6	0.786
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NC_010905	Amycolatopsis benzoatilytica strain DSM 43387 plasmid pA387, complete sequence	13016-13047	6	0.812
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	MT451980	Streptomyces phage Ignacio, complete genome	18173-18204	6	0.812
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NZ_CP022775	Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence	1348420-1348451	6	0.812
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NZ_CP021653	Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence	1444164-1444195	6	0.812
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NC_014310	Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence	1404508-1404539	6	0.812
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NZ_CP022762	Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence	1270233-1270264	6	0.812
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NZ_CP021767	Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence	1444131-1444162	6	0.812
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NZ_CP012688	Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence	1444171-1444202	6	0.812
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NZ_CP023017	Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence	1333555-1333586	6	0.812
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NZ_CP014703	Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence	1269255-1269286	6	0.812
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NZ_CP022760	Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence	1311889-1311920	6	0.812
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NZ_CP022789	Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence	1311880-1311911	6	0.812
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NZ_CP022771	Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence	1270225-1270256	6	0.812
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NZ_CP022777	Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence	1269579-1269610	6	0.812
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NZ_CP022799	Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence	1270216-1270247	6	0.812
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	CP047139	Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence	1361922-1361953	6	0.812
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	CP047137	Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence	1307190-1307221	6	0.812
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NZ_CP022764	Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence	1348561-1348592	6	0.812
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NZ_CP022797	Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence	1348543-1348574	6	0.812
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NZ_CP022758	Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence	1348528-1348559	6	0.812
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NZ_CP026091	Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence	1004848-1004879	6	0.812
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NC_014309	Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome	1487764-1487795	6	0.812
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NZ_CP021763	Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence	1399533-1399564	6	0.812
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NZ_CP026093	Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence	1004953-1004984	6	0.812
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NZ_CP012940	Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence	1183649-1183680	6	0.812
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NZ_CP012944	Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence	659262-659293	6	0.812
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NZ_CP030263	Ensifer adhaerens strain Corn53 plasmid AA, complete sequence	1635295-1635326	6	0.812
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NC_017575	Ralstonia solanacearum Po82 megaplasmid, complete sequence	1004663-1004694	6	0.812
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NZ_CP026308	Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence	1004609-1004640	6	0.812
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NZ_CP021765	Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence	1399504-1399535	6	0.812
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NZ_CP051295	Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence	1172105-1172136	6	0.812
NC_016109_2	2.2\|613168\|32\|NC_016109\|CRT	613168-613199	32	NZ_CP012399	Chelatococcus sp. CO-6 plasmid pCO-6, complete sequence	349374-349405	6	0.812
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2225637-2225668	6	0.812
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	MN813682	Microbacterium phage Matzah, complete genome	34611-34642	6	0.812
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	491751-491782	6	0.812
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NZ_CP024896	Amycolatopsis sp. AA4 plasmid unnamed2, complete sequence	32473-32504	6	0.812
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NC_004934	Streptomyces violaceoruber strain SANK95570 plasmid pSV2, complete sequence	39442-39473	6	0.812
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NZ_CP021083	Deinococcus ficus strain CC-FR2-10 plasmid pDFI2, complete sequence	266838-266869	6	0.812
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NZ_CP029209	Nitratireductor sp. OM-1 plasmid pOM-1, complete sequence	653798-653829	6	0.812
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NZ_CP030074	Streptomyces sp. ZFG47 plasmid unnamed1, complete sequence	382473-382504	6	0.812
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NZ_CP016617	Microvirga ossetica strain V5/3m plasmid unnamed1, complete sequence	30954-30985	6	0.812
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NZ_CP016617	Microvirga ossetica strain V5/3m plasmid unnamed1, complete sequence	1285815-1285846	6	0.812
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	ASHF01000034	Streptomyces sp. GBA 94-10 plasmid pGBA1, complete sequence, whole genome shotgun sequence	10951-10982	6	0.812
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NZ_CP007129	Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence	1085241-1085272	6	0.812
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NZ_CP006368	Aureimonas sp. AU20 plasmid pAU20a, complete sequence	121176-121207	6	0.812
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	LN997844	Streptomyces reticuli genome assembly TUE45, plasmid : III	41736-41767	6	0.812
NC_016109_2	2.6\|613412\|32\|NC_016109\|CRT	613412-613443	32	NZ_CP016618	Microvirga ossetica strain V5/3m plasmid unnamed3, complete sequence	33573-33604	6	0.812
NC_016109_2	2.8\|613534\|32\|NC_016109\|CRT	613534-613565	32	NZ_CP020568	Kitasatospora aureofaciens strain DM-1 plasmid unnamed1, complete sequence	127120-127151	6	0.812
NC_016109_2	2.12\|613778\|32\|NC_016109\|CRT	613778-613809	32	NZ_CP012186	Pseudonocardia sp. EC080619-01 plasmid pBCI1-1, complete sequence	75022-75053	6	0.812
NC_016109_2	2.13\|613107\|33\|NC_016109\|CRISPRCasFinder	613107-613139	33	NC_003903	Streptomyces coelicolor A3(2) plasmid SCP1, complete sequence	110035-110067	6	0.818
NC_016109_2	2.16\|613290\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613290-613322	33	NZ_CP024896	Amycolatopsis sp. AA4 plasmid unnamed2, complete sequence	32473-32505	6	0.818
NC_016109_2	2.16\|613290\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613290-613322	33	NC_004934	Streptomyces violaceoruber strain SANK95570 plasmid pSV2, complete sequence	39441-39473	6	0.818
NC_016109_2	2.16\|613290\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613290-613322	33	NZ_CP021083	Deinococcus ficus strain CC-FR2-10 plasmid pDFI2, complete sequence	266838-266870	6	0.818
NC_016109_2	2.16\|613290\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613290-613322	33	NZ_LR594676	Variovorax sp. PBS-H4 plasmid 2	81466-81498	6	0.818
NC_016109_2	2.16\|613290\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613290-613322	33	ASHF01000034	Streptomyces sp. GBA 94-10 plasmid pGBA1, complete sequence, whole genome shotgun sequence	10950-10982	6	0.818
NC_016109_2	2.16\|613290\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613290-613322	33	NC_023498	Mycobacterium phage Validus, complete genome	51372-51404	6	0.818
NC_016109_2	2.18\|613412\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613412-613444	33	NZ_CP016618	Microvirga ossetica strain V5/3m plasmid unnamed3, complete sequence	33573-33605	6	0.818
NC_016109_2	2.24\|613778\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613778-613810	33	NZ_CP012186	Pseudonocardia sp. EC080619-01 plasmid pBCI1-1, complete sequence	75021-75053	6	0.818
NC_016109_3	3.11\|624168\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624168-624200	33	KY092482	Streptomyces phage Mojorita, complete genome	26520-26552	6	0.818
NC_016109_3	3.11\|624168\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624168-624200	33	KY092480	Streptomyces phage Picard, complete genome	26718-26750	6	0.818
NC_016109_3	3.12\|624229\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624229-624261	33	NZ_CP030354	Novosphingobium sp. P6W plasmid pP6W1, complete sequence	216927-216959	6	0.818
NC_016109_3	3.20\|624717\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624717-624749	33	NZ_CP012941	Ralstonia solanacearum strain UW163 plasmid pUW163a, complete sequence	103100-103132	6	0.818
NC_016109_3	3.21\|624778\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624778-624810	33	NC_010510	Methylobacterium radiotolerans JCM 2831 plasmid pMRAD01, complete sequence	285811-285843	6	0.818
NC_016109_3	3.25\|625022\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	625022-625054	33	NZ_CP017076	Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence	139219-139251	6	0.818
NC_016109_3	3.26\|625083\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	625083-625115	33	NZ_AP014707	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_3p, complete sequence	4178-4210	6	0.818
NC_016109_3	3.30\|625327\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	625327-625359	33	NZ_CP039425	Citricoccus sp. SGAir0253 plasmid unnamed1, complete sequence	102403-102435	6	0.818
NC_016109_3	3.30\|625327\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	625327-625359	33	NZ_CP039430	Citricoccus sp. SGAir0453 plasmid unnamed1, complete sequence	102401-102433	6	0.818
NC_016109_3	3.30\|625327\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	625327-625359	33	NZ_CP015737	Shinella sp. HZN7 plasmid pShin-01, complete sequence	77370-77402	6	0.818
NC_016109_3	3.36\|625693\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	625693-625725	33	NZ_CP031166	Euzebya sp. DY32-46 plasmid pEDY32-46I, complete sequence	39428-39460	6	0.818
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP044425	Paracoccus pantotrophus strain DSM 2944 plasmid pPAN2, complete sequence	514770-514801	6	0.812
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP030832	Neorhizobium sp. NCHU2750 plasmid pNCHU2750d, complete sequence	116833-116864	6	0.812
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP015446	Streptomyces sp. S8 plasmid unnamed, complete sequence	24957-24988	6	0.812
NC_016109_8	8.1\|7220782\|31\|NC_016109\|CRISPRCasFinder	7220782-7220812	31	NC_018836	Streptomyces phage phiHau3, complete genome	18523-18553	6	0.806
NC_016109_8	8.1\|7220782\|31\|NC_016109\|CRISPRCasFinder	7220782-7220812	31	MF038791	Arthrobacter phage ElephantMan, complete genome	28980-29010	6	0.806
NC_016109_8	8.1\|7220782\|31\|NC_016109\|CRISPRCasFinder	7220782-7220812	31	MF038790	Arthrobacter phage Niktson, complete genome	28980-29010	6	0.806
NC_016109_8	8.1\|7220782\|31\|NC_016109\|CRISPRCasFinder	7220782-7220812	31	MF140432	Arthrobacter phage Teacup, complete genome	28288-28318	6	0.806
NC_016109_9	9.4\|7273190\|31\|NC_016109\|CRISPRCasFinder	7273190-7273220	31	NZ_CP049141	Pseudomonas nitroreducens strain HBP1 plasmid pPniHBP1_2, complete sequence	125788-125818	6	0.806
NC_016109_9	9.7\|7273373\|31\|NC_016109\|CRISPRCasFinder	7273373-7273403	31	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	209549-209579	6	0.806
NC_016109_9	9.7\|7273373\|31\|NC_016109\|CRISPRCasFinder	7273373-7273403	31	NC_005838	Thermus thermophilus HB27 plasmid pTT27, complete sequence	151579-151609	6	0.806
NC_016109_9	9.7\|7273373\|31\|NC_016109\|CRISPRCasFinder	7273373-7273403	31	NZ_CP030074	Streptomyces sp. ZFG47 plasmid unnamed1, complete sequence	297916-297946	6	0.806
NC_016109_9	9.7\|7273373\|31\|NC_016109\|CRISPRCasFinder	7273373-7273403	31	MF377440	Mycobacterium phage Bella96, complete genome	12130-12160	6	0.806
NC_016109_9	9.7\|7273373\|31\|NC_016109\|CRISPRCasFinder	7273373-7273403	31	MK937607	Gordonia phage Zipp, complete genome	40165-40195	6	0.806
NC_016109_9	9.13\|7273749\|31\|NC_016109\|CRISPRCasFinder	7273749-7273779	31	CP006880	Rhizobium gallicum bv. gallicum R602 plasmid pRgalR602c, complete sequence	1817170-1817200	6	0.806
NC_016109_9	9.13\|7273749\|31\|NC_016109\|CRISPRCasFinder	7273749-7273779	31	NC_015314	Pseudonocardia dioxanivorans CB1190 plasmid pPSED01, complete sequence	134018-134048	6	0.806
NC_016109_9	9.14\|7273810\|31\|NC_016109\|CRISPRCasFinder	7273810-7273840	31	NC_013859	Azospirillum sp. B510 plasmid pAB510e, complete sequence	335907-335937	6	0.806
NC_016109_9	9.14\|7273810\|31\|NC_016109\|CRISPRCasFinder	7273810-7273840	31	NZ_AP022333	Methylosinus sp. C49 isolate Methylosinus sp. C49 plasmid pMSC49a, complete sequence	242250-242280	6	0.806
NC_016109_9	9.17\|7273993\|31\|NC_016109\|CRISPRCasFinder	7273993-7274023	31	NZ_AP014705	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence	883357-883387	6	0.806
NC_016109_9	9.17\|7273993\|31\|NC_016109\|CRISPRCasFinder	7273993-7274023	31	NZ_CP017148	Bosea vaviloviae strain Vaf18 plasmid unnamed1, complete sequence	133211-133241	6	0.806
NC_016109_9	9.21\|7273189\|32\|NC_016109\|CRT	7273189-7273220	32	NC_019849	Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence	923934-923965	6	0.812
NC_016109_9	9.21\|7273189\|32\|NC_016109\|CRT	7273189-7273220	32	NC_009620	Sinorhizobium medicae WSM419 plasmid pSMED01, complete sequence	1072290-1072321	6	0.812
NC_016109_9	9.24\|7273372\|32\|NC_016109\|CRT	7273372-7273403	32	NZ_CP020040	Streptomyces sp. 3211 isolate 3 plasmid p3211-1, complete sequence	279552-279583	6	0.812
NC_016109_9	9.24\|7273372\|32\|NC_016109\|CRT	7273372-7273403	32	MF377440	Mycobacterium phage Bella96, complete genome	12129-12160	6	0.812
NC_016109_9	9.24\|7273372\|32\|NC_016109\|CRT	7273372-7273403	32	MK937607	Gordonia phage Zipp, complete genome	40164-40195	6	0.812
NC_016109_9	9.30\|7273748\|32\|NC_016109\|CRT	7273748-7273779	32	CP006880	Rhizobium gallicum bv. gallicum R602 plasmid pRgalR602c, complete sequence	1817170-1817201	6	0.812
NC_016109_9	9.31\|7273809\|32\|NC_016109\|CRT	7273809-7273840	32	NZ_AP022333	Methylosinus sp. C49 isolate Methylosinus sp. C49 plasmid pMSC49a, complete sequence	242250-242281	6	0.812
NC_016109_9	9.33\|7273931\|32\|NC_016109\|CRT	7273931-7273962	32	NZ_CP017756	Cupriavidus malaysiensis strain USMAA1020 isolate pure plasmid unnamed1, complete sequence	144049-144080	6	0.812
NC_016109_9	9.34\|7273992\|32\|NC_016109\|CRT	7273992-7274023	32	NC_004808	Streptomyces rochei plasmid pSLA2-L DNA, complete sequence	25561-25592	6	0.812
NC_016109_9	9.40\|7273371\|33\|NC_016109\|PILER-CR	7273371-7273403	33	MN234205	Mycobacterium phage Veliki, complete genome	12238-12270	6	0.818
NC_016109_9	9.40\|7273371\|33\|NC_016109\|PILER-CR	7273371-7273403	33	MH727544	Mycobacterium phage Dalmuri, complete genome	12238-12270	6	0.818
NC_016109_9	9.40\|7273371\|33\|NC_016109\|PILER-CR	7273371-7273403	33	MH001453	Mycobacterium phage Adonis, complete genome	12210-12242	6	0.818
NC_016109_9	9.40\|7273371\|33\|NC_016109\|PILER-CR	7273371-7273403	33	JF704105	Mycobacterium phage Adephagia, complete sequence	12201-12233	6	0.818
NC_016109_9	9.40\|7273371\|33\|NC_016109\|PILER-CR	7273371-7273403	33	MN234182	Mycobacterium phage Geraldini, complete genome	12214-12246	6	0.818
NC_016109_9	9.40\|7273371\|33\|NC_016109\|PILER-CR	7273371-7273403	33	MN234198	Mycobacterium phage Zavala, complete genome	12179-12211	6	0.818
NC_016109_9	9.40\|7273371\|33\|NC_016109\|PILER-CR	7273371-7273403	33	MF140412	Mycobacterium phage Jeckyll, complete genome	12238-12270	6	0.818
NC_016109_9	9.40\|7273371\|33\|NC_016109\|PILER-CR	7273371-7273403	33	KY380102	Mycobacterium phage CREW, complete genome	12238-12270	6	0.818
NC_016109_9	9.40\|7273371\|33\|NC_016109\|PILER-CR	7273371-7273403	33	KX585253	Mycobacterium phage HedwigODU, complete genome	12201-12233	6	0.818
NC_016109_9	9.40\|7273371\|33\|NC_016109\|PILER-CR	7273371-7273403	33	MH536822	Mycobacterium phage Joy99, complete genome	12167-12199	6	0.818
NC_016109_9	9.40\|7273371\|33\|NC_016109\|PILER-CR	7273371-7273403	33	MF140428	Mycobacterium phage Slimphazie, complete genome	12202-12234	6	0.818
NC_016109_9	9.40\|7273371\|33\|NC_016109\|PILER-CR	7273371-7273403	33	KJ567045	Mycobacterium phage Emerson, complete genome	12198-12230	6	0.818
NC_016109_9	9.40\|7273371\|33\|NC_016109\|PILER-CR	7273371-7273403	33	MK460247	Mycobacterium phage YoureAdopted, complete genome	12171-12203	6	0.818
NC_016109_9	9.40\|7273371\|33\|NC_016109\|PILER-CR	7273371-7273403	33	JN185608	Mycobacterium virus JAWS, complete genome	12192-12224	6	0.818
NC_016109_9	9.40\|7273371\|33\|NC_016109\|PILER-CR	7273371-7273403	33	MN234231	Mycobacterium phage Rapunzel97, complete genome	12202-12234	6	0.818
NC_016109_9	9.40\|7273371\|33\|NC_016109\|PILER-CR	7273371-7273403	33	MN908692	Mycobacterium Phage BGlluviae, complete genome	12238-12270	6	0.818
NC_016109_9	9.40\|7273371\|33\|NC_016109\|PILER-CR	7273371-7273403	33	NC_023747	Mycobacterium phage BarrelRoll, complete genome	12190-12222	6	0.818
NC_016109_9	9.40\|7273371\|33\|NC_016109\|PILER-CR	7273371-7273403	33	MH536821	Mycobacterium phage Homura, complete genome	12238-12270	6	0.818
NC_016109_9	9.40\|7273371\|33\|NC_016109\|PILER-CR	7273371-7273403	33	MF668267	Mycobacterium phage Apocalypse, complete genome	12175-12207	6	0.818
NC_016109_9	9.40\|7273371\|33\|NC_016109\|PILER-CR	7273371-7273403	33	MH697578	Mycobacterium phage Belladonna, complete genome	12238-12270	6	0.818
NC_016109_9	9.40\|7273371\|33\|NC_016109\|PILER-CR	7273371-7273403	33	MH077577	Mycobacterium phage AlishaPH, complete genome	12197-12229	6	0.818
NC_016109_9	9.40\|7273371\|33\|NC_016109\|PILER-CR	7273371-7273403	33	MH509444	Mycobacterium phage BEEST, complete genome	12238-12270	6	0.818
NC_016109_9	9.40\|7273371\|33\|NC_016109\|PILER-CR	7273371-7273403	33	MN369742	Mycobacterium phage Spock, complete genome	12238-12270	6	0.818
NC_016109_9	9.40\|7273371\|33\|NC_016109\|PILER-CR	7273371-7273403	33	MK112537	Mycobacterium Phage Capricorn, complete genome	12238-12270	6	0.818
NC_016109_9	9.40\|7273371\|33\|NC_016109\|PILER-CR	7273371-7273403	33	MN369746	Mycobacterium phage Inky, complete genome	12238-12270	6	0.818
NC_016109_9	9.40\|7273371\|33\|NC_016109\|PILER-CR	7273371-7273403	33	MH051246	Mycobacterium phage ActinUp, complete genome	12201-12233	6	0.818
NC_016109_9	9.40\|7273371\|33\|NC_016109\|PILER-CR	7273371-7273403	33	MH513977	Mycobacterium phage Mynx, complete genome	12221-12253	6	0.818
NC_016109_9	9.40\|7273371\|33\|NC_016109\|PILER-CR	7273371-7273403	33	MN234197	Mycobacterium phage Ramen, complete genome	12201-12233	6	0.818
NC_016109_9	9.40\|7273371\|33\|NC_016109\|PILER-CR	7273371-7273403	33	MH371113	Mycobacterium phage Beezoo, complete genome	12214-12246	6	0.818
NC_016109_1	1.1\|591426\|28\|NC_016109\|CRISPRCasFinder	591426-591453	28	MK813942	Aeromonas phage 4_4512, complete genome	24546-24573	7	0.75
NC_016109_1	1.1\|591426\|28\|NC_016109\|CRISPRCasFinder	591426-591453	28	NZ_CP029211	Aquabacterium olei strain NBRC 110486 plasmid pTB101, complete sequence	133780-133807	7	0.75
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NC_010997	Rhizobium etli CIAT 652 plasmid pC, complete sequence	61858-61889	7	0.781
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	MT521991	Streptomyces phage Eklok, complete genome	18142-18173	7	0.781
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	MT451981	Streptomyces phage Vondra, complete genome	18178-18209	7	0.781
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NZ_CP031166	Euzebya sp. DY32-46 plasmid pEDY32-46I, complete sequence	411609-411640	7	0.781
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NZ_CP022367	Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence	706930-706961	7	0.781
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NC_003903	Streptomyces coelicolor A3(2) plasmid SCP1, complete sequence	110035-110066	7	0.781
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	MT521993	Gordonia phage RedWattleHog, complete genome	76477-76508	7	0.781
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	MN586040	Gordonia phage Stormageddon, complete genome	76458-76489	7	0.781
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NC_005262	Burkholderia cepacia phage Bcep22, complete genome	29884-29915	7	0.781
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NZ_CP049244	Rhizobium pseudoryzae strain DSM 19479 plasmid unnamed3, complete sequence	567797-567828	7	0.781
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NZ_CP015882	Ensifer adhaerens strain Casida A plasmid pCasidaAB, complete sequence	214085-214116	7	0.781
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NZ_CP030264	Ensifer adhaerens strain Corn53 plasmid AB, complete sequence	746851-746882	7	0.781
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	MK279887	Mycobacterium phage Timmi, complete genome	57110-57141	7	0.781
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	MH651175	Mycobacterium phage Gophee, complete genome	57606-57637	7	0.781
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	MG925339	Mycobacterium phage Chunky, complete genome	56969-57000	7	0.781
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	GU247134	Mycobacterium phage Scoot17C, complete genome	57061-57092	7	0.781
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	JN006063	Mycobacterium phage Serendipity, complete genome	57416-57447	7	0.781
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	MH230875	Mycobacterium phage CheetO, complete genome	57352-57383	7	0.781
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	MG962365	Mycobacterium phage DoesntMatter, complete genome	57124-57155	7	0.781
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	MK524512	Mycobacterium phage Carthage, complete genome	57040-57071	7	0.781
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	MN945899	Mycobacterium phage Skippy, complete genome	57352-57383	7	0.781
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	MK279908	Mycobacterium phage Roliet, complete genome	56456-56487	7	0.781
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	MT897909	Mycobacterium phage Maru, complete genome	57533-57564	7	0.781
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	KY006474	Mycobacterium phage Prann, complete genome	57449-57480	7	0.781
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	MG962370	Mycobacterium phage Kykar, complete genome	12306-12337	7	0.781
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	JN698990	Mycobacterium phage IsaacEli, complete genome	57633-57664	7	0.781
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	KY965066	Mycobacterium phage BlackStallion, complete genome	57381-57412	7	0.781
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	MN703415	Mycobacterium phage Mcshane, complete genome	57105-57136	7	0.781
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NC_028942	Mycobacterium phage Phipps, complete sequence	57182-57213	7	0.781
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	KJ567044	Mycobacterium phage EmpTee, complete genome	57344-57375	7	0.781
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	MK279855	Mycobacterium phage Haleema, complete genome	57161-57192	7	0.781
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	JX649096	Mycobacterium phage Serpentine, complete genome	57499-57530	7	0.781
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	MG944225	Mycobacterium phage Xavier, complete genome	57110-57141	7	0.781
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	5419080-5419111	7	0.781
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	531553-531584	7	0.781
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NZ_CP022775	Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence	1213408-1213439	7	0.781
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NC_014310	Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence	1262337-1262368	7	0.781
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NZ_CP029835	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed5, complete sequence	250060-250091	7	0.781
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NZ_CP022760	Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence	1165069-1165100	7	0.781
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NZ_CP022789	Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence	1165058-1165089	7	0.781
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NZ_CP054615	Azospirillum oryzae strain KACC 14407 plasmid unnamed1, complete sequence	270613-270644	7	0.781
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NZ_CP022764	Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence	1213523-1213554	7	0.781
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NZ_CP021083	Deinococcus ficus strain CC-FR2-10 plasmid pDFI2, complete sequence	272971-273002	7	0.781
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NZ_CP022797	Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence	1213507-1213538	7	0.781
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NZ_CP022758	Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence	1213500-1213531	7	0.781
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NZ_CP029359	Azospirillum sp. CFH 70021 plasmid unnamed4	36389-36420	7	0.781
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	LN997843	Streptomyces reticuli genome assembly TUE45, plasmid : II	508962-508993	7	0.781
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NC_016588	Azospirillum lipoferum 4B plasmid AZO_p6, complete sequence	171936-171967	7	0.781
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	KY092483	Streptomyces phage Bioscum, complete genome	23789-23820	7	0.781
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NC_047792	Streptomyces phage Ididsumtinwong, complete genome	23789-23820	7	0.781
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	KY092481	Streptomyces phage PapayaSalad, complete genome	24098-24129	7	0.781
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NZ_CP007129	Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence	168128-168159	7	0.781
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NZ_CP007129	Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence	192925-192956	7	0.781
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NZ_CP023549	Rhodobacter sp. CZR27 plasmid unnamed1, complete sequence	701261-701292	7	0.781
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NC_011758	Methylorubrum extorquens CM4 plasmid pCMU01, complete sequence	241072-241103	7	0.781
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NZ_CP041158	Leisingera aquaemixtae strain R2C4 plasmid unnamed4, complete sequence	59154-59185	7	0.781
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NC_021278	Mycobacteroides abscessus subsp. bolletii 50594 plasmid 1, complete sequence	16950-16981	7	0.781
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NC_005887	Burkholderia phage BcepC6B, complete genome	40176-40207	7	0.781
NC_016109_2	2.6\|613412\|32\|NC_016109\|CRT	613412-613443	32	NC_018022	Mycolicibacterium chubuense NBB4 plasmid pMYCCH.01, complete sequence	18149-18180	7	0.781
NC_016109_2	2.6\|613412\|32\|NC_016109\|CRT	613412-613443	32	NC_018022	Mycolicibacterium chubuense NBB4 plasmid pMYCCH.01, complete sequence	552536-552567	7	0.781
NC_016109_2	2.6\|613412\|32\|NC_016109\|CRT	613412-613443	32	NZ_CP054621	Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence	925667-925698	7	0.781
NC_016109_2	2.6\|613412\|32\|NC_016109\|CRT	613412-613443	32	NZ_CP015008	Aminobacter aminovorans strain KCTC 2477 plasmid pAA03, complete sequence	141747-141778	7	0.781
NC_016109_2	2.6\|613412\|32\|NC_016109\|CRT	613412-613443	32	MH727593	Acidovorax phage ACPWH, complete genome	39043-39074	7	0.781
NC_016109_2	2.6\|613412\|32\|NC_016109\|CRT	613412-613443	32	NZ_CP026518	Deinococcus sp. NW-56 plasmid unnamed2, complete sequence	184709-184740	7	0.781
NC_016109_2	2.8\|613534\|32\|NC_016109\|CRT	613534-613565	32	NZ_LR134459	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 17, complete sequence	114308-114339	7	0.781
NC_016109_2	2.8\|613534\|32\|NC_016109\|CRT	613534-613565	32	NZ_CP016313	Thermus brockianus strain GE-1 plasmid pTB1, complete sequence	121680-121711	7	0.781
NC_016109_2	2.9\|613595\|32\|NC_016109\|CRT	613595-613626	32	NZ_CP024936	Paraburkholderia graminis strain PHS1 plasmid pPHS1_P, complete sequence	490365-490396	7	0.781
NC_016109_2	2.9\|613595\|32\|NC_016109\|CRT	613595-613626	32	NC_015952	Streptomyces violaceusniger Tu 4113 plasmid pSTRVI02, complete sequence	143754-143785	7	0.781
NC_016109_2	2.11\|613717\|32\|NC_016109\|CRT	613717-613748	32	NC_002679	Mesorhizobium japonicum MAFF 303099 plasmid pMLa, complete sequence	50524-50555	7	0.781
NC_016109_2	2.13\|613107\|33\|NC_016109\|CRISPRCasFinder	613107-613139	33	NC_010905	Amycolatopsis benzoatilytica strain DSM 43387 plasmid pA387, complete sequence	13015-13047	7	0.788
NC_016109_2	2.13\|613107\|33\|NC_016109\|CRISPRCasFinder	613107-613139	33	MT451980	Streptomyces phage Ignacio, complete genome	18173-18205	7	0.788
NC_016109_2	2.13\|613107\|33\|NC_016109\|CRISPRCasFinder	613107-613139	33	NC_005262	Burkholderia cepacia phage Bcep22, complete genome	29884-29916	7	0.788
NC_016109_2	2.16\|613290\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613290-613322	33	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2225636-2225668	7	0.788
NC_016109_2	2.16\|613290\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613290-613322	33	MN813682	Microbacterium phage Matzah, complete genome	34611-34643	7	0.788
NC_016109_2	2.16\|613290\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613290-613322	33	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	491751-491783	7	0.788
NC_016109_2	2.16\|613290\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613290-613322	33	NZ_CP029359	Azospirillum sp. CFH 70021 plasmid unnamed4	36388-36420	7	0.788
NC_016109_2	2.16\|613290\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613290-613322	33	KY092483	Streptomyces phage Bioscum, complete genome	23788-23820	7	0.788
NC_016109_2	2.16\|613290\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613290-613322	33	NC_047792	Streptomyces phage Ididsumtinwong, complete genome	23788-23820	7	0.788
NC_016109_2	2.16\|613290\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613290-613322	33	KY092481	Streptomyces phage PapayaSalad, complete genome	24097-24129	7	0.788
NC_016109_2	2.16\|613290\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613290-613322	33	NZ_CP029209	Nitratireductor sp. OM-1 plasmid pOM-1, complete sequence	653798-653830	7	0.788
NC_016109_2	2.16\|613290\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613290-613322	33	NZ_CP030074	Streptomyces sp. ZFG47 plasmid unnamed1, complete sequence	382473-382505	7	0.788
NC_016109_2	2.16\|613290\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613290-613322	33	NZ_CP016617	Microvirga ossetica strain V5/3m plasmid unnamed1, complete sequence	30954-30986	7	0.788
NC_016109_2	2.16\|613290\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613290-613322	33	NZ_CP016617	Microvirga ossetica strain V5/3m plasmid unnamed1, complete sequence	1285815-1285847	7	0.788
NC_016109_2	2.16\|613290\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613290-613322	33	NZ_CP007129	Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence	168127-168159	7	0.788
NC_016109_2	2.16\|613290\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613290-613322	33	NC_011758	Methylorubrum extorquens CM4 plasmid pCMU01, complete sequence	241072-241104	7	0.788
NC_016109_2	2.16\|613290\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613290-613322	33	NC_005887	Burkholderia phage BcepC6B, complete genome	40176-40208	7	0.788
NC_016109_2	2.16\|613290\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613290-613322	33	AY605181	Burkholderia cepacia complex phage BcepC6B, complete genome	40176-40208	7	0.788
NC_016109_2	2.18\|613412\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613412-613444	33	NZ_CP026518	Deinococcus sp. NW-56 plasmid unnamed2, complete sequence	184709-184741	7	0.788
NC_016109_2	2.20\|613534\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613534-613566	33	NZ_CP020568	Kitasatospora aureofaciens strain DM-1 plasmid unnamed1, complete sequence	127120-127152	7	0.788
NC_016109_2	2.21\|613595\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613595-613627	33	NZ_CP024936	Paraburkholderia graminis strain PHS1 plasmid pPHS1_P, complete sequence	490365-490397	7	0.788
NC_016109_2	2.23\|613717\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613717-613749	33	NC_002679	Mesorhizobium japonicum MAFF 303099 plasmid pMLa, complete sequence	50523-50555	7	0.788
NC_016109_3	3.3\|623680\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	623680-623712	33	NZ_CP046906	Streptomyces sp. QHH-9511 plasmid unnamed, complete sequence	65679-65711	7	0.788
NC_016109_3	3.3\|623680\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	623680-623712	33	NZ_CP042263	Litoreibacter sp. LN3S51 plasmid unnamed2, complete sequence	53436-53468	7	0.788
NC_016109_3	3.3\|623680\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	623680-623712	33	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	500378-500410	7	0.788
NC_016109_3	3.3\|623680\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	623680-623712	33	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	1312690-1312722	7	0.788
NC_016109_3	3.3\|623680\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	623680-623712	33	NZ_CP019938	Ketogulonicigenium robustum strain SPU_B003 plasmid unnamed1, complete sequence	59181-59213	7	0.788
NC_016109_3	3.4\|623741\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	623741-623773	33	NC_013856	Azospirillum sp. B510 plasmid pAB510b, complete sequence	455836-455868	7	0.788
NC_016109_3	3.4\|623741\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	623741-623773	33	NZ_AP014579	Burkholderia sp. RPE67 plasmid p1, complete sequence	899315-899347	7	0.788
NC_016109_3	3.4\|623741\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	623741-623773	33	NC_016626	Burkholderia sp. YI23 plasmid byi_1p, complete sequence	759499-759531	7	0.788
NC_016109_3	3.4\|623741\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	623741-623773	33	NC_016587	Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence	568704-568736	7	0.788
NC_016109_3	3.4\|623741\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	623741-623773	33	NZ_LR134453	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 11, complete sequence	4485-4517	7	0.788
NC_016109_3	3.8\|623985\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	623985-624017	33	NZ_CP054032	Rhizobium sp. JKLM13E plasmid pPR13E01, complete sequence	810559-810591	7	0.788
NC_016109_3	3.11\|624168\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624168-624200	33	NZ_CP031166	Euzebya sp. DY32-46 plasmid pEDY32-46I, complete sequence	465261-465293	7	0.788
NC_016109_3	3.11\|624168\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624168-624200	33	NZ_CP034352	Streptomyces sp. W1SF4 plasmid p2, complete sequence	6058-6090	7	0.788
NC_016109_3	3.14\|624351\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624351-624383	33	NZ_CP030772	Streptomyces sp. YIM 121038 plasmid pSSP121038, complete sequence	610481-610513	7	0.788
NC_016109_3	3.14\|624351\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624351-624383	33	NZ_CP032685	Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence	52710-52742	7	0.788
NC_016109_3	3.14\|624351\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624351-624383	33	NC_015951	Streptomyces violaceusniger Tu 4113 plasmid pSTRVI01, complete sequence	111873-111905	7	0.788
NC_016109_3	3.14\|624351\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624351-624383	33	NZ_CP032690	Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence	52710-52742	7	0.788
NC_016109_3	3.14\|624351\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624351-624383	33	NZ_CP040819	Paraoceanicella profunda strain D4M1 plasmid pD4M1A, complete sequence	405620-405652	7	0.788
NC_016109_3	3.16\|624473\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624473-624505	33	NZ_HG813238	Erwinia amylovora strain 692 plasmid pEA68, complete sequence	46725-46757	7	0.788
NC_016109_3	3.19\|624656\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624656-624688	33	NZ_HG813238	Erwinia amylovora strain 692 plasmid pEA68, complete sequence	46725-46757	7	0.788
NC_016109_3	3.21\|624778\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624778-624810	33	NZ_LN832562	Paracoccus aminovorans isolate JCM7685 plasmid IV, complete sequence	17183-17215	7	0.788
NC_016109_3	3.21\|624778\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624778-624810	33	NZ_CP026517	Deinococcus sp. NW-56 plasmid unnamed1, complete sequence	102715-102747	7	0.788
NC_016109_3	3.21\|624778\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624778-624810	33	NZ_CP032322	Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence	1395676-1395708	7	0.788
NC_016109_3	3.21\|624778\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624778-624810	33	NZ_CP007794	Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence	218546-218578	7	0.788
NC_016109_3	3.21\|624778\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624778-624810	33	NZ_CP007794	Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence	1444147-1444179	7	0.788
NC_016109_3	3.21\|624778\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624778-624810	33	NZ_CP044079	Paracoccus yeei strain FDAARGOS_643 plasmid unnamed2, complete sequence	326118-326150	7	0.788
NC_016109_3	3.21\|624778\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624778-624810	33	NZ_CP031079	Paracoccus yeei strain CCUG 32053 plasmid pYEE1, complete sequence	232568-232600	7	0.788
NC_016109_3	3.27\|625144\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	625144-625176	33	NZ_CP021405	Celeribacter manganoxidans strain DY25 plasmid pDY25-A, complete sequence	4644-4676	7	0.788
NC_016109_3	3.27\|625144\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	625144-625176	33	KU160644	Arthrobacter phage Galaxy, complete genome	12712-12744	7	0.788
NC_016109_3	3.30\|625327\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	625327-625359	33	NZ_CP015007	Aminobacter aminovorans strain KCTC 2477 plasmid pAA02, complete sequence	274335-274367	7	0.788
NC_016109_3	3.31\|625388\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	625388-625420	33	NZ_CP015203	Rhodococcus sp. 008 plasmid pR8L1, complete sequence	678306-678338	7	0.788
NC_016109_3	3.31\|625388\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	625388-625420	33	NZ_LR594673	Variovorax sp. PBL-E5 plasmid 3	517960-517992	7	0.788
NC_016109_3	3.32\|625449\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	625449-625481	33	NC_014310	Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence	1224156-1224188	7	0.788
NC_016109_3	3.32\|625449\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	625449-625481	33	NZ_CP022760	Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence	1126889-1126921	7	0.788
NC_016109_3	3.32\|625449\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	625449-625481	33	NZ_CP022789	Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence	1126877-1126909	7	0.788
NC_016109_3	3.33\|625510\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	625510-625542	33	NZ_CP035709	Sphaerotilus natans subsp. sulfidivorans strain D-507 plasmid pSna507_unt12, complete sequence	39316-39348	7	0.788
NC_016109_3	3.36\|625693\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	625693-625725	33	NZ_CP028969	Aminobacter sp. MSH1 plasmid pUSP1, complete sequence	367283-367315	7	0.788
NC_016109_3	3.36\|625693\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	625693-625725	33	NZ_CP026266	Aminobacter sp. MSH1 plasmid pAM01, complete sequence	364469-364501	7	0.788
NC_016109_3	3.36\|625693\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	625693-625725	33	NC_017575	Ralstonia solanacearum Po82 megaplasmid, complete sequence	498492-498524	7	0.788
NC_016109_3	3.36\|625693\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	625693-625725	33	NZ_CP026308	Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence	498488-498520	7	0.788
NC_016109_3	3.36\|625693\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	625693-625725	33	NZ_CP012940	Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence	1503849-1503881	7	0.788
NC_016109_3	3.36\|625693\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	625693-625725	33	NZ_CP012944	Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence	1375356-1375388	7	0.788
NC_016109_3	3.36\|625693\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	625693-625725	33	NZ_CP051295	Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence	1488652-1488684	7	0.788
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP016083	Streptomyces sp. SAT1 plasmid unnamed3, complete sequence	322458-322489	7	0.781
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP007797	Azospirillum brasilense strain Az39 plasmid AbAZ39_p4, complete sequence	544218-544249	7	0.781
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP013744	Streptomyces sp. CdTB01 plasmid unnamed, complete sequence	77967-77998	7	0.781
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NC_002699	Frankia sp. CpI1 plasmid pFQ12, complete plasmid sequence	820-851	7	0.781
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NC_017966	Tistrella mobilis KA081020-065 plasmid pTM2, complete sequence	222229-222260	7	0.781
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP046573	Rhodococcus sp. WAY2 plasmid pRWAY01, complete sequence	347407-347438	7	0.781
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NC_041927	Sphingobium phage Lacusarx, complete genome	44918-44949	7	0.781
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP018464	Xanthomonas euvesicatoria strain LMG930 plasmid pLMG930.1, complete sequence	53178-53209	7	0.781
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP013941	Cronobacter malonaticus LMG 23826 plasmid pCMA1, complete sequence	65953-65984	7	0.781
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP029357	Azospirillum sp. CFH 70021 plasmid unnamed2	293356-293387	7	0.781
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NC_023024	Cronobacter malonaticus plasmid p1, complete sequence	60589-60620	7	0.781
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP012258	Cronobacter universalis NCTC 9529 plasmid pCUNV1, complete sequence	129426-129457	7	0.781
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP016452	Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence	900642-900673	7	0.781
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	LN997843	Streptomyces reticuli genome assembly TUE45, plasmid : II	429477-429508	7	0.781
NC_016109_9	9.3\|7273129\|31\|NC_016109\|CRISPRCasFinder	7273129-7273159	31	NZ_CP049142	Pseudomonas nitroreducens strain HBP1 plasmid pPniHBP1_1, complete sequence	329756-329786	7	0.774
NC_016109_9	9.4\|7273190\|31\|NC_016109\|CRISPRCasFinder	7273190-7273220	31	NZ_LR134452	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 10, complete sequence	357968-357998	7	0.774
NC_016109_9	9.4\|7273190\|31\|NC_016109\|CRISPRCasFinder	7273190-7273220	31	NC_012520	Rhodococcus opacus B4 plasmid pROB01, complete sequence	113651-113681	7	0.774
NC_016109_9	9.4\|7273190\|31\|NC_016109\|CRISPRCasFinder	7273190-7273220	31	NZ_CP046573	Rhodococcus sp. WAY2 plasmid pRWAY01, complete sequence	100347-100377	7	0.774
NC_016109_9	9.4\|7273190\|31\|NC_016109\|CRISPRCasFinder	7273190-7273220	31	NZ_CP016082	Streptomyces sp. SAT1 plasmid unnamed2, complete sequence	114208-114238	7	0.774
NC_016109_9	9.7\|7273373\|31\|NC_016109\|CRISPRCasFinder	7273373-7273403	31	NZ_CP039697	Novosphingobium sp. ABRDHK2 plasmid pABRDHK22, complete sequence	688458-688488	7	0.774
NC_016109_9	9.7\|7273373\|31\|NC_016109\|CRISPRCasFinder	7273373-7273403	31	NZ_CP006995	Methylobacterium sp. AMS5 plasmid pAMS5c, complete sequence	13558-13588	7	0.774
NC_016109_9	9.9\|7273495\|31\|NC_016109\|CRISPRCasFinder	7273495-7273525	31	NZ_CP025188	Roseomonas mucosa strain AD2 plasmid p1-AD2, complete sequence	162327-162357	7	0.774
NC_016109_9	9.9\|7273495\|31\|NC_016109\|CRISPRCasFinder	7273495-7273525	31	NZ_LT907976	Pseudodesulfovibrio profundus strain 500-1 plasmid paDPRO, complete sequence	31900-31930	7	0.774
NC_016109_9	9.13\|7273749\|31\|NC_016109\|CRISPRCasFinder	7273749-7273779	31	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	938294-938324	7	0.774
NC_016109_9	9.13\|7273749\|31\|NC_016109\|CRISPRCasFinder	7273749-7273779	31	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	874831-874861	7	0.774
NC_016109_9	9.13\|7273749\|31\|NC_016109\|CRISPRCasFinder	7273749-7273779	31	NZ_CP032322	Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence	344933-344963	7	0.774
NC_016109_9	9.13\|7273749\|31\|NC_016109\|CRISPRCasFinder	7273749-7273779	31	NZ_CP022367	Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence	1777943-1777973	7	0.774
NC_016109_9	9.13\|7273749\|31\|NC_016109\|CRISPRCasFinder	7273749-7273779	31	NZ_CP007794	Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence	780279-780309	7	0.774
NC_016109_9	9.13\|7273749\|31\|NC_016109\|CRISPRCasFinder	7273749-7273779	31	NZ_CP032340	Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence	1159109-1159139	7	0.774
NC_016109_9	9.13\|7273749\|31\|NC_016109\|CRISPRCasFinder	7273749-7273779	31	NZ_CP032346	Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence	290262-290292	7	0.774
NC_016109_9	9.13\|7273749\|31\|NC_016109\|CRISPRCasFinder	7273749-7273779	31	NZ_CP012915	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence	973266-973296	7	0.774
NC_016109_9	9.14\|7273810\|31\|NC_016109\|CRISPRCasFinder	7273810-7273840	31	NC_022599	Micrococcus sp. V7 plasmid pLMV7, complete sequence	85098-85128	7	0.774
NC_016109_9	9.14\|7273810\|31\|NC_016109\|CRISPRCasFinder	7273810-7273840	31	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	1159125-1159155	7	0.774
NC_016109_9	9.14\|7273810\|31\|NC_016109\|CRISPRCasFinder	7273810-7273840	31	CP047137	Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence	1714833-1714863	7	0.774
NC_016109_9	9.16\|7273932\|31\|NC_016109\|CRISPRCasFinder	7273932-7273962	31	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	1942656-1942686	7	0.774
NC_016109_9	9.17\|7273993\|31\|NC_016109\|CRISPRCasFinder	7273993-7274023	31	NZ_CP034472	Pantoea agglomerans strain CFSAN047153 plasmid pCFSAN047153_3, complete sequence	48881-48911	7	0.774
NC_016109_9	9.17\|7273993\|31\|NC_016109\|CRISPRCasFinder	7273993-7274023	31	NZ_CP034477	Pantoea agglomerans strain CFSAN047154 plasmid pCFSAN047154_3, complete sequence	132151-132181	7	0.774
NC_016109_9	9.20\|7273128\|32\|NC_016109\|CRT	7273128-7273159	32	NZ_CP049142	Pseudomonas nitroreducens strain HBP1 plasmid pPniHBP1_1, complete sequence	329756-329787	7	0.781
NC_016109_9	9.24\|7273372\|32\|NC_016109\|CRT	7273372-7273403	32	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	209549-209580	7	0.781
NC_016109_9	9.24\|7273372\|32\|NC_016109\|CRT	7273372-7273403	32	NC_005838	Thermus thermophilus HB27 plasmid pTT27, complete sequence	151579-151610	7	0.781
NC_016109_9	9.26\|7273494\|32\|NC_016109\|CRT	7273494-7273525	32	NZ_CP025188	Roseomonas mucosa strain AD2 plasmid p1-AD2, complete sequence	162327-162358	7	0.781
NC_016109_9	9.30\|7273748\|32\|NC_016109\|CRT	7273748-7273779	32	NZ_CP032322	Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence	344932-344963	7	0.781
NC_016109_9	9.30\|7273748\|32\|NC_016109\|CRT	7273748-7273779	32	NZ_CP022367	Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence	1777942-1777973	7	0.781
NC_016109_9	9.30\|7273748\|32\|NC_016109\|CRT	7273748-7273779	32	NZ_CP007794	Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence	780279-780310	7	0.781
NC_016109_9	9.30\|7273748\|32\|NC_016109\|CRT	7273748-7273779	32	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	938294-938325	7	0.781
NC_016109_9	9.30\|7273748\|32\|NC_016109\|CRT	7273748-7273779	32	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	874830-874861	7	0.781
NC_016109_9	9.30\|7273748\|32\|NC_016109\|CRT	7273748-7273779	32	NZ_CP032340	Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence	1159108-1159139	7	0.781
NC_016109_9	9.30\|7273748\|32\|NC_016109\|CRT	7273748-7273779	32	NZ_CP032346	Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence	290261-290292	7	0.781
NC_016109_9	9.30\|7273748\|32\|NC_016109\|CRT	7273748-7273779	32	NZ_CP012915	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence	973266-973297	7	0.781
NC_016109_9	9.31\|7273809\|32\|NC_016109\|CRT	7273809-7273840	32	NC_013859	Azospirillum sp. B510 plasmid pAB510e, complete sequence	335906-335937	7	0.781
NC_016109_9	9.31\|7273809\|32\|NC_016109\|CRT	7273809-7273840	32	NZ_CP049749	Rhodococcus fascians A21d2 plasmid pA21d2, complete sequence	58304-58335	7	0.781
NC_016109_9	9.31\|7273809\|32\|NC_016109\|CRT	7273809-7273840	32	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	1159125-1159156	7	0.781
NC_016109_9	9.31\|7273809\|32\|NC_016109\|CRT	7273809-7273840	32	NZ_CP029831	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed7, complete sequence	327337-327368	7	0.781
NC_016109_9	9.31\|7273809\|32\|NC_016109\|CRT	7273809-7273840	32	NC_014120	Paraburkholderia sp. CCGE1002 plasmid pBC201, complete sequence	294009-294040	7	0.781
NC_016109_9	9.34\|7273992\|32\|NC_016109\|CRT	7273992-7274023	32	NZ_AP014705	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence	883356-883387	7	0.781
NC_016109_9	9.46\|7273747\|33\|NC_016109\|PILER-CR	7273747-7273779	33	CP006880	Rhizobium gallicum bv. gallicum R602 plasmid pRgalR602c, complete sequence	1817170-1817202	7	0.788
NC_016109_9	9.47\|7273808\|33\|NC_016109\|PILER-CR	7273808-7273840	33	NC_013859	Azospirillum sp. B510 plasmid pAB510e, complete sequence	335905-335937	7	0.788
NC_016109_9	9.47\|7273808\|33\|NC_016109\|PILER-CR	7273808-7273840	33	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	1159125-1159157	7	0.788
NC_016109_9	9.47\|7273808\|33\|NC_016109\|PILER-CR	7273808-7273840	33	NZ_CP029831	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed7, complete sequence	327337-327369	7	0.788
NC_016109_9	9.47\|7273808\|33\|NC_016109\|PILER-CR	7273808-7273840	33	NC_022599	Micrococcus sp. V7 plasmid pLMV7, complete sequence	85098-85130	7	0.788
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NZ_LR134465	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 23, complete sequence	192259-192290	8	0.75
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NZ_CP021653	Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence	1367671-1367702	8	0.75
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NZ_CP021767	Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence	1367637-1367668	8	0.75
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NZ_CP030864	Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence	234395-234426	8	0.75
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NZ_CP012688	Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence	1367678-1367709	8	0.75
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	CP047139	Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence	1292366-1292397	8	0.75
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	CP047137	Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence	1238416-1238447	8	0.75
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	MT498055	Arthrobacter phage Bumble, complete genome	27338-27369	8	0.75
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NZ_CP021449	Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence	1835712-1835743	8	0.75
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NZ_CP026091	Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence	1614269-1614300	8	0.75
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NC_014309	Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome	1415096-1415127	8	0.75
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NZ_CP049788	Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence	1700943-1700974	8	0.75
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NZ_CP007130	Gemmatirosa kalamazoonesis strain KBS708 plasmid 2, complete sequence	752561-752592	8	0.75
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NZ_CP039340	Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence	676778-676809	8	0.75
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NZ_CP021763	Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence	301084-301115	8	0.75
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NZ_CP026093	Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence	1614405-1614436	8	0.75
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NZ_CP015116	Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence	393132-393163	8	0.75
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NZ_CP009763	Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence	234019-234050	8	0.75
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NZ_CP021765	Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence	1345243-1345274	8	0.75
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	685762-685793	8	0.75
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	GQ303264	Mycobacterium phage Puhltonio, complete genome	57390-57421	8	0.75
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	KX683293	Mycobacterium phage Daffy, complete genome	57103-57134	8	0.75
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	MK279888	Mycobacterium phage TomBombadil, complete genome	57667-57698	8	0.75
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	MT316463	Mycobacterium phage Slatt, complete genome	57401-57432	8	0.75
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	KX576645	Mycobacterium phage Derpp, complete genome	57202-57233	8	0.75
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	MH651184	Mycobacterium phage Phareon, complete genome	56823-56854	8	0.75
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	MF919511	Mycobacterium phage Kailash, complete genome	57525-57556	8	0.75
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	MK279882	Mycobacterium phage Sophia, complete genome	57093-57124	8	0.75
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	KX670813	Mycobacterium phage MitKao, complete genome	57103-57134	8	0.75
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	MH576970	Mycobacterium phage DonSanchon, complete genome	56800-56831	8	0.75
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	MK279866	Mycobacterium phage MRabcd, complete genome	57421-57452	8	0.75
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NC_023727	Mycobacterium phage Vista, complete genome	57105-57136	8	0.75
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	KM347890	Mycobacterium phage Vivaldi, complete genome	57566-57597	8	0.75
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	MH727555	Mycobacterium phage Mulan, complete genome	57332-57363	8	0.75
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	MG757164	Mycobacterium phage PhenghisKhan, complete genome	57271-57302	8	0.75
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NC_027985	Mycobacterium phage UncleHowie, complete genome	56804-56835	8	0.75
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	KX592589	Mycobacterium phage Iridoclysis, complete genome	57418-57449	8	0.75
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	MH051251	Mycobacterium phage DuchessDung, complete genome	56681-56712	8	0.75
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	KX576646	Mycobacterium phage TyrionL, complete genome	57202-57233	8	0.75
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	MK279871	Mycobacterium phage Plmatters, complete genome	57121-57152	8	0.75
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	MG757165	Mycobacterium phage Phergie, complete genome	57263-57294	8	0.75
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	JQ680375	Unidentified phage clone 2209_scaffold2350 genomic sequence	1815-1846	8	0.75
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	MK279881	Mycobacterium phage Solosis, complete genome	57100-57131	8	0.75
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	MG944223	Mycobacterium phage Trypo, complete genome	57834-57865	8	0.75
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	MK494104	Mycobacterium phage HenryJackson, complete genome	57644-57675	8	0.75
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	JX649099	Mycobacterium phage Gyarad, complete genome	56970-57001	8	0.75
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	MH450116	Mycobacterium phage Buckeye, complete genome	58201-58232	8	0.75
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	JN638753	Mycobacterium phage Morgushi, complete genome	57092-57123	8	0.75
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	MG757158	Mycobacterium phage HighStump, complete genome	57607-57638	8	0.75
NC_016109_2	2.3\|613229\|32\|NC_016109\|CRT	613229-613260	32	NZ_CP020539	Sphingobium herbicidovorans strain MH plasmid pMSHV, complete sequence	477712-477743	8	0.75
NC_016109_2	2.3\|613229\|32\|NC_016109\|CRT	613229-613260	32	NC_013859	Azospirillum sp. B510 plasmid pAB510e, complete sequence	485188-485219	8	0.75
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NZ_CP007130	Gemmatirosa kalamazoonesis strain KBS708 plasmid 2, complete sequence	449575-449606	8	0.75
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NZ_CP021653	Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence	1312764-1312795	8	0.75
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NZ_CP021767	Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence	1312744-1312775	8	0.75
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NZ_CP012688	Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence	1312771-1312802	8	0.75
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	CP047139	Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence	1239430-1239461	8	0.75
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	CP047137	Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence	1185923-1185954	8	0.75
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NC_015314	Pseudonocardia dioxanivorans CB1190 plasmid pPSED01, complete sequence	137156-137187	8	0.75
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NZ_CP026091	Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence	1561640-1561671	8	0.75
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NC_014309	Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome	1358435-1358466	8	0.75
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	1696484-1696515	8	0.75
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NZ_CP026093	Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence	1561770-1561801	8	0.75
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NZ_CP012940	Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence	1057877-1057908	8	0.75
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NZ_CP012944	Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence	785029-785060	8	0.75
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	116777-116808	8	0.75
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NC_017575	Ralstonia solanacearum Po82 megaplasmid, complete sequence	1561336-1561367	8	0.75
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NZ_CP030074	Streptomyces sp. ZFG47 plasmid unnamed1, complete sequence	223886-223917	8	0.75
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NZ_CP026308	Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence	1561279-1561310	8	0.75
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NZ_CP051295	Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence	1048891-1048922	8	0.75
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	MK801727	Gordonia phage ThankyouJordi, complete genome	14534-14565	8	0.75
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	MK875793	Gordonia phage WelcomeAyanna, complete genome	14534-14565	8	0.75
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NZ_CP032828	Sphingomonas sp. YZ-8 plasmid unnamed1, complete sequence	603931-603962	8	0.75
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NZ_CP029831	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed7, complete sequence	633249-633280	8	0.75
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NZ_LR134467	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 25, complete sequence	97893-97924	8	0.75
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NC_021289	Burkholderia insecticola plasmid p1, complete sequence	699807-699838	8	0.75
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NZ_CP022192	Yangia pacifica strain YSBP01 plasmid unnamed2, complete sequence	142518-142549	8	0.75
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NZ_CP045548	Streptomyces sp. SYP-A7193 plasmid unnamed1, complete sequence	342940-342971	8	0.75
NC_016109_2	2.6\|613412\|32\|NC_016109\|CRT	613412-613443	32	NZ_CP015009	Aminobacter aminovorans strain KCTC 2477 plasmid pAA04, complete sequence	3037-3068	8	0.75
NC_016109_2	2.6\|613412\|32\|NC_016109\|CRT	613412-613443	32	NZ_CP020539	Sphingobium herbicidovorans strain MH plasmid pMSHV, complete sequence	343065-343096	8	0.75
NC_016109_2	2.6\|613412\|32\|NC_016109\|CRT	613412-613443	32	NZ_AP018921	Pseudonocardia autotrophica strain NBRC 12743 plasmid pPA12743CP, complete sequence	63962-63993	8	0.75
NC_016109_2	2.6\|613412\|32\|NC_016109\|CRT	613412-613443	32	KR053197	Gordonia phage GRU3, complete genome	3029-3060	8	0.75
NC_016109_2	2.6\|613412\|32\|NC_016109\|CRT	613412-613443	32	MH727593	Acidovorax phage ACPWH, complete genome	7452-7483	8	0.75
NC_016109_2	2.8\|613534\|32\|NC_016109\|CRT	613534-613565	32	NZ_CP015006	Aminobacter aminovorans strain KCTC 2477 plasmid pAA01, complete sequence	445494-445525	8	0.75
NC_016109_2	2.9\|613595\|32\|NC_016109\|CRT	613595-613626	32	NZ_CP032340	Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence	871105-871136	8	0.75
NC_016109_2	2.9\|613595\|32\|NC_016109\|CRT	613595-613626	32	NZ_CP012915	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence	1261274-1261305	8	0.75
NC_016109_2	2.9\|613595\|32\|NC_016109\|CRT	613595-613626	32	NZ_CP016453	Sphingobium sp. RAC03 plasmid pBSY17_1, complete sequence	744229-744260	8	0.75
NC_016109_2	2.9\|613595\|32\|NC_016109\|CRT	613595-613626	32	NZ_CP047179	Rathayibacter sp. VKM Ac-2759 plasmid unnamed3, complete sequence	8793-8824	8	0.75
NC_016109_2	2.10\|613656\|32\|NC_016109\|CRT	613656-613687	32	NZ_CP030074	Streptomyces sp. ZFG47 plasmid unnamed1, complete sequence	665352-665383	8	0.75
NC_016109_2	2.11\|613717\|32\|NC_016109\|CRT	613717-613748	32	CP023013	Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence	175279-175310	8	0.75
NC_016109_2	2.11\|613717\|32\|NC_016109\|CRT	613717-613748	32	NZ_CP049790	Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence	194897-194928	8	0.75
NC_016109_2	2.11\|613717\|32\|NC_016109\|CRT	613717-613748	32	NZ_CP049794	Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence	456751-456782	8	0.75
NC_016109_2	2.11\|613717\|32\|NC_016109\|CRT	613717-613748	32	NZ_CP021763	Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence	236681-236712	8	0.75
NC_016109_2	2.11\|613717\|32\|NC_016109\|CRT	613717-613748	32	NZ_CP049792	Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence	238227-238258	8	0.75
NC_016109_2	2.11\|613717\|32\|NC_016109\|CRT	613717-613748	32	NZ_CP016915	Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence	789712-789743	8	0.75
NC_016109_2	2.11\|613717\|32\|NC_016109\|CRT	613717-613748	32	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	138519-138550	8	0.75
NC_016109_2	2.11\|613717\|32\|NC_016109\|CRT	613717-613748	32	NZ_CP015851	Ralstonia solanacearum strain YC40-M plasmid, complete sequence	210795-210826	8	0.75
NC_016109_2	2.11\|613717\|32\|NC_016109\|CRT	613717-613748	32	NZ_CP022795	Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence	175457-175488	8	0.75
NC_016109_2	2.11\|613717\|32\|NC_016109\|CRT	613717-613748	32	NZ_CP052085	Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence	195413-195444	8	0.75
NC_016109_2	2.11\|613717\|32\|NC_016109\|CRT	613717-613748	32	NZ_CP021765	Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence	236749-236780	8	0.75
NC_016109_2	2.11\|613717\|32\|NC_016109\|CRT	613717-613748	32	NZ_CP052077	Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence	172638-172669	8	0.75
NC_016109_2	2.11\|613717\|32\|NC_016109\|CRT	613717-613748	32	NZ_CP052087	Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence	195413-195444	8	0.75
NC_016109_2	2.11\|613717\|32\|NC_016109\|CRT	613717-613748	32	NZ_CP052127	Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence	195413-195444	8	0.75
NC_016109_2	2.11\|613717\|32\|NC_016109\|CRT	613717-613748	32	NZ_CP052079	Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence	172638-172669	8	0.75
NC_016109_2	2.11\|613717\|32\|NC_016109\|CRT	613717-613748	32	NZ_CP052089	Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence	195413-195444	8	0.75
NC_016109_2	2.11\|613717\|32\|NC_016109\|CRT	613717-613748	32	NZ_CP052125	Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence	172638-172669	8	0.75
NC_016109_2	2.11\|613717\|32\|NC_016109\|CRT	613717-613748	32	NZ_CP052123	Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence	172638-172669	8	0.75
NC_016109_2	2.11\|613717\|32\|NC_016109\|CRT	613717-613748	32	NZ_CP052131	Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence	195413-195444	8	0.75
NC_016109_2	2.11\|613717\|32\|NC_016109\|CRT	613717-613748	32	NZ_CP052081	Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence	172638-172669	8	0.75
NC_016109_2	2.11\|613717\|32\|NC_016109\|CRT	613717-613748	32	NZ_CP052083	Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence	172638-172669	8	0.75
NC_016109_2	2.12\|613778\|32\|NC_016109\|CRT	613778-613809	32	MK765627	Tortoise microvirus 74 isolate 74_SP_45, complete genome	5976-6007	8	0.75
NC_016109_2	2.13\|613107\|33\|NC_016109\|CRISPRCasFinder	613107-613139	33	NC_010997	Rhizobium etli CIAT 652 plasmid pC, complete sequence	61857-61889	8	0.758
NC_016109_2	2.13\|613107\|33\|NC_016109\|CRISPRCasFinder	613107-613139	33	MT521991	Streptomyces phage Eklok, complete genome	18142-18174	8	0.758
NC_016109_2	2.13\|613107\|33\|NC_016109\|CRISPRCasFinder	613107-613139	33	MT451981	Streptomyces phage Vondra, complete genome	18178-18210	8	0.758
NC_016109_2	2.13\|613107\|33\|NC_016109\|CRISPRCasFinder	613107-613139	33	MT521993	Gordonia phage RedWattleHog, complete genome	76477-76509	8	0.758
NC_016109_2	2.13\|613107\|33\|NC_016109\|CRISPRCasFinder	613107-613139	33	MN586040	Gordonia phage Stormageddon, complete genome	76458-76490	8	0.758
NC_016109_2	2.16\|613290\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613290-613322	33	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	5419079-5419111	8	0.758
NC_016109_2	2.16\|613290\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613290-613322	33	NZ_CP029835	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed5, complete sequence	250060-250092	8	0.758
NC_016109_2	2.16\|613290\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613290-613322	33	NZ_CP054615	Azospirillum oryzae strain KACC 14407 plasmid unnamed1, complete sequence	270612-270644	8	0.758
NC_016109_2	2.16\|613290\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613290-613322	33	NC_015314	Pseudonocardia dioxanivorans CB1190 plasmid pPSED01, complete sequence	137156-137188	8	0.758
NC_016109_2	2.16\|613290\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613290-613322	33	NZ_CP030074	Streptomyces sp. ZFG47 plasmid unnamed1, complete sequence	223886-223918	8	0.758
NC_016109_2	2.16\|613290\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613290-613322	33	NC_016588	Azospirillum lipoferum 4B plasmid AZO_p6, complete sequence	171935-171967	8	0.758
NC_016109_2	2.18\|613412\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613412-613444	33	NC_018022	Mycolicibacterium chubuense NBB4 plasmid pMYCCH.01, complete sequence	552535-552567	8	0.758
NC_016109_2	2.18\|613412\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613412-613444	33	NC_018022	Mycolicibacterium chubuense NBB4 plasmid pMYCCH.01, complete sequence	18149-18181	8	0.758
NC_016109_2	2.18\|613412\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613412-613444	33	NZ_CP054621	Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence	925667-925699	8	0.758
NC_016109_2	2.18\|613412\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613412-613444	33	NZ_CP015008	Aminobacter aminovorans strain KCTC 2477 plasmid pAA03, complete sequence	141747-141779	8	0.758
NC_016109_2	2.18\|613412\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613412-613444	33	MH727593	Acidovorax phage ACPWH, complete genome	39043-39075	8	0.758
NC_016109_2	2.20\|613534\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613534-613566	33	NZ_CP015006	Aminobacter aminovorans strain KCTC 2477 plasmid pAA01, complete sequence	445494-445526	8	0.758
NC_016109_2	2.24\|613778\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613778-613810	33	NZ_CP053712	Acetobacteraceae bacterium strain PAMC 26569 plasmid unnamed5, complete sequence	99854-99886	8	0.758
NC_016109_3	3.4\|623741\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	623741-623773	33	MH001453	Mycobacterium phage Adonis, complete genome	31811-31843	8	0.758
NC_016109_3	3.4\|623741\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	623741-623773	33	NC_014458	Mycobacterium phage Angelica, complete genome	31745-31777	8	0.758
NC_016109_3	3.4\|623741\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	623741-623773	33	MG962364	Mycobacterium phage Deby, complete genome	31763-31795	8	0.758
NC_016109_3	3.4\|623741\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	623741-623773	33	MF919532	Mycobacterium phage Sulley, complete genome	31762-31794	8	0.758
NC_016109_3	3.4\|623741\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	623741-623773	33	NZ_CP029232	Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence	79634-79666	8	0.758
NC_016109_3	3.11\|624168\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624168-624200	33	MH001451	Mycobacterium phage Nairb, complete genome	6260-6292	8	0.758
NC_016109_3	3.11\|624168\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624168-624200	33	MF155936	Mycobacterium phage ZenTime222, complete genome	6260-6292	8	0.758
NC_016109_3	3.11\|624168\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624168-624200	33	MK494089	Mycobacterium phage Ibrahim, complete genome	6260-6292	8	0.758
NC_016109_3	3.11\|624168\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624168-624200	33	NC_024135	Mycobacterium phage Bernal13, complete genome	6260-6292	8	0.758
NC_016109_3	3.11\|624168\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624168-624200	33	KM591905	Mycobacterium phage RonRayGun, complete genome	6260-6292	8	0.758
NC_016109_3	3.11\|624168\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624168-624200	33	MN735432	Mycobacteriophage Whitty, complete genome	6260-6292	8	0.758
NC_016109_3	3.11\|624168\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624168-624200	33	NZ_CP016083	Streptomyces sp. SAT1 plasmid unnamed3, complete sequence	633712-633744	8	0.758
NC_016109_3	3.11\|624168\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624168-624200	33	NZ_CP030864	Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence	376882-376914	8	0.758
NC_016109_3	3.11\|624168\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624168-624200	33	NZ_CP007214	Burkholderia plantarii strain ATCC 43733 plasmid bpln_1p, complete sequence	6157-6189	8	0.758
NC_016109_3	3.14\|624351\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624351-624383	33	NZ_CP029555	Chromobacterium sp. IIBBL 274-1 plasmid unnamed, complete sequence	24961-24993	8	0.758
NC_016109_3	3.14\|624351\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624351-624383	33	NZ_CP045204	Citrobacter sp. NMI7904_11 plasmid pCTEL-1, complete sequence	57750-57782	8	0.758
NC_016109_3	3.14\|624351\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624351-624383	33	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	3297995-3298027	8	0.758
NC_016109_3	3.14\|624351\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624351-624383	33	NZ_CP030128	Indioceanicola profundi strain SCSIO 08040 plasmid unnamed2, complete sequence	97705-97737	8	0.758
NC_016109_3	3.14\|624351\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624351-624383	33	NC_016591	Burkholderia sp. YI23 plasmid byi_2p, complete sequence	101742-101774	8	0.758
NC_016109_3	3.15\|624412\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624412-624444	33	NZ_CP019037	Massilia putida strain 6NM-7 plasmid unnamed2, complete sequence	126010-126042	8	0.758
NC_016109_3	3.18\|624595\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624595-624627	33	NZ_CP019037	Massilia putida strain 6NM-7 plasmid unnamed2, complete sequence	126010-126042	8	0.758
NC_016109_3	3.21\|624778\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624778-624810	33	NZ_LR134446	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 4, complete sequence	68542-68574	8	0.758
NC_016109_3	3.21\|624778\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624778-624810	33	NZ_CP022363	Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence	644924-644956	8	0.758
NC_016109_3	3.21\|624778\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624778-624810	33	NZ_CP054621	Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence	1075369-1075401	8	0.758
NC_016109_3	3.21\|624778\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624778-624810	33	NZ_CP032346	Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence	1313350-1313382	8	0.758
NC_016109_3	3.23\|624900\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624900-624932	33	NZ_CP020539	Sphingobium herbicidovorans strain MH plasmid pMSHV, complete sequence	872250-872282	8	0.758
NC_016109_3	3.26\|625083\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	625083-625115	33	NZ_CP006369	Aureimonas sp. AU20 plasmid pAU20b, complete sequence	76073-76105	8	0.758
NC_016109_3	3.26\|625083\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	625083-625115	33	NZ_CP017244	Rhizobium etli 8C-3 plasmid pRsp8C3c, complete sequence	1248485-1248517	8	0.758
NC_016109_3	3.27\|625144\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	625144-625176	33	MH271305	Gordonia phage Morrissey, complete genome	10907-10939	8	0.758
NC_016109_3	3.30\|625327\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	625327-625359	33	NC_016624	Azospirillum lipoferum 4B plasmid AZO_p5, complete sequence	244933-244965	8	0.758
NC_016109_3	3.30\|625327\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	625327-625359	33	NZ_CP054620	Azospirillum oryzae strain KACC 14407 plasmid unnamed5, complete sequence	7967-7999	8	0.758
NC_016109_3	3.30\|625327\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	625327-625359	33	NZ_CP054620	Azospirillum oryzae strain KACC 14407 plasmid unnamed5, complete sequence	40516-40548	8	0.758
NC_016109_3	3.30\|625327\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	625327-625359	33	NZ_LR594663	Variovorax sp. RA8 plasmid 2	268295-268327	8	0.758
NC_016109_3	3.30\|625327\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	625327-625359	33	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	2700653-2700685	8	0.758
NC_016109_3	3.31\|625388\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	625388-625420	33	NZ_CP053022	Sphingobium yanoikuyae strain YC-XJ2 plasmid p-A-Sy, complete sequence	330114-330146	8	0.758
NC_016109_3	3.31\|625388\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	625388-625420	33	NZ_CP024424	Paracoccus yeei strain TT13 plasmid pTT13-2, complete sequence	163521-163553	8	0.758
NC_016109_3	3.31\|625388\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	625388-625420	33	NZ_CP034351	Streptomyces sp. W1SF4 plasmid p1, complete sequence	92486-92518	8	0.758
NC_016109_3	3.31\|625388\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	625388-625420	33	NZ_CP017104	Rhizobium gallicum strain IE4872 plasmid pRgalIE4872c, complete sequence	475514-475546	8	0.758
NC_016109_3	3.31\|625388\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	625388-625420	33	NC_042014	Arthrobacter phage Piccoletto, complete genome	44309-44341	8	0.758
NC_016109_3	3.33\|625510\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	625510-625542	33	NZ_CP017426	Arthrobacter sp. ZXY-2 plasmid pZXY25, complete sequence	17022-17054	8	0.758
NC_016109_3	3.33\|625510\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	625510-625542	33	NZ_CP040819	Paraoceanicella profunda strain D4M1 plasmid pD4M1A, complete sequence	46593-46625	8	0.758
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP016613	Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence	1250399-1250430	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP021449	Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence	1272371-1272402	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	CP023013	Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence	1382207-1382238	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP049790	Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence	685479-685510	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP049794	Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence	1986368-1986399	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP049788	Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence	437025-437056	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP022766	Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence	1456405-1456436	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP039340	Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence	1447775-1447806	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP021763	Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence	1460685-1460716	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP015116	Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence	1635601-1635632	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP016555	Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence	1200815-1200846	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP049792	Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence	1761529-1761560	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP052069	Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence	1380514-1380545	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP016915	Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence	1281000-1281031	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP016905	Ralstonia solanacearum strain KACC 10709 plasmid unnamed1	460190-460221	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	1896309-1896340	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP022769	Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence	1463852-1463883	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP015851	Ralstonia solanacearum strain YC40-M plasmid, complete sequence	1005721-1005752	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NC_013855	Azospirillum sp. B510 plasmid pAB510a, complete sequence	520357-520388	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP022773	Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence	1173509-1173540	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP022783	Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence	1388400-1388431	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP022791	Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence	1425508-1425539	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP022795	Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence	1385128-1385159	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP052071	Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence	1563924-1563955	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP022482	Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence	1653511-1653542	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP009763	Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence	1350616-1350647	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	CP023015	Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence	604482-604513	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP022779	Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence	1475333-1475364	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP052075	Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence	1563891-1563922	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP052085	Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence	1440888-1440919	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP052095	Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence	1471240-1471271	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP052105	Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence	1562685-1562716	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP021765	Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence	1460667-1460698	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP052077	Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence	1374487-1374518	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP052087	Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence	1440888-1440919	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP052097	Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence	1471240-1471271	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP052115	Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence	1562721-1562752	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP052127	Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence	1440888-1440919	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP052079	Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence	1374509-1374540	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP052089	Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence	1440091-1440122	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP052093	Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence	1471240-1471271	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP052101	Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence	1471240-1471271	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP052099	Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence	1471240-1471271	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP052107	Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence	1562721-1562752	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP022781	Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence	578609-578640	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP052117	Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence	1562710-1562741	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP052125	Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence	1374509-1374540	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP022793	Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence	1381451-1381482	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP022785	Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence	1362104-1362135	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP022787	Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence	1415360-1415391	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP022756	Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence	1454238-1454269	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP052129	Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence	713920-713951	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP052121	Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence	1562710-1562741	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP052123	Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence	1374509-1374540	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP052131	Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence	1440887-1440918	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	CP011998	Ralstonia solanacearum strain YC45 plasmid, complete sequence	1520294-1520325	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP052073	Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence	1563711-1563742	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP052081	Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence	1374509-1374540	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP052083	Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence	1374509-1374540	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP052109	Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence	1562721-1562752	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP052091	Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence	1471243-1471274	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP052111	Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence	569620-569651	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP052103	Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence	1562732-1562763	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP052119	Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence	1562533-1562564	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP052113	Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence	569620-569651	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP032343	Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence	359058-359089	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP030127	Indioceanicola profundi strain SCSIO 08040 plasmid unnamed1, complete sequence	461879-461910	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP030129	Indioceanicola profundi strain SCSIO 08040 plasmid unnamed3, complete sequence	24475-24506	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP032348	Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence	140718-140749	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP012917	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence	369137-369168	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP035710	Sphaerotilus natans subsp. sulfidivorans strain D-507 plasmid pSna507_unt10, complete sequence	241507-241538	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	2382-2413	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	1810734-1810765	8	0.75
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP012399	Chelatococcus sp. CO-6 plasmid pCO-6, complete sequence	374774-374805	8	0.75
NC_016109_8	8.1\|7220782\|31\|NC_016109\|CRISPRCasFinder	7220782-7220812	31	NZ_AP022602	Mycobacterium gallinarum strain JCM 6399 plasmid pJCM6399	120422-120452	8	0.742
NC_016109_8	8.1\|7220782\|31\|NC_016109\|CRISPRCasFinder	7220782-7220812	31	MG589384	Enterobacter phage phi63_307, complete genome	14703-14733	8	0.742
NC_016109_8	8.1\|7220782\|31\|NC_016109\|CRISPRCasFinder	7220782-7220812	31	KR080195	Mycobacterium phage Phayonce, complete genome	10543-10573	8	0.742
NC_016109_8	8.1\|7220782\|31\|NC_016109\|CRISPRCasFinder	7220782-7220812	31	MK759884	Salmonella phage vB_SenM_SB18, complete genome	79064-79094	8	0.742
NC_016109_8	8.1\|7220782\|31\|NC_016109\|CRISPRCasFinder	7220782-7220812	31	NC_015292	Erwinia phage phiEa104, complete genome	78809-78839	8	0.742
NC_016109_8	8.1\|7220782\|31\|NC_016109\|CRISPRCasFinder	7220782-7220812	31	MH426725	Erwinia phage SunLIRen, complete genome	78805-78835	8	0.742
NC_016109_8	8.1\|7220782\|31\|NC_016109\|CRISPRCasFinder	7220782-7220812	31	FQ482083	Erwinia amylovora phage phiEa104 complete genome	78809-78839	8	0.742
NC_016109_8	8.1\|7220782\|31\|NC_016109\|CRISPRCasFinder	7220782-7220812	31	HQ728263	Erwinia phage vB_EamM-M7, complete genome	61773-61803	8	0.742
NC_016109_8	8.1\|7220782\|31\|NC_016109\|CRISPRCasFinder	7220782-7220812	31	NC_011811	Erwinia phage phiEa21-4, complete genome	78822-78852	8	0.742
NC_016109_8	8.1\|7220782\|31\|NC_016109\|CRISPRCasFinder	7220782-7220812	31	MN604407	Salmonella phage ST-3, complete genome	52653-52683	8	0.742
NC_016109_8	8.1\|7220782\|31\|NC_016109\|CRISPRCasFinder	7220782-7220812	31	MK770412	Salmonella phage SE5, complete genome	24908-24938	8	0.742
NC_016109_9	9.4\|7273190\|31\|NC_016109\|CRISPRCasFinder	7273190-7273220	31	NZ_CP028348	Novosphingobium sp. THN1 plasmid pTHN, complete sequence	715147-715177	8	0.742
NC_016109_9	9.4\|7273190\|31\|NC_016109\|CRISPRCasFinder	7273190-7273220	31	NZ_CP039905	Agrobacterium tumefaciens strain CFBP6623 plasmid pAtCFBP6623a, complete sequence	128919-128949	8	0.742
NC_016109_9	9.4\|7273190\|31\|NC_016109\|CRISPRCasFinder	7273190-7273220	31	NZ_CP018229	Rhizobium leguminosarum strain Vaf-108 plasmid unnamed1, complete sequence	23151-23181	8	0.742
NC_016109_9	9.4\|7273190\|31\|NC_016109\|CRISPRCasFinder	7273190-7273220	31	NZ_CP016290	Rhizobium leguminosarum strain Vaf10 plasmid unnamed3, complete sequence	69724-69754	8	0.742
NC_016109_9	9.4\|7273190\|31\|NC_016109\|CRISPRCasFinder	7273190-7273220	31	NC_010625	Paraburkholderia phymatum STM815 plasmid pBPHY01, complete sequence	592837-592867	8	0.742
NC_016109_9	9.7\|7273373\|31\|NC_016109\|CRISPRCasFinder	7273373-7273403	31	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	753914-753944	8	0.742
NC_016109_9	9.7\|7273373\|31\|NC_016109\|CRISPRCasFinder	7273373-7273403	31	LN997843	Streptomyces reticuli genome assembly TUE45, plasmid : II	655585-655615	8	0.742
NC_016109_9	9.7\|7273373\|31\|NC_016109\|CRISPRCasFinder	7273373-7273403	31	NZ_CP044283	Rhodococcus erythropolis strain X5 plasmid pRhX5, complete sequence	136358-136388	8	0.742
NC_016109_9	9.7\|7273373\|31\|NC_016109\|CRISPRCasFinder	7273373-7273403	31	NZ_CP041045	Paracoccus sp. AK26 plasmid pAK1, complete sequence	212696-212726	8	0.742
NC_016109_9	9.7\|7273373\|31\|NC_016109\|CRISPRCasFinder	7273373-7273403	31	NZ_LR134459	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 17, complete sequence	73443-73473	8	0.742
NC_016109_9	9.7\|7273373\|31\|NC_016109\|CRISPRCasFinder	7273373-7273403	31	NZ_AP022339	Mameliella alba strain KU6B plasmid pKUB112, complete sequence	47278-47308	8	0.742
NC_016109_9	9.9\|7273495\|31\|NC_016109\|CRISPRCasFinder	7273495-7273525	31	NZ_LR134460	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 18, complete sequence	355742-355772	8	0.742
NC_016109_9	9.11\|7273627\|31\|NC_016109\|CRISPRCasFinder	7273627-7273657	31	NZ_CP054606	Sulfitobacter pseudonitzschiae strain H46 plasmid unnamed7, complete sequence	227310-227340	8	0.742
NC_016109_9	9.13\|7273749\|31\|NC_016109\|CRISPRCasFinder	7273749-7273779	31	NZ_CP011665	Streptomyces sp. Mg1 plasmid pSMg1-1, complete sequence	127404-127434	8	0.742
NC_016109_9	9.13\|7273749\|31\|NC_016109\|CRISPRCasFinder	7273749-7273779	31	NZ_CP017105	Rhizobium gallicum strain IE4872 plasmid pRgalIE4872d, complete sequence	1662637-1662667	8	0.742
NC_016109_9	9.13\|7273749\|31\|NC_016109\|CRISPRCasFinder	7273749-7273779	31	NZ_CP021410	Celeribacter manganoxidans strain DY25 plasmid pDY25-F, complete sequence	33980-34010	8	0.742
NC_016109_9	9.13\|7273749\|31\|NC_016109\|CRISPRCasFinder	7273749-7273779	31	NZ_CP030762	Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed2, complete sequence	330775-330805	8	0.742
NC_016109_9	9.13\|7273749\|31\|NC_016109\|CRISPRCasFinder	7273749-7273779	31	MH536819	Gordonia phage Fury, complete genome	44033-44063	8	0.742
NC_016109_9	9.13\|7273749\|31\|NC_016109\|CRISPRCasFinder	7273749-7273779	31	MH576960	Gordonia phage Pleakley, complete genome	44034-44064	8	0.742
NC_016109_9	9.14\|7273810\|31\|NC_016109\|CRISPRCasFinder	7273810-7273840	31	NC_014120	Paraburkholderia sp. CCGE1002 plasmid pBC201, complete sequence	294009-294039	8	0.742
NC_016109_9	9.14\|7273810\|31\|NC_016109\|CRISPRCasFinder	7273810-7273840	31	MN234179	Gordonia phage Pipp, complete genome	40386-40416	8	0.742
NC_016109_9	9.14\|7273810\|31\|NC_016109\|CRISPRCasFinder	7273810-7273840	31	MK501729	Gordonia phage Walrus, complete genome	39194-39224	8	0.742
NC_016109_9	9.14\|7273810\|31\|NC_016109\|CRISPRCasFinder	7273810-7273840	31	NC_022125	Rhodococcus erythropolis CCM2595 plasmid pRECF1, complete sequence	8531-8561	8	0.742
NC_016109_9	9.14\|7273810\|31\|NC_016109\|CRISPRCasFinder	7273810-7273840	31	NZ_CP015205	Rhodococcus sp. 008 plasmid pR8C2, complete sequence	51535-51565	8	0.742
NC_016109_9	9.14\|7273810\|31\|NC_016109\|CRISPRCasFinder	7273810-7273840	31	NC_015057	Granulicella tundricola MP5ACTX9 plasmid pACIX901, complete sequence	291681-291711	8	0.742
NC_016109_9	9.14\|7273810\|31\|NC_016109\|CRISPRCasFinder	7273810-7273840	31	NZ_CP025960	Rhodococcus qingshengii strain djl-6-2 plasmid pDJL1, complete sequence	29474-29504	8	0.742
NC_016109_9	9.14\|7273810\|31\|NC_016109\|CRISPRCasFinder	7273810-7273840	31	NZ_CP011297	Rhodococcus erythropolis strain BG43 plasmid pRLLBG43, complete sequence	92589-92619	8	0.742
NC_016109_9	9.14\|7273810\|31\|NC_016109\|CRISPRCasFinder	7273810-7273840	31	NZ_CP034352	Streptomyces sp. W1SF4 plasmid p2, complete sequence	173622-173652	8	0.742
NC_016109_9	9.14\|7273810\|31\|NC_016109\|CRISPRCasFinder	7273810-7273840	31	NZ_CP017300	Rhodococcus sp. YL-1 plasmid pYLC1, complete sequence	413885-413915	8	0.742
NC_016109_9	9.14\|7273810\|31\|NC_016109\|CRISPRCasFinder	7273810-7273840	31	NZ_LR134465	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 23, complete sequence	261315-261345	8	0.742
NC_016109_9	9.14\|7273810\|31\|NC_016109\|CRISPRCasFinder	7273810-7273840	31	NC_016586	Azospirillum lipoferum 4B plasmid AZO_p2, complete sequence	741059-741089	8	0.742
NC_016109_9	9.15\|7273871\|31\|NC_016109\|CRISPRCasFinder	7273871-7273901	31	MK433272	Gordonia phage IDyn, complete genome	31918-31948	8	0.742
NC_016109_9	9.15\|7273871\|31\|NC_016109\|CRISPRCasFinder	7273871-7273901	31	NZ_CP015738	Shinella sp. HZN7 plasmid pShin-02, complete sequence	300124-300154	8	0.742
NC_016109_9	9.16\|7273932\|31\|NC_016109\|CRISPRCasFinder	7273932-7273962	31	NZ_CP046906	Streptomyces sp. QHH-9511 plasmid unnamed, complete sequence	30648-30678	8	0.742
NC_016109_9	9.17\|7273993\|31\|NC_016109\|CRISPRCasFinder	7273993-7274023	31	NZ_CP021083	Deinococcus ficus strain CC-FR2-10 plasmid pDFI2, complete sequence	147876-147906	8	0.742
NC_016109_9	9.17\|7273993\|31\|NC_016109\|CRISPRCasFinder	7273993-7274023	31	NZ_LR134467	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 25, complete sequence	13275-13305	8	0.742
NC_016109_9	9.17\|7273993\|31\|NC_016109\|CRISPRCasFinder	7273993-7274023	31	NZ_LR723672	Rhizobium flavum strain YW14 plasmid 3	65953-65983	8	0.742
NC_016109_9	9.17\|7273993\|31\|NC_016109\|CRISPRCasFinder	7273993-7274023	31	KX961385	Bordetella virus LK3, complete genome	40962-40992	8	0.742
NC_016109_9	9.17\|7273993\|31\|NC_016109\|CRISPRCasFinder	7273993-7274023	31	KY000220	Bordetella phage FP1, complete genome	16251-16281	8	0.742
NC_016109_9	9.17\|7273993\|31\|NC_016109\|CRISPRCasFinder	7273993-7274023	31	KY000221	Bordetella phage CN1, complete genome	16359-16389	8	0.742
NC_016109_9	9.17\|7273993\|31\|NC_016109\|CRISPRCasFinder	7273993-7274023	31	NC_047877	Bordetella phage CN2, complete genome	16250-16280	8	0.742
NC_016109_9	9.17\|7273993\|31\|NC_016109\|CRISPRCasFinder	7273993-7274023	31	NC_047879	Bordetella phage MW2, complete genome	16628-16658	8	0.742
NC_016109_9	9.21\|7273189\|32\|NC_016109\|CRT	7273189-7273220	32	NZ_LR134452	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 10, complete sequence	357967-357998	8	0.75
NC_016109_9	9.21\|7273189\|32\|NC_016109\|CRT	7273189-7273220	32	NZ_CP016082	Streptomyces sp. SAT1 plasmid unnamed2, complete sequence	114207-114238	8	0.75
NC_016109_9	9.24\|7273372\|32\|NC_016109\|CRT	7273372-7273403	32	NZ_CP039697	Novosphingobium sp. ABRDHK2 plasmid pABRDHK22, complete sequence	688458-688489	8	0.75
NC_016109_9	9.24\|7273372\|32\|NC_016109\|CRT	7273372-7273403	32	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	753914-753945	8	0.75
NC_016109_9	9.24\|7273372\|32\|NC_016109\|CRT	7273372-7273403	32	NZ_AP022339	Mameliella alba strain KU6B plasmid pKUB112, complete sequence	47277-47308	8	0.75
NC_016109_9	9.24\|7273372\|32\|NC_016109\|CRT	7273372-7273403	32	NZ_CP006995	Methylobacterium sp. AMS5 plasmid pAMS5c, complete sequence	13558-13589	8	0.75
NC_016109_9	9.26\|7273494\|32\|NC_016109\|CRT	7273494-7273525	32	NZ_LR134460	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 18, complete sequence	355742-355773	8	0.75
NC_016109_9	9.30\|7273748\|32\|NC_016109\|CRT	7273748-7273779	32	NZ_CP017105	Rhizobium gallicum strain IE4872 plasmid pRgalIE4872d, complete sequence	1662637-1662668	8	0.75
NC_016109_9	9.30\|7273748\|32\|NC_016109\|CRT	7273748-7273779	32	NZ_CP021410	Celeribacter manganoxidans strain DY25 plasmid pDY25-F, complete sequence	33979-34010	8	0.75
NC_016109_9	9.30\|7273748\|32\|NC_016109\|CRT	7273748-7273779	32	MH536819	Gordonia phage Fury, complete genome	44033-44064	8	0.75
NC_016109_9	9.30\|7273748\|32\|NC_016109\|CRT	7273748-7273779	32	MH576960	Gordonia phage Pleakley, complete genome	44034-44065	8	0.75
NC_016109_9	9.31\|7273809\|32\|NC_016109\|CRT	7273809-7273840	32	NC_022599	Micrococcus sp. V7 plasmid pLMV7, complete sequence	85098-85129	8	0.75
NC_016109_9	9.31\|7273809\|32\|NC_016109\|CRT	7273809-7273840	32	NZ_CP034352	Streptomyces sp. W1SF4 plasmid p2, complete sequence	173622-173653	8	0.75
NC_016109_9	9.31\|7273809\|32\|NC_016109\|CRT	7273809-7273840	32	NC_016623	Azospirillum lipoferum 4B plasmid AZO_p3, complete sequence	453607-453638	8	0.75
NC_016109_9	9.31\|7273809\|32\|NC_016109\|CRT	7273809-7273840	32	NZ_CP054616	Azospirillum oryzae strain KACC 14407 plasmid unnamed2, complete sequence	108215-108246	8	0.75
NC_016109_9	9.31\|7273809\|32\|NC_016109\|CRT	7273809-7273840	32	NC_016586	Azospirillum lipoferum 4B plasmid AZO_p2, complete sequence	741058-741089	8	0.75
NC_016109_9	9.32\|7273870\|32\|NC_016109\|CRT	7273870-7273901	32	NZ_CP015738	Shinella sp. HZN7 plasmid pShin-02, complete sequence	300124-300155	8	0.75
NC_016109_9	9.33\|7273931\|32\|NC_016109\|CRT	7273931-7273962	32	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	1942655-1942686	8	0.75
NC_016109_9	9.34\|7273992\|32\|NC_016109\|CRT	7273992-7274023	32	NZ_CP021083	Deinococcus ficus strain CC-FR2-10 plasmid pDFI2, complete sequence	147875-147906	8	0.75
NC_016109_9	9.34\|7273992\|32\|NC_016109\|CRT	7273992-7274023	32	NZ_CP034472	Pantoea agglomerans strain CFSAN047153 plasmid pCFSAN047153_3, complete sequence	48880-48911	8	0.75
NC_016109_9	9.34\|7273992\|32\|NC_016109\|CRT	7273992-7274023	32	NZ_CP034477	Pantoea agglomerans strain CFSAN047154 plasmid pCFSAN047154_3, complete sequence	132151-132182	8	0.75
NC_016109_9	9.37\|7273188\|33\|NC_016109\|PILER-CR	7273188-7273220	33	NZ_LR134452	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 10, complete sequence	357966-357998	8	0.758
NC_016109_9	9.40\|7273371\|33\|NC_016109\|PILER-CR	7273371-7273403	33	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	209549-209581	8	0.758
NC_016109_9	9.40\|7273371\|33\|NC_016109\|PILER-CR	7273371-7273403	33	NC_005838	Thermus thermophilus HB27 plasmid pTT27, complete sequence	151579-151611	8	0.758
NC_016109_9	9.46\|7273747\|33\|NC_016109\|PILER-CR	7273747-7273779	33	NZ_CP032322	Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence	344931-344963	8	0.758
NC_016109_9	9.46\|7273747\|33\|NC_016109\|PILER-CR	7273747-7273779	33	NZ_CP022367	Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence	1777941-1777973	8	0.758
NC_016109_9	9.46\|7273747\|33\|NC_016109\|PILER-CR	7273747-7273779	33	NZ_CP007794	Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence	780279-780311	8	0.758
NC_016109_9	9.46\|7273747\|33\|NC_016109\|PILER-CR	7273747-7273779	33	NZ_CP032340	Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence	1159107-1159139	8	0.758
NC_016109_9	9.46\|7273747\|33\|NC_016109\|PILER-CR	7273747-7273779	33	NZ_CP032346	Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence	290260-290292	8	0.758
NC_016109_9	9.46\|7273747\|33\|NC_016109\|PILER-CR	7273747-7273779	33	NZ_CP012915	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence	973266-973298	8	0.758
NC_016109_9	9.47\|7273808\|33\|NC_016109\|PILER-CR	7273808-7273840	33	NZ_CP049749	Rhodococcus fascians A21d2 plasmid pA21d2, complete sequence	58303-58335	8	0.758
NC_016109_9	9.47\|7273808\|33\|NC_016109\|PILER-CR	7273808-7273840	33	NC_016623	Azospirillum lipoferum 4B plasmid AZO_p3, complete sequence	453607-453639	8	0.758
NC_016109_9	9.47\|7273808\|33\|NC_016109\|PILER-CR	7273808-7273840	33	NZ_CP054616	Azospirillum oryzae strain KACC 14407 plasmid unnamed2, complete sequence	108214-108246	8	0.758
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	4741877-4741908	9	0.719
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NZ_AP014705	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence	271326-271357	9	0.719
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NZ_CP032349	Azospirillum brasilense strain MTCC4039 plasmid p3, complete sequence	624314-624345	9	0.719
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	FJ937737	Burkholderia cenocepacia phage BcepIL02, complete genome	28659-28690	9	0.719
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NC_012743	Burkholderia phage BcepIL02, complete genome	28659-28690	9	0.719
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	CP054921	Streptomyces sp. NA03103 plasmid unnamed1, complete sequence	5853-5884	9	0.719
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NZ_CP027025	Streptomyces sp. WAC00288 plasmid p3, complete sequence	37916-37947	9	0.719
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NZ_CP013345	Sphingopyxis macrogoltabida strain 203N plasmid unnamed1, complete sequence	289541-289572	9	0.719
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NC_007765	Rhizobium etli CFN 42 plasmid p42e, complete sequence	172723-172754	9	0.719
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NZ_CP039340	Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence	1552303-1552334	9	0.719
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NZ_CP020909	Rhizobium etli strain NXC12 plasmid pRetNXC12c, complete sequence	172930-172961	9	0.719
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NZ_CP025613	Niveispirillum cyanobacteriorum strain TH16 plasmid unnamed1, complete sequence	548692-548723	9	0.719
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NC_021908	Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1d, complete sequence	171994-172025	9	0.719
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NZ_CP017563	Paraburkholderia sprentiae WSM5005 plasmid pl1WSM5005, complete sequence	604405-604436	9	0.719
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	LN997843	Streptomyces reticuli genome assembly TUE45, plasmid : II	658611-658642	9	0.719
NC_016109_2	2.2\|613168\|32\|NC_016109\|CRT	613168-613199	32	NZ_CP050098	Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b4, complete sequence	287414-287445	9	0.719
NC_016109_2	2.2\|613168\|32\|NC_016109\|CRT	613168-613199	32	NZ_CP021033	Rhizobium sp. NXC14 plasmid pRspNXC14c, complete sequence	17826-17857	9	0.719
NC_016109_2	2.2\|613168\|32\|NC_016109\|CRT	613168-613199	32	NZ_CP049731	Rhizobium leguminosarum strain A1 plasmid pRL12, complete sequence	183491-183522	9	0.719
NC_016109_2	2.2\|613168\|32\|NC_016109\|CRT	613168-613199	32	NC_007766	Rhizobium etli CFN 42 plasmid p42f, complete sequence	13211-13242	9	0.719
NC_016109_2	2.2\|613168\|32\|NC_016109\|CRT	613168-613199	32	NZ_CP053440	Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eF, complete sequence	292945-292976	9	0.719
NC_016109_2	2.2\|613168\|32\|NC_016109\|CRT	613168-613199	32	NZ_CP006990	Rhizobium sp. IE4771 plasmid pRetIE4771d, complete sequence	22800-22831	9	0.719
NC_016109_2	2.2\|613168\|32\|NC_016109\|CRT	613168-613199	32	NZ_CP021029	Rhizobium sp. TAL182 plasmid pRetTAL182e, complete sequence	13541-13572	9	0.719
NC_016109_2	2.2\|613168\|32\|NC_016109\|CRT	613168-613199	32	NZ_CP013635	Rhizobium sp. N324 plasmid pRspN324e, complete sequence	19816-19847	9	0.719
NC_016109_2	2.2\|613168\|32\|NC_016109\|CRT	613168-613199	32	NZ_CP020911	Rhizobium etli strain NXC12 plasmid pRetNXC12e, complete sequence	13221-13252	9	0.719
NC_016109_2	2.2\|613168\|32\|NC_016109\|CRT	613168-613199	32	NZ_CP020952	Rhizobium sp. CIAT894 plasmid pRheCIAT894e, complete sequence	28155-28186	9	0.719
NC_016109_2	2.2\|613168\|32\|NC_016109\|CRT	613168-613199	32	NZ_CP013600	Rhizobium sp. N741 plasmid pRspN741e, complete sequence	14646-14677	9	0.719
NC_016109_2	2.2\|613168\|32\|NC_016109\|CRT	613168-613199	32	NZ_CP013531	Rhizobium phaseoli strain R723 plasmid pRphaR723d, complete sequence	17347-17378	9	0.719
NC_016109_2	2.2\|613168\|32\|NC_016109\|CRT	613168-613199	32	NC_021911	Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1f, complete sequence	13222-13253	9	0.719
NC_016109_2	2.2\|613168\|32\|NC_016109\|CRT	613168-613199	32	NC_011368	Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG201, complete sequence	315629-315660	9	0.719
NC_016109_2	2.2\|613168\|32\|NC_016109\|CRT	613168-613199	32	NZ_CP013504	Rhizobium esperanzae strain N561 plasmid pRspN561d, complete sequence	14646-14677	9	0.719
NC_016109_2	2.2\|613168\|32\|NC_016109\|CRT	613168-613199	32	NZ_CP013584	Rhizobium phaseoli strain N261 plasmid pRphaN261d, complete sequence	17347-17378	9	0.719
NC_016109_2	2.2\|613168\|32\|NC_016109\|CRT	613168-613199	32	NZ_CP013510	Rhizobium sp. N1341 plasmid pRspN1341e, complete sequence	14646-14677	9	0.719
NC_016109_2	2.2\|613168\|32\|NC_016109\|CRT	613168-613199	32	NZ_CP013521	Rhizobium sp. N113 plasmid pRspN113d, complete sequence	14646-14677	9	0.719
NC_016109_2	2.2\|613168\|32\|NC_016109\|CRT	613168-613199	32	NZ_CP013494	Rhizobium sp. N6212 plasmid pRspN6212d, complete sequence	14646-14677	9	0.719
NC_016109_2	2.2\|613168\|32\|NC_016109\|CRT	613168-613199	32	NZ_CP013515	Rhizobium sp. N1314 plasmid pRspN1314d, complete sequence	13229-13260	9	0.719
NC_016109_2	2.2\|613168\|32\|NC_016109\|CRT	613168-613199	32	NZ_CP054028	Rhizobium sp. JKLM19E plasmid pPR19E01, complete sequence	88489-88520	9	0.719
NC_016109_2	2.2\|613168\|32\|NC_016109\|CRT	613168-613199	32	NZ_CP013594	Rhizobium sp. N871 plasmid pRspN871d, complete sequence	14646-14677	9	0.719
NC_016109_2	2.2\|613168\|32\|NC_016109\|CRT	613168-613199	32	CP007644	Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803c, complete sequence	21656-21687	9	0.719
NC_016109_2	2.2\|613168\|32\|NC_016109\|CRT	613168-613199	32	NC_010997	Rhizobium etli CIAT 652 plasmid pC, complete sequence	17138-17169	9	0.719
NC_016109_2	2.2\|613168\|32\|NC_016109\|CRT	613168-613199	32	NZ_CP013605	Rhizobium sp. N731 plasmid pRspN731d, complete sequence	13223-13254	9	0.719
NC_016109_2	2.3\|613229\|32\|NC_016109\|CRT	613229-613260	32	NC_016624	Azospirillum lipoferum 4B plasmid AZO_p5, complete sequence	240034-240065	9	0.719
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NZ_CP016083	Streptomyces sp. SAT1 plasmid unnamed3, complete sequence	76388-76419	9	0.719
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NZ_AP022607	Mycobacterium branderi strain JCM 12687 plasmid pJCM12687	73667-73698	9	0.719
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	990045-990076	9	0.719
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	CP047137	Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence	357056-357087	9	0.719
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NZ_CP032054	Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence	591787-591818	9	0.719
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NZ_CP016560	Streptomyces clavuligerus strain F613-1 plasmid pSCL4, complete sequence	249043-249074	9	0.719
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NZ_CP007129	Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence	913621-913652	9	0.719
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NZ_CP034351	Streptomyces sp. W1SF4 plasmid p1, complete sequence	218859-218890	9	0.719
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NZ_CP035710	Sphaerotilus natans subsp. sulfidivorans strain D-507 plasmid pSna507_unt10, complete sequence	241556-241587	9	0.719
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NZ_CP030772	Streptomyces sp. YIM 121038 plasmid pSSP121038, complete sequence	352368-352399	9	0.719
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NZ_CP013856	Pseudonocardia sp. HH130630-07 plasmid pLS2-2, complete sequence	19493-19524	9	0.719
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NZ_CP024907	Paraburkholderia caledonica strain PHRS4 plasmid pPHRS4, complete sequence	148996-149027	9	0.719
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NZ_CP040820	Paraoceanicella profunda strain D4M1 plasmid pD4M1B, complete sequence	136457-136488	9	0.719
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NC_008757	Polaromonas naphthalenivorans CJ2 plasmid pPNAP01, complete sequence	274930-274961	9	0.719
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NC_017958	Tistrella mobilis KA081020-065 plasmid pTM3, complete sequence	282244-282275	9	0.719
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NZ_CP026518	Deinococcus sp. NW-56 plasmid unnamed2, complete sequence	344378-344409	9	0.719
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	MT188704	Mesorhizobium phage Cp1R7A-A1, complete genome	94749-94780	9	0.719
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	MG757166	Gordonia phage SuperSulley, complete genome	61666-61697	9	0.719
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	MK937595	Streptomyces phage Dubu, complete genome	5755-5786	9	0.719
NC_016109_2	2.6\|613412\|32\|NC_016109\|CRT	613412-613443	32	NZ_CP045385	Ruegeria sp. THAF33 plasmid pTHAF33_a, complete sequence	381921-381952	9	0.719
NC_016109_2	2.6\|613412\|32\|NC_016109\|CRT	613412-613443	32	NC_015583	Novosphingobium sp. PP1Y plasmid Mpl, complete sequence	489124-489155	9	0.719
NC_016109_2	2.6\|613412\|32\|NC_016109\|CRT	613412-613443	32	NC_015583	Novosphingobium sp. PP1Y plasmid Mpl, complete sequence	493133-493164	9	0.719
NC_016109_2	2.6\|613412\|32\|NC_016109\|CRT	613412-613443	32	NC_012987	Methylorubrum extorquens AM1 plasmid p1METDI, complete sequence	115277-115308	9	0.719
NC_016109_2	2.6\|613412\|32\|NC_016109\|CRT	613412-613443	32	NZ_CP032347	Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence	627793-627824	9	0.719
NC_016109_2	2.6\|613412\|32\|NC_016109\|CRT	613412-613443	32	NC_047861	Bordetella phage vB_BbrM_PHB04, complete genome	68962-68993	9	0.719
NC_016109_2	2.7\|613473\|32\|NC_016109\|CRT	613473-613504	32	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	1144491-1144522	9	0.719
NC_016109_2	2.8\|613534\|32\|NC_016109\|CRT	613534-613565	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	1486131-1486162	9	0.719
NC_016109_2	2.8\|613534\|32\|NC_016109\|CRT	613534-613565	32	NZ_CP031163	Deinococcus wulumuqiensis strain NEB 479 plasmid pDrdI, complete sequence	278817-278848	9	0.719
NC_016109_2	2.8\|613534\|32\|NC_016109\|CRT	613534-613565	32	NC_018022	Mycolicibacterium chubuense NBB4 plasmid pMYCCH.01, complete sequence	362085-362116	9	0.719
NC_016109_2	2.8\|613534\|32\|NC_016109\|CRT	613534-613565	32	NC_008703	Mycobacterium sp. KMS plasmid pMKMS01, complete sequence	257922-257953	9	0.719
NC_016109_2	2.9\|613595\|32\|NC_016109\|CRT	613595-613626	32	NC_005241	Cupriavidus necator H16 megaplasmid pHG1, complete sequence	267277-267308	9	0.719
NC_016109_2	2.9\|613595\|32\|NC_016109\|CRT	613595-613626	32	NZ_AP022334	Methylosinus sp. C49 isolate Methylosinus sp. C49 plasmid pMSC49b, complete sequence	141417-141448	9	0.719
NC_016109_2	2.9\|613595\|32\|NC_016109\|CRT	613595-613626	32	NZ_CP039289	Cupriavidus necator H16 plasmid pHG1, complete sequence	267276-267307	9	0.719
NC_016109_2	2.10\|613656\|32\|NC_016109\|CRT	613656-613687	32	NZ_CP016879	Xanthomonas hortorum strain B07-007 plasmid pB07007, complete sequence	34234-34265	9	0.719
NC_016109_2	2.10\|613656\|32\|NC_016109\|CRT	613656-613687	32	NZ_CP042268	Pseudomonas aeruginosa strain HOU1 plasmid pHOU1-1, complete sequence	153959-153990	9	0.719
NC_016109_2	2.10\|613656\|32\|NC_016109\|CRT	613656-613687	32	NZ_CP018733	Xanthomonas gardneri strain ICMP 7383 plasmid pICMP7383.2, complete sequence	38800-38831	9	0.719
NC_016109_2	2.12\|613778\|32\|NC_016109\|CRT	613778-613809	32	NZ_CP014516	Frondihabitans sp. PAMC 28766 strain SR6 plasmid 3, complete sequence	70313-70344	9	0.719
NC_016109_2	2.12\|613778\|32\|NC_016109\|CRT	613778-613809	32	NC_042014	Arthrobacter phage Piccoletto, complete genome	2810-2841	9	0.719
NC_016109_2	2.13\|613107\|33\|NC_016109\|CRISPRCasFinder	613107-613139	33	FJ937737	Burkholderia cenocepacia phage BcepIL02, complete genome	28659-28691	9	0.727
NC_016109_2	2.13\|613107\|33\|NC_016109\|CRISPRCasFinder	613107-613139	33	NC_012743	Burkholderia phage BcepIL02, complete genome	28659-28691	9	0.727
NC_016109_2	2.13\|613107\|33\|NC_016109\|CRISPRCasFinder	613107-613139	33	NZ_CP030864	Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence	234395-234427	9	0.727
NC_016109_2	2.13\|613107\|33\|NC_016109\|CRISPRCasFinder	613107-613139	33	MT498055	Arthrobacter phage Bumble, complete genome	27338-27370	9	0.727
NC_016109_2	2.15\|613229\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613229-613261	33	NC_016624	Azospirillum lipoferum 4B plasmid AZO_p5, complete sequence	240033-240065	9	0.727
NC_016109_2	2.16\|613290\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613290-613322	33	NZ_CP034351	Streptomyces sp. W1SF4 plasmid p1, complete sequence	218858-218890	9	0.727
NC_016109_2	2.16\|613290\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613290-613322	33	MK801727	Gordonia phage ThankyouJordi, complete genome	14534-14566	9	0.727
NC_016109_2	2.16\|613290\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613290-613322	33	MK875793	Gordonia phage WelcomeAyanna, complete genome	14534-14566	9	0.727
NC_016109_2	2.16\|613290\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613290-613322	33	NZ_CP032828	Sphingomonas sp. YZ-8 plasmid unnamed1, complete sequence	603931-603963	9	0.727
NC_016109_2	2.16\|613290\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613290-613322	33	NZ_CP007129	Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence	913620-913652	9	0.727
NC_016109_2	2.16\|613290\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613290-613322	33	NZ_CP035710	Sphaerotilus natans subsp. sulfidivorans strain D-507 plasmid pSna507_unt10, complete sequence	241555-241587	9	0.727
NC_016109_2	2.16\|613290\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613290-613322	33	MN693668	Marine virus AFVG_250M1112, complete genome	3334-3366	9	0.727
NC_016109_2	2.18\|613412\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613412-613444	33	NZ_CP015009	Aminobacter aminovorans strain KCTC 2477 plasmid pAA04, complete sequence	3036-3068	9	0.727
NC_016109_2	2.18\|613412\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613412-613444	33	NZ_AP018921	Pseudonocardia autotrophica strain NBRC 12743 plasmid pPA12743CP, complete sequence	63961-63993	9	0.727
NC_016109_2	2.18\|613412\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613412-613444	33	KR053197	Gordonia phage GRU3, complete genome	3028-3060	9	0.727
NC_016109_2	2.18\|613412\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613412-613444	33	NZ_CP020539	Sphingobium herbicidovorans strain MH plasmid pMSHV, complete sequence	343065-343097	9	0.727
NC_016109_2	2.19\|613473\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613473-613505	33	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	1144491-1144523	9	0.727
NC_016109_2	2.21\|613595\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613595-613627	33	NZ_CP032340	Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence	871105-871137	9	0.727
NC_016109_2	2.21\|613595\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613595-613627	33	NZ_CP012915	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence	1261273-1261305	9	0.727
NC_016109_2	2.24\|613778\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613778-613810	33	MK765627	Tortoise microvirus 74 isolate 74_SP_45, complete genome	5975-6007	9	0.727
NC_016109_3	3.2\|623619\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	623619-623651	33	NZ_CP046574	Rhodococcus sp. WAY2 plasmid pRWAY02, complete sequence	188510-188542	9	0.727
NC_016109_3	3.3\|623680\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	623680-623712	33	NZ_CP017148	Bosea vaviloviae strain Vaf18 plasmid unnamed1, complete sequence	24108-24140	9	0.727
NC_016109_3	3.4\|623741\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	623741-623773	33	NZ_CP042332	Bosea sp. F3-2 plasmid pB32-1, complete sequence	390167-390199	9	0.727
NC_016109_3	3.4\|623741\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	623741-623773	33	NZ_CP026093	Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence	831870-831902	9	0.727
NC_016109_3	3.4\|623741\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	623741-623773	33	NZ_CP029358	Azospirillum sp. CFH 70021 plasmid unnamed3	140922-140954	9	0.727
NC_016109_3	3.4\|623741\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	623741-623773	33	NC_014309	Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome	1678750-1678782	9	0.727
NC_016109_3	3.4\|623741\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	623741-623773	33	NZ_CP021767	Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence	1691772-1691804	9	0.727
NC_016109_3	3.11\|624168\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624168-624200	33	NC_024970	Streptomyces aureofaciens strain CCM3239 plasmid pSA3239, complete sequence	217982-218014	9	0.727
NC_016109_3	3.11\|624168\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624168-624200	33	NZ_KJ396772	Streptomyces lavendulae subsp. lavendulae strain CCM3239 plasmid pSA3239, complete sequence	217982-218014	9	0.727
NC_016109_3	3.11\|624168\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624168-624200	33	NZ_CP013856	Pseudonocardia sp. HH130630-07 plasmid pLS2-2, complete sequence	100690-100722	9	0.727
NC_016109_3	3.11\|624168\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624168-624200	33	NZ_CP024986	Streptomyces lavendulae subsp. lavendulae strain CCM 3239 plasmid pSA3239, complete sequence	23063-23095	9	0.727
NC_016109_3	3.11\|624168\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624168-624200	33	NZ_CP025188	Roseomonas mucosa strain AD2 plasmid p1-AD2, complete sequence	163884-163916	9	0.727
NC_016109_3	3.14\|624351\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624351-624383	33	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	3961923-3961955	9	0.727
NC_016109_3	3.15\|624412\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624412-624444	33	NZ_LR134467	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 25, complete sequence	20815-20847	9	0.727
NC_016109_3	3.17\|624534\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624534-624566	33	NZ_LT984809	Cupriavidus taiwanensis isolate Cupriavidus taiwanensis STM 8555 plasmid I, complete sequence	240948-240980	9	0.727
NC_016109_3	3.18\|624595\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624595-624627	33	NZ_LR134467	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 25, complete sequence	20815-20847	9	0.727
NC_016109_3	3.20\|624717\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624717-624749	33	NZ_CP023071	Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence	1677919-1677951	9	0.727
NC_016109_3	3.21\|624778\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624778-624810	33	NZ_CP039965	Pseudorhodobacter sp. S12M18 plasmid unnamed1, complete sequence	1054806-1054838	9	0.727
NC_016109_3	3.21\|624778\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624778-624810	33	NZ_CP041045	Paracoccus sp. AK26 plasmid pAK1, complete sequence	211776-211808	9	0.727
NC_016109_3	3.21\|624778\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624778-624810	33	NC_011143	Phenylobacterium zucineum HLK1 plasmid, complete sequence	316253-316285	9	0.727
NC_016109_3	3.21\|624778\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624778-624810	33	NZ_CP030864	Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence	386052-386084	9	0.727
NC_016109_3	3.21\|624778\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624778-624810	33	NC_017311	Desulfovibrio vulgaris RCH1 plasmid pDEVAL01, complete sequence	65566-65598	9	0.727
NC_016109_3	3.21\|624778\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624778-624810	33	NZ_CP032347	Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence	108601-108633	9	0.727
NC_016109_3	3.21\|624778\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624778-624810	33	NZ_CP045548	Streptomyces sp. SYP-A7193 plasmid unnamed1, complete sequence	105667-105699	9	0.727
NC_016109_3	3.21\|624778\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624778-624810	33	NC_005863	Desulfovibrio vulgaris str. Hildenborough plasmid pDV, complete sequence	71009-71041	9	0.727
NC_016109_3	3.21\|624778\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624778-624810	33	NZ_CP041605	Streptomyces sp. S1D4-14 plasmid pS1D4-14.1, complete sequence	106443-106475	9	0.727
NC_016109_3	3.21\|624778\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624778-624810	33	NC_008741	Desulfovibrio vulgaris DP4 plasmid pDVUL01, complete sequence	132779-132811	9	0.727
NC_016109_3	3.24\|624961\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624961-624993	33	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	710524-710556	9	0.727
NC_016109_3	3.24\|624961\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624961-624993	33	NZ_CP007796	Azospirillum brasilense strain Az39 plasmid AbAZ39_p3, complete sequence	34384-34416	9	0.727
NC_016109_3	3.24\|624961\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624961-624993	33	NZ_CP032325	Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence	612424-612456	9	0.727
NC_016109_3	3.26\|625083\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	625083-625115	33	MN234199	Mycobacterium phage Ekdilam, complete genome	19409-19441	9	0.727
NC_016109_3	3.30\|625327\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	625327-625359	33	NZ_CP015742	Shinella sp. HZN7 plasmid pShin-06, complete sequence	66672-66704	9	0.727
NC_016109_3	3.31\|625388\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	625388-625420	33	NC_013858	Azospirillum sp. B510 plasmid pAB510d, complete sequence	142179-142211	9	0.727
NC_016109_3	3.31\|625388\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	625388-625420	33	NZ_CP030772	Streptomyces sp. YIM 121038 plasmid pSSP121038, complete sequence	934582-934614	9	0.727
NC_016109_3	3.31\|625388\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	625388-625420	33	NZ_CP051182	Thalassobius gelatinovorus strain NEB572 plasmid pAge77, complete sequence	41895-41927	9	0.727
NC_016109_3	3.33\|625510\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	625510-625542	33	NZ_CP007050	Rhizobium leguminosarum bv. trifolii WSM1689 plasmid unnamed, complete sequence	85908-85940	9	0.727
NC_016109_3	3.33\|625510\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	625510-625542	33	NC_012852	Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132504, complete sequence	316043-316075	9	0.727
NC_016109_3	3.33\|625510\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	625510-625542	33	NZ_CP054025	Rhizobium sp. JKLM12A2 plasmid pPR12A204, complete sequence	292098-292130	9	0.727
NC_016109_3	3.36\|625693\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	625693-625725	33	NZ_CP044283	Rhodococcus erythropolis strain X5 plasmid pRhX5, complete sequence	316092-316124	9	0.727
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP021357	Rhodococcus sp. S2-17 plasmid pRB11, complete sequence	8460-8491	9	0.719
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP023450	Rhizorhabdus dicambivorans strain Ndbn-20 plasmid p1, complete sequence	72402-72433	9	0.719
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_AP017658	Sphingobium cloacae strain JCM 10874 plasmid pSCLO_4, complete sequence	98346-98377	9	0.719
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP010956	Sphingobium sp. YBL2 plasmid 2pYBL2-2, complete sequence	78845-78876	9	0.719
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP013071	Sphingobium indicum B90A plasmid pSRL1, complete sequence	9251-9282	9	0.719
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NC_012520	Rhodococcus opacus B4 plasmid pROB01, complete sequence	323621-323652	9	0.719
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NC_015595	Sphingobium chlorophenolicum L-1 plasmid pSPHCH01, complete sequence	57421-57452	9	0.719
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NC_008271	Rhodococcus jostii RHA1 plasmid pRHL3, complete sequence	235278-235309	9	0.719
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP046254	Sphingobium sp. CAP-1 plasmid p1, complete sequence	167131-167162	9	0.719
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NC_015974	Sphingobium sp. SYK-6 plasmid pSLPG, complete sequence	139596-139627	9	0.719
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP029832	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence	633368-633399	9	0.719
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	CP021182	Sphingomonas wittichii DC-6 plasmid pDC01, complete sequence	152363-152394	9	0.719
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP005085	Sphingobium sp. TKS plasmid pTK1, complete sequence	500671-500702	9	0.719
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP018225	Tardibacter chloracetimidivorans strain JJ-A5 plasmid pHSL4, complete sequence	169993-170024	9	0.719
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP030074	Streptomyces sp. ZFG47 plasmid unnamed1, complete sequence	141712-141743	9	0.719
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP013265	Sphingobium baderi strain DE-13 plasmid pDE1, complete sequence	106720-106751	9	0.719
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP041018	Sphingobium fuliginis ATCC 27551 plasmid pSF1, complete sequence	71935-71966	9	0.719
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	LN997845	Streptomyces reticuli genome assembly TUE45, plasmid : IV	39986-40017	9	0.719
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	MH744423	Mycobacterium phage Saguaro, complete genome	60508-60539	9	0.719
NC_016109_8	8.1\|7220782\|31\|NC_016109\|CRISPRCasFinder	7220782-7220812	31	NZ_CP032695	Rhizobium jaguaris strain CCGE525 plasmid pRCCGE525c, complete sequence	2531789-2531819	9	0.71
NC_016109_9	9.4\|7273190\|31\|NC_016109\|CRISPRCasFinder	7273190-7273220	31	NC_010625	Paraburkholderia phymatum STM815 plasmid pBPHY01, complete sequence	450011-450041	9	0.71
NC_016109_9	9.4\|7273190\|31\|NC_016109\|CRISPRCasFinder	7273190-7273220	31	NZ_CP015322	Mesorhizobium amorphae CCNWGS0123 plasmid pM0123d, complete sequence	118615-118645	9	0.71
NC_016109_9	9.11\|7273627\|31\|NC_016109\|CRISPRCasFinder	7273627-7273657	31	NZ_CP040821	Paraoceanicella profunda strain D4M1 plasmid pD4M1C, complete sequence	108113-108143	9	0.71
NC_016109_9	9.11\|7273627\|31\|NC_016109\|CRISPRCasFinder	7273627-7273657	31	NZ_CP035419	Leisingera sp. NJS204 plasmid unnamed2, complete sequence	45574-45604	9	0.71
NC_016109_9	9.12\|7273688\|31\|NC_016109\|CRISPRCasFinder	7273688-7273718	31	NC_014838	Pantoea sp. At-9b plasmid pPAT9B01, complete sequence	429373-429403	9	0.71
NC_016109_9	9.13\|7273749\|31\|NC_016109\|CRISPRCasFinder	7273749-7273779	31	JX100810	Caulobacter phage CcrColossus, complete genome	114304-114334	9	0.71
NC_016109_9	9.14\|7273810\|31\|NC_016109\|CRISPRCasFinder	7273810-7273840	31	NZ_LN832562	Paracoccus aminovorans isolate JCM7685 plasmid IV, complete sequence	278585-278615	9	0.71
NC_016109_9	9.14\|7273810\|31\|NC_016109\|CRISPRCasFinder	7273810-7273840	31	NZ_CP044217	Mesorhizobium sp. NIBRBAC000500504 plasmid unnamed, complete sequence	262382-262412	9	0.71
NC_016109_9	9.14\|7273810\|31\|NC_016109\|CRISPRCasFinder	7273810-7273840	31	NZ_CP032342	Azospirillum brasilense strain MTCC4038 plasmid p3, complete sequence	209168-209198	9	0.71
NC_016109_9	9.14\|7273810\|31\|NC_016109\|CRISPRCasFinder	7273810-7273840	31	NZ_CP033321	Azospirillum brasilense strain Cd plasmid p3, complete sequence	46399-46429	9	0.71
NC_016109_9	9.14\|7273810\|31\|NC_016109\|CRISPRCasFinder	7273810-7273840	31	NZ_CP033315	Azospirillum brasilense strain Sp 7 plasmid p3, complete sequence	104954-104984	9	0.71
NC_016109_9	9.15\|7273871\|31\|NC_016109\|CRISPRCasFinder	7273871-7273901	31	NZ_CP021357	Rhodococcus sp. S2-17 plasmid pRB11, complete sequence	101876-101906	9	0.71
NC_016109_9	9.15\|7273871\|31\|NC_016109\|CRISPRCasFinder	7273871-7273901	31	NZ_CP046573	Rhodococcus sp. WAY2 plasmid pRWAY01, complete sequence	409536-409566	9	0.71
NC_016109_9	9.17\|7273993\|31\|NC_016109\|CRISPRCasFinder	7273993-7274023	31	MH271305	Gordonia phage Morrissey, complete genome	834-864	9	0.71
NC_016109_9	9.21\|7273189\|32\|NC_016109\|CRT	7273189-7273220	32	NZ_CP028348	Novosphingobium sp. THN1 plasmid pTHN, complete sequence	715147-715178	9	0.719
NC_016109_9	9.21\|7273189\|32\|NC_016109\|CRT	7273189-7273220	32	NZ_CP018229	Rhizobium leguminosarum strain Vaf-108 plasmid unnamed1, complete sequence	23150-23181	9	0.719
NC_016109_9	9.21\|7273189\|32\|NC_016109\|CRT	7273189-7273220	32	NZ_CP016290	Rhizobium leguminosarum strain Vaf10 plasmid unnamed3, complete sequence	69723-69754	9	0.719
NC_016109_9	9.21\|7273189\|32\|NC_016109\|CRT	7273189-7273220	32	NC_010625	Paraburkholderia phymatum STM815 plasmid pBPHY01, complete sequence	592836-592867	9	0.719
NC_016109_9	9.21\|7273189\|32\|NC_016109\|CRT	7273189-7273220	32	NZ_CP015322	Mesorhizobium amorphae CCNWGS0123 plasmid pM0123d, complete sequence	118615-118646	9	0.719
NC_016109_9	9.24\|7273372\|32\|NC_016109\|CRT	7273372-7273403	32	NZ_LR134459	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 17, complete sequence	73442-73473	9	0.719
NC_016109_9	9.24\|7273372\|32\|NC_016109\|CRT	7273372-7273403	32	NZ_CP044283	Rhodococcus erythropolis strain X5 plasmid pRhX5, complete sequence	136358-136389	9	0.719
NC_016109_9	9.24\|7273372\|32\|NC_016109\|CRT	7273372-7273403	32	NZ_CP041045	Paracoccus sp. AK26 plasmid pAK1, complete sequence	212696-212727	9	0.719
NC_016109_9	9.28\|7273626\|32\|NC_016109\|CRT	7273626-7273657	32	NZ_CP035419	Leisingera sp. NJS204 plasmid unnamed2, complete sequence	45573-45604	9	0.719
NC_016109_9	9.28\|7273626\|32\|NC_016109\|CRT	7273626-7273657	32	NZ_CP054606	Sulfitobacter pseudonitzschiae strain H46 plasmid unnamed7, complete sequence	227309-227340	9	0.719
NC_016109_9	9.28\|7273626\|32\|NC_016109\|CRT	7273626-7273657	32	NZ_CP040821	Paraoceanicella profunda strain D4M1 plasmid pD4M1C, complete sequence	108113-108144	9	0.719
NC_016109_9	9.30\|7273748\|32\|NC_016109\|CRT	7273748-7273779	32	NZ_CP011665	Streptomyces sp. Mg1 plasmid pSMg1-1, complete sequence	127403-127434	9	0.719
NC_016109_9	9.30\|7273748\|32\|NC_016109\|CRT	7273748-7273779	32	NZ_CP030762	Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed2, complete sequence	330775-330806	9	0.719
NC_016109_9	9.31\|7273809\|32\|NC_016109\|CRT	7273809-7273840	32	NZ_CP017300	Rhodococcus sp. YL-1 plasmid pYLC1, complete sequence	413884-413915	9	0.719
NC_016109_9	9.31\|7273809\|32\|NC_016109\|CRT	7273809-7273840	32	NC_022125	Rhodococcus erythropolis CCM2595 plasmid pRECF1, complete sequence	8531-8562	9	0.719
NC_016109_9	9.31\|7273809\|32\|NC_016109\|CRT	7273809-7273840	32	NZ_CP015205	Rhodococcus sp. 008 plasmid pR8C2, complete sequence	51535-51566	9	0.719
NC_016109_9	9.31\|7273809\|32\|NC_016109\|CRT	7273809-7273840	32	NC_015057	Granulicella tundricola MP5ACTX9 plasmid pACIX901, complete sequence	291681-291712	9	0.719
NC_016109_9	9.31\|7273809\|32\|NC_016109\|CRT	7273809-7273840	32	NZ_LR134465	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 23, complete sequence	261314-261345	9	0.719
NC_016109_9	9.31\|7273809\|32\|NC_016109\|CRT	7273809-7273840	32	NZ_CP025960	Rhodococcus qingshengii strain djl-6-2 plasmid pDJL1, complete sequence	29474-29505	9	0.719
NC_016109_9	9.31\|7273809\|32\|NC_016109\|CRT	7273809-7273840	32	NZ_CP011297	Rhodococcus erythropolis strain BG43 plasmid pRLLBG43, complete sequence	92589-92620	9	0.719
NC_016109_9	9.32\|7273870\|32\|NC_016109\|CRT	7273870-7273901	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	3098659-3098690	9	0.719
NC_016109_9	9.33\|7273931\|32\|NC_016109\|CRT	7273931-7273962	32	NZ_CP046906	Streptomyces sp. QHH-9511 plasmid unnamed, complete sequence	30647-30678	9	0.719
NC_016109_9	9.34\|7273992\|32\|NC_016109\|CRT	7273992-7274023	32	NZ_LR134467	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 25, complete sequence	13274-13305	9	0.719
NC_016109_9	9.34\|7273992\|32\|NC_016109\|CRT	7273992-7274023	32	NZ_LR723672	Rhizobium flavum strain YW14 plasmid 3	65952-65983	9	0.719
NC_016109_9	9.34\|7273992\|32\|NC_016109\|CRT	7273992-7274023	32	KX961385	Bordetella virus LK3, complete genome	40961-40992	9	0.719
NC_016109_9	9.34\|7273992\|32\|NC_016109\|CRT	7273992-7274023	32	KY000220	Bordetella phage FP1, complete genome	16250-16281	9	0.719
NC_016109_9	9.34\|7273992\|32\|NC_016109\|CRT	7273992-7274023	32	KY000221	Bordetella phage CN1, complete genome	16358-16389	9	0.719
NC_016109_9	9.34\|7273992\|32\|NC_016109\|CRT	7273992-7274023	32	NC_047877	Bordetella phage CN2, complete genome	16249-16280	9	0.719
NC_016109_9	9.34\|7273992\|32\|NC_016109\|CRT	7273992-7274023	32	NC_047879	Bordetella phage MW2, complete genome	16627-16658	9	0.719
NC_016109_9	9.40\|7273371\|33\|NC_016109\|PILER-CR	7273371-7273403	33	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	753914-753946	9	0.727
NC_016109_9	9.47\|7273808\|33\|NC_016109\|PILER-CR	7273808-7273840	33	NZ_CP034352	Streptomyces sp. W1SF4 plasmid p2, complete sequence	173622-173654	9	0.727
NC_016109_9	9.47\|7273808\|33\|NC_016109\|PILER-CR	7273808-7273840	33	NC_014120	Paraburkholderia sp. CCGE1002 plasmid pBC201, complete sequence	294009-294041	9	0.727
NC_016109_9	9.47\|7273808\|33\|NC_016109\|PILER-CR	7273808-7273840	33	NC_016586	Azospirillum lipoferum 4B plasmid AZO_p2, complete sequence	741057-741089	9	0.727
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2491804-2491835	10	0.688
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NZ_CP019037	Massilia putida strain 6NM-7 plasmid unnamed2, complete sequence	312070-312101	10	0.688
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	CP030179	Xanthomonas citri pv. punicae strain LMG 859 plasmid unnamed, complete sequence	148898-148929	10	0.688
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NZ_CP045721	Pantoea eucalypti strain LMG 24197 plasmid unnamed1, complete sequence	290072-290103	10	0.688
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NZ_CP032344	Azospirillum brasilense strain MTCC4038 plasmid p5, complete sequence	69318-69349	10	0.688
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NZ_CP033323	Azospirillum brasilense strain Cd plasmid p5, complete sequence	73438-73469	10	0.688
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NZ_CP033317	Azospirillum brasilense strain Sp 7 plasmid p5, complete sequence	131655-131686	10	0.688
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NZ_CP012919	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p5, complete sequence	114122-114153	10	0.688
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	NZ_CP022517	Pantoea vagans strain FBS135 plasmid pPant1, complete sequence	117051-117082	10	0.688
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	MH779500	Mycobacterium phage Crownjwl, complete genome	57154-57185	10	0.688
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	MT776813	Mycobacterium phage Magic8, complete genome	57433-57464	10	0.688
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	MK279883	Mycobacterium phage Struggle, complete genome	57213-57244	10	0.688
NC_016109_2	2.1\|613107\|32\|NC_016109\|CRT	613107-613138	32	MT897902	Mycobacterium phage Boehler, complete genome	57314-57345	10	0.688
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NZ_CP039340	Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence	501434-501465	10	0.688
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NZ_CP032322	Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence	1233260-1233291	10	0.688
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NZ_CP033874	Caulobacter sp. FWC26 plasmid p2	2268-2299	10	0.688
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NZ_CP017753	Cupriavidus sp. USMAHM13 plasmid unnamed1, complete sequence	253312-253343	10	0.688
NC_016109_2	2.5\|613351\|32\|NC_016109\|CRT	613351-613382	32	NZ_CP035089	Pseudomonas sp. 11K1 plasmid p11K1, complete sequence	7397-7428	10	0.688
NC_016109_2	2.6\|613412\|32\|NC_016109\|CRT	613412-613443	32	NC_017792	Deinococcus gobiensis I-0 plasmid P4, complete sequence	71128-71159	10	0.688
NC_016109_2	2.6\|613412\|32\|NC_016109\|CRT	613412-613443	32	MH744420	Streptomyces phage Kromp, complete genome	1697-1728	10	0.688
NC_016109_2	2.6\|613412\|32\|NC_016109\|CRT	613412-613443	32	AY576796	Actinoplanes phage phiAsp2, complete genome	34502-34533	10	0.688
NC_016109_2	2.8\|613534\|32\|NC_016109\|CRT	613534-613565	32	NZ_CP032343	Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence	15198-15229	10	0.688
NC_016109_2	2.8\|613534\|32\|NC_016109\|CRT	613534-613565	32	NZ_CP032230	Streptomyces seoulensis strain KCTC 9819 plasmid unnamed	56683-56714	10	0.688
NC_016109_2	2.8\|613534\|32\|NC_016109\|CRT	613534-613565	32	NZ_CP012917	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence	78212-78243	10	0.688
NC_016109_2	2.12\|613778\|32\|NC_016109\|CRT	613778-613809	32	NZ_CP053712	Acetobacteraceae bacterium strain PAMC 26569 plasmid unnamed5, complete sequence	99854-99885	10	0.688
NC_016109_2	2.14\|613168\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613168-613200	33	NZ_CP050098	Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b4, complete sequence	287413-287445	10	0.697
NC_016109_2	2.14\|613168\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613168-613200	33	NZ_CP021033	Rhizobium sp. NXC14 plasmid pRspNXC14c, complete sequence	17825-17857	10	0.697
NC_016109_2	2.14\|613168\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613168-613200	33	NZ_CP049731	Rhizobium leguminosarum strain A1 plasmid pRL12, complete sequence	183491-183523	10	0.697
NC_016109_2	2.14\|613168\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613168-613200	33	NC_007766	Rhizobium etli CFN 42 plasmid p42f, complete sequence	13210-13242	10	0.697
NC_016109_2	2.14\|613168\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613168-613200	33	NZ_CP053440	Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eF, complete sequence	292944-292976	10	0.697
NC_016109_2	2.14\|613168\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613168-613200	33	NZ_CP006990	Rhizobium sp. IE4771 plasmid pRetIE4771d, complete sequence	22799-22831	10	0.697
NC_016109_2	2.14\|613168\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613168-613200	33	NZ_CP021029	Rhizobium sp. TAL182 plasmid pRetTAL182e, complete sequence	13540-13572	10	0.697
NC_016109_2	2.14\|613168\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613168-613200	33	NZ_CP013635	Rhizobium sp. N324 plasmid pRspN324e, complete sequence	19815-19847	10	0.697
NC_016109_2	2.14\|613168\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613168-613200	33	NZ_CP020911	Rhizobium etli strain NXC12 plasmid pRetNXC12e, complete sequence	13220-13252	10	0.697
NC_016109_2	2.14\|613168\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613168-613200	33	NZ_CP020952	Rhizobium sp. CIAT894 plasmid pRheCIAT894e, complete sequence	28154-28186	10	0.697
NC_016109_2	2.14\|613168\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613168-613200	33	NZ_CP013600	Rhizobium sp. N741 plasmid pRspN741e, complete sequence	14645-14677	10	0.697
NC_016109_2	2.14\|613168\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613168-613200	33	NZ_CP013531	Rhizobium phaseoli strain R723 plasmid pRphaR723d, complete sequence	17346-17378	10	0.697
NC_016109_2	2.14\|613168\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613168-613200	33	NC_021911	Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1f, complete sequence	13221-13253	10	0.697
NC_016109_2	2.14\|613168\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613168-613200	33	NC_011368	Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG201, complete sequence	315629-315661	10	0.697
NC_016109_2	2.14\|613168\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613168-613200	33	NZ_CP013504	Rhizobium esperanzae strain N561 plasmid pRspN561d, complete sequence	14645-14677	10	0.697
NC_016109_2	2.14\|613168\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613168-613200	33	NZ_CP013584	Rhizobium phaseoli strain N261 plasmid pRphaN261d, complete sequence	17346-17378	10	0.697
NC_016109_2	2.14\|613168\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613168-613200	33	NZ_CP013510	Rhizobium sp. N1341 plasmid pRspN1341e, complete sequence	14645-14677	10	0.697
NC_016109_2	2.14\|613168\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613168-613200	33	NZ_CP013521	Rhizobium sp. N113 plasmid pRspN113d, complete sequence	14645-14677	10	0.697
NC_016109_2	2.14\|613168\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613168-613200	33	NZ_CP013494	Rhizobium sp. N6212 plasmid pRspN6212d, complete sequence	14645-14677	10	0.697
NC_016109_2	2.14\|613168\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613168-613200	33	NZ_CP013515	Rhizobium sp. N1314 plasmid pRspN1314d, complete sequence	13228-13260	10	0.697
NC_016109_2	2.14\|613168\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613168-613200	33	NZ_CP054028	Rhizobium sp. JKLM19E plasmid pPR19E01, complete sequence	88488-88520	10	0.697
NC_016109_2	2.14\|613168\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613168-613200	33	NZ_CP013594	Rhizobium sp. N871 plasmid pRspN871d, complete sequence	14645-14677	10	0.697
NC_016109_2	2.14\|613168\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613168-613200	33	CP007644	Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803c, complete sequence	21655-21687	10	0.697
NC_016109_2	2.14\|613168\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613168-613200	33	NC_010997	Rhizobium etli CIAT 652 plasmid pC, complete sequence	17137-17169	10	0.697
NC_016109_2	2.14\|613168\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613168-613200	33	NZ_CP013605	Rhizobium sp. N731 plasmid pRspN731d, complete sequence	13222-13254	10	0.697
NC_016109_2	2.16\|613290\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613290-613322	33	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	990045-990077	10	0.697
NC_016109_2	2.16\|613290\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613290-613322	33	NZ_CP032054	Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence	591787-591819	10	0.697
NC_016109_2	2.16\|613290\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613290-613322	33	NZ_CP016560	Streptomyces clavuligerus strain F613-1 plasmid pSCL4, complete sequence	249043-249075	10	0.697
NC_016109_2	2.18\|613412\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613412-613444	33	NC_015583	Novosphingobium sp. PP1Y plasmid Mpl, complete sequence	489124-489156	10	0.697
NC_016109_2	2.18\|613412\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613412-613444	33	NC_015583	Novosphingobium sp. PP1Y plasmid Mpl, complete sequence	493133-493165	10	0.697
NC_016109_3	3.4\|623741\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	623741-623773	33	NC_024970	Streptomyces aureofaciens strain CCM3239 plasmid pSA3239, complete sequence	195833-195865	10	0.697
NC_016109_3	3.4\|623741\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	623741-623773	33	NZ_KJ396772	Streptomyces lavendulae subsp. lavendulae strain CCM3239 plasmid pSA3239, complete sequence	195833-195865	10	0.697
NC_016109_3	3.4\|623741\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	623741-623773	33	NZ_CP024986	Streptomyces lavendulae subsp. lavendulae strain CCM 3239 plasmid pSA3239, complete sequence	45212-45244	10	0.697
NC_016109_3	3.10\|624107\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624107-624139	33	NC_015583	Novosphingobium sp. PP1Y plasmid Mpl, complete sequence	297479-297511	10	0.697
NC_016109_3	3.10\|624107\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624107-624139	33	MK929790	Caulobacter phage RW, complete genome	845-877	10	0.697
NC_016109_3	3.10\|624107\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624107-624139	33	MK929790	Caulobacter phage RW, complete genome	60267-60299	10	0.697
NC_016109_3	3.11\|624168\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624168-624200	33	NZ_CP030864	Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence	399725-399757	10	0.697
NC_016109_3	3.14\|624351\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624351-624383	33	NZ_CP026333	Pseudomonas sp. XWY-1 plasmid pXWY, complete sequence	282870-282902	10	0.697
NC_016109_3	3.14\|624351\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624351-624383	33	MK496050	Pseudomonas sp. strain FFUP_PS_41 plasmid pJBCL41, complete sequence	272052-272084	10	0.697
NC_016109_3	3.14\|624351\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624351-624383	33	NZ_CP016850	Pseudomonas sp. TMW 2.1634 plasmid pL21564-1, complete sequence	52783-52815	10	0.697
NC_016109_3	3.14\|624351\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624351-624383	33	MK977708	Mycobacterium phage Fulbright, complete genome	39196-39228	10	0.697
NC_016109_3	3.14\|624351\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624351-624383	33	MG099948	Mycobacterium phage Philonius, complete genome	40687-40719	10	0.697
NC_016109_3	3.14\|624351\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624351-624383	33	MH926055	Mycobacterium phage Chewbacca, complete genome	40397-40429	10	0.697
NC_016109_3	3.14\|624351\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624351-624383	33	MT723932	Mycobacterium phage Schnauzer, complete genome	40522-40554	10	0.697
NC_016109_3	3.14\|624351\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624351-624383	33	KU935726	Mycobacterium phage Xerxes, complete genome	40519-40551	10	0.697
NC_016109_3	3.14\|624351\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624351-624383	33	KU935730	Mycobacterium phage Pipsqueaks, complete genome	40500-40532	10	0.697
NC_016109_3	3.14\|624351\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624351-624383	33	MH316570	Mycobacterium phage Silvafighter, complete genome	40065-40097	10	0.697
NC_016109_3	3.14\|624351\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624351-624383	33	MK524518	Mycobacterium phage Smurph, complete genome	40522-40554	10	0.697
NC_016109_3	3.14\|624351\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624351-624383	33	MK524515	Mycobacterium phage Parmesanjohn, complete genome	40522-40554	10	0.697
NC_016109_3	3.14\|624351\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624351-624383	33	MH697585	Mycobacterium phage Gex, complete genome	40518-40550	10	0.697
NC_016109_3	3.14\|624351\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624351-624383	33	KM588359	Mycobacterium phage Carcharodon, complete genome	40502-40534	10	0.697
NC_016109_3	3.14\|624351\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624351-624383	33	MH697576	Mycobacterium phage Aggie, complete genome	41155-41187	10	0.697
NC_016109_3	3.14\|624351\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624351-624383	33	MH697593	Mycobacterium phage Tapioca, complete genome	41039-41071	10	0.697
NC_016109_3	3.14\|624351\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624351-624383	33	KU935729	Mycobacterium phage SkinnyPete, complete genome	40269-40301	10	0.697
NC_016109_3	3.14\|624351\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624351-624383	33	JN256079	Mycobacterium phage Charlie, complete genome	39828-39860	10	0.697
NC_016109_3	3.16\|624473\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624473-624505	33	NZ_CP018634	Salmonella enterica subsp. enterica serovar Enteritidis strain 49-2444 plasmid pSE49-2444, complete sequence	64108-64140	10	0.697
NC_016109_3	3.19\|624656\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624656-624688	33	NZ_CP018634	Salmonella enterica subsp. enterica serovar Enteritidis strain 49-2444 plasmid pSE49-2444, complete sequence	64108-64140	10	0.697
NC_016109_3	3.23\|624900\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624900-624932	33	NC_012586	Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence	848719-848751	10	0.697
NC_016109_3	3.25\|625022\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	625022-625054	33	NZ_CP012477	Arthrobacter sp. ERGS1:01 isolate water plasmid unnamed2, complete sequence	537566-537598	10	0.697
NC_016109_3	3.30\|625327\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	625327-625359	33	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	2276305-2276337	10	0.697
NC_016109_3	3.30\|625327\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	625327-625359	33	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	1350998-1351030	10	0.697
NC_016109_3	3.31\|625388\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	625388-625420	33	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2630960-2630992	10	0.697
NC_016109_3	3.34\|625571\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	625571-625603	33	NZ_CP018464	Xanthomonas euvesicatoria strain LMG930 plasmid pLMG930.1, complete sequence	48307-48339	10	0.697
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP044425	Paracoccus pantotrophus strain DSM 2944 plasmid pPAN2, complete sequence	185725-185756	10	0.688
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP007129	Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence	1094570-1094601	10	0.688
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	NZ_CP010410	Xanthomonas sacchari strain R1 plasmid unnamed, complete sequence	252489-252520	10	0.688
NC_016109_5	5.1\|2749100\|32\|NC_016109\|CRISPRCasFinder	2749100-2749131	32	MN586006	Mycobacterium phage Bachome, complete genome	32874-32905	10	0.688
NC_016109_9	9.11\|7273627\|31\|NC_016109\|CRISPRCasFinder	7273627-7273657	31	NZ_LR594673	Variovorax sp. PBL-E5 plasmid 3	56374-56404	10	0.677
NC_016109_9	9.15\|7273871\|31\|NC_016109\|CRISPRCasFinder	7273871-7273901	31	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	3098659-3098689	10	0.677
NC_016109_9	9.16\|7273932\|31\|NC_016109\|CRISPRCasFinder	7273932-7273962	31	NC_010510	Methylobacterium radiotolerans JCM 2831 plasmid pMRAD01, complete sequence	25650-25680	10	0.677
NC_016109_9	9.17\|7273993\|31\|NC_016109\|CRISPRCasFinder	7273993-7274023	31	MH271318	Gordonia phage Trine, complete genome	842-872	10	0.677
NC_016109_9	9.21\|7273189\|32\|NC_016109\|CRT	7273189-7273220	32	NC_010625	Paraburkholderia phymatum STM815 plasmid pBPHY01, complete sequence	450011-450042	10	0.688
NC_016109_9	9.21\|7273189\|32\|NC_016109\|CRT	7273189-7273220	32	KY006853	Erythrobacter phage vB_EliS_R6L, complete genome	38127-38158	10	0.688
NC_016109_9	9.29\|7273687\|32\|NC_016109\|CRT	7273687-7273718	32	NC_014838	Pantoea sp. At-9b plasmid pPAT9B01, complete sequence	429373-429404	10	0.688
NC_016109_9	9.30\|7273748\|32\|NC_016109\|CRT	7273748-7273779	32	JX100810	Caulobacter phage CcrColossus, complete genome	114304-114335	10	0.688
NC_016109_9	9.31\|7273809\|32\|NC_016109\|CRT	7273809-7273840	32	NZ_LN832562	Paracoccus aminovorans isolate JCM7685 plasmid IV, complete sequence	278585-278616	10	0.688
NC_016109_9	9.31\|7273809\|32\|NC_016109\|CRT	7273809-7273840	32	NZ_CP044217	Mesorhizobium sp. NIBRBAC000500504 plasmid unnamed, complete sequence	262382-262413	10	0.688
NC_016109_9	9.31\|7273809\|32\|NC_016109\|CRT	7273809-7273840	32	NZ_CP032342	Azospirillum brasilense strain MTCC4038 plasmid p3, complete sequence	209168-209199	10	0.688
NC_016109_9	9.31\|7273809\|32\|NC_016109\|CRT	7273809-7273840	32	NZ_CP033321	Azospirillum brasilense strain Cd plasmid p3, complete sequence	46399-46430	10	0.688
NC_016109_9	9.31\|7273809\|32\|NC_016109\|CRT	7273809-7273840	32	NZ_CP033315	Azospirillum brasilense strain Sp 7 plasmid p3, complete sequence	104954-104985	10	0.688
NC_016109_9	9.32\|7273870\|32\|NC_016109\|CRT	7273870-7273901	32	NZ_CP021357	Rhodococcus sp. S2-17 plasmid pRB11, complete sequence	101875-101906	10	0.688
NC_016109_9	9.32\|7273870\|32\|NC_016109\|CRT	7273870-7273901	32	NZ_CP046573	Rhodococcus sp. WAY2 plasmid pRWAY01, complete sequence	409535-409566	10	0.688
NC_016109_9	9.34\|7273992\|32\|NC_016109\|CRT	7273992-7274023	32	MH271305	Gordonia phage Morrissey, complete genome	834-865	10	0.688
NC_016109_9	9.37\|7273188\|33\|NC_016109\|PILER-CR	7273188-7273220	33	NZ_CP028348	Novosphingobium sp. THN1 plasmid pTHN, complete sequence	715147-715179	10	0.697
NC_016109_9	9.37\|7273188\|33\|NC_016109\|PILER-CR	7273188-7273220	33	KY006853	Erythrobacter phage vB_EliS_R6L, complete genome	38126-38158	10	0.697
NC_016109_2	2.9\|613595\|32\|NC_016109\|CRT	613595-613626	32	NZ_CP050953	Rhodococcus sp. DMU1 plasmid unnamed	471146-471177	11	0.656
NC_016109_2	2.12\|613778\|32\|NC_016109\|CRT	613778-613809	32	NZ_CP013744	Streptomyces sp. CdTB01 plasmid unnamed, complete sequence	111383-111414	11	0.656
NC_016109_2	2.12\|613778\|32\|NC_016109\|CRT	613778-613809	32	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	571205-571236	11	0.656
NC_016109_2	2.16\|613290\|33\|NC_016109\|CRISPRCasFinder,PILER-CR	613290-613322	33	NZ_CP039340	Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence	501433-501465	11	0.667
NC_016109_3	3.4\|623741\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	623741-623773	33	NC_023285	Streptomyces sp. F8 plasmid pFRL5, complete sequence	186442-186474	11	0.667
NC_016109_3	3.7\|623924\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	623924-623956	33	NZ_CP017750	Cupriavidus sp. USMAA2-4 plasmid unnamed1, complete sequence	408812-408844	11	0.667
NC_016109_3	3.7\|623924\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	623924-623956	33	NZ_CP017753	Cupriavidus sp. USMAHM13 plasmid unnamed1, complete sequence	94559-94591	11	0.667
NC_016109_3	3.21\|624778\|33\|NC_016109\|PILER-CR,CRISPRCasFinder,CRT	624778-624810	33	NC_016586	Azospirillum lipoferum 4B plasmid AZO_p2, complete sequence	598267-598299	11	0.667
NC_016109_9	9.28\|7273626\|32\|NC_016109\|CRT	7273626-7273657	32	NZ_LR594673	Variovorax sp. PBL-E5 plasmid 3	56373-56404	11	0.656
NC_016109_9	9.33\|7273931\|32\|NC_016109\|CRT	7273931-7273962	32	NC_010510	Methylobacterium radiotolerans JCM 2831 plasmid pMRAD01, complete sequence	25649-25680	11	0.656
NC_016109_9	9.34\|7273992\|32\|NC_016109\|CRT	7273992-7274023	32	MH271318	Gordonia phage Trine, complete genome	842-873	11	0.656
NC_016109_2	2.4\|613290\|32\|NC_016109\|CRT	613290-613321	32	NZ_CP035502	Sphingosinicella sp. BN140058 plasmid p1, complete sequence	98414-98445	14	0.562

1. spacer 9.14|7273810|31|NC_016109|CRISPRCasFinder matches to NZ_CP007129 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.871

acgcctaccgcaccgtcgccgcccagctccg	CRISPR spacer
gcacgtaccgcaccgtcgccgaccagctccg	Protospacer
.*.* **************** *********

2. spacer 1.1|591426|28|NC_016109|CRISPRCasFinder matches to NZ_AP020329 (Mycobacterium avium subsp. hominissuis strain JP-H-1 plasmid p3-JPH1, complete sequence) position: , mismatch: 5, identity: 0.821

cctggcgctgtactcggagctgtcggag	CRISPR spacer
cgcggcggtgtactcggagctgtcgacg	Protospacer
* .**** *****************. *

3. spacer 1.1|591426|28|NC_016109|CRISPRCasFinder matches to NZ_CP015271 (Mycobacterium chimaera strain ZUERICH-2 plasmid unnamed 4, complete sequence) position: , mismatch: 5, identity: 0.821

cctggcgctgtactcggagctgtcggag	CRISPR spacer
cgcggcggtgtactcggagctgtcgacg	Protospacer
* .**** *****************. *

4. spacer 1.1|591426|28|NC_016109|CRISPRCasFinder matches to NZ_CP015277 (Mycobacterium chimaera strain ZUERICH-1 plasmid unnamed 5, complete sequence) position: , mismatch: 5, identity: 0.821

cctggcgctgtactcggagctgtcggag	CRISPR spacer
cgcggcggtgtactcggagctgtcgacg	Protospacer
* .**** *****************. *

5. spacer 1.1|591426|28|NC_016109|CRISPRCasFinder matches to NZ_CP012888 (Mycobacterium chimaera strain AH16 plasmid unnamed3, complete sequence) position: , mismatch: 5, identity: 0.821

cctggcgctgtactcggagctgtcggag	CRISPR spacer
cgcggcggtgtactcggagctgtcgacg	Protospacer
* .**** *****************. *

6. spacer 1.1|591426|28|NC_016109|CRISPRCasFinder matches to NZ_CP022225 (Mycobacterium chimaera strain SJ42 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.821

cctggcgctgtactcggagctgtcggag	CRISPR spacer
cgcggcggtgtactcggagctgtcgacg	Protospacer
* .**** *****************. *

7. spacer 1.1|591426|28|NC_016109|CRISPRCasFinder matches to NZ_CP045968 (Mycobacterium chimaera strain AUSMDU00007395 plasmid pAUSMDU00007395_05, complete sequence) position: , mismatch: 5, identity: 0.821

cctggcgctgtactcggagctgtcggag	CRISPR spacer
cgcggcggtgtactcggagctgtcgacg	Protospacer
* .**** *****************. *

8. spacer 2.4|613290|32|NC_016109|CRT matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 5, identity: 0.844

---cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
gctcgacc---gcgcggtgctcgccgcgttcgccg	Protospacer
   *****   .******** **************

9. spacer 2.4|613290|32|NC_016109|CRT matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 5, identity: 0.844

---cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
gctcgacc---gcgcggtgctcgccgcgttcgccg	Protospacer
   *****   .******** **************

10. spacer 2.4|613290|32|NC_016109|CRT matches to NZ_LR594676 (Variovorax sp. PBS-H4 plasmid 2) position: , mismatch: 5, identity: 0.844

-cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
acaaccc-gacgcggtccgcgccgccttcgccg	Protospacer
 *.***. ******** ******** *******

11. spacer 2.6|613412|32|NC_016109|CRT matches to NC_016655 (Rhodococcus phage REQ1, complete genome) position: , mismatch: 5, identity: 0.844

ctggtgtcgatcaggtcggcagcctcgccgag	CRISPR spacer
ttggtctcgatcaggtcggcggcctcgcgcag	Protospacer
.**** **************.*******  **

12. spacer 2.6|613412|32|NC_016109|CRT matches to NZ_CP032325 (Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence) position: , mismatch: 5, identity: 0.844

ctggtgtcgatcaggtcggcagcc-tcgccgag	CRISPR spacer
gtggtgtcgctcaggtcggcggccatcgccgc-	Protospacer
 ******** **********.*** ******

13. spacer 3.24|624961|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP017104 (Rhizobium gallicum strain IE4872 plasmid pRgalIE4872c, complete sequence) position: , mismatch: 5, identity: 0.848

cgcg-gtggacaggctgaccacgctggtgggtga	CRISPR spacer
-gcgtctggacaggctgaccaagctggtggtgga	Protospacer
 ***  *************** ********  **

14. spacer 3.24|624961|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to CP006879 (Rhizobium gallicum bv. gallicum R602 plasmid pRgalR602b, complete sequence) position: , mismatch: 5, identity: 0.848

cgcg-gtggacaggctgaccacgctggtgggtga	CRISPR spacer
-gcgtctggacaggctgaccaagctggtggtgga	Protospacer
 ***  *************** ********  **

15. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP040821 (Paraoceanicella profunda strain D4M1 plasmid pD4M1C, complete sequence) position: , mismatch: 5, identity: 0.844

agcccccgcagcagcagcccggcggctacggc--	CRISPR spacer
agcccgcgcagcagcagcccggc--cgagggccg	Protospacer
***** *****************  * * ***

16. spacer 9.7|7273373|31|NC_016109|CRISPRCasFinder matches to MN234205 (Mycobacterium phage Veliki, complete genome) position: , mismatch: 5, identity: 0.839

-tgcagcaggcggtccgcggtgccgggcgcga	CRISPR spacer
ccgctg-aggcgggccgccgtgccgggcgcga	Protospacer
 .** * ****** **** *************

17. spacer 9.7|7273373|31|NC_016109|CRISPRCasFinder matches to MH727544 (Mycobacterium phage Dalmuri, complete genome) position: , mismatch: 5, identity: 0.839

-tgcagcaggcggtccgcggtgccgggcgcga	CRISPR spacer
ccgctg-aggcgggccgccgtgccgggcgcga	Protospacer
 .** * ****** **** *************

18. spacer 9.7|7273373|31|NC_016109|CRISPRCasFinder matches to MH001453 (Mycobacterium phage Adonis, complete genome) position: , mismatch: 5, identity: 0.839

-tgcagcaggcggtccgcggtgccgggcgcga	CRISPR spacer
ccgctg-aggcgggccgccgtgccgggcgcga	Protospacer
 .** * ****** **** *************

19. spacer 9.7|7273373|31|NC_016109|CRISPRCasFinder matches to JF704105 (Mycobacterium phage Adephagia, complete sequence) position: , mismatch: 5, identity: 0.839

-tgcagcaggcggtccgcggtgccgggcgcga	CRISPR spacer
ccgctg-aggcgggccgccgtgccgggcgcga	Protospacer
 .** * ****** **** *************

20. spacer 9.7|7273373|31|NC_016109|CRISPRCasFinder matches to MN234182 (Mycobacterium phage Geraldini, complete genome) position: , mismatch: 5, identity: 0.839

-tgcagcaggcggtccgcggtgccgggcgcga	CRISPR spacer
ccgctg-aggcgggccgccgtgccgggcgcga	Protospacer
 .** * ****** **** *************

21. spacer 9.7|7273373|31|NC_016109|CRISPRCasFinder matches to MN234198 (Mycobacterium phage Zavala, complete genome) position: , mismatch: 5, identity: 0.839

-tgcagcaggcggtccgcggtgccgggcgcga	CRISPR spacer
ccgctg-aggcgggccgccgtgccgggcgcga	Protospacer
 .** * ****** **** *************

22. spacer 9.7|7273373|31|NC_016109|CRISPRCasFinder matches to MF140412 (Mycobacterium phage Jeckyll, complete genome) position: , mismatch: 5, identity: 0.839

-tgcagcaggcggtccgcggtgccgggcgcga	CRISPR spacer
ccgctg-aggcgggccgccgtgccgggcgcga	Protospacer
 .** * ****** **** *************

23. spacer 9.7|7273373|31|NC_016109|CRISPRCasFinder matches to KY380102 (Mycobacterium phage CREW, complete genome) position: , mismatch: 5, identity: 0.839

-tgcagcaggcggtccgcggtgccgggcgcga	CRISPR spacer
ccgctg-aggcgggccgccgtgccgggcgcga	Protospacer
 .** * ****** **** *************

24. spacer 9.7|7273373|31|NC_016109|CRISPRCasFinder matches to KX585253 (Mycobacterium phage HedwigODU, complete genome) position: , mismatch: 5, identity: 0.839

-tgcagcaggcggtccgcggtgccgggcgcga	CRISPR spacer
ccgctg-aggcgggccgccgtgccgggcgcga	Protospacer
 .** * ****** **** *************

25. spacer 9.7|7273373|31|NC_016109|CRISPRCasFinder matches to MH536822 (Mycobacterium phage Joy99, complete genome) position: , mismatch: 5, identity: 0.839

-tgcagcaggcggtccgcggtgccgggcgcga	CRISPR spacer
ccgctg-aggcgggccgccgtgccgggcgcga	Protospacer
 .** * ****** **** *************

26. spacer 9.7|7273373|31|NC_016109|CRISPRCasFinder matches to MF140428 (Mycobacterium phage Slimphazie, complete genome) position: , mismatch: 5, identity: 0.839

-tgcagcaggcggtccgcggtgccgggcgcga	CRISPR spacer
ccgctg-aggcgggccgccgtgccgggcgcga	Protospacer
 .** * ****** **** *************

27. spacer 9.7|7273373|31|NC_016109|CRISPRCasFinder matches to KJ567045 (Mycobacterium phage Emerson, complete genome) position: , mismatch: 5, identity: 0.839

-tgcagcaggcggtccgcggtgccgggcgcga	CRISPR spacer
ccgctg-aggcgggccgccgtgccgggcgcga	Protospacer
 .** * ****** **** *************

28. spacer 9.7|7273373|31|NC_016109|CRISPRCasFinder matches to MK460247 (Mycobacterium phage YoureAdopted, complete genome) position: , mismatch: 5, identity: 0.839

-tgcagcaggcggtccgcggtgccgggcgcga	CRISPR spacer
ccgctg-aggcgggccgccgtgccgggcgcga	Protospacer
 .** * ****** **** *************

29. spacer 9.7|7273373|31|NC_016109|CRISPRCasFinder matches to JN185608 (Mycobacterium virus JAWS, complete genome) position: , mismatch: 5, identity: 0.839

-tgcagcaggcggtccgcggtgccgggcgcga	CRISPR spacer
ccgctg-aggcgggccgccgtgccgggcgcga	Protospacer
 .** * ****** **** *************

30. spacer 9.7|7273373|31|NC_016109|CRISPRCasFinder matches to MN234231 (Mycobacterium phage Rapunzel97, complete genome) position: , mismatch: 5, identity: 0.839

-tgcagcaggcggtccgcggtgccgggcgcga	CRISPR spacer
ccgctg-aggcgggccgccgtgccgggcgcga	Protospacer
 .** * ****** **** *************

31. spacer 9.7|7273373|31|NC_016109|CRISPRCasFinder matches to MN908692 (Mycobacterium Phage BGlluviae, complete genome) position: , mismatch: 5, identity: 0.839

-tgcagcaggcggtccgcggtgccgggcgcga	CRISPR spacer
ccgctg-aggcgggccgccgtgccgggcgcga	Protospacer
 .** * ****** **** *************

32. spacer 9.7|7273373|31|NC_016109|CRISPRCasFinder matches to NC_023747 (Mycobacterium phage BarrelRoll, complete genome) position: , mismatch: 5, identity: 0.839

-tgcagcaggcggtccgcggtgccgggcgcga	CRISPR spacer
ccgctg-aggcgggccgccgtgccgggcgcga	Protospacer
 .** * ****** **** *************

33. spacer 9.7|7273373|31|NC_016109|CRISPRCasFinder matches to MH536821 (Mycobacterium phage Homura, complete genome) position: , mismatch: 5, identity: 0.839

-tgcagcaggcggtccgcggtgccgggcgcga	CRISPR spacer
ccgctg-aggcgggccgccgtgccgggcgcga	Protospacer
 .** * ****** **** *************

34. spacer 9.7|7273373|31|NC_016109|CRISPRCasFinder matches to MF668267 (Mycobacterium phage Apocalypse, complete genome) position: , mismatch: 5, identity: 0.839

-tgcagcaggcggtccgcggtgccgggcgcga	CRISPR spacer
ccgctg-aggcgggccgccgtgccgggcgcga	Protospacer
 .** * ****** **** *************

35. spacer 9.7|7273373|31|NC_016109|CRISPRCasFinder matches to MH697578 (Mycobacterium phage Belladonna, complete genome) position: , mismatch: 5, identity: 0.839

-tgcagcaggcggtccgcggtgccgggcgcga	CRISPR spacer
ccgctg-aggcgggccgccgtgccgggcgcga	Protospacer
 .** * ****** **** *************

36. spacer 9.7|7273373|31|NC_016109|CRISPRCasFinder matches to MH077577 (Mycobacterium phage AlishaPH, complete genome) position: , mismatch: 5, identity: 0.839

-tgcagcaggcggtccgcggtgccgggcgcga	CRISPR spacer
ccgctg-aggcgggccgccgtgccgggcgcga	Protospacer
 .** * ****** **** *************

37. spacer 9.7|7273373|31|NC_016109|CRISPRCasFinder matches to MH509444 (Mycobacterium phage BEEST, complete genome) position: , mismatch: 5, identity: 0.839

-tgcagcaggcggtccgcggtgccgggcgcga	CRISPR spacer
ccgctg-aggcgggccgccgtgccgggcgcga	Protospacer
 .** * ****** **** *************

38. spacer 9.7|7273373|31|NC_016109|CRISPRCasFinder matches to MN369742 (Mycobacterium phage Spock, complete genome) position: , mismatch: 5, identity: 0.839

-tgcagcaggcggtccgcggtgccgggcgcga	CRISPR spacer
ccgctg-aggcgggccgccgtgccgggcgcga	Protospacer
 .** * ****** **** *************

39. spacer 9.7|7273373|31|NC_016109|CRISPRCasFinder matches to MK112537 (Mycobacterium Phage Capricorn, complete genome) position: , mismatch: 5, identity: 0.839

-tgcagcaggcggtccgcggtgccgggcgcga	CRISPR spacer
ccgctg-aggcgggccgccgtgccgggcgcga	Protospacer
 .** * ****** **** *************

40. spacer 9.7|7273373|31|NC_016109|CRISPRCasFinder matches to MN369746 (Mycobacterium phage Inky, complete genome) position: , mismatch: 5, identity: 0.839

-tgcagcaggcggtccgcggtgccgggcgcga	CRISPR spacer
ccgctg-aggcgggccgccgtgccgggcgcga	Protospacer
 .** * ****** **** *************

41. spacer 9.7|7273373|31|NC_016109|CRISPRCasFinder matches to MH051246 (Mycobacterium phage ActinUp, complete genome) position: , mismatch: 5, identity: 0.839

-tgcagcaggcggtccgcggtgccgggcgcga	CRISPR spacer
ccgctg-aggcgggccgccgtgccgggcgcga	Protospacer
 .** * ****** **** *************

42. spacer 9.7|7273373|31|NC_016109|CRISPRCasFinder matches to MH513977 (Mycobacterium phage Mynx, complete genome) position: , mismatch: 5, identity: 0.839

-tgcagcaggcggtccgcggtgccgggcgcga	CRISPR spacer
ccgctg-aggcgggccgccgtgccgggcgcga	Protospacer
 .** * ****** **** *************

43. spacer 9.7|7273373|31|NC_016109|CRISPRCasFinder matches to MN234197 (Mycobacterium phage Ramen, complete genome) position: , mismatch: 5, identity: 0.839

-tgcagcaggcggtccgcggtgccgggcgcga	CRISPR spacer
ccgctg-aggcgggccgccgtgccgggcgcga	Protospacer
 .** * ****** **** *************

44. spacer 9.7|7273373|31|NC_016109|CRISPRCasFinder matches to MH371113 (Mycobacterium phage Beezoo, complete genome) position: , mismatch: 5, identity: 0.839

-tgcagcaggcggtccgcggtgccgggcgcga	CRISPR spacer
ccgctg-aggcgggccgccgtgccgggcgcga	Protospacer
 .** * ****** **** *************

45. spacer 9.13|7273749|31|NC_016109|CRISPRCasFinder matches to NZ_CP011665 (Streptomyces sp. Mg1 plasmid pSMg1-1, complete sequence) position: , mismatch: 5, identity: 0.839

cgacgccgcgggtccggatcac--cgcgacgta	CRISPR spacer
cgacgccgcggatccggatcacgacccgccg--	Protospacer
***********.**********  * ** **

46. spacer 9.14|7273810|31|NC_016109|CRISPRCasFinder matches to NZ_CP049749 (Rhodococcus fascians A21d2 plasmid pA21d2, complete sequence) position: , mismatch: 5, identity: 0.839

acgc-ctaccgcaccgtcgccgcccagctccg	CRISPR spacer
-cgcagaaccgcaccgtcgccgccctgcaccg	Protospacer
 ***   ****************** ** ***

47. spacer 9.16|7273932|31|NC_016109|CRISPRCasFinder matches to NZ_CP017756 (Cupriavidus malaysiensis strain USMAA1020 isolate pure plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.839

gctccagccagtacggcagccact-cggagag	CRISPR spacer
gcaccaggcagtacggcagccaccgctgaga-	Protospacer
** **** ***************. * ****

48. spacer 9.17|7273993|31|NC_016109|CRISPRCasFinder matches to NC_004808 (Streptomyces rochei plasmid pSLA2-L DNA, complete sequence) position: , mismatch: 5, identity: 0.839

cgccgaccgcgcccaggaggagctggtccgc	CRISPR spacer
cgtctgccgcgaccaggacgagctggtccgc	Protospacer
**.* .***** ****** ************

49. spacer 9.17|7273993|31|NC_016109|CRISPRCasFinder matches to NC_023316 (Streptomyces sp. 14R-10 plasmid pZL1, complete sequence) position: , mismatch: 5, identity: 0.839

cgccgaccgcgcccaggaggag---ctggtccgc	CRISPR spacer
cgccgactgcgcccaggaggagacacaggtc---	Protospacer
*******.**************   * ****

50. spacer 9.24|7273372|32|NC_016109|CRT matches to MN234205 (Mycobacterium phage Veliki, complete genome) position: , mismatch: 5, identity: 0.844

gtgcagc--aggcggtccgcggtgccgggcgcga	CRISPR spacer
--gccgctgaggcgggccgccgtgccgggcgcga	Protospacer
  ** **  ****** **** *************

51. spacer 9.24|7273372|32|NC_016109|CRT matches to MH727544 (Mycobacterium phage Dalmuri, complete genome) position: , mismatch: 5, identity: 0.844

gtgcagc--aggcggtccgcggtgccgggcgcga	CRISPR spacer
--gccgctgaggcgggccgccgtgccgggcgcga	Protospacer
  ** **  ****** **** *************

52. spacer 9.24|7273372|32|NC_016109|CRT matches to MH001453 (Mycobacterium phage Adonis, complete genome) position: , mismatch: 5, identity: 0.844

gtgcagc--aggcggtccgcggtgccgggcgcga	CRISPR spacer
--gccgctgaggcgggccgccgtgccgggcgcga	Protospacer
  ** **  ****** **** *************

53. spacer 9.24|7273372|32|NC_016109|CRT matches to JF704105 (Mycobacterium phage Adephagia, complete sequence) position: , mismatch: 5, identity: 0.844

gtgcagc--aggcggtccgcggtgccgggcgcga	CRISPR spacer
--gccgctgaggcgggccgccgtgccgggcgcga	Protospacer
  ** **  ****** **** *************

54. spacer 9.24|7273372|32|NC_016109|CRT matches to MN234182 (Mycobacterium phage Geraldini, complete genome) position: , mismatch: 5, identity: 0.844

gtgcagc--aggcggtccgcggtgccgggcgcga	CRISPR spacer
--gccgctgaggcgggccgccgtgccgggcgcga	Protospacer
  ** **  ****** **** *************

55. spacer 9.24|7273372|32|NC_016109|CRT matches to MN234198 (Mycobacterium phage Zavala, complete genome) position: , mismatch: 5, identity: 0.844

gtgcagc--aggcggtccgcggtgccgggcgcga	CRISPR spacer
--gccgctgaggcgggccgccgtgccgggcgcga	Protospacer
  ** **  ****** **** *************

56. spacer 9.24|7273372|32|NC_016109|CRT matches to MF140412 (Mycobacterium phage Jeckyll, complete genome) position: , mismatch: 5, identity: 0.844

gtgcagc--aggcggtccgcggtgccgggcgcga	CRISPR spacer
--gccgctgaggcgggccgccgtgccgggcgcga	Protospacer
  ** **  ****** **** *************

57. spacer 9.24|7273372|32|NC_016109|CRT matches to KY380102 (Mycobacterium phage CREW, complete genome) position: , mismatch: 5, identity: 0.844

gtgcagc--aggcggtccgcggtgccgggcgcga	CRISPR spacer
--gccgctgaggcgggccgccgtgccgggcgcga	Protospacer
  ** **  ****** **** *************

58. spacer 9.24|7273372|32|NC_016109|CRT matches to KX585253 (Mycobacterium phage HedwigODU, complete genome) position: , mismatch: 5, identity: 0.844

gtgcagc--aggcggtccgcggtgccgggcgcga	CRISPR spacer
--gccgctgaggcgggccgccgtgccgggcgcga	Protospacer
  ** **  ****** **** *************

59. spacer 9.24|7273372|32|NC_016109|CRT matches to MH536822 (Mycobacterium phage Joy99, complete genome) position: , mismatch: 5, identity: 0.844

gtgcagc--aggcggtccgcggtgccgggcgcga	CRISPR spacer
--gccgctgaggcgggccgccgtgccgggcgcga	Protospacer
  ** **  ****** **** *************

60. spacer 9.24|7273372|32|NC_016109|CRT matches to MF140428 (Mycobacterium phage Slimphazie, complete genome) position: , mismatch: 5, identity: 0.844

gtgcagc--aggcggtccgcggtgccgggcgcga	CRISPR spacer
--gccgctgaggcgggccgccgtgccgggcgcga	Protospacer
  ** **  ****** **** *************

61. spacer 9.24|7273372|32|NC_016109|CRT matches to KJ567045 (Mycobacterium phage Emerson, complete genome) position: , mismatch: 5, identity: 0.844

gtgcagc--aggcggtccgcggtgccgggcgcga	CRISPR spacer
--gccgctgaggcgggccgccgtgccgggcgcga	Protospacer
  ** **  ****** **** *************

62. spacer 9.24|7273372|32|NC_016109|CRT matches to MK460247 (Mycobacterium phage YoureAdopted, complete genome) position: , mismatch: 5, identity: 0.844

gtgcagc--aggcggtccgcggtgccgggcgcga	CRISPR spacer
--gccgctgaggcgggccgccgtgccgggcgcga	Protospacer
  ** **  ****** **** *************

63. spacer 9.24|7273372|32|NC_016109|CRT matches to JN185608 (Mycobacterium virus JAWS, complete genome) position: , mismatch: 5, identity: 0.844

gtgcagc--aggcggtccgcggtgccgggcgcga	CRISPR spacer
--gccgctgaggcgggccgccgtgccgggcgcga	Protospacer
  ** **  ****** **** *************

64. spacer 9.24|7273372|32|NC_016109|CRT matches to MN234231 (Mycobacterium phage Rapunzel97, complete genome) position: , mismatch: 5, identity: 0.844

gtgcagc--aggcggtccgcggtgccgggcgcga	CRISPR spacer
--gccgctgaggcgggccgccgtgccgggcgcga	Protospacer
  ** **  ****** **** *************

65. spacer 9.24|7273372|32|NC_016109|CRT matches to MN908692 (Mycobacterium Phage BGlluviae, complete genome) position: , mismatch: 5, identity: 0.844

gtgcagc--aggcggtccgcggtgccgggcgcga	CRISPR spacer
--gccgctgaggcgggccgccgtgccgggcgcga	Protospacer
  ** **  ****** **** *************

66. spacer 9.24|7273372|32|NC_016109|CRT matches to NC_023747 (Mycobacterium phage BarrelRoll, complete genome) position: , mismatch: 5, identity: 0.844

gtgcagc--aggcggtccgcggtgccgggcgcga	CRISPR spacer
--gccgctgaggcgggccgccgtgccgggcgcga	Protospacer
  ** **  ****** **** *************

67. spacer 9.24|7273372|32|NC_016109|CRT matches to MH536821 (Mycobacterium phage Homura, complete genome) position: , mismatch: 5, identity: 0.844

gtgcagc--aggcggtccgcggtgccgggcgcga	CRISPR spacer
--gccgctgaggcgggccgccgtgccgggcgcga	Protospacer
  ** **  ****** **** *************

68. spacer 9.24|7273372|32|NC_016109|CRT matches to MF668267 (Mycobacterium phage Apocalypse, complete genome) position: , mismatch: 5, identity: 0.844

gtgcagc--aggcggtccgcggtgccgggcgcga	CRISPR spacer
--gccgctgaggcgggccgccgtgccgggcgcga	Protospacer
  ** **  ****** **** *************

69. spacer 9.24|7273372|32|NC_016109|CRT matches to MH697578 (Mycobacterium phage Belladonna, complete genome) position: , mismatch: 5, identity: 0.844

gtgcagc--aggcggtccgcggtgccgggcgcga	CRISPR spacer
--gccgctgaggcgggccgccgtgccgggcgcga	Protospacer
  ** **  ****** **** *************

70. spacer 9.24|7273372|32|NC_016109|CRT matches to MH077577 (Mycobacterium phage AlishaPH, complete genome) position: , mismatch: 5, identity: 0.844

gtgcagc--aggcggtccgcggtgccgggcgcga	CRISPR spacer
--gccgctgaggcgggccgccgtgccgggcgcga	Protospacer
  ** **  ****** **** *************

71. spacer 9.24|7273372|32|NC_016109|CRT matches to MH509444 (Mycobacterium phage BEEST, complete genome) position: , mismatch: 5, identity: 0.844

gtgcagc--aggcggtccgcggtgccgggcgcga	CRISPR spacer
--gccgctgaggcgggccgccgtgccgggcgcga	Protospacer
  ** **  ****** **** *************

72. spacer 9.24|7273372|32|NC_016109|CRT matches to MN369742 (Mycobacterium phage Spock, complete genome) position: , mismatch: 5, identity: 0.844

gtgcagc--aggcggtccgcggtgccgggcgcga	CRISPR spacer
--gccgctgaggcgggccgccgtgccgggcgcga	Protospacer
  ** **  ****** **** *************

73. spacer 9.24|7273372|32|NC_016109|CRT matches to MK112537 (Mycobacterium Phage Capricorn, complete genome) position: , mismatch: 5, identity: 0.844

gtgcagc--aggcggtccgcggtgccgggcgcga	CRISPR spacer
--gccgctgaggcgggccgccgtgccgggcgcga	Protospacer
  ** **  ****** **** *************

74. spacer 9.24|7273372|32|NC_016109|CRT matches to MN369746 (Mycobacterium phage Inky, complete genome) position: , mismatch: 5, identity: 0.844

gtgcagc--aggcggtccgcggtgccgggcgcga	CRISPR spacer
--gccgctgaggcgggccgccgtgccgggcgcga	Protospacer
  ** **  ****** **** *************

75. spacer 9.24|7273372|32|NC_016109|CRT matches to MH051246 (Mycobacterium phage ActinUp, complete genome) position: , mismatch: 5, identity: 0.844

gtgcagc--aggcggtccgcggtgccgggcgcga	CRISPR spacer
--gccgctgaggcgggccgccgtgccgggcgcga	Protospacer
  ** **  ****** **** *************

76. spacer 9.24|7273372|32|NC_016109|CRT matches to MH513977 (Mycobacterium phage Mynx, complete genome) position: , mismatch: 5, identity: 0.844

gtgcagc--aggcggtccgcggtgccgggcgcga	CRISPR spacer
--gccgctgaggcgggccgccgtgccgggcgcga	Protospacer
  ** **  ****** **** *************

77. spacer 9.24|7273372|32|NC_016109|CRT matches to MN234197 (Mycobacterium phage Ramen, complete genome) position: , mismatch: 5, identity: 0.844

gtgcagc--aggcggtccgcggtgccgggcgcga	CRISPR spacer
--gccgctgaggcgggccgccgtgccgggcgcga	Protospacer
  ** **  ****** **** *************

78. spacer 9.24|7273372|32|NC_016109|CRT matches to MH371113 (Mycobacterium phage Beezoo, complete genome) position: , mismatch: 5, identity: 0.844

gtgcagc--aggcggtccgcggtgccgggcgcga	CRISPR spacer
--gccgctgaggcgggccgccgtgccgggcgcga	Protospacer
  ** **  ****** **** *************

79. spacer 9.31|7273809|32|NC_016109|CRT matches to NZ_CP007129 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.844

gacgcctaccgcaccgtcgccgcccagctccg	CRISPR spacer
cgcacgtaccgcaccgtcgccgaccagctccg	Protospacer
 .*.* **************** *********

80. spacer 9.47|7273808|33|NC_016109|PILER-CR matches to NZ_CP007129 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.848

ggacgcctaccgcaccgtcgccgcccagctccg	CRISPR spacer
gcgcacgtaccgcaccgtcgccgaccagctccg	Protospacer
* .*.* **************** *********

81. spacer 1.1|591426|28|NC_016109|CRISPRCasFinder matches to NZ_LR134452 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 10, complete sequence) position: , mismatch: 6, identity: 0.786

cctggcgctgtactcggagctgtcggag	CRISPR spacer
tctggcgctgtactcggcgatgtcgctc	Protospacer
.**************** * *****

82. spacer 1.1|591426|28|NC_016109|CRISPRCasFinder matches to MT114163 (Mycobacterium phage Settecandela, complete genome) position: , mismatch: 6, identity: 0.786

cctggcgctgtactcggagctgtcggag	CRISPR spacer
gcgggcgctgcgctcggagctgtcggcc	Protospacer
 * *******..**************

83. spacer 1.1|591426|28|NC_016109|CRISPRCasFinder matches to MK937592 (Mycobacterium phage Phrappuccino, complete genome) position: , mismatch: 6, identity: 0.786

cctggcgctgtactcggagctgtcggag	CRISPR spacer
gcgggcgctgcgctcggagctgtcggcc	Protospacer
 * *******..**************

84. spacer 2.1|613107|32|NC_016109|CRT matches to NC_010905 (Amycolatopsis benzoatilytica strain DSM 43387 plasmid pA387, complete sequence) position: , mismatch: 6, identity: 0.812

gccgtcgacggcctgaccgacgacgagggcgc	CRISPR spacer
atcatggacgccctgaccgacgacgaggccgc	Protospacer
..*.* **** ***************** ***

85. spacer 2.1|613107|32|NC_016109|CRT matches to MT451980 (Streptomyces phage Ignacio, complete genome) position: , mismatch: 6, identity: 0.812

gccgtcgacggcctgaccgacgacgagggcgc	CRISPR spacer
ctcggcctcggcctgaccgacgacgggggcgc	Protospacer
 .** *  *****************.******

86. spacer 2.1|613107|32|NC_016109|CRT matches to NZ_CP022775 (Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gccgtcgacggcctgaccgacgacgagggcgc---	CRISPR spacer
gccggcgacgacctgac---cgacgagagcgcctt	Protospacer
**** *****.******   *******.****

87. spacer 2.1|613107|32|NC_016109|CRT matches to NZ_CP021653 (Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gccgtcgacggcctgaccgacgacgagggcgc---	CRISPR spacer
gccggcgacgacctgac---cgacgagagcgcctt	Protospacer
**** *****.******   *******.****

88. spacer 2.1|613107|32|NC_016109|CRT matches to NC_014310 (Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence) position: , mismatch: 6, identity: 0.812

gccgtcgacggcctgaccgacgacgagggcgc---	CRISPR spacer
gccggcgacgacctgac---cgacgagagcgcctt	Protospacer
**** *****.******   *******.****

89. spacer 2.1|613107|32|NC_016109|CRT matches to NZ_CP022762 (Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gccgtcgacggcctgaccgacgacgagggcgc---	CRISPR spacer
gccggcgacgacctgac---cgacgagagcgcctt	Protospacer
**** *****.******   *******.****

90. spacer 2.1|613107|32|NC_016109|CRT matches to NZ_CP021767 (Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gccgtcgacggcctgaccgacgacgagggcgc---	CRISPR spacer
gccggcgacgacctgac---cgacgagagcgcctt	Protospacer
**** *****.******   *******.****

91. spacer 2.1|613107|32|NC_016109|CRT matches to NZ_CP012688 (Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gccgtcgacggcctgaccgacgacgagggcgc---	CRISPR spacer
gccggcgacgacctgac---cgacgagagcgcctt	Protospacer
**** *****.******   *******.****

92. spacer 2.1|613107|32|NC_016109|CRT matches to NZ_CP023017 (Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gccgtcgacggcctgaccgacgacgagggcgc---	CRISPR spacer
gccggcgacgacctgac---cgacgagagcgcctt	Protospacer
**** *****.******   *******.****

93. spacer 2.1|613107|32|NC_016109|CRT matches to NZ_CP014703 (Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence) position: , mismatch: 6, identity: 0.812

gccgtcgacggcctgaccgacgacgagggcgc---	CRISPR spacer
gccggcgacgacctgac---cgacgagagcgcctt	Protospacer
**** *****.******   *******.****

94. spacer 2.1|613107|32|NC_016109|CRT matches to NZ_CP022760 (Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gccgtcgacggcctgaccgacgacgagggcgc---	CRISPR spacer
gccggcgacgacctgac---cgacgagagcgcctt	Protospacer
**** *****.******   *******.****

95. spacer 2.1|613107|32|NC_016109|CRT matches to NZ_CP022789 (Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gccgtcgacggcctgaccgacgacgagggcgc---	CRISPR spacer
gccggcgacgacctgac---cgacgagagcgcctt	Protospacer
**** *****.******   *******.****

96. spacer 2.1|613107|32|NC_016109|CRT matches to NZ_CP022771 (Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gccgtcgacggcctgaccgacgacgagggcgc---	CRISPR spacer
gccggcgacgacctgac---cgacgagagcgcctt	Protospacer
**** *****.******   *******.****

97. spacer 2.1|613107|32|NC_016109|CRT matches to NZ_CP022777 (Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gccgtcgacggcctgaccgacgacgagggcgc---	CRISPR spacer
gccggcgacgacctgac---cgacgagagcgcctt	Protospacer
**** *****.******   *******.****

98. spacer 2.1|613107|32|NC_016109|CRT matches to NZ_CP022799 (Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gccgtcgacggcctgaccgacgacgagggcgc---	CRISPR spacer
gccggcgacgacctgac---cgacgagagcgcctt	Protospacer
**** *****.******   *******.****

99. spacer 2.1|613107|32|NC_016109|CRT matches to CP047139 (Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gccgtcgacggcctgaccgacgacgagggcgc---	CRISPR spacer
gccggcgacgacctgac---cgacgagagcgcctt	Protospacer
**** *****.******   *******.****

100. spacer 2.1|613107|32|NC_016109|CRT matches to CP047137 (Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gccgtcgacggcctgaccgacgacgagggcgc---	CRISPR spacer
gccggcgacgacctgac---cgacgagagcgcctt	Protospacer
**** *****.******   *******.****

101. spacer 2.1|613107|32|NC_016109|CRT matches to NZ_CP022764 (Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gccgtcgacggcctgaccgacgacgagggcgc---	CRISPR spacer
gccggcgacgacctgac---cgacgagagcgcctt	Protospacer
**** *****.******   *******.****

102. spacer 2.1|613107|32|NC_016109|CRT matches to NZ_CP022797 (Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gccgtcgacggcctgaccgacgacgagggcgc---	CRISPR spacer
gccggcgacgacctgac---cgacgagagcgcctt	Protospacer
**** *****.******   *******.****

103. spacer 2.1|613107|32|NC_016109|CRT matches to NZ_CP022758 (Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gccgtcgacggcctgaccgacgacgagggcgc---	CRISPR spacer
gccggcgacgacctgac---cgacgagagcgcctt	Protospacer
**** *****.******   *******.****

104. spacer 2.1|613107|32|NC_016109|CRT matches to NZ_CP026091 (Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gccgtcgacggcctgaccgacgacgagggcgc---	CRISPR spacer
gccggcgacgacctgac---cgacgagagcgcctt	Protospacer
**** *****.******   *******.****

105. spacer 2.1|613107|32|NC_016109|CRT matches to NC_014309 (Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome) position: , mismatch: 6, identity: 0.812

gccgtcgacggcctgaccgacgacgagggcgc---	CRISPR spacer
gccggcgacgacctgac---cgacgagagcgcctt	Protospacer
**** *****.******   *******.****

106. spacer 2.1|613107|32|NC_016109|CRT matches to NZ_CP021763 (Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gccgtcgacggcctgaccgacgacgagggcgc---	CRISPR spacer
gccggcgacgacctgac---cgacgagagcgcctt	Protospacer
**** *****.******   *******.****

107. spacer 2.1|613107|32|NC_016109|CRT matches to NZ_CP026093 (Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gccgtcgacggcctgaccgacgacgagggcgc---	CRISPR spacer
gccggcgacgacctgac---cgacgagagcgcctt	Protospacer
**** *****.******   *******.****

108. spacer 2.1|613107|32|NC_016109|CRT matches to NZ_CP012940 (Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gccgtcgacggcctgaccgacgacgagggcgc---	CRISPR spacer
gccggcgacgacctgac---cgacgagagcgcctt	Protospacer
**** *****.******   *******.****

109. spacer 2.1|613107|32|NC_016109|CRT matches to NZ_CP012944 (Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gccgtcgacggcctgaccgacgacgagggcgc---	CRISPR spacer
gccggcgacgacctgac---cgacgagagcgcctt	Protospacer
**** *****.******   *******.****

110. spacer 2.1|613107|32|NC_016109|CRT matches to NZ_CP030263 (Ensifer adhaerens strain Corn53 plasmid AA, complete sequence) position: , mismatch: 6, identity: 0.812

--gccgtcgacggcctgaccgacgacgagggcgc	CRISPR spacer
aagcagtc--cggccttgccgacgacgagggcgt	Protospacer
  ** ***  ****** .***************.

111. spacer 2.1|613107|32|NC_016109|CRT matches to NC_017575 (Ralstonia solanacearum Po82 megaplasmid, complete sequence) position: , mismatch: 6, identity: 0.812

gccgtcgacggcctgaccgacgacgagggcgc---	CRISPR spacer
gccggcgacgacctgac---cgacgagagcgcctt	Protospacer
**** *****.******   *******.****

112. spacer 2.1|613107|32|NC_016109|CRT matches to NZ_CP026308 (Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gccgtcgacggcctgaccgacgacgagggcgc---	CRISPR spacer
gccggcgacgacctgac---cgacgagagcgcctt	Protospacer
**** *****.******   *******.****

113. spacer 2.1|613107|32|NC_016109|CRT matches to NZ_CP021765 (Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gccgtcgacggcctgaccgacgacgagggcgc---	CRISPR spacer
gccggcgacgacctgac---cgacgagagcgcctt	Protospacer
**** *****.******   *******.****

114. spacer 2.1|613107|32|NC_016109|CRT matches to NZ_CP051295 (Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence) position: , mismatch: 6, identity: 0.812

gccgtcgacggcctgaccgacgacgagggcgc---	CRISPR spacer
gccggcgacgacctgac---cgacgagagcgcctt	Protospacer
**** *****.******   *******.****

115. spacer 2.2|613168|32|NC_016109|CRT matches to NZ_CP012399 (Chelatococcus sp. CO-6 plasmid pCO-6, complete sequence) position: , mismatch: 6, identity: 0.812

-accacgcccgcccgtcgtcgccccagatgtcc	CRISPR spacer
ggccgc-cccgctcgtcgtcgccgcagatgtgc	Protospacer
 .**.* *****.********** ******* *

116. spacer 2.4|613290|32|NC_016109|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 6, identity: 0.812

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
ggtcgtcgacgcggtgctcgccgggttcgccg	Protospacer
 * * * ********** ***** ********

117. spacer 2.4|613290|32|NC_016109|CRT matches to MN813682 (Microbacterium phage Matzah, complete genome) position: , mismatch: 6, identity: 0.812

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
agacctggaggcggtgcgcgccgtgttccgca	Protospacer
 ******** *************.****  *.

118. spacer 2.4|613290|32|NC_016109|CRT matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 6, identity: 0.812

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
cgggttcgacgcggtgcacgccgggttcgccg	Protospacer
**. .* **********.***** ********

119. spacer 2.4|613290|32|NC_016109|CRT matches to NZ_CP024896 (Amycolatopsis sp. AA4 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.812

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
ggctcgggacgcggtgcgcgccgcgatcgcgg	Protospacer
 * .* ******************* **** *

120. spacer 2.4|613290|32|NC_016109|CRT matches to NC_004934 (Streptomyces violaceoruber strain SANK95570 plasmid pSV2, complete sequence) position: , mismatch: 6, identity: 0.812

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
ggccggggacgcggtgctcgccgcgttcggcg	Protospacer
 * *  *********** *********** **

121. spacer 2.4|613290|32|NC_016109|CRT matches to NZ_CP021083 (Deinococcus ficus strain CC-FR2-10 plasmid pDFI2, complete sequence) position: , mismatch: 6, identity: 0.812

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
cgacctggacgccgtgcgcgccgccatcacgc	Protospacer
************ ***********  **.*

122. spacer 2.4|613290|32|NC_016109|CRT matches to NZ_CP029209 (Nitratireductor sp. OM-1 plasmid pOM-1, complete sequence) position: , mismatch: 6, identity: 0.812

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
cgacccggacgtggtgcgcgccgcgcaggcca	Protospacer
*****.*****.*************.  ***.

123. spacer 2.4|613290|32|NC_016109|CRT matches to NZ_CP030074 (Streptomyces sp. ZFG47 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.812

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
cgacctggacgcggtccgcgcggcggtgtcct	Protospacer
*************** ***** *** *  **

124. spacer 2.4|613290|32|NC_016109|CRT matches to NZ_CP016617 (Microvirga ossetica strain V5/3m plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.812

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
cggcgaagaggcggtgcgcgccgcgttccccg	Protospacer
**.*  .** ****************** ***

125. spacer 2.4|613290|32|NC_016109|CRT matches to NZ_CP016617 (Microvirga ossetica strain V5/3m plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.812

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
cggcgaagaggcggtgcgcgccgcgttccccg	Protospacer
**.*  .** ****************** ***

126. spacer 2.4|613290|32|NC_016109|CRT matches to ASHF01000034 (Streptomyces sp. GBA 94-10 plasmid pGBA1, complete sequence, whole genome shotgun sequence) position: , mismatch: 6, identity: 0.812

--cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
gtcgagc--gacgcggtgcgcgcggcgttcacca	Protospacer
  *** *  ************** ******.**.

127. spacer 2.4|613290|32|NC_016109|CRT matches to NZ_CP007129 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.812

cgacctggacgcggtgcgcgccgcgttcgccg---	CRISPR spacer
cgacgtggacgcggcgcgcgccg---gcgccgagc	Protospacer
**** *********.********    *****

128. spacer 2.4|613290|32|NC_016109|CRT matches to NZ_CP006368 (Aureimonas sp. AU20 plasmid pAU20a, complete sequence) position: , mismatch: 6, identity: 0.812

cgacctggacgcggtgcgcgccgcgtt-cgccg	CRISPR spacer
cgacccggacgcgctgcgcgccgaactgcgcc-	Protospacer
*****.******* ********* ..* ****

129. spacer 2.4|613290|32|NC_016109|CRT matches to LN997844 (Streptomyces reticuli genome assembly TUE45, plasmid : III) position: , mismatch: 6, identity: 0.812

cgacctggacgcggtgcgcgccgcgttcgccg-	CRISPR spacer
cgacctggacgcggggcgcggcg-gtcagcagg	Protospacer
************** ***** ** **. ** *

130. spacer 2.6|613412|32|NC_016109|CRT matches to NZ_CP016618 (Microvirga ossetica strain V5/3m plasmid unnamed3, complete sequence) position: , mismatch: 6, identity: 0.812

ctggtg-tcgatcaggtcggcagcctcgccgag	CRISPR spacer
-agttgcccgatcaggtcggcagcctggacgag	Protospacer
  * ** .****************** * ****

131. spacer 2.8|613534|32|NC_016109|CRT matches to NZ_CP020568 (Kitasatospora aureofaciens strain DM-1 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.812

ggcgtcggtggcgaggagttcggtgggggtga	CRISPR spacer
ggcgccgatggcgaggagttcggtccggagga	Protospacer
****.**.****************  **. **

132. spacer 2.12|613778|32|NC_016109|CRT matches to NZ_CP012186 (Pseudonocardia sp. EC080619-01 plasmid pBCI1-1, complete sequence) position: , mismatch: 6, identity: 0.812

atgacgaccgggtcggccagcgacc--cggatcc	CRISPR spacer
gtgacggccgcgtcggccagcgaccgacggaa--	Protospacer
.*****.*** **************  ****

133. spacer 2.13|613107|33|NC_016109|CRISPRCasFinder matches to NC_003903 (Streptomyces coelicolor A3(2) plasmid SCP1, complete sequence) position: , mismatch: 6, identity: 0.818

gccgtcgacggcctgaccgacga-cgagggcgcg	CRISPR spacer
gccgtccacggcctgacggacgaccgcatgcgc-	Protospacer
****** ********** ***** ** . ****

134. spacer 2.16|613290|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NZ_CP024896 (Amycolatopsis sp. AA4 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.818

cgacctggacgcggtgcgcgccgcgttcgccgc	CRISPR spacer
ggctcgggacgcggtgcgcgccgcgatcgcggc	Protospacer
 * .* ******************* **** **

135. spacer 2.16|613290|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NC_004934 (Streptomyces violaceoruber strain SANK95570 plasmid pSV2, complete sequence) position: , mismatch: 6, identity: 0.818

cgacctggacgcggtgcgcgccgcgttcgccgc	CRISPR spacer
ggccggggacgcggtgctcgccgcgttcggcgc	Protospacer
 * *  *********** *********** ***

136. spacer 2.16|613290|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NZ_CP021083 (Deinococcus ficus strain CC-FR2-10 plasmid pDFI2, complete sequence) position: , mismatch: 6, identity: 0.818

cgacctggacgcggtgcgcgccgcgttcgccgc	CRISPR spacer
cgacctggacgccgtgcgcgccgccatcacgcc	Protospacer
************ ***********  **.*  *

137. spacer 2.16|613290|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NZ_LR594676 (Variovorax sp. PBS-H4 plasmid 2) position: , mismatch: 6, identity: 0.818

-cgacctggacgcggtgcgcgccgcgttcgccgc	CRISPR spacer
acaaccc-gacgcggtccgcgccgccttcgccga	Protospacer
 *.***. ******** ******** *******

138. spacer 2.16|613290|33|NC_016109|CRISPRCasFinder,PILER-CR matches to ASHF01000034 (Streptomyces sp. GBA 94-10 plasmid pGBA1, complete sequence, whole genome shotgun sequence) position: , mismatch: 6, identity: 0.818

--cgacctggacgcggtgcgcgccgcgttcgccgc	CRISPR spacer
gtcgagc--gacgcggtgcgcgcggcgttcaccac	Protospacer
  *** *  ************** ******.**.*

139. spacer 2.16|613290|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NC_023498 (Mycobacterium phage Validus, complete genome) position: , mismatch: 6, identity: 0.818

--cgacctggacgcggtgcgcgccgcgttcgccgc	CRISPR spacer
cacggcccg--cgaggtgcgcgccgcgctcgccgc	Protospacer
  **.**.*  ** *************.*******

140. spacer 2.18|613412|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NZ_CP016618 (Microvirga ossetica strain V5/3m plasmid unnamed3, complete sequence) position: , mismatch: 6, identity: 0.818

ctggtg-tcgatcaggtcggcagcctcgccgagg	CRISPR spacer
-agttgcccgatcaggtcggcagcctggacgagg	Protospacer
  * ** .****************** * *****

141. spacer 2.24|613778|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NZ_CP012186 (Pseudonocardia sp. EC080619-01 plasmid pBCI1-1, complete sequence) position: , mismatch: 6, identity: 0.818

atgacgaccgggtcggccagcgacc--cggatccg	CRISPR spacer
gtgacggccgcgtcggccagcgaccgacggaac--	Protospacer
.*****.*** **************  **** *

142. spacer 3.11|624168|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to KY092482 (Streptomyces phage Mojorita, complete genome) position: , mismatch: 6, identity: 0.818

ccgggacag--cggcggccggggctgcgggctgct	CRISPR spacer
--gggcctgctcggcggccggcgccgcgggctgct	Protospacer
  *** * *  ********** **.**********

143. spacer 3.11|624168|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to KY092480 (Streptomyces phage Picard, complete genome) position: , mismatch: 6, identity: 0.818

ccgggacag--cggcggccggggctgcgggctgct	CRISPR spacer
--gggcctgctcggcggccggcgccgcgggctgct	Protospacer
  *** * *  ********** **.**********

144. spacer 3.12|624229|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP030354 (Novosphingobium sp. P6W plasmid pP6W1, complete sequence) position: , mismatch: 6, identity: 0.818

gtcggccg-aacaccgcgcggccaccggcaagga	CRISPR spacer
-cctgcggcaacgcggcgcggccaccggcaagga	Protospacer
 .* ** * ***.* *******************

145. spacer 3.20|624717|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP012941 (Ralstonia solanacearum strain UW163 plasmid pUW163a, complete sequence) position: , mismatch: 6, identity: 0.818

gggtctcgcgatcctggccaggat-cggactcgt	CRISPR spacer
gggtgtcgcgagcctggccaggatccgcgatcg-	Protospacer
**** ****** ************ ** . ***

146. spacer 3.21|624778|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NC_010510 (Methylobacterium radiotolerans JCM 2831 plasmid pMRAD01, complete sequence) position: , mismatch: 6, identity: 0.818

ccggcccg-gggcgcccgccgccggggcggagag	CRISPR spacer
-cgttccgcaggcggccgccgccggggcggcgag	Protospacer
 ** .*** .**** *************** ***

147. spacer 3.25|625022|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP017076 (Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence) position: , mismatch: 6, identity: 0.818

gcggggcacgaccccggccgaggacaaggcgta	CRISPR spacer
gatcggcacgaccccggccgaggccgaggcgaa	Protospacer
*   ******************* *.***** *

148. spacer 3.26|625083|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_AP014707 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_3p, complete sequence) position: , mismatch: 6, identity: 0.818

tcgcccggcgccacgctcaaggacctgctgctg----	CRISPR spacer
tcggccggcgccatgctcaagga----ctgctgcgtc	Protospacer
*** *********.*********    ******

149. spacer 3.30|625327|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP039425 (Citricoccus sp. SGAir0253 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.818

cccatccccgacggccgcgcgctgttc---ctggcc	CRISPR spacer
tccatccccggcggccgcgccctgttcgatctg---	Protospacer
.*********.********* ******   ***

150. spacer 3.30|625327|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP039430 (Citricoccus sp. SGAir0453 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.818

cccatccccgacggccgcgcgctgttc---ctggcc	CRISPR spacer
tccatccccggcggccgcgccctgttcgatctg---	Protospacer
.*********.********* ******   ***

151. spacer 3.30|625327|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP015737 (Shinella sp. HZN7 plasmid pShin-01, complete sequence) position: , mismatch: 6, identity: 0.818

cccatccccgacggccgcgc---gctgttcctggcc	CRISPR spacer
cccatccacgacggccgcgccctgccggtcctg---	Protospacer
******* ************   **.* *****

152. spacer 3.36|625693|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP031166 (Euzebya sp. DY32-46 plasmid pEDY32-46I, complete sequence) position: , mismatch: 6, identity: 0.818

caccgac-ttgacgaggtcggtctcgttgacgtc	CRISPR spacer
-gtcgatggtgacgaggtcgttctcgttgacgtc	Protospacer
 ..***.  *********** *************

153. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP044425 (Paracoccus pantotrophus strain DSM 2944 plasmid pPAN2, complete sequence) position: , mismatch: 6, identity: 0.812

agcccccgcagcagcagcccggcg-gctacggc	CRISPR spacer
agccgccgcagcagcagccgggcgtggcgcgg-	Protospacer
**** ************** **** * ..***

154. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP030832 (Neorhizobium sp. NCHU2750 plasmid pNCHU2750d, complete sequence) position: , mismatch: 6, identity: 0.812

agcccccg---cagcagcagcccggcggctacggc	CRISPR spacer
---ccacggaacagcagcagcacggcgtctacggc	Protospacer
   ** **   ********** ***** *******

155. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP015446 (Streptomyces sp. S8 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

agcccccgcagcagcagcccggcggctacggc-	CRISPR spacer
acaccccccaggagcagcccggcggc-acggtt	Protospacer
*  **** *** ************** ****.

156. spacer 8.1|7220782|31|NC_016109|CRISPRCasFinder matches to NC_018836 (Streptomyces phage phiHau3, complete genome) position: , mismatch: 6, identity: 0.806

tcagcaggtcgtccgtatcggtggcgacagc	CRISPR spacer
gttgaaggacgtccgtatcggtggcgccagc	Protospacer
 . * *** ***************** ****

157. spacer 8.1|7220782|31|NC_016109|CRISPRCasFinder matches to MF038791 (Arthrobacter phage ElephantMan, complete genome) position: , mismatch: 6, identity: 0.806

tcagcaggtcgtccgtatcggtggcgacagc-	CRISPR spacer
acagcaggtcgtccgtctcggcggt-acacct	Protospacer
 *************** ****.**. *** *

158. spacer 8.1|7220782|31|NC_016109|CRISPRCasFinder matches to MF038790 (Arthrobacter phage Niktson, complete genome) position: , mismatch: 6, identity: 0.806

tcagcaggtcgtccgtatcggtggcgacagc-	CRISPR spacer
acagcaggtcgtccgtctcggcggt-acacct	Protospacer
 *************** ****.**. *** *

159. spacer 8.1|7220782|31|NC_016109|CRISPRCasFinder matches to MF140432 (Arthrobacter phage Teacup, complete genome) position: , mismatch: 6, identity: 0.806

tcagcaggtcgtccgtatcggtggcgacagc-	CRISPR spacer
acagcaggtcgtccgtctcggcggt-acacct	Protospacer
 *************** ****.**. *** *

160. spacer 9.4|7273190|31|NC_016109|CRISPRCasFinder matches to NZ_CP049141 (Pseudomonas nitroreducens strain HBP1 plasmid pPniHBP1_2, complete sequence) position: , mismatch: 6, identity: 0.806

ggtcg-aacacgccgtcggtctgcgcgcgccg	CRISPR spacer
-ctcgcaccacgcagtcggtctgcgcgcgcat	Protospacer
  *** * ***** ****************

161. spacer 9.7|7273373|31|NC_016109|CRISPRCasFinder matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 6, identity: 0.806

tgcagcaggcggtccgcggtgccgggcgcga	CRISPR spacer
gccagcaggcggtccacggcgccgggcgccc	Protospacer
  *************.***.*********

162. spacer 9.7|7273373|31|NC_016109|CRISPRCasFinder matches to NC_005838 (Thermus thermophilus HB27 plasmid pTT27, complete sequence) position: , mismatch: 6, identity: 0.806

tgcagcaggcggtccgcggtgccgggcgcga	CRISPR spacer
gccagcaggcggtccacggcgccgggcgccc	Protospacer
  *************.***.*********

163. spacer 9.7|7273373|31|NC_016109|CRISPRCasFinder matches to NZ_CP030074 (Streptomyces sp. ZFG47 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.806

tgcagcaggcggtccgcggtgccgggcgcga	CRISPR spacer
tccggccagcggtccgcggcgccgggcggga	Protospacer
* *.** .***********.******** **

164. spacer 9.7|7273373|31|NC_016109|CRISPRCasFinder matches to MF377440 (Mycobacterium phage Bella96, complete genome) position: , mismatch: 6, identity: 0.806

-tgcagcaggcggtccgcggtgccgggcgcga	CRISPR spacer
ccgctg-atgcgggccgccgtgccgggcgcga	Protospacer
 .** * * **** **** *************

165. spacer 9.7|7273373|31|NC_016109|CRISPRCasFinder matches to MK937607 (Gordonia phage Zipp, complete genome) position: , mismatch: 6, identity: 0.806

-tgcagcaggcggtccgcggtgccgggcgcga	CRISPR spacer
gtgccgt-ggctgtccgcggtgcagggcgcgc	Protospacer
 *** *. *** *********** *******

166. spacer 9.13|7273749|31|NC_016109|CRISPRCasFinder matches to CP006880 (Rhizobium gallicum bv. gallicum R602 plasmid pRgalR602c, complete sequence) position: , mismatch: 6, identity: 0.806

cgacgccgcgggtccggatcaccgcgacgta	CRISPR spacer
tgacgccgcgggtccggatcaccgcctggcg	Protospacer
.************************   *..

167. spacer 9.13|7273749|31|NC_016109|CRISPRCasFinder matches to NC_015314 (Pseudonocardia dioxanivorans CB1190 plasmid pPSED01, complete sequence) position: , mismatch: 6, identity: 0.806

cgacgccgcgggtccggatcaccgcgacgta	CRISPR spacer
ccgcgccgcggatccggatcaccgcctcgga	Protospacer
* .********.*************  ** *

168. spacer 9.14|7273810|31|NC_016109|CRISPRCasFinder matches to NC_013859 (Azospirillum sp. B510 plasmid pAB510e, complete sequence) position: , mismatch: 6, identity: 0.806

acgcctaccgcaccgtcgccgcccagctccg	CRISPR spacer
ccgccgaccgcatcgtcgccgcccagcgcga	Protospacer
 **** ******.************** * .

169. spacer 9.14|7273810|31|NC_016109|CRISPRCasFinder matches to NZ_AP022333 (Methylosinus sp. C49 isolate Methylosinus sp. C49 plasmid pMSC49a, complete sequence) position: , mismatch: 6, identity: 0.806

acgcctaccgcaccgtcgccgcccagctccg	CRISPR spacer
aggcgcgccgcaccgtcgccgcccagcgcct	Protospacer
* ** ..******************** **

170. spacer 9.17|7273993|31|NC_016109|CRISPRCasFinder matches to NZ_AP014705 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence) position: , mismatch: 6, identity: 0.806

cgccgaccgcgcccaggaggagctggtccgc	CRISPR spacer
cgccggccgcgcccaggacgagctgacctcc	Protospacer
*****.************ ******..*. *

171. spacer 9.17|7273993|31|NC_016109|CRISPRCasFinder matches to NZ_CP017148 (Bosea vaviloviae strain Vaf18 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.806

cgccgaccgcgcccaggaggagctggtccgc	CRISPR spacer
cactgaacgcgcccgggaggagctggtcgcc	Protospacer
*.*.** *******.*************  *

172. spacer 9.21|7273189|32|NC_016109|CRT matches to NC_019849 (Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence) position: , mismatch: 6, identity: 0.812

cggtcgaacacgccgtcggtctgcgcgcgccg-	CRISPR spacer
cggtcgaacaggccatcggtctg-gcgggaggc	Protospacer
********** ***.******** *** *  *

173. spacer 9.21|7273189|32|NC_016109|CRT matches to NC_009620 (Sinorhizobium medicae WSM419 plasmid pSMED01, complete sequence) position: , mismatch: 6, identity: 0.812

cggtcgaacacgccgtcggtctgcgcgcgccg-	CRISPR spacer
cggtcgagcaggccgtcggtctg-gcgggaggc	Protospacer
*******.** ************ *** *  *

174. spacer 9.24|7273372|32|NC_016109|CRT matches to NZ_CP020040 (Streptomyces sp. 3211 isolate 3 plasmid p3211-1, complete sequence) position: , mismatch: 6, identity: 0.812

gtgcagcaggcggtccgcggtgccgggcgcga-	CRISPR spacer
gtgtggcaggcggtccgcggtg-cgccggcgac	Protospacer
***..***************** **   ****

175. spacer 9.24|7273372|32|NC_016109|CRT matches to MF377440 (Mycobacterium phage Bella96, complete genome) position: , mismatch: 6, identity: 0.812

gtgcagc--aggcggtccgcggtgccgggcgcga	CRISPR spacer
--gccgctgatgcgggccgccgtgccgggcgcga	Protospacer
  ** **  * **** **** *************

176. spacer 9.24|7273372|32|NC_016109|CRT matches to MK937607 (Gordonia phage Zipp, complete genome) position: , mismatch: 6, identity: 0.812

-gtgcagcaggcggtccgcggtgccgggcgcga	CRISPR spacer
cgtgccgt-ggctgtccgcggtgcagggcgcgc	Protospacer
 **** *. *** *********** *******

177. spacer 9.30|7273748|32|NC_016109|CRT matches to CP006880 (Rhizobium gallicum bv. gallicum R602 plasmid pRgalR602c, complete sequence) position: , mismatch: 6, identity: 0.812

gcgacgccgcgggtccggatcaccgcgacgta	CRISPR spacer
gtgacgccgcgggtccggatcaccgcctggcg	Protospacer
*.************************   *..

178. spacer 9.31|7273809|32|NC_016109|CRT matches to NZ_AP022333 (Methylosinus sp. C49 isolate Methylosinus sp. C49 plasmid pMSC49a, complete sequence) position: , mismatch: 6, identity: 0.812

gacgcctaccgcaccgtcgccgcccagctccg	CRISPR spacer
gaggcgcgccgcaccgtcgccgcccagcgcct	Protospacer
** ** ..******************** **

179. spacer 9.33|7273931|32|NC_016109|CRT matches to NZ_CP017756 (Cupriavidus malaysiensis strain USMAA1020 isolate pure plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.812

tgctccagccagtacggcagccact-cggagag	CRISPR spacer
agcaccaggcagtacggcagccaccgctgaga-	Protospacer
 ** **** ***************. * ****

180. spacer 9.34|7273992|32|NC_016109|CRT matches to NC_004808 (Streptomyces rochei plasmid pSLA2-L DNA, complete sequence) position: , mismatch: 6, identity: 0.812

acgccgaccgcgcccaggaggagctggtccgc	CRISPR spacer
tcgtctgccgcgaccaggacgagctggtccgc	Protospacer
 **.* .***** ****** ************

181. spacer 9.40|7273371|33|NC_016109|PILER-CR matches to MN234205 (Mycobacterium phage Veliki, complete genome) position: , mismatch: 6, identity: 0.818

agtgcagc--aggcggtccgcggtgccgggcgcga	CRISPR spacer
--cgccgctgaggcgggccgccgtgccgggcgcga	Protospacer
  .** **  ****** **** *************

182. spacer 9.40|7273371|33|NC_016109|PILER-CR matches to MH727544 (Mycobacterium phage Dalmuri, complete genome) position: , mismatch: 6, identity: 0.818

agtgcagc--aggcggtccgcggtgccgggcgcga	CRISPR spacer
--cgccgctgaggcgggccgccgtgccgggcgcga	Protospacer
  .** **  ****** **** *************

183. spacer 9.40|7273371|33|NC_016109|PILER-CR matches to MH001453 (Mycobacterium phage Adonis, complete genome) position: , mismatch: 6, identity: 0.818

agtgcagc--aggcggtccgcggtgccgggcgcga	CRISPR spacer
--cgccgctgaggcgggccgccgtgccgggcgcga	Protospacer
  .** **  ****** **** *************

184. spacer 9.40|7273371|33|NC_016109|PILER-CR matches to JF704105 (Mycobacterium phage Adephagia, complete sequence) position: , mismatch: 6, identity: 0.818

agtgcagc--aggcggtccgcggtgccgggcgcga	CRISPR spacer
--cgccgctgaggcgggccgccgtgccgggcgcga	Protospacer
  .** **  ****** **** *************

185. spacer 9.40|7273371|33|NC_016109|PILER-CR matches to MN234182 (Mycobacterium phage Geraldini, complete genome) position: , mismatch: 6, identity: 0.818

agtgcagc--aggcggtccgcggtgccgggcgcga	CRISPR spacer
--cgccgctgaggcgggccgccgtgccgggcgcga	Protospacer
  .** **  ****** **** *************

186. spacer 9.40|7273371|33|NC_016109|PILER-CR matches to MN234198 (Mycobacterium phage Zavala, complete genome) position: , mismatch: 6, identity: 0.818

agtgcagc--aggcggtccgcggtgccgggcgcga	CRISPR spacer
--cgccgctgaggcgggccgccgtgccgggcgcga	Protospacer
  .** **  ****** **** *************

187. spacer 9.40|7273371|33|NC_016109|PILER-CR matches to MF140412 (Mycobacterium phage Jeckyll, complete genome) position: , mismatch: 6, identity: 0.818

agtgcagc--aggcggtccgcggtgccgggcgcga	CRISPR spacer
--cgccgctgaggcgggccgccgtgccgggcgcga	Protospacer
  .** **  ****** **** *************

188. spacer 9.40|7273371|33|NC_016109|PILER-CR matches to KY380102 (Mycobacterium phage CREW, complete genome) position: , mismatch: 6, identity: 0.818

agtgcagc--aggcggtccgcggtgccgggcgcga	CRISPR spacer
--cgccgctgaggcgggccgccgtgccgggcgcga	Protospacer
  .** **  ****** **** *************

189. spacer 9.40|7273371|33|NC_016109|PILER-CR matches to KX585253 (Mycobacterium phage HedwigODU, complete genome) position: , mismatch: 6, identity: 0.818

agtgcagc--aggcggtccgcggtgccgggcgcga	CRISPR spacer
--cgccgctgaggcgggccgccgtgccgggcgcga	Protospacer
  .** **  ****** **** *************

190. spacer 9.40|7273371|33|NC_016109|PILER-CR matches to MH536822 (Mycobacterium phage Joy99, complete genome) position: , mismatch: 6, identity: 0.818

agtgcagc--aggcggtccgcggtgccgggcgcga	CRISPR spacer
--cgccgctgaggcgggccgccgtgccgggcgcga	Protospacer
  .** **  ****** **** *************

191. spacer 9.40|7273371|33|NC_016109|PILER-CR matches to MF140428 (Mycobacterium phage Slimphazie, complete genome) position: , mismatch: 6, identity: 0.818

agtgcagc--aggcggtccgcggtgccgggcgcga	CRISPR spacer
--cgccgctgaggcgggccgccgtgccgggcgcga	Protospacer
  .** **  ****** **** *************

192. spacer 9.40|7273371|33|NC_016109|PILER-CR matches to KJ567045 (Mycobacterium phage Emerson, complete genome) position: , mismatch: 6, identity: 0.818

agtgcagc--aggcggtccgcggtgccgggcgcga	CRISPR spacer
--cgccgctgaggcgggccgccgtgccgggcgcga	Protospacer
  .** **  ****** **** *************

193. spacer 9.40|7273371|33|NC_016109|PILER-CR matches to MK460247 (Mycobacterium phage YoureAdopted, complete genome) position: , mismatch: 6, identity: 0.818

agtgcagc--aggcggtccgcggtgccgggcgcga	CRISPR spacer
--cgccgctgaggcgggccgccgtgccgggcgcga	Protospacer
  .** **  ****** **** *************

194. spacer 9.40|7273371|33|NC_016109|PILER-CR matches to JN185608 (Mycobacterium virus JAWS, complete genome) position: , mismatch: 6, identity: 0.818

agtgcagc--aggcggtccgcggtgccgggcgcga	CRISPR spacer
--cgccgctgaggcgggccgccgtgccgggcgcga	Protospacer
  .** **  ****** **** *************

195. spacer 9.40|7273371|33|NC_016109|PILER-CR matches to MN234231 (Mycobacterium phage Rapunzel97, complete genome) position: , mismatch: 6, identity: 0.818

agtgcagc--aggcggtccgcggtgccgggcgcga	CRISPR spacer
--cgccgctgaggcgggccgccgtgccgggcgcga	Protospacer
  .** **  ****** **** *************

196. spacer 9.40|7273371|33|NC_016109|PILER-CR matches to MN908692 (Mycobacterium Phage BGlluviae, complete genome) position: , mismatch: 6, identity: 0.818

agtgcagc--aggcggtccgcggtgccgggcgcga	CRISPR spacer
--cgccgctgaggcgggccgccgtgccgggcgcga	Protospacer
  .** **  ****** **** *************

197. spacer 9.40|7273371|33|NC_016109|PILER-CR matches to NC_023747 (Mycobacterium phage BarrelRoll, complete genome) position: , mismatch: 6, identity: 0.818

agtgcagc--aggcggtccgcggtgccgggcgcga	CRISPR spacer
--cgccgctgaggcgggccgccgtgccgggcgcga	Protospacer
  .** **  ****** **** *************

198. spacer 9.40|7273371|33|NC_016109|PILER-CR matches to MH536821 (Mycobacterium phage Homura, complete genome) position: , mismatch: 6, identity: 0.818

agtgcagc--aggcggtccgcggtgccgggcgcga	CRISPR spacer
--cgccgctgaggcgggccgccgtgccgggcgcga	Protospacer
  .** **  ****** **** *************

199. spacer 9.40|7273371|33|NC_016109|PILER-CR matches to MF668267 (Mycobacterium phage Apocalypse, complete genome) position: , mismatch: 6, identity: 0.818

agtgcagc--aggcggtccgcggtgccgggcgcga	CRISPR spacer
--cgccgctgaggcgggccgccgtgccgggcgcga	Protospacer
  .** **  ****** **** *************

200. spacer 9.40|7273371|33|NC_016109|PILER-CR matches to MH697578 (Mycobacterium phage Belladonna, complete genome) position: , mismatch: 6, identity: 0.818

agtgcagc--aggcggtccgcggtgccgggcgcga	CRISPR spacer
--cgccgctgaggcgggccgccgtgccgggcgcga	Protospacer
  .** **  ****** **** *************

201. spacer 9.40|7273371|33|NC_016109|PILER-CR matches to MH077577 (Mycobacterium phage AlishaPH, complete genome) position: , mismatch: 6, identity: 0.818

agtgcagc--aggcggtccgcggtgccgggcgcga	CRISPR spacer
--cgccgctgaggcgggccgccgtgccgggcgcga	Protospacer
  .** **  ****** **** *************

202. spacer 9.40|7273371|33|NC_016109|PILER-CR matches to MH509444 (Mycobacterium phage BEEST, complete genome) position: , mismatch: 6, identity: 0.818

agtgcagc--aggcggtccgcggtgccgggcgcga	CRISPR spacer
--cgccgctgaggcgggccgccgtgccgggcgcga	Protospacer
  .** **  ****** **** *************

203. spacer 9.40|7273371|33|NC_016109|PILER-CR matches to MN369742 (Mycobacterium phage Spock, complete genome) position: , mismatch: 6, identity: 0.818

agtgcagc--aggcggtccgcggtgccgggcgcga	CRISPR spacer
--cgccgctgaggcgggccgccgtgccgggcgcga	Protospacer
  .** **  ****** **** *************

204. spacer 9.40|7273371|33|NC_016109|PILER-CR matches to MK112537 (Mycobacterium Phage Capricorn, complete genome) position: , mismatch: 6, identity: 0.818

agtgcagc--aggcggtccgcggtgccgggcgcga	CRISPR spacer
--cgccgctgaggcgggccgccgtgccgggcgcga	Protospacer
  .** **  ****** **** *************

205. spacer 9.40|7273371|33|NC_016109|PILER-CR matches to MN369746 (Mycobacterium phage Inky, complete genome) position: , mismatch: 6, identity: 0.818

agtgcagc--aggcggtccgcggtgccgggcgcga	CRISPR spacer
--cgccgctgaggcgggccgccgtgccgggcgcga	Protospacer
  .** **  ****** **** *************

206. spacer 9.40|7273371|33|NC_016109|PILER-CR matches to MH051246 (Mycobacterium phage ActinUp, complete genome) position: , mismatch: 6, identity: 0.818

agtgcagc--aggcggtccgcggtgccgggcgcga	CRISPR spacer
--cgccgctgaggcgggccgccgtgccgggcgcga	Protospacer
  .** **  ****** **** *************

207. spacer 9.40|7273371|33|NC_016109|PILER-CR matches to MH513977 (Mycobacterium phage Mynx, complete genome) position: , mismatch: 6, identity: 0.818

agtgcagc--aggcggtccgcggtgccgggcgcga	CRISPR spacer
--cgccgctgaggcgggccgccgtgccgggcgcga	Protospacer
  .** **  ****** **** *************

208. spacer 9.40|7273371|33|NC_016109|PILER-CR matches to MN234197 (Mycobacterium phage Ramen, complete genome) position: , mismatch: 6, identity: 0.818

agtgcagc--aggcggtccgcggtgccgggcgcga	CRISPR spacer
--cgccgctgaggcgggccgccgtgccgggcgcga	Protospacer
  .** **  ****** **** *************

209. spacer 9.40|7273371|33|NC_016109|PILER-CR matches to MH371113 (Mycobacterium phage Beezoo, complete genome) position: , mismatch: 6, identity: 0.818

agtgcagc--aggcggtccgcggtgccgggcgcga	CRISPR spacer
--cgccgctgaggcgggccgccgtgccgggcgcga	Protospacer
  .** **  ****** **** *************

210. spacer 1.1|591426|28|NC_016109|CRISPRCasFinder matches to MK813942 (Aeromonas phage 4_4512, complete genome) position: , mismatch: 7, identity: 0.75

cctggcgctgtactcggagctgtcggag	CRISPR spacer
gttggcgctgtactcggagctgggattg	Protospacer
 .********************  .  *

211. spacer 1.1|591426|28|NC_016109|CRISPRCasFinder matches to NZ_CP029211 (Aquabacterium olei strain NBRC 110486 plasmid pTB101, complete sequence) position: , mismatch: 7, identity: 0.75

cctggcgctgtactcggagctgtcggag	CRISPR spacer
cctggcgctggacccggagctgtaccga	Protospacer
********** **.*********   ..

212. spacer 2.1|613107|32|NC_016109|CRT matches to NC_010997 (Rhizobium etli CIAT 652 plasmid pC, complete sequence) position: , mismatch: 7, identity: 0.781

gccgtcgacggcctgaccgacgacgagggcgc	CRISPR spacer
ttcttcgagggcccgaccgacgacgagggcat	Protospacer
 .* **** ****.****************..

213. spacer 2.1|613107|32|NC_016109|CRT matches to MT521991 (Streptomyces phage Eklok, complete genome) position: , mismatch: 7, identity: 0.781

gccgtcgacggcctgaccgacgacgagggcgc	CRISPR spacer
ctcggtctcggcctgaccgacgacgggggcgc	Protospacer
 .** .  *****************.******

214. spacer 2.1|613107|32|NC_016109|CRT matches to MT451981 (Streptomyces phage Vondra, complete genome) position: , mismatch: 7, identity: 0.781

gccgtcgacggcctgaccgacgacgagggcgc	CRISPR spacer
ctcggtctcggcctgaccgacgacgggggcgc	Protospacer
 .** .  *****************.******

215. spacer 2.1|613107|32|NC_016109|CRT matches to NZ_CP031166 (Euzebya sp. DY32-46 plasmid pEDY32-46I, complete sequence) position: , mismatch: 7, identity: 0.781

gccgtcgacggcctgaccgacgacgagggcgc	CRISPR spacer
acggtcgacgacctgaccgacgacgaaatccc	Protospacer
.* *******.***************.. * *

216. spacer 2.1|613107|32|NC_016109|CRT matches to NZ_CP022367 (Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence) position: , mismatch: 7, identity: 0.781

gccgtcgacggcctgaccgacgacgagggcgc	CRISPR spacer
gtcgccgaccgcctgaccgacgacggcgaggc	Protospacer
*.**.**** ***************. *. **

217. spacer 2.1|613107|32|NC_016109|CRT matches to NC_003903 (Streptomyces coelicolor A3(2) plasmid SCP1, complete sequence) position: , mismatch: 7, identity: 0.781

gccgtcgacggcctgaccgacgacgagggcgc-----	CRISPR spacer
gccgtccacggcctgacggacgac-----cgcatgcg	Protospacer
****** ********** ******     ***

218. spacer 2.1|613107|32|NC_016109|CRT matches to MT521993 (Gordonia phage RedWattleHog, complete genome) position: , mismatch: 7, identity: 0.781

gccgtcgacggcctgaccgacgacgagggcgc	CRISPR spacer
gactactacggcctgaccgacgaggaaggcgt	Protospacer
* *  * **************** **.****.

219. spacer 2.1|613107|32|NC_016109|CRT matches to MN586040 (Gordonia phage Stormageddon, complete genome) position: , mismatch: 7, identity: 0.781

gccgtcgacggcctgaccgacgacgagggcgc	CRISPR spacer
gactactacggcctgaccgacgaggaaggcgt	Protospacer
* *  * **************** **.****.

220. spacer 2.1|613107|32|NC_016109|CRT matches to NC_005262 (Burkholderia cepacia phage Bcep22, complete genome) position: , mismatch: 7, identity: 0.781

gccgtcgacggcctgaccgacgacgagggcgc	CRISPR spacer
gatttggccggcctgaccgacgaggagcgcgc	Protospacer
* . * * *************** *** ****

221. spacer 2.1|613107|32|NC_016109|CRT matches to NZ_CP049244 (Rhizobium pseudoryzae strain DSM 19479 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.781

gccgtcgacggcctgaccgacgacgagggcgc	CRISPR spacer
gcgttcttcgccctgaccgacgaagagggcgg	Protospacer
**  **  ** ************ *******

222. spacer 2.1|613107|32|NC_016109|CRT matches to NZ_CP015882 (Ensifer adhaerens strain Casida A plasmid pCasidaAB, complete sequence) position: , mismatch: 7, identity: 0.781

gccgtcgacggcctgaccgacgacgagggcgc---	CRISPR spacer
gccgtccacggcctgac---cgtcgaaggcgtgca	Protospacer
****** **********   ** ***.****.

223. spacer 2.1|613107|32|NC_016109|CRT matches to NZ_CP030264 (Ensifer adhaerens strain Corn53 plasmid AB, complete sequence) position: , mismatch: 7, identity: 0.781

gccgtcgacggcctgaccgacgacgagggcgc---	CRISPR spacer
gccgtccacggcctgac---cgtcgaaggcgtgca	Protospacer
****** **********   ** ***.****.

224. spacer 2.1|613107|32|NC_016109|CRT matches to MK279887 (Mycobacterium phage Timmi, complete genome) position: , mismatch: 7, identity: 0.781

gccgtcgacggcctgaccgacgacgag-ggcgc	CRISPR spacer
gggatcaacggcatgaccgacgacgagctgcg-	Protospacer
*  .**.***** **************  ***

225. spacer 2.1|613107|32|NC_016109|CRT matches to MH651175 (Mycobacterium phage Gophee, complete genome) position: , mismatch: 7, identity: 0.781

gccgtcgacggcctgaccgacgacgag-ggcgc	CRISPR spacer
gggctcaacggcatgaccgacgacgagctgcg-	Protospacer
*   **.***** **************  ***

226. spacer 2.1|613107|32|NC_016109|CRT matches to MG925339 (Mycobacterium phage Chunky, complete genome) position: , mismatch: 7, identity: 0.781

gccgtcgacggcctgaccgacgacgag-ggcgc	CRISPR spacer
gggctcaacggcatgaccgacgacgagctgcg-	Protospacer
*   **.***** **************  ***

227. spacer 2.1|613107|32|NC_016109|CRT matches to GU247134 (Mycobacterium phage Scoot17C, complete genome) position: , mismatch: 7, identity: 0.781

gccgtcgacggcctgaccgacgacgag-ggcgc	CRISPR spacer
gggctcaacggcatgaccgacgacgagctgcg-	Protospacer
*   **.***** **************  ***

228. spacer 2.1|613107|32|NC_016109|CRT matches to JN006063 (Mycobacterium phage Serendipity, complete genome) position: , mismatch: 7, identity: 0.781

gccgtcgacggcctgaccgacgacgag-ggcgc	CRISPR spacer
gggctcaacggcatgaccgacgacgagctgcg-	Protospacer
*   **.***** **************  ***

229. spacer 2.1|613107|32|NC_016109|CRT matches to MH230875 (Mycobacterium phage CheetO, complete genome) position: , mismatch: 7, identity: 0.781

gccgtcgacggcctgaccgacgacgag-ggcgc	CRISPR spacer
gggctcaacggcatgaccgacgacgagctgcg-	Protospacer
*   **.***** **************  ***

230. spacer 2.1|613107|32|NC_016109|CRT matches to MG962365 (Mycobacterium phage DoesntMatter, complete genome) position: , mismatch: 7, identity: 0.781

gccgtcgacggcctgaccgacgacgag-ggcgc	CRISPR spacer
gggctcaacggcatgaccgacgacgagctgcg-	Protospacer
*   **.***** **************  ***

231. spacer 2.1|613107|32|NC_016109|CRT matches to MK524512 (Mycobacterium phage Carthage, complete genome) position: , mismatch: 7, identity: 0.781

gccgtcgacggcctgaccgacgacgag-ggcgc	CRISPR spacer
gagctcaacggcatgaccgacgacgagctgcg-	Protospacer
*   **.***** **************  ***

232. spacer 2.1|613107|32|NC_016109|CRT matches to MN945899 (Mycobacterium phage Skippy, complete genome) position: , mismatch: 7, identity: 0.781

gccgtcgacggcctgaccgacgacgag-ggcgc	CRISPR spacer
gggctcaacggcatgaccgacgacgagctgcg-	Protospacer
*   **.***** **************  ***

233. spacer 2.1|613107|32|NC_016109|CRT matches to MK279908 (Mycobacterium phage Roliet, complete genome) position: , mismatch: 7, identity: 0.781

gccgtcgacggcctgaccgacgacgag-ggcgc	CRISPR spacer
gagctcaacggcatgaccgacgacgagctgcg-	Protospacer
*   **.***** **************  ***

234. spacer 2.1|613107|32|NC_016109|CRT matches to MT897909 (Mycobacterium phage Maru, complete genome) position: , mismatch: 7, identity: 0.781

gccgtcgacggcctgaccgacgacgag-ggcgc	CRISPR spacer
gagctcaacggcatgaccgacgacgagctgcg-	Protospacer
*   **.***** **************  ***

235. spacer 2.1|613107|32|NC_016109|CRT matches to KY006474 (Mycobacterium phage Prann, complete genome) position: , mismatch: 7, identity: 0.781

gccgtcgacggcctgaccgacgacgag-ggcgc	CRISPR spacer
gagctcaacggcatgaccgacgacgagctgcg-	Protospacer
*   **.***** **************  ***

236. spacer 2.1|613107|32|NC_016109|CRT matches to MG962370 (Mycobacterium phage Kykar, complete genome) position: , mismatch: 7, identity: 0.781

gccgtcgacggcctgaccgacgacgagggcgc	CRISPR spacer
accttctcgggcctgaccgacggcgaaggcgc	Protospacer
.** **   *************.***.*****

237. spacer 2.1|613107|32|NC_016109|CRT matches to JN698990 (Mycobacterium phage IsaacEli, complete genome) position: , mismatch: 7, identity: 0.781

gccgtcgacggcctgaccgacgacgag-ggcgc	CRISPR spacer
gggctcaacggcatgaccgacgacgagctgcg-	Protospacer
*   **.***** **************  ***

238. spacer 2.1|613107|32|NC_016109|CRT matches to KY965066 (Mycobacterium phage BlackStallion, complete genome) position: , mismatch: 7, identity: 0.781

gccgtcgacggcctgaccgacgacgag-ggcgc	CRISPR spacer
gagctcaacggcatgaccgacgacgagctgcg-	Protospacer
*   **.***** **************  ***

239. spacer 2.1|613107|32|NC_016109|CRT matches to MN703415 (Mycobacterium phage Mcshane, complete genome) position: , mismatch: 7, identity: 0.781

gccgtcgacggcctgaccgacgacgag-ggcgc	CRISPR spacer
gggctcaacggcatgaccgacgacgagctgcg-	Protospacer
*   **.***** **************  ***

240. spacer 2.1|613107|32|NC_016109|CRT matches to NC_028942 (Mycobacterium phage Phipps, complete sequence) position: , mismatch: 7, identity: 0.781

gccgtcgacggcctgaccgacgacgag-ggcgc	CRISPR spacer
gggctcaacggcatgaccgacgacgagctgcg-	Protospacer
*   **.***** **************  ***

241. spacer 2.1|613107|32|NC_016109|CRT matches to KJ567044 (Mycobacterium phage EmpTee, complete genome) position: , mismatch: 7, identity: 0.781

gccgtcgacggcctgaccgacgacgag-ggcgc	CRISPR spacer
gggctcaacggcatgaccgacgacgagctgcg-	Protospacer
*   **.***** **************  ***

242. spacer 2.1|613107|32|NC_016109|CRT matches to MK279855 (Mycobacterium phage Haleema, complete genome) position: , mismatch: 7, identity: 0.781

gccgtcgacggcctgaccgacgacgag-ggcgc	CRISPR spacer
gggctcaacggcatgaccgacgacgagctgcg-	Protospacer
*   **.***** **************  ***

243. spacer 2.1|613107|32|NC_016109|CRT matches to JX649096 (Mycobacterium phage Serpentine, complete genome) position: , mismatch: 7, identity: 0.781

gccgtcgacggcctgaccgacgacgag-ggcgc	CRISPR spacer
gggctcaacggcatgaccgacgacgagctgcg-	Protospacer
*   **.***** **************  ***

244. spacer 2.1|613107|32|NC_016109|CRT matches to MG944225 (Mycobacterium phage Xavier, complete genome) position: , mismatch: 7, identity: 0.781

gccgtcgacggcctgaccgacgacgag-ggcgc	CRISPR spacer
gggctcaacggcatgaccgacgacgagctgcg-	Protospacer
*   **.***** **************  ***

245. spacer 2.4|613290|32|NC_016109|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 7, identity: 0.781

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
cgcgctggacgcggtgcacgccgccttcgaac	Protospacer
**  *************.****** ****

246. spacer 2.4|613290|32|NC_016109|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 7, identity: 0.781

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
cgacctggacgaggtgcccgccgaggtgctcg	Protospacer
*********** ***** ***** * *  .**

247. spacer 2.4|613290|32|NC_016109|CRT matches to NZ_CP022775 (Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
ggcgatgcccgcggtgcgcgccgcgctcgccg	Protospacer
 *   **  ****************.******

248. spacer 2.4|613290|32|NC_016109|CRT matches to NC_014310 (Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence) position: , mismatch: 7, identity: 0.781

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
ggcgatgcccgcggtgcgcgccgcgctcgccg	Protospacer
 *   **  ****************.******

249. spacer 2.4|613290|32|NC_016109|CRT matches to NZ_CP029835 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed5, complete sequence) position: , mismatch: 7, identity: 0.781

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
caagggcgacgcggtgcgcgccggattcgccg	Protospacer
*.*    **************** .*******

250. spacer 2.4|613290|32|NC_016109|CRT matches to NZ_CP022760 (Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
ggcgatgcccgcggtgcgcgccgcgctcgccg	Protospacer
 *   **  ****************.******

251. spacer 2.4|613290|32|NC_016109|CRT matches to NZ_CP022789 (Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
ggcgatgcccgcggtgcgcgccgcgctcgccg	Protospacer
 *   **  ****************.******

252. spacer 2.4|613290|32|NC_016109|CRT matches to NZ_CP054615 (Azospirillum oryzae strain KACC 14407 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
caagggcgacgcggtgcgcgccggcttcgccg	Protospacer
*.*    ****************  *******

253. spacer 2.4|613290|32|NC_016109|CRT matches to NZ_CP022764 (Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
ggcgatgcccgcggtgcgcgccgcgctcgccg	Protospacer
 *   **  ****************.******

254. spacer 2.4|613290|32|NC_016109|CRT matches to NZ_CP021083 (Deinococcus ficus strain CC-FR2-10 plasmid pDFI2, complete sequence) position: , mismatch: 7, identity: 0.781

cgacctggacgcggtgcgcgccgcgttcgccg----	CRISPR spacer
gaacctggacgcggtgcgagcc----tcgccgctgt	Protospacer
 .**************** ***    ******

255. spacer 2.4|613290|32|NC_016109|CRT matches to NZ_CP022797 (Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
ggcgatgcccgcggtgcgcgccgcgctcgccg	Protospacer
 *   **  ****************.******

256. spacer 2.4|613290|32|NC_016109|CRT matches to NZ_CP022758 (Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
ggcgatgcccgcggtgcgcgccgcgctcgccg	Protospacer
 *   **  ****************.******

257. spacer 2.4|613290|32|NC_016109|CRT matches to NZ_CP029359 (Azospirillum sp. CFH 70021 plasmid unnamed4) position: , mismatch: 7, identity: 0.781

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
caagggcgacgcggtgcgcgccggcttcgccg	Protospacer
*.*    ****************  *******

258. spacer 2.4|613290|32|NC_016109|CRT matches to LN997843 (Streptomyces reticuli genome assembly TUE45, plasmid : II) position: , mismatch: 7, identity: 0.781

--cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
gctggc--ggacgcggtgcgcgccgcggtcgggg	Protospacer
  .*.*  ******************* ***  *

259. spacer 2.4|613290|32|NC_016109|CRT matches to NC_016588 (Azospirillum lipoferum 4B plasmid AZO_p6, complete sequence) position: , mismatch: 7, identity: 0.781

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
caagggcgacgcggtgcgcgccggcttcgccg	Protospacer
*.*    ****************  *******

260. spacer 2.4|613290|32|NC_016109|CRT matches to KY092483 (Streptomyces phage Bioscum, complete genome) position: , mismatch: 7, identity: 0.781

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
caagaccgacgcgacgcgcgccgcgttcgccg	Protospacer
*.*  . ******..*****************

261. spacer 2.4|613290|32|NC_016109|CRT matches to NC_047792 (Streptomyces phage Ididsumtinwong, complete genome) position: , mismatch: 7, identity: 0.781

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
caagaccgacgcgacgcgcgccgcgttcgccg	Protospacer
*.*  . ******..*****************

262. spacer 2.4|613290|32|NC_016109|CRT matches to KY092481 (Streptomyces phage PapayaSalad, complete genome) position: , mismatch: 7, identity: 0.781

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
caagaccgacgcgacgcgcgccgcgttcgccg	Protospacer
*.*  . ******..*****************

263. spacer 2.4|613290|32|NC_016109|CRT matches to NZ_CP007129 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.781

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
caccctccccgcgctgcgcgccgcgctcgccg	Protospacer
*. ***   **** ***********.******

264. spacer 2.4|613290|32|NC_016109|CRT matches to NZ_CP007129 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.781

-cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
ccgggccag-cgcgtcgcgcgccgcgttcgccg	Protospacer
 **. *..* **** .*****************

265. spacer 2.4|613290|32|NC_016109|CRT matches to NZ_CP023549 (Rhodobacter sp. CZR27 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

--cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
cctgacc--gacgcgatgcgcgccgcgctcgcga	Protospacer
  .****  ******.***********.**** .

266. spacer 2.4|613290|32|NC_016109|CRT matches to NC_011758 (Methylorubrum extorquens CM4 plasmid pCMU01, complete sequence) position: , mismatch: 7, identity: 0.781

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
cgaccttgacgctgtgcgcgccgccctgacgg	Protospacer
****** ***** *********** .* .* *

267. spacer 2.4|613290|32|NC_016109|CRT matches to NZ_CP041158 (Leisingera aquaemixtae strain R2C4 plasmid unnamed4, complete sequence) position: , mismatch: 7, identity: 0.781

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
ctaccgggacgcggtgcgcgctgcgctgcgcg	Protospacer
* *** ***************.***.*   **

268. spacer 2.4|613290|32|NC_016109|CRT matches to NC_021278 (Mycobacteroides abscessus subsp. bolletii 50594 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.781

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
cgacccggacgcggtccgcgccggggccgacc	Protospacer
*****.********* ******* * .** *

269. spacer 2.4|613290|32|NC_016109|CRT matches to NC_005887 (Burkholderia phage BcepC6B, complete genome) position: , mismatch: 7, identity: 0.781

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
cgtgcggtgcgcgctgcgcgccgcgctcgccg	Protospacer
**  * * .**** ***********.******

270. spacer 2.6|613412|32|NC_016109|CRT matches to NC_018022 (Mycolicibacterium chubuense NBB4 plasmid pMYCCH.01, complete sequence) position: , mismatch: 7, identity: 0.781

ctggtgtcgatcaggtcggcagcctcgccgag	CRISPR spacer
gcccggtcgatcaggtcggcagtctcgcggag	Protospacer
 .   *****************.***** ***

271. spacer 2.6|613412|32|NC_016109|CRT matches to NC_018022 (Mycolicibacterium chubuense NBB4 plasmid pMYCCH.01, complete sequence) position: , mismatch: 7, identity: 0.781

ctggtgtcgatcaggtcggcagcctcgccgag	CRISPR spacer
gcccggtcgatcaggtcggcagtctcgcggag	Protospacer
 .   *****************.***** ***

272. spacer 2.6|613412|32|NC_016109|CRT matches to NZ_CP054621 (Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence) position: , mismatch: 7, identity: 0.781

--ctggtgtcgatcaggtcggcagcctcgccgag	CRISPR spacer
agccg--gtcgagcaggtcggcggcctcgccgga	Protospacer
  *.*  ***** *********.*********..

273. spacer 2.6|613412|32|NC_016109|CRT matches to NZ_CP015008 (Aminobacter aminovorans strain KCTC 2477 plasmid pAA03, complete sequence) position: , mismatch: 7, identity: 0.781

ctggtgtcgatcaggtcggcagcctcgccgag	CRISPR spacer
atcgagacgatcaggtcgaccgcctcgccgat	Protospacer
 * * * ***********.* **********

274. spacer 2.6|613412|32|NC_016109|CRT matches to MH727593 (Acidovorax phage ACPWH, complete genome) position: , mismatch: 7, identity: 0.781

ctggtgtcgatcaggtcggcagcctcgccgag	CRISPR spacer
atcttgtcgttcaggtcggcggcctcgcgcag	Protospacer
 *  ***** **********.*******  **

275. spacer 2.6|613412|32|NC_016109|CRT matches to NZ_CP026518 (Deinococcus sp. NW-56 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.781

ctggtgtcg----atcaggtcggcagcctcgccgag	CRISPR spacer
----agtcggggaatcaggtcggcagcgttgccgag	Protospacer
     ****    ************** *.******

276. spacer 2.8|613534|32|NC_016109|CRT matches to NZ_LR134459 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 17, complete sequence) position: , mismatch: 7, identity: 0.781

ggcgtcggtggcgaggagttcggtgggggtga	CRISPR spacer
gccgtcggtggcgaggagctcggtgaccttgg	Protospacer
* ****************.******.   **.

277. spacer 2.8|613534|32|NC_016109|CRT matches to NZ_CP016313 (Thermus brockianus strain GE-1 plasmid pTB1, complete sequence) position: , mismatch: 7, identity: 0.781

ggcgtcggtggcgaggagttcggtgggggtga	CRISPR spacer
gtaggcggtggcgaggaggtaggtggggagga	Protospacer
*  * ************* * *******. **

278. spacer 2.9|613595|32|NC_016109|CRT matches to NZ_CP024936 (Paraburkholderia graminis strain PHS1 plasmid pPHS1_P, complete sequence) position: , mismatch: 7, identity: 0.781

tcggcgagggtgtgctgggcgtcggcgtaggc	CRISPR spacer
tcggcgtgggtgtgctggccgtcggcatttcg	Protospacer
****** *********** *******.*

279. spacer 2.9|613595|32|NC_016109|CRT matches to NC_015952 (Streptomyces violaceusniger Tu 4113 plasmid pSTRVI02, complete sequence) position: , mismatch: 7, identity: 0.781

tcggcgagggtgtgctgggcgtcggcgtaggc	CRISPR spacer
tcggcgagggtgtgcagcgcgtccacgatgtc	Protospacer
*************** * ***** .**  * *

280. spacer 2.11|613717|32|NC_016109|CRT matches to NC_002679 (Mesorhizobium japonicum MAFF 303099 plasmid pMLa, complete sequence) position: , mismatch: 7, identity: 0.781

cccactagagcgagcacgacttcgcggtcccg	CRISPR spacer
gccgcgatggcgagctcgacttcgctgtcccg	Protospacer
 **.* * .****** ********* ******

281. spacer 2.13|613107|33|NC_016109|CRISPRCasFinder matches to NC_010905 (Amycolatopsis benzoatilytica strain DSM 43387 plasmid pA387, complete sequence) position: , mismatch: 7, identity: 0.788

gccgtcgacggcctgaccgacgacgagggcgcg	CRISPR spacer
atcatggacgccctgaccgacgacgaggccgcc	Protospacer
..*.* **** ***************** ***

282. spacer 2.13|613107|33|NC_016109|CRISPRCasFinder matches to MT451980 (Streptomyces phage Ignacio, complete genome) position: , mismatch: 7, identity: 0.788

gccgtcgacggcctgaccgacgacgagggcgcg	CRISPR spacer
ctcggcctcggcctgaccgacgacgggggcgcc	Protospacer
 .** *  *****************.******

283. spacer 2.13|613107|33|NC_016109|CRISPRCasFinder matches to NC_005262 (Burkholderia cepacia phage Bcep22, complete genome) position: , mismatch: 7, identity: 0.788

gccgtcgacggcctgaccgacgacgagggcgcg	CRISPR spacer
gatttggccggcctgaccgacgaggagcgcgcg	Protospacer
* . * * *************** *** *****

284. spacer 2.16|613290|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 7, identity: 0.788

cgacctggacgcggtgcgcgccgcgttcgccgc	CRISPR spacer
ggtcgtcgacgcggtgctcgccgggttcgccga	Protospacer
 * * * ********** ***** ********

285. spacer 2.16|613290|33|NC_016109|CRISPRCasFinder,PILER-CR matches to MN813682 (Microbacterium phage Matzah, complete genome) position: , mismatch: 7, identity: 0.788

cgacctggacgcggtgcgcgccgcgttcgccgc	CRISPR spacer
agacctggaggcggtgcgcgccgtgttccgcaa	Protospacer
 ******** *************.****  *.

286. spacer 2.16|613290|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 7, identity: 0.788

cgacctggacgcggtgcgcgccgcgttcgccgc	CRISPR spacer
cgggttcgacgcggtgcacgccgggttcgccgt	Protospacer
**. .* **********.***** ********.

287. spacer 2.16|613290|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NZ_CP029359 (Azospirillum sp. CFH 70021 plasmid unnamed4) position: , mismatch: 7, identity: 0.788

cgacctggacgcggtgcgcgccgcgttcgccgc	CRISPR spacer
caagggcgacgcggtgcgcgccggcttcgccgc	Protospacer
*.*    ****************  ********

288. spacer 2.16|613290|33|NC_016109|CRISPRCasFinder,PILER-CR matches to KY092483 (Streptomyces phage Bioscum, complete genome) position: , mismatch: 7, identity: 0.788

cgacctggacgcggtgcgcgccgcgttcgccgc	CRISPR spacer
caagaccgacgcgacgcgcgccgcgttcgccgc	Protospacer
*.*  . ******..******************

289. spacer 2.16|613290|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NC_047792 (Streptomyces phage Ididsumtinwong, complete genome) position: , mismatch: 7, identity: 0.788

cgacctggacgcggtgcgcgccgcgttcgccgc	CRISPR spacer
caagaccgacgcgacgcgcgccgcgttcgccgc	Protospacer
*.*  . ******..******************

290. spacer 2.16|613290|33|NC_016109|CRISPRCasFinder,PILER-CR matches to KY092481 (Streptomyces phage PapayaSalad, complete genome) position: , mismatch: 7, identity: 0.788

cgacctggacgcggtgcgcgccgcgttcgccgc	CRISPR spacer
caagaccgacgcgacgcgcgccgcgttcgccgc	Protospacer
*.*  . ******..******************

291. spacer 2.16|613290|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NZ_CP029209 (Nitratireductor sp. OM-1 plasmid pOM-1, complete sequence) position: , mismatch: 7, identity: 0.788

cgacctggacgcggtgcgcgccgcgttcgccgc	CRISPR spacer
cgacccggacgtggtgcgcgccgcgcaggccag	Protospacer
*****.*****.*************.  ***.

292. spacer 2.16|613290|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NZ_CP030074 (Streptomyces sp. ZFG47 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.788

cgacctggacgcggtgcgcgccgcgttcgccgc	CRISPR spacer
cgacctggacgcggtccgcgcggcggtgtcctt	Protospacer
*************** ***** *** *  ** .

293. spacer 2.16|613290|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NZ_CP016617 (Microvirga ossetica strain V5/3m plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.788

cgacctggacgcggtgcgcgccgcgttcgccgc	CRISPR spacer
cggcgaagaggcggtgcgcgccgcgttccccga	Protospacer
**.*  .** ****************** ***

294. spacer 2.16|613290|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NZ_CP016617 (Microvirga ossetica strain V5/3m plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.788

cgacctggacgcggtgcgcgccgcgttcgccgc	CRISPR spacer
cggcgaagaggcggtgcgcgccgcgttccccga	Protospacer
**.*  .** ****************** ***

295. spacer 2.16|613290|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NZ_CP007129 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.788

cgacctggacgcggtgcgcgccgcgttcgccgc	CRISPR spacer
caccctccccgcgctgcgcgccgcgctcgccgc	Protospacer
*. ***   **** ***********.*******

296. spacer 2.16|613290|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NC_011758 (Methylorubrum extorquens CM4 plasmid pCMU01, complete sequence) position: , mismatch: 7, identity: 0.788

cgacctggacgcggtgcgcgccgcgttcgccgc	CRISPR spacer
cgaccttgacgctgtgcgcgccgccctgacggc	Protospacer
****** ***** *********** .* .* **

297. spacer 2.16|613290|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NC_005887 (Burkholderia phage BcepC6B, complete genome) position: , mismatch: 7, identity: 0.788

cgacctggacgcggtgcgcgccgcgttcgccgc	CRISPR spacer
cgtgcggtgcgcgctgcgcgccgcgctcgccgc	Protospacer
**  * * .**** ***********.*******

298. spacer 2.16|613290|33|NC_016109|CRISPRCasFinder,PILER-CR matches to AY605181 (Burkholderia cepacia complex phage BcepC6B, complete genome) position: , mismatch: 7, identity: 0.788

cgacctggacgcggtgcgcgccgcgttcgccgc	CRISPR spacer
cgtgcggtgcgcgctgcgcgccgcgctcgccgc	Protospacer
**  * * .**** ***********.*******

299. spacer 2.18|613412|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NZ_CP026518 (Deinococcus sp. NW-56 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.788

ctggtgtcg----atcaggtcggcagcctcgccgagg	CRISPR spacer
----agtcggggaatcaggtcggcagcgttgccgagg	Protospacer
     ****    ************** *.*******

300. spacer 2.20|613534|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NZ_CP020568 (Kitasatospora aureofaciens strain DM-1 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.788

ggcgtcggtggcgaggagttcggtgggggtgag	CRISPR spacer
ggcgccgatggcgaggagttcggtccggaggac	Protospacer
****.**.****************  **. **

301. spacer 2.21|613595|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NZ_CP024936 (Paraburkholderia graminis strain PHS1 plasmid pPHS1_P, complete sequence) position: , mismatch: 7, identity: 0.788

tcggcgagggtgtgctgggcgtcggcgtaggcg	CRISPR spacer
tcggcgtgggtgtgctggccgtcggcatttcgg	Protospacer
****** *********** *******.*    *

302. spacer 2.23|613717|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NC_002679 (Mesorhizobium japonicum MAFF 303099 plasmid pMLa, complete sequence) position: , mismatch: 7, identity: 0.788

cccactagagcgagcacgacttcgcggtcccgg	CRISPR spacer
gccgcgatggcgagctcgacttcgctgtcccgg	Protospacer
 **.* * .****** ********* *******

303. spacer 3.3|623680|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP046906 (Streptomyces sp. QHH-9511 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.788

cggtcgtggtgccggagacggtgatgctggggg	CRISPR spacer
cggtcgtggtgccggaggcggtgaccttcagcg	Protospacer
*****************.******. .* .* *

304. spacer 3.3|623680|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP042263 (Litoreibacter sp. LN3S51 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.788

cggtcgtggtgccggagacggtgatgctggggg	CRISPR spacer
cggtcatggtgccggagacgttgatcacgggcc	Protospacer
*****.************** ****  .***

305. spacer 3.3|623680|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 7, identity: 0.788

cggtcgtggtgccggagacggtgatgctggggg	CRISPR spacer
tggtggtggtgccggagacggtgttgagggcga	Protospacer
.*** ****************** **  ** *.

306. spacer 3.3|623680|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 7, identity: 0.788

cggtcgtggtgccggagacggtgatgctggggg	CRISPR spacer
tggtggtggtgccggagacggtgttgagggcga	Protospacer
.*** ****************** **  ** *.

307. spacer 3.3|623680|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP019938 (Ketogulonicigenium robustum strain SPU_B003 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.788

cggtcgtggtgccggagacggtgatgctggggg-----	CRISPR spacer
cggtcgtggtgccgggggcggtga-----ggggctttg	Protospacer
***************.*.******     ****

308. spacer 3.4|623741|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NC_013856 (Azospirillum sp. B510 plasmid pAB510b, complete sequence) position: , mismatch: 7, identity: 0.788

ccagcaggcggccggagccgagcgcgacgccta	CRISPR spacer
gctgtcggcgtccggggccgagcgcgacgcctg	Protospacer
 * *. **** ****.****************.

309. spacer 3.4|623741|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_AP014579 (Burkholderia sp. RPE67 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.788

ccagcaggcggccggagccgagcgcgacgccta	CRISPR spacer
gcacgaggcggccccagccgagcgcgacgccct	Protospacer
 **  ********  ****************.

310. spacer 3.4|623741|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NC_016626 (Burkholderia sp. YI23 plasmid byi_1p, complete sequence) position: , mismatch: 7, identity: 0.788

ccagcaggcggccggagccgagcgcgacgccta	CRISPR spacer
gcacgaggcggccccagccgagcgcgacgccct	Protospacer
 **  ********  ****************.

311. spacer 3.4|623741|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NC_016587 (Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence) position: , mismatch: 7, identity: 0.788

ccagca-ggcggccggagccgagcgcgacgccta	CRISPR spacer
-aggcgcggcggacgaagccgagcgcgacgcctt	Protospacer
  .**. ***** **.*****************

312. spacer 3.4|623741|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_LR134453 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 11, complete sequence) position: , mismatch: 7, identity: 0.788

--ccagcaggcggccggagccgagcgcgacgccta	CRISPR spacer
agccggt--gcggccggagccgggcgcgatgccca	Protospacer
  **.*.  *************.******.***.*

313. spacer 3.8|623985|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP054032 (Rhizobium sp. JKLM13E plasmid pPR13E01, complete sequence) position: , mismatch: 7, identity: 0.788

gaccgacatggcccgtgagttcgcagtccggca	CRISPR spacer
gcgcgacctggcccgtgagttcgaagtcacgcg	Protospacer
*  **** *************** ****  **.

314. spacer 3.11|624168|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP031166 (Euzebya sp. DY32-46 plasmid pEDY32-46I, complete sequence) position: , mismatch: 7, identity: 0.788

ccgggacagcggcggccggggctgcgggctgct	CRISPR spacer
ccgggacggcggcggccggggccgcgccgagca	Protospacer
*******.**************.***    **

315. spacer 3.11|624168|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP034352 (Streptomyces sp. W1SF4 plasmid p2, complete sequence) position: , mismatch: 7, identity: 0.788

ccgggacagcggcggccggggctgcgggctgct	CRISPR spacer
cggcgagggcggcggccgggacggcgggctgcg	Protospacer
* * ** .************.* *********

316. spacer 3.14|624351|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP030772 (Streptomyces sp. YIM 121038 plasmid pSSP121038, complete sequence) position: , mismatch: 7, identity: 0.788

gccgaagccgcgctcatcgccgcccaccgcctc	CRISPR spacer
gagggcgccgcgctcatcgcggccctccgcccc	Protospacer
*  *. ************** **** *****.*

317. spacer 3.14|624351|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032685 (Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence) position: , mismatch: 7, identity: 0.788

gccgaagccgcgctcatcgccgcccaccgcctc	CRISPR spacer
gccgcagccgcgctcctcgccgcctctcccgtc	Protospacer
**** ********** ********. .* * **

318. spacer 3.14|624351|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NC_015951 (Streptomyces violaceusniger Tu 4113 plasmid pSTRVI01, complete sequence) position: , mismatch: 7, identity: 0.788

gccgaagccgcgctcatcgccgcccaccgcctc	CRISPR spacer
gcggtggccgcgctgatcgccgcccgccgcgac	Protospacer
** * .******** **********.****  *

319. spacer 3.14|624351|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032690 (Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence) position: , mismatch: 7, identity: 0.788

gccgaagccgcgctcatcgccgcccaccgcctc	CRISPR spacer
gccgcagccgcgctcctcgccgcctctcccgtc	Protospacer
**** ********** ********. .* * **

320. spacer 3.14|624351|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP040819 (Paraoceanicella profunda strain D4M1 plasmid pD4M1A, complete sequence) position: , mismatch: 7, identity: 0.788

gccgaagccgcgctcatcgccgcccaccgcctc-	CRISPR spacer
tccgaagcggcgctcttcgccgcccg-cgcggca	Protospacer
 ******* ****** *********. ***  *

321. spacer 3.16|624473|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_HG813238 (Erwinia amylovora strain 692 plasmid pEA68, complete sequence) position: , mismatch: 7, identity: 0.788

ccgggagccgcggcaggagatggtcag---ccgggc	CRISPR spacer
gccggaggcgcggcaggagacggtcaggccccg---	Protospacer
 * **** ************.******   ***

322. spacer 3.19|624656|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_HG813238 (Erwinia amylovora strain 692 plasmid pEA68, complete sequence) position: , mismatch: 7, identity: 0.788

ccgggagccgcggcaggagatggtcag---ccgggc	CRISPR spacer
gccggaggcgcggcaggagacggtcaggccccg---	Protospacer
 * **** ************.******   ***

323. spacer 3.21|624778|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_LN832562 (Paracoccus aminovorans isolate JCM7685 plasmid IV, complete sequence) position: , mismatch: 7, identity: 0.788

ccggcccggggcgcccgccgccggggcggagag	CRISPR spacer
ctcgcccgtggcgcccgccgccggggtggcggc	Protospacer
*. ***** *****************.** *.

324. spacer 3.21|624778|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP026517 (Deinococcus sp. NW-56 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.788

ccggcccggggcgcccgccgccggggcggagag	CRISPR spacer
cgtcaccgggtcgcccgccgccggggcggtcag	Protospacer
*    ***** ******************  **

325. spacer 3.21|624778|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032322 (Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.788

ccggcccggggcgcccgccgccggggcggagag	CRISPR spacer
ccctgccgggccgcccgccgacggggcggggcg	Protospacer
**   ***** ********* ********.* *

326. spacer 3.21|624778|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP007794 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence) position: , mismatch: 7, identity: 0.788

ccggcccggggcgcccgccgccggggcggagag	CRISPR spacer
ccctgccgggccgcccgccgacggggcggggcg	Protospacer
**   ***** ********* ********.* *

327. spacer 3.21|624778|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP007794 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence) position: , mismatch: 7, identity: 0.788

ccggcccg-gggcgcccgccgccggggcggagag	CRISPR spacer
-catcgcgcgggcgctcgccgccggggcgaagat	Protospacer
 *. * ** ******.*************.***

328. spacer 3.21|624778|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP044079 (Paracoccus yeei strain FDAARGOS_643 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.788

ccggc--ccggggcgcccgccgccggggcggagag	CRISPR spacer
--ggcaagcgcggcgcccgccgccgaggcggaaac	Protospacer
  ***   ** **************.******.*

329. spacer 3.21|624778|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP031079 (Paracoccus yeei strain CCUG 32053 plasmid pYEE1, complete sequence) position: , mismatch: 7, identity: 0.788

ccggc--ccggggcgcccgccgccggggcggagag	CRISPR spacer
--ggcaagcgcggcgcccgccgccgaggcggaaac	Protospacer
  ***   ** **************.******.*

330. spacer 3.27|625144|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP021405 (Celeribacter manganoxidans strain DY25 plasmid pDY25-A, complete sequence) position: , mismatch: 7, identity: 0.788

ccgctggaccgggctcaccggcgcgcgccccgg	CRISPR spacer
cgtcggggccgcgctcaccggcgcgcgcccggt	Protospacer
*  * **.*** ****************** *

331. spacer 3.27|625144|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to KU160644 (Arthrobacter phage Galaxy, complete genome) position: , mismatch: 7, identity: 0.788

ccgctg-gaccgggctcaccggcgcgcgccccgg	CRISPR spacer
-cattgcggccgggctgaccggcgcgggccccga	Protospacer
 *..** *.******* ********* ******.

332. spacer 3.30|625327|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP015007 (Aminobacter aminovorans strain KCTC 2477 plasmid pAA02, complete sequence) position: , mismatch: 7, identity: 0.788

cccatccccgacggccgcgcgctgttcctggcc	CRISPR spacer
cgcacggccgacggcggcacgctgttcctggac	Protospacer
* **.  ******** **.************ *

333. spacer 3.31|625388|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP015203 (Rhodococcus sp. 008 plasmid pR8L1, complete sequence) position: , mismatch: 7, identity: 0.788

gatcggcctcggcgggatcggcgacac--cctgaa	CRISPR spacer
gcgcgacctcggcgggatcggcggcacgacccg--	Protospacer
*  **.*****************.***  **.*

334. spacer 3.31|625388|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_LR594673 (Variovorax sp. PBL-E5 plasmid 3) position: , mismatch: 7, identity: 0.788

gatcggcctcggcgggatcggcgacaccctgaa	CRISPR spacer
gatcggcctcggcggcatcagcgaggtgcagaa	Protospacer
*************** ***.**** .. * ***

335. spacer 3.32|625449|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NC_014310 (Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence) position: , mismatch: 7, identity: 0.788

agcgggcccgccccatccatccggtggaccgca	CRISPR spacer
ggcggtctcgccccatccatccggtggcgggaa	Protospacer
.**** *.*******************   * *

336. spacer 3.32|625449|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022760 (Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.788

agcgggcccgccccatccatccggtggaccgca	CRISPR spacer
ggcggtctcgccccatccatccggtggcgggaa	Protospacer
.**** *.*******************   * *

337. spacer 3.32|625449|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022789 (Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.788

agcgggcccgccccatccatccggtggaccgca	CRISPR spacer
ggcggtctcgccccatccatccggtggcgggaa	Protospacer
.**** *.*******************   * *

338. spacer 3.33|625510|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP035709 (Sphaerotilus natans subsp. sulfidivorans strain D-507 plasmid pSna507_unt12, complete sequence) position: , mismatch: 7, identity: 0.788

cgatgagggcctggcgctcagccgggctacggg	CRISPR spacer
ccatgagggcctggcgctctgccggggtcttcg	Protospacer
* ***************** ****** * .  *

339. spacer 3.36|625693|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP028969 (Aminobacter sp. MSH1 plasmid pUSP1, complete sequence) position: , mismatch: 7, identity: 0.788

caccg-acttgacgaggtcggtctcgttgacgtc	CRISPR spacer
-gccgtcctcgacgaggtcggtctcgttggcggt	Protospacer
 .***  **.*******************.** .

340. spacer 3.36|625693|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP026266 (Aminobacter sp. MSH1 plasmid pAM01, complete sequence) position: , mismatch: 7, identity: 0.788

caccg-acttgacgaggtcggtctcgttgacgtc	CRISPR spacer
-gccgtcctcgacgaggtcggtctcgttggcggt	Protospacer
 .***  **.*******************.** .

341. spacer 3.36|625693|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NC_017575 (Ralstonia solanacearum Po82 megaplasmid, complete sequence) position: , mismatch: 7, identity: 0.788

caccg-acttgacgaggtcggtctcgttgacgtc	CRISPR spacer
-gccgcggttgaccaggtcggtcgcgttgacggc	Protospacer
 .*** . ***** ********* ******** *

342. spacer 3.36|625693|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP026308 (Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.788

caccg-acttgacgaggtcggtctcgttgacgtc	CRISPR spacer
-gccgcggttgaccaggtcggtcgcgttgacggc	Protospacer
 .*** . ***** ********* ******** *

343. spacer 3.36|625693|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP012940 (Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.788

caccg-acttgacgaggtcggtctcgttgacgtc	CRISPR spacer
-gccgcggttgaccaggtcggtcgcgttgacggc	Protospacer
 .*** . ***** ********* ******** *

344. spacer 3.36|625693|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP012944 (Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.788

caccg-acttgacgaggtcggtctcgttgacgtc	CRISPR spacer
-gccgcggttgaccaggtcggtcgcgttgacggc	Protospacer
 .*** . ***** ********* ******** *

345. spacer 3.36|625693|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP051295 (Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence) position: , mismatch: 7, identity: 0.788

caccg-acttgacgaggtcggtctcgttgacgtc	CRISPR spacer
-gccgcggttgaccaggtcggtcgcgttgacggc	Protospacer
 .*** . ***** ********* ******** *

346. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP016083 (Streptomyces sp. SAT1 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.781

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gaacggtgcagcagcagcccggcggcgacggc	Protospacer
.. *  .******************* *****

347. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP007797 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p4, complete sequence) position: , mismatch: 7, identity: 0.781

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
cggccccgcagcagcgccccggcggctccccc	Protospacer
 * ************. ********** *  *

348. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP013744 (Streptomyces sp. CdTB01 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

agcccccg--cagcagcagcccggcggctacggc	CRISPR spacer
--tcttcggccaccagcagcccggcggcttcggc	Protospacer
  .*..**  ** **************** ****

349. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NC_002699 (Frankia sp. CpI1 plasmid pFQ12, complete plasmid sequence) position: , mismatch: 7, identity: 0.781

agcccccgcagcagcagcccggcggctacggc-	CRISPR spacer
agccgccgcaacagcagcccggcga-gatgccc	Protospacer
**** *****.*************.  *.* *

350. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NC_017966 (Tistrella mobilis KA081020-065 plasmid pTM2, complete sequence) position: , mismatch: 7, identity: 0.781

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
tgcttcaccagcagcagcccggcggccgcggc	Protospacer
 **..*  ******************..****

351. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP046573 (Rhodococcus sp. WAY2 plasmid pRWAY01, complete sequence) position: , mismatch: 7, identity: 0.781

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
cggccggccagcagcagcacggcggctccggc	Protospacer
 * **   ********** ******** ****

352. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NC_041927 (Sphingobium phage Lacusarx, complete genome) position: , mismatch: 7, identity: 0.781

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
ggccggtgcagcagcagcacggcggctgcggg	Protospacer
.***  .*********** ********.***

353. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP018464 (Xanthomonas euvesicatoria strain LMG930 plasmid pLMG930.1, complete sequence) position: , mismatch: 7, identity: 0.781

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
atgcccagcagcaccagcccggcggcggctgc	Protospacer
*  *** ****** ************ .* **

354. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP013941 (Cronobacter malonaticus LMG 23826 plasmid pCMA1, complete sequence) position: , mismatch: 7, identity: 0.781

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
tgcgccagcagcagcagcccggcgaaaccggc	Protospacer
 ** ** *****************.   ****

355. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP029357 (Azospirillum sp. CFH 70021 plasmid unnamed2) position: , mismatch: 7, identity: 0.781

agcccccgcagcagcagcccgg-cggctacggc	CRISPR spacer
agcgcccgcagcagcagccgggccatctgccg-	Protospacer
*** *************** ** *. **.* *

356. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NC_023024 (Cronobacter malonaticus plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.781

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
tgcgccagcagcagcagcccggcgaaaccggc	Protospacer
 ** ** *****************.   ****

357. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP012258 (Cronobacter universalis NCTC 9529 plasmid pCUNV1, complete sequence) position: , mismatch: 7, identity: 0.781

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
tgcgccagcagcagcagcccggcgaaaccggc	Protospacer
 ** ** *****************.   ****

358. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP016452 (Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence) position: , mismatch: 7, identity: 0.781

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
agcccccgcaccagcagccaggcatcgaaggg	Protospacer
********** ******** ***. * * **

359. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to LN997843 (Streptomyces reticuli genome assembly TUE45, plasmid : II) position: , mismatch: 7, identity: 0.781

agcccccgc-agcagcagcccggcggctacggc	CRISPR spacer
-gtggcggcgagcagcagtccggcggcgacggc	Protospacer
 *.  * ** ********.******** *****

360. spacer 9.3|7273129|31|NC_016109|CRISPRCasFinder matches to NZ_CP049142 (Pseudomonas nitroreducens strain HBP1 plasmid pPniHBP1_1, complete sequence) position: , mismatch: 7, identity: 0.774

ctgtcgtcagaacgtgcataccgtccaacgg	CRISPR spacer
gtcccgtctgaacgtgcataccgaccatggg	Protospacer
 * .**** ************** ***  **

361. spacer 9.4|7273190|31|NC_016109|CRISPRCasFinder matches to NZ_LR134452 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 10, complete sequence) position: , mismatch: 7, identity: 0.774

ggtcgaacacgccgtcggtctgcgcgcgccg	CRISPR spacer
gctgctccacgccgtcgatctccgcgcgccg	Protospacer
* *    **********.*** *********

362. spacer 9.4|7273190|31|NC_016109|CRISPRCasFinder matches to NC_012520 (Rhodococcus opacus B4 plasmid pROB01, complete sequence) position: , mismatch: 7, identity: 0.774

ggtcgaacacgccgtcggtctgcgcgcgccg-	CRISPR spacer
ctacgaactcgccgtcggtctgcgc-cgcttc	Protospacer
   ***** **************** ***.

363. spacer 9.4|7273190|31|NC_016109|CRISPRCasFinder matches to NZ_CP046573 (Rhodococcus sp. WAY2 plasmid pRWAY01, complete sequence) position: , mismatch: 7, identity: 0.774

ggtcgaacacgccgtcggtctgcgcgcgccg-	CRISPR spacer
ctacgaactcgccgtcggtctgcgc-cgcttc	Protospacer
   ***** **************** ***.

364. spacer 9.4|7273190|31|NC_016109|CRISPRCasFinder matches to NZ_CP016082 (Streptomyces sp. SAT1 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.774

ggtcgaacacgccgtcggtctgcgcgcgccg	CRISPR spacer
tggcgaacacgcggtcggcctgcgcggtcag	Protospacer
 * ********* *****.*******  * *

365. spacer 9.7|7273373|31|NC_016109|CRISPRCasFinder matches to NZ_CP039697 (Novosphingobium sp. ABRDHK2 plasmid pABRDHK22, complete sequence) position: , mismatch: 7, identity: 0.774

tgcagcaggcggtccgcggtgccgggcgcga	CRISPR spacer
tccagcaggcggtgcgcggtgccggcgatca	Protospacer
* *********** ***********  .. *

366. spacer 9.7|7273373|31|NC_016109|CRISPRCasFinder matches to NZ_CP006995 (Methylobacterium sp. AMS5 plasmid pAMS5c, complete sequence) position: , mismatch: 7, identity: 0.774

tgcagcaggcggtccgcggtgccgggcgcga	CRISPR spacer
tgaggttggcggtccgcgatgccgtgcgcgg	Protospacer
** .*. ***********.***** *****.

367. spacer 9.9|7273495|31|NC_016109|CRISPRCasFinder matches to NZ_CP025188 (Roseomonas mucosa strain AD2 plasmid p1-AD2, complete sequence) position: , mismatch: 7, identity: 0.774

tagtgatcacgaggccgagccaggtggtcat	CRISPR spacer
cggggccgacgaggccgagccaggtggtgat	Protospacer
..* * . ******************** **

368. spacer 9.9|7273495|31|NC_016109|CRISPRCasFinder matches to NZ_LT907976 (Pseudodesulfovibrio profundus strain 500-1 plasmid paDPRO, complete sequence) position: , mismatch: 7, identity: 0.774

tagtgatcacgaggccgagccaggtggtcat-	CRISPR spacer
aggcgatcacgaggccgaaccaggt-gtggtg	Protospacer
 .*.**************.****** ** .*

369. spacer 9.13|7273749|31|NC_016109|CRISPRCasFinder matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 7, identity: 0.774

cgacgccgcgggtccggatcaccgcgacgta	CRISPR spacer
tgccgccgcgggtccgggtgaccgcgaactc	Protospacer
.* **************.* *******  *

370. spacer 9.13|7273749|31|NC_016109|CRISPRCasFinder matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 7, identity: 0.774

cgacgccgcgggtccggatcaccgcgacgta	CRISPR spacer
tgccgccgcgggtccgggtgaccgcgaactc	Protospacer
.* **************.* *******  *

371. spacer 9.13|7273749|31|NC_016109|CRISPRCasFinder matches to NZ_CP032322 (Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.774

cgacgccgcgggtccggatcaccgcgacgta	CRISPR spacer
cgtcgccgcgggtcaggatcaccagcacgcc	Protospacer
** *********** ********.  ***.

372. spacer 9.13|7273749|31|NC_016109|CRISPRCasFinder matches to NZ_CP022367 (Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence) position: , mismatch: 7, identity: 0.774

cgacgccgcgggtccggatcaccgcgacgta	CRISPR spacer
cgtcgccgcgggtcaggatcaccagcacgcc	Protospacer
** *********** ********.  ***.

373. spacer 9.13|7273749|31|NC_016109|CRISPRCasFinder matches to NZ_CP007794 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence) position: , mismatch: 7, identity: 0.774

cgacgccgcgggtccggatcaccgcgacgta	CRISPR spacer
cgtcgccgcgggtcaggatcaccagcacgcc	Protospacer
** *********** ********.  ***.

374. spacer 9.13|7273749|31|NC_016109|CRISPRCasFinder matches to NZ_CP032340 (Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.774

cgacgccgcgggtccggatcaccgcgacgta	CRISPR spacer
cgtcgccgcgggtcaggatcaccagcacgcc	Protospacer
** *********** ********.  ***.

375. spacer 9.13|7273749|31|NC_016109|CRISPRCasFinder matches to NZ_CP032346 (Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.774

cgacgccgcgggtccggatcaccgcgacgta	CRISPR spacer
cgtcgccgcgggtcaggatcaccagcacgcc	Protospacer
** *********** ********.  ***.

376. spacer 9.13|7273749|31|NC_016109|CRISPRCasFinder matches to NZ_CP012915 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence) position: , mismatch: 7, identity: 0.774

cgacgccgcgggtccggatcaccgcgacgta	CRISPR spacer
cgtcgccgcgggtcaggatcaccagcacgcc	Protospacer
** *********** ********.  ***.

377. spacer 9.14|7273810|31|NC_016109|CRISPRCasFinder matches to NC_022599 (Micrococcus sp. V7 plasmid pLMV7, complete sequence) position: , mismatch: 7, identity: 0.774

acgcctaccgcaccgtcgccgcccagctccg	CRISPR spacer
cccggcaccgcaccgtcgccgccaagcgccg	Protospacer
 *   .***************** *** ***

378. spacer 9.14|7273810|31|NC_016109|CRISPRCasFinder matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

acgcctaccgcaccgtcgccgcccagctccg----	CRISPR spacer
acgcctaccgcaccggcgccgcgta----cgagga	Protospacer
*************** ****** .*    **

379. spacer 9.14|7273810|31|NC_016109|CRISPRCasFinder matches to CP047137 (Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.774

----acgcctaccgcaccgtcgccgcccagctccg	CRISPR spacer
catgacg----gtgcaccgtcgccgcccagcgccg	Protospacer
    ***     .****************** ***

380. spacer 9.16|7273932|31|NC_016109|CRISPRCasFinder matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

gctccagccagtacggcagccactcggagag	CRISPR spacer
gcaccagccagtacggcagccacgccaggcc	Protospacer
** ******************** * ..*

381. spacer 9.17|7273993|31|NC_016109|CRISPRCasFinder matches to NZ_CP034472 (Pantoea agglomerans strain CFSAN047153 plasmid pCFSAN047153_3, complete sequence) position: , mismatch: 7, identity: 0.774

cgccgaccgcgcccaggaggagctggtccgc	CRISPR spacer
gcccgagcgcgcgcaggaggagctgtcgcgc	Protospacer
  **** ***** ************ . ***

382. spacer 9.17|7273993|31|NC_016109|CRISPRCasFinder matches to NZ_CP034477 (Pantoea agglomerans strain CFSAN047154 plasmid pCFSAN047154_3, complete sequence) position: , mismatch: 7, identity: 0.774

cgccgaccgcgcccaggaggagctggtccgc	CRISPR spacer
gcccgagcgcgcgcaggaggagctgtcgcgc	Protospacer
  **** ***** ************ . ***

383. spacer 9.20|7273128|32|NC_016109|CRT matches to NZ_CP049142 (Pseudomonas nitroreducens strain HBP1 plasmid pPniHBP1_1, complete sequence) position: , mismatch: 7, identity: 0.781

cctgtcgtcagaacgtgcataccgtccaacgg	CRISPR spacer
cgtcccgtctgaacgtgcataccgaccatggg	Protospacer
* * .**** ************** ***  **

384. spacer 9.24|7273372|32|NC_016109|CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 7, identity: 0.781

gtgcagcaggcggtccgcggtgccgggcgcga	CRISPR spacer
cgccagcaggcggtccacggcgccgggcgccc	Protospacer
   *************.***.*********

385. spacer 9.24|7273372|32|NC_016109|CRT matches to NC_005838 (Thermus thermophilus HB27 plasmid pTT27, complete sequence) position: , mismatch: 7, identity: 0.781

gtgcagcaggcggtccgcggtgccgggcgcga	CRISPR spacer
cgccagcaggcggtccacggcgccgggcgccc	Protospacer
   *************.***.*********

386. spacer 9.26|7273494|32|NC_016109|CRT matches to NZ_CP025188 (Roseomonas mucosa strain AD2 plasmid p1-AD2, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtgatcacgaggccgagccaggtggtcat	CRISPR spacer
gcggggccgacgaggccgagccaggtggtgat	Protospacer
*..* * . ******************** **

387. spacer 9.30|7273748|32|NC_016109|CRT matches to NZ_CP032322 (Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.781

gcgacgccgcgggtccggatcaccgcgacgta	CRISPR spacer
gcgtcgccgcgggtcaggatcaccagcacgcc	Protospacer
*** *********** ********.  ***.

388. spacer 9.30|7273748|32|NC_016109|CRT matches to NZ_CP022367 (Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence) position: , mismatch: 7, identity: 0.781

gcgacgccgcgggtccggatcaccgcgacgta	CRISPR spacer
gcgtcgccgcgggtcaggatcaccagcacgcc	Protospacer
*** *********** ********.  ***.

389. spacer 9.30|7273748|32|NC_016109|CRT matches to NZ_CP007794 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence) position: , mismatch: 7, identity: 0.781

gcgacgccgcgggtccggatcaccgcgacgta	CRISPR spacer
gcgtcgccgcgggtcaggatcaccagcacgcc	Protospacer
*** *********** ********.  ***.

390. spacer 9.30|7273748|32|NC_016109|CRT matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 7, identity: 0.781

gcgacgccgcgggtccggatcaccgcgacgta	CRISPR spacer
gtgccgccgcgggtccgggtgaccgcgaactc	Protospacer
*.* **************.* *******  *

391. spacer 9.30|7273748|32|NC_016109|CRT matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 7, identity: 0.781

gcgacgccgcgggtccggatcaccgcgacgta	CRISPR spacer
gtgccgccgcgggtccgggtgaccgcgaactc	Protospacer
*.* **************.* *******  *

392. spacer 9.30|7273748|32|NC_016109|CRT matches to NZ_CP032340 (Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.781

gcgacgccgcgggtccggatcaccgcgacgta	CRISPR spacer
gcgtcgccgcgggtcaggatcaccagcacgcc	Protospacer
*** *********** ********.  ***.

393. spacer 9.30|7273748|32|NC_016109|CRT matches to NZ_CP032346 (Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.781

gcgacgccgcgggtccggatcaccgcgacgta	CRISPR spacer
gcgtcgccgcgggtcaggatcaccagcacgcc	Protospacer
*** *********** ********.  ***.

394. spacer 9.30|7273748|32|NC_016109|CRT matches to NZ_CP012915 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence) position: , mismatch: 7, identity: 0.781

gcgacgccgcgggtccggatcaccgcgacgta	CRISPR spacer
gcgtcgccgcgggtcaggatcaccagcacgcc	Protospacer
*** *********** ********.  ***.

395. spacer 9.31|7273809|32|NC_016109|CRT matches to NC_013859 (Azospirillum sp. B510 plasmid pAB510e, complete sequence) position: , mismatch: 7, identity: 0.781

gacgcctaccgcaccgtcgccgcccagctccg	CRISPR spacer
accgccgaccgcatcgtcgccgcccagcgcga	Protospacer
. **** ******.************** * .

396. spacer 9.31|7273809|32|NC_016109|CRT matches to NZ_CP049749 (Rhodococcus fascians A21d2 plasmid pA21d2, complete sequence) position: , mismatch: 7, identity: 0.781

-----gacgcctaccgcaccgtcgccgcccagctccg	CRISPR spacer
ccgcaga-----accgcaccgtcgccgccctgcaccg	Protospacer
     **     ****************** ** ***

397. spacer 9.31|7273809|32|NC_016109|CRT matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

gacgcctaccgcaccgtcgccgcccagctccg----	CRISPR spacer
gacgcctaccgcaccggcgccgcgta----cgagga	Protospacer
**************** ****** .*    **

398. spacer 9.31|7273809|32|NC_016109|CRT matches to NZ_CP029831 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed7, complete sequence) position: , mismatch: 7, identity: 0.781

gacgcctaccgcaccgtcgccgcccagctccg	CRISPR spacer
gaggcctaccgcaccgccgccgccgcgatcgt	Protospacer
** *************.*******  * **

399. spacer 9.31|7273809|32|NC_016109|CRT matches to NC_014120 (Paraburkholderia sp. CCGE1002 plasmid pBC201, complete sequence) position: , mismatch: 7, identity: 0.781

-gacgcctaccgcaccgtcgccgcccagctccg	CRISPR spacer
caacg-tgaccgcgccgtcgccgcccagatcct	Protospacer
 .*** . *****.************** ***

400. spacer 9.34|7273992|32|NC_016109|CRT matches to NZ_AP014705 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence) position: , mismatch: 7, identity: 0.781

acgccgaccgcgcccaggaggagctggtccgc	CRISPR spacer
ccgccggccgcgcccaggacgagctgacctcc	Protospacer
 *****.************ ******..*. *

401. spacer 9.46|7273747|33|NC_016109|PILER-CR matches to CP006880 (Rhizobium gallicum bv. gallicum R602 plasmid pRgalR602c, complete sequence) position: , mismatch: 7, identity: 0.788

ggcgacgccgcgggtccggatcaccgcgacgta	CRISPR spacer
cgtgacgccgcgggtccggatcaccgcctggcg	Protospacer
 *.************************   *..

402. spacer 9.47|7273808|33|NC_016109|PILER-CR matches to NC_013859 (Azospirillum sp. B510 plasmid pAB510e, complete sequence) position: , mismatch: 7, identity: 0.788

ggacgcctaccgcaccgtcgccgcccagctccg	CRISPR spacer
gaccgccgaccgcatcgtcgccgcccagcgcga	Protospacer
*. **** ******.************** * .

403. spacer 9.47|7273808|33|NC_016109|PILER-CR matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.788

ggacgcctaccgcaccgtcgccgcccagctccg----	CRISPR spacer
ggacgcctaccgcaccggcgccgcgta----cgagga	Protospacer
***************** ****** .*    **

404. spacer 9.47|7273808|33|NC_016109|PILER-CR matches to NZ_CP029831 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed7, complete sequence) position: , mismatch: 7, identity: 0.788

ggacgcctaccgcaccgtcgccgcccagctccg	CRISPR spacer
ggaggcctaccgcaccgccgccgccgcgatcgt	Protospacer
*** *************.*******  * **

405. spacer 9.47|7273808|33|NC_016109|PILER-CR matches to NC_022599 (Micrococcus sp. V7 plasmid pLMV7, complete sequence) position: , mismatch: 7, identity: 0.788

ggacgcc---taccgcaccgtcgccgcccagctccg	CRISPR spacer
---cccccggcaccgcaccgtcgccgccaagcgccg	Protospacer
   * **   .***************** *** ***

406. spacer 2.1|613107|32|NC_016109|CRT matches to NZ_LR134465 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 23, complete sequence) position: , mismatch: 8, identity: 0.75

gccgtcgacggcctgaccgacgacgagggcgc	CRISPR spacer
ctcctcgccggcctgcccgacgacgagctcga	Protospacer
 .* *** ******* ***********  **

407. spacer 2.1|613107|32|NC_016109|CRT matches to NZ_CP021653 (Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

gccgtcgacggcctgaccgacgacgagggcgc----	CRISPR spacer
tacgtcgacggcctgcgcgacgac----gcgctgta	Protospacer
  *************  *******    ****

408. spacer 2.1|613107|32|NC_016109|CRT matches to NZ_CP021767 (Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

gccgtcgacggcctgaccgacgacgagggcgc----	CRISPR spacer
tacgtcgacggcctgcgcgacgac----gcgctgta	Protospacer
  *************  *******    ****

409. spacer 2.1|613107|32|NC_016109|CRT matches to NZ_CP030864 (Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

gccgtcgacggcctgaccgacgacgagggcgc	CRISPR spacer
ctcgacgccggcctgaccgacgacgaacgccg	Protospacer
 .** ** ******************. **

410. spacer 2.1|613107|32|NC_016109|CRT matches to NZ_CP012688 (Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

gccgtcgacggcctgaccgacgacgagggcgc----	CRISPR spacer
tacgtcgacggcctgcgcgacgac----gcgctgta	Protospacer
  *************  *******    ****

411. spacer 2.1|613107|32|NC_016109|CRT matches to CP047139 (Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

gccgtcgacggcctgaccgacgacgagggcgc----	CRISPR spacer
tacgtcgacggcctgcgcgacgac----gcgctgta	Protospacer
  *************  *******    ****

412. spacer 2.1|613107|32|NC_016109|CRT matches to CP047137 (Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

gccgtcgacggcctgaccgacgacgagggcgc----	CRISPR spacer
tacgtcgacggcctgcgcgacgac----gcgctgta	Protospacer
  *************  *******    ****

413. spacer 2.1|613107|32|NC_016109|CRT matches to MT498055 (Arthrobacter phage Bumble, complete genome) position: , mismatch: 8, identity: 0.75

gccgtcgacggcctgaccgacgacgagggcgc	CRISPR spacer
accgtcgacggcctcaccgccgacggcgggat	Protospacer
.************* **** *****. ** ..

414. spacer 2.1|613107|32|NC_016109|CRT matches to NZ_CP021449 (Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence) position: , mismatch: 8, identity: 0.75

gccgtcgacggcctgaccgacgacgagggcgc	CRISPR spacer
ggcgtcgaaggcccgaccgacgacgccgccat	Protospacer
* ****** ****.***********  * *..

415. spacer 2.1|613107|32|NC_016109|CRT matches to NZ_CP026091 (Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

gccgtcgacggcctgaccgacgacgagggcgc----	CRISPR spacer
tacgtcgacggcctgcgcgacgac----gcgctgta	Protospacer
  *************  *******    ****

416. spacer 2.1|613107|32|NC_016109|CRT matches to NC_014309 (Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome) position: , mismatch: 8, identity: 0.75

gccgtcgacggcctgaccgacgacgagggcgc----	CRISPR spacer
tacgtcgacggcctgcgcgacgac----gcgctgta	Protospacer
  *************  *******    ****

417. spacer 2.1|613107|32|NC_016109|CRT matches to NZ_CP049788 (Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

gccgtcgacggcctgaccgacgacgagggcgc	CRISPR spacer
ggcgtcgaaggcccgaccgacgacgccgccat	Protospacer
* ****** ****.***********  * *..

418. spacer 2.1|613107|32|NC_016109|CRT matches to NZ_CP007130 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 2, complete sequence) position: , mismatch: 8, identity: 0.75

gccgtcgacggcctgaccgacgacgagggcgc	CRISPR spacer
ggcgtcggcggactgaccgacgacggcgacta	Protospacer
* *****.*** *************. *.*

419. spacer 2.1|613107|32|NC_016109|CRT matches to NZ_CP039340 (Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence) position: , mismatch: 8, identity: 0.75

gccgtcgacggcctgaccgacgacgagggcgc	CRISPR spacer
ggcgtcgaaggcccgaccgacgacgccgccat	Protospacer
* ****** ****.***********  * *..

420. spacer 2.1|613107|32|NC_016109|CRT matches to NZ_CP021763 (Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

gccgtcgacggcctgaccgacgacgagggcgc	CRISPR spacer
ggcgtcgaaggcccgaccgacgacgccgccat	Protospacer
* ****** ****.***********  * *..

421. spacer 2.1|613107|32|NC_016109|CRT matches to NZ_CP026093 (Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

gccgtcgacggcctgaccgacgacgagggcgc----	CRISPR spacer
tacgtcgacggcctgcgcgacgac----gcgctgta	Protospacer
  *************  *******    ****

422. spacer 2.1|613107|32|NC_016109|CRT matches to NZ_CP015116 (Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

gccgtcgacggcctgaccgacgacgagggcgc	CRISPR spacer
ggcgtcgaaggcccgaccgacgacgccgccat	Protospacer
* ****** ****.***********  * *..

423. spacer 2.1|613107|32|NC_016109|CRT matches to NZ_CP009763 (Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

gccgtcgacggcctgaccgacgacgagggcgc	CRISPR spacer
ggcgtcgaaggcccgaccgacgacgccgccat	Protospacer
* ****** ****.***********  * *..

424. spacer 2.1|613107|32|NC_016109|CRT matches to NZ_CP021765 (Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

gccgtcgacggcctgaccgacgacgagggcgc----	CRISPR spacer
tacgtcgacggcctgcgcgacgac----gcgctgta	Protospacer
  *************  *******    ****

425. spacer 2.1|613107|32|NC_016109|CRT matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

gccgtcgacggcctgaccgacgacgagggcgc	CRISPR spacer
ctcgacctcggcctgcccgacgacgacggcgt	Protospacer
 .** *  ******* ********** ****.

426. spacer 2.1|613107|32|NC_016109|CRT matches to GQ303264 (Mycobacterium phage Puhltonio, complete genome) position: , mismatch: 8, identity: 0.75

gccgtcgacggcctgaccgacgacgag-ggcgc	CRISPR spacer
gagctcaacggcatgaccgacgacgagctacg-	Protospacer
*   **.***** **************  .**

427. spacer 2.1|613107|32|NC_016109|CRT matches to KX683293 (Mycobacterium phage Daffy, complete genome) position: , mismatch: 8, identity: 0.75

gccgtcgacggcctgaccgacgacgag-ggcgc	CRISPR spacer
gagctcaacggcatgaccgacgacgagctacg-	Protospacer
*   **.***** **************  .**

428. spacer 2.1|613107|32|NC_016109|CRT matches to MK279888 (Mycobacterium phage TomBombadil, complete genome) position: , mismatch: 8, identity: 0.75

gccgtcgacggcctgaccgacgacgag-ggcgc	CRISPR spacer
gagctcaacggcatgaccgacgacgagctacg-	Protospacer
*   **.***** **************  .**

429. spacer 2.1|613107|32|NC_016109|CRT matches to MT316463 (Mycobacterium phage Slatt, complete genome) position: , mismatch: 8, identity: 0.75

gccgtcgacggcctgaccgacgacgag-ggcgc	CRISPR spacer
gagctcaacggcatgaccgacgacgagctacg-	Protospacer
*   **.***** **************  .**

430. spacer 2.1|613107|32|NC_016109|CRT matches to KX576645 (Mycobacterium phage Derpp, complete genome) position: , mismatch: 8, identity: 0.75

gccgtcgacggcctgaccgacgacgag-ggcgc	CRISPR spacer
gagctcaacggcatgaccgacgacgagctacg-	Protospacer
*   **.***** **************  .**

431. spacer 2.1|613107|32|NC_016109|CRT matches to MH651184 (Mycobacterium phage Phareon, complete genome) position: , mismatch: 8, identity: 0.75

gccgtcgacggcctgaccgacgacgag-ggcgc	CRISPR spacer
gagctcaacggcatgaccgacgacgagctacg-	Protospacer
*   **.***** **************  .**

432. spacer 2.1|613107|32|NC_016109|CRT matches to MF919511 (Mycobacterium phage Kailash, complete genome) position: , mismatch: 8, identity: 0.75

gccgtcgacggcctgaccgacgacgag-ggcgc	CRISPR spacer
gagctcaacggcatgaccgacgacgagctacg-	Protospacer
*   **.***** **************  .**

433. spacer 2.1|613107|32|NC_016109|CRT matches to MK279882 (Mycobacterium phage Sophia, complete genome) position: , mismatch: 8, identity: 0.75

gccgtcgacggcctgaccgacgacgag-ggcgc	CRISPR spacer
gagctcaacggcatgaccgacgacgagctacg-	Protospacer
*   **.***** **************  .**

434. spacer 2.1|613107|32|NC_016109|CRT matches to KX670813 (Mycobacterium phage MitKao, complete genome) position: , mismatch: 8, identity: 0.75

gccgtcgacggcctgaccgacgacgag-ggcgc	CRISPR spacer
gagctcaacggcatgaccgacgacgagctacg-	Protospacer
*   **.***** **************  .**

435. spacer 2.1|613107|32|NC_016109|CRT matches to MH576970 (Mycobacterium phage DonSanchon, complete genome) position: , mismatch: 8, identity: 0.75

gccgtcgacggcctgaccgacgacgag-ggcgc	CRISPR spacer
gagctcaacggcatgaccgacgacgagctacg-	Protospacer
*   **.***** **************  .**

436. spacer 2.1|613107|32|NC_016109|CRT matches to MK279866 (Mycobacterium phage MRabcd, complete genome) position: , mismatch: 8, identity: 0.75

gccgtcgacggcctgaccgacgacgag-ggcgc	CRISPR spacer
gagctcaacggcatgaccgacgacgagctacg-	Protospacer
*   **.***** **************  .**

437. spacer 2.1|613107|32|NC_016109|CRT matches to NC_023727 (Mycobacterium phage Vista, complete genome) position: , mismatch: 8, identity: 0.75

gccgtcgacggcctgaccgacgacgag-ggcgc	CRISPR spacer
gagctcaacggcatgaccgacgacgagctacg-	Protospacer
*   **.***** **************  .**

438. spacer 2.1|613107|32|NC_016109|CRT matches to KM347890 (Mycobacterium phage Vivaldi, complete genome) position: , mismatch: 8, identity: 0.75

gccgtcgacggcctgaccgacgacgag-ggcgc	CRISPR spacer
gagctcaacggcatgaccgacgacgagctacg-	Protospacer
*   **.***** **************  .**

439. spacer 2.1|613107|32|NC_016109|CRT matches to MH727555 (Mycobacterium phage Mulan, complete genome) position: , mismatch: 8, identity: 0.75

gccgtcgacggcctgaccgacgacgag-ggcgc	CRISPR spacer
gagctcaacggcatgaccgacgacgagctacg-	Protospacer
*   **.***** **************  .**

440. spacer 2.1|613107|32|NC_016109|CRT matches to MG757164 (Mycobacterium phage PhenghisKhan, complete genome) position: , mismatch: 8, identity: 0.75

gccgtcgacggcctgaccgacgacgag-ggcgc	CRISPR spacer
gagctcaacggcatgaccgacgacgagctacg-	Protospacer
*   **.***** **************  .**

441. spacer 2.1|613107|32|NC_016109|CRT matches to NC_027985 (Mycobacterium phage UncleHowie, complete genome) position: , mismatch: 8, identity: 0.75

gccgtcgacggcctgaccgacgacgag-ggcgc	CRISPR spacer
gagctcaacggcatgaccgacgacgagctacg-	Protospacer
*   **.***** **************  .**

442. spacer 2.1|613107|32|NC_016109|CRT matches to KX592589 (Mycobacterium phage Iridoclysis, complete genome) position: , mismatch: 8, identity: 0.75

gccgtcgacggcctgaccgacgacgag-ggcgc	CRISPR spacer
gagctcaacggcatgaccgacgacgagctacg-	Protospacer
*   **.***** **************  .**

443. spacer 2.1|613107|32|NC_016109|CRT matches to MH051251 (Mycobacterium phage DuchessDung, complete genome) position: , mismatch: 8, identity: 0.75

gccgtcgacggcctgaccgacgacgag-ggcgc	CRISPR spacer
gagctcaacggcatgaccgacgacgagctacg-	Protospacer
*   **.***** **************  .**

444. spacer 2.1|613107|32|NC_016109|CRT matches to KX576646 (Mycobacterium phage TyrionL, complete genome) position: , mismatch: 8, identity: 0.75

gccgtcgacggcctgaccgacgacgag-ggcgc	CRISPR spacer
gagctcaacggcatgaccgacgacgagctacg-	Protospacer
*   **.***** **************  .**

445. spacer 2.1|613107|32|NC_016109|CRT matches to MK279871 (Mycobacterium phage Plmatters, complete genome) position: , mismatch: 8, identity: 0.75

gccgtcgacggcctgaccgacgacgag-ggcgc	CRISPR spacer
gagctcaacggcatgaccgacgacgagctacg-	Protospacer
*   **.***** **************  .**

446. spacer 2.1|613107|32|NC_016109|CRT matches to MG757165 (Mycobacterium phage Phergie, complete genome) position: , mismatch: 8, identity: 0.75

gccgtcgacggcctgaccgacgacgag-ggcgc	CRISPR spacer
gagctcaacggcatgaccgacgacgagctacg-	Protospacer
*   **.***** **************  .**

447. spacer 2.1|613107|32|NC_016109|CRT matches to JQ680375 (Unidentified phage clone 2209_scaffold2350 genomic sequence) position: , mismatch: 8, identity: 0.75

gccgtcgacggcctgaccgacgacgagggcgc-	CRISPR spacer
atttacgacggcctgaccgacggcg-gggcgtt	Protospacer
...  *****************.** *****.

448. spacer 2.1|613107|32|NC_016109|CRT matches to MK279881 (Mycobacterium phage Solosis, complete genome) position: , mismatch: 8, identity: 0.75

gccgtcgacggcctgaccgacgacgag-ggcgc	CRISPR spacer
gagctcaacggcatgaccgacgacgagctacg-	Protospacer
*   **.***** **************  .**

449. spacer 2.1|613107|32|NC_016109|CRT matches to MG944223 (Mycobacterium phage Trypo, complete genome) position: , mismatch: 8, identity: 0.75

gccgtcgacggcctgaccgacgacgag-ggcgc	CRISPR spacer
gagctcaacggcatgaccgacgacgagctacg-	Protospacer
*   **.***** **************  .**

450. spacer 2.1|613107|32|NC_016109|CRT matches to MK494104 (Mycobacterium phage HenryJackson, complete genome) position: , mismatch: 8, identity: 0.75

gccgtcgacggcctgaccgacgacgag-ggcgc	CRISPR spacer
gagctcaacggcatgaccgacgacgagctacg-	Protospacer
*   **.***** **************  .**

451. spacer 2.1|613107|32|NC_016109|CRT matches to JX649099 (Mycobacterium phage Gyarad, complete genome) position: , mismatch: 8, identity: 0.75

gccgtcgacggcctgaccgacgacgag-ggcgc	CRISPR spacer
gagctcaacggcatgaccgacgacgagctacg-	Protospacer
*   **.***** **************  .**

452. spacer 2.1|613107|32|NC_016109|CRT matches to MH450116 (Mycobacterium phage Buckeye, complete genome) position: , mismatch: 8, identity: 0.75

gccgtcgacggcctgaccgacgacgag-ggcgc	CRISPR spacer
gagctcaacggcatgaccgacgacgagctacg-	Protospacer
*   **.***** **************  .**

453. spacer 2.1|613107|32|NC_016109|CRT matches to JN638753 (Mycobacterium phage Morgushi, complete genome) position: , mismatch: 8, identity: 0.75

gccgtcgacggcctgaccgacgacgag-ggcgc	CRISPR spacer
gagctcaacggcatgaccgacgacgagctacg-	Protospacer
*   **.***** **************  .**

454. spacer 2.1|613107|32|NC_016109|CRT matches to MG757158 (Mycobacterium phage HighStump, complete genome) position: , mismatch: 8, identity: 0.75

gccgtcgacggcctgaccgacgacgag-ggcgc	CRISPR spacer
gagctcaacggcatgaccgacgacgagctacg-	Protospacer
*   **.***** **************  .**

455. spacer 2.3|613229|32|NC_016109|CRT matches to NZ_CP020539 (Sphingobium herbicidovorans strain MH plasmid pMSHV, complete sequence) position: , mismatch: 8, identity: 0.75

ccgacaacccgggggaagacggcgcgacgccg	CRISPR spacer
tcgcggtcacgggtgaagaaggcgcgacgccg	Protospacer
.**  . * **** ***** ************

456. spacer 2.3|613229|32|NC_016109|CRT matches to NC_013859 (Azospirillum sp. B510 plasmid pAB510e, complete sequence) position: , mismatch: 8, identity: 0.75

ccgacaacccgggggaagacggcgcgacgccg	CRISPR spacer
tcgtcggaccgggagaagacggcgcggcgccc	Protospacer
.** *.. *****.************.****

457. spacer 2.4|613290|32|NC_016109|CRT matches to NZ_CP007130 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 2, complete sequence) position: , mismatch: 8, identity: 0.75

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
cgcgcccgatgcggtgcgcgccgcgctcgcgc	Protospacer
**  *. **.***************.****

458. spacer 2.4|613290|32|NC_016109|CRT matches to NZ_CP021653 (Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
ggcgctccccgccgtgcgcgccgcgctcgccg	Protospacer
 *  **   *** ************.******

459. spacer 2.4|613290|32|NC_016109|CRT matches to NZ_CP021767 (Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
ggcgctccccgccgtgcgcgccgcgctcgccg	Protospacer
 *  **   *** ************.******

460. spacer 2.4|613290|32|NC_016109|CRT matches to NZ_CP012688 (Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
ggcgctccccgccgtgcgcgccgcgctcgccg	Protospacer
 *  **   *** ************.******

461. spacer 2.4|613290|32|NC_016109|CRT matches to CP047139 (Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
ggcgctccccgccgtgcgcgccgcgctcgccg	Protospacer
 *  **   *** ************.******

462. spacer 2.4|613290|32|NC_016109|CRT matches to CP047137 (Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
ggcgctccccgccgtgcgcgccgcgctcgccg	Protospacer
 *  **   *** ************.******

463. spacer 2.4|613290|32|NC_016109|CRT matches to NC_015314 (Pseudonocardia dioxanivorans CB1190 plasmid pPSED01, complete sequence) position: , mismatch: 8, identity: 0.75

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
cgacctggacgtggtgcgggccgccgcgacca	Protospacer
***********.****** *****  . .**.

464. spacer 2.4|613290|32|NC_016109|CRT matches to NZ_CP026091 (Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
ggcgctccccgccgtgcgcgccgcgctcgccg	Protospacer
 *  **   *** ************.******

465. spacer 2.4|613290|32|NC_016109|CRT matches to NC_014309 (Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome) position: , mismatch: 8, identity: 0.75

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
ggcgctccccgccgtgcgcgccgcgctcgccg	Protospacer
 *  **   *** ************.******

466. spacer 2.4|613290|32|NC_016109|CRT matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 8, identity: 0.75

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
cgcctgccacgcggtgcccgccgcggtcgcca	Protospacer
** *.   ********* ******* *****.

467. spacer 2.4|613290|32|NC_016109|CRT matches to NZ_CP026093 (Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
ggcgctccccgccgtgcgcgccgcgctcgccg	Protospacer
 *  **   *** ************.******

468. spacer 2.4|613290|32|NC_016109|CRT matches to NZ_CP012940 (Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
ggcgctccccgccgtgcgcgccgcgctcgccg	Protospacer
 *  **   *** ************.******

469. spacer 2.4|613290|32|NC_016109|CRT matches to NZ_CP012944 (Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
ggcgctccccgccgtgcgcgccgcgctcgccg	Protospacer
 *  **   *** ************.******

470. spacer 2.4|613290|32|NC_016109|CRT matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 8, identity: 0.75

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
cgcctgccacgcggtgcccgccgcggtcgcca	Protospacer
** *.   ********* ******* *****.

471. spacer 2.4|613290|32|NC_016109|CRT matches to NC_017575 (Ralstonia solanacearum Po82 megaplasmid, complete sequence) position: , mismatch: 8, identity: 0.75

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
ggcgctccccgccgtgcgcgccgcgctcgccg	Protospacer
 *  **   *** ************.******

472. spacer 2.4|613290|32|NC_016109|CRT matches to NZ_CP030074 (Streptomyces sp. ZFG47 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
ctgcgagaccgcggtgcgcgccgccctcgccg	Protospacer
* .*  *. *************** .******

473. spacer 2.4|613290|32|NC_016109|CRT matches to NZ_CP026308 (Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
ggcgctccccgccgtgcgcgccgcgctcgccg	Protospacer
 *  **   *** ************.******

474. spacer 2.4|613290|32|NC_016109|CRT matches to NZ_CP051295 (Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence) position: , mismatch: 8, identity: 0.75

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
ggcgctccccgccgtgcgcgccgcgctcgccg	Protospacer
 *  **   *** ************.******

475. spacer 2.4|613290|32|NC_016109|CRT matches to MK801727 (Gordonia phage ThankyouJordi, complete genome) position: , mismatch: 8, identity: 0.75

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
catgtgggacgcggtgcgcaccgcgttcccca	Protospacer
*.  . *************.******** **.

476. spacer 2.4|613290|32|NC_016109|CRT matches to MK875793 (Gordonia phage WelcomeAyanna, complete genome) position: , mismatch: 8, identity: 0.75

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
catgtgggacgcggtgcgcaccgcgttcccca	Protospacer
*.  . *************.******** **.

477. spacer 2.4|613290|32|NC_016109|CRT matches to NZ_CP032828 (Sphingomonas sp. YZ-8 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

--cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
attggtc--aactcggtgcgcgccgcgatcgccg	Protospacer
  .*..*  .** ************** ******

478. spacer 2.4|613290|32|NC_016109|CRT matches to NZ_CP029831 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed7, complete sequence) position: , mismatch: 8, identity: 0.75

cgacctggacgcggtgcgcgcc-----gcgttcgccg	CRISPR spacer
cgacctggatgcggtgggcgccgggaagcgtc-----	Protospacer
*********.****** *****     ****.

479. spacer 2.4|613290|32|NC_016109|CRT matches to NZ_LR134467 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 25, complete sequence) position: , mismatch: 8, identity: 0.75

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
cgacctcgacgcgctgcgcgccgtggacaacc	Protospacer
****** ****** *********.*  *. *

480. spacer 2.4|613290|32|NC_016109|CRT matches to NC_021289 (Burkholderia insecticola plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.75

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
gggcgcaggcgcggtgcgcgcggcgctcgccg	Protospacer
 *.* ..*.************ ***.******

481. spacer 2.4|613290|32|NC_016109|CRT matches to NZ_CP022192 (Yangia pacifica strain YSBP01 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
agcctgggacgcggtgcgcgccgagtgcgacc	Protospacer
 * *. ***************** ** ** *

482. spacer 2.4|613290|32|NC_016109|CRT matches to NZ_CP045548 (Streptomyces sp. SYP-A7193 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

cgacctggacgcggtgcgcgccgcgttcgccg-----	CRISPR spacer
cgacctggacggggtgcgggccg-----gccatgagc	Protospacer
*********** ****** ****     ***.

483. spacer 2.6|613412|32|NC_016109|CRT matches to NZ_CP015009 (Aminobacter aminovorans strain KCTC 2477 plasmid pAA04, complete sequence) position: , mismatch: 8, identity: 0.75

ctggtgtcgatcaggtcggcagcctcgccgag	CRISPR spacer
atcgacacgatcaggtcgaccgcctcgccgat	Protospacer
 * *   ***********.* **********

484. spacer 2.6|613412|32|NC_016109|CRT matches to NZ_CP020539 (Sphingobium herbicidovorans strain MH plasmid pMSHV, complete sequence) position: , mismatch: 8, identity: 0.75

ctggtgtcgatcaggtcggcagcctcgccgag	CRISPR spacer
aggaagtcgatcagttcggcaacctcgccagg	Protospacer
  *. ********* ******.*******..*

485. spacer 2.6|613412|32|NC_016109|CRT matches to NZ_AP018921 (Pseudonocardia autotrophica strain NBRC 12743 plasmid pPA12743CP, complete sequence) position: , mismatch: 8, identity: 0.75

-----ctggtgtcgatcaggtcggcagcctcgccgag	CRISPR spacer
aacagcag-----gatcaggtcggctgccccgccgag	Protospacer
     * *     ************ ***.*******

486. spacer 2.6|613412|32|NC_016109|CRT matches to KR053197 (Gordonia phage GRU3, complete genome) position: , mismatch: 8, identity: 0.75

ctggtgtcgatcaggtcggcagcctcgccgag	CRISPR spacer
ccgtagtcgatcaggtcggcggccttgccctc	Protospacer
*.*  ***************.****.***

487. spacer 2.6|613412|32|NC_016109|CRT matches to MH727593 (Acidovorax phage ACPWH, complete genome) position: , mismatch: 8, identity: 0.75

ctggtgtcgatcaggtcggcagcctcgccgag	CRISPR spacer
ctttcttagaacaggtcggcagactcgccgaa	Protospacer
**  . * ** *********** ********.

488. spacer 2.8|613534|32|NC_016109|CRT matches to NZ_CP015006 (Aminobacter aminovorans strain KCTC 2477 plasmid pAA01, complete sequence) position: , mismatch: 8, identity: 0.75

ggcgtcggtggcgaggagttcggtgggggtga	CRISPR spacer
cgcatcggtggcgaggagttcggtgtctttct	Protospacer
 **.*********************    *

489. spacer 2.9|613595|32|NC_016109|CRT matches to NZ_CP032340 (Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.75

tcggcgagggtgtgctgggcgtcggcgtaggc	CRISPR spacer
tcggcgacggtgtgctgtgcgtcgagttcacc	Protospacer
******* ********* ******.  * . *

490. spacer 2.9|613595|32|NC_016109|CRT matches to NZ_CP012915 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence) position: , mismatch: 8, identity: 0.75

tcggcgagggtgtgctgggcgtcggcgtaggc	CRISPR spacer
tcggcgacggtgtgctgtgcgtcgagttcacc	Protospacer
******* ********* ******.  * . *

491. spacer 2.9|613595|32|NC_016109|CRT matches to NZ_CP016453 (Sphingobium sp. RAC03 plasmid pBSY17_1, complete sequence) position: , mismatch: 8, identity: 0.75

tcggcgagggtgtgctgggcgtcggcgtaggc	CRISPR spacer
gcggcgagggtgtgcctggcgtcgttgcgggt	Protospacer
 **************. ******* .*..**.

492. spacer 2.9|613595|32|NC_016109|CRT matches to NZ_CP047179 (Rathayibacter sp. VKM Ac-2759 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.75

tcggcgagggtgtgctgggcgtcggcgtaggc	CRISPR spacer
atgcagagggtgtcctggccgtcggcgtcgcc	Protospacer
 .*  ******** **** ********* * *

493. spacer 2.10|613656|32|NC_016109|CRT matches to NZ_CP030074 (Streptomyces sp. ZFG47 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

atcacgccgcgggtccgcagctccgcgagcag	CRISPR spacer
aagtccccacgggtccgcagctcggcgagttg	Protospacer
*   * **.************** *****. *

494. spacer 2.11|613717|32|NC_016109|CRT matches to CP023013 (Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

cccactagagcgagcacgacttcgcggtcccg--	CRISPR spacer
tccaccagagcgagcacgtctt--cggccgtggc	Protospacer
.****.************ ***  ***.* .*

495. spacer 2.11|613717|32|NC_016109|CRT matches to NZ_CP049790 (Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

cccactagagcgagcacgacttcgcggtcccg--	CRISPR spacer
tccaccagagcgagcacgtctt--cggccgtggc	Protospacer
.****.************ ***  ***.* .*

496. spacer 2.11|613717|32|NC_016109|CRT matches to NZ_CP049794 (Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

cccactagagcgagcacgacttcgcggtcccg--	CRISPR spacer
tccaccagagcgagcacgtctt--cggccgtggc	Protospacer
.****.************ ***  ***.* .*

497. spacer 2.11|613717|32|NC_016109|CRT matches to NZ_CP021763 (Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

cccactagagcgagcacgacttcgcggtcccg--	CRISPR spacer
tccaccagagcgagcacgtctt--cggccgtggc	Protospacer
.****.************ ***  ***.* .*

498. spacer 2.11|613717|32|NC_016109|CRT matches to NZ_CP049792 (Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

cccactagagcgagcacgacttcgcggtcccg--	CRISPR spacer
tccaccagagcgagcacgtctt--cggccgtggc	Protospacer
.****.************ ***  ***.* .*

499. spacer 2.11|613717|32|NC_016109|CRT matches to NZ_CP016915 (Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

cccactagagcgagcacgacttcgcggtcccg--	CRISPR spacer
tccaccagagcgagcacgtctt--cggccgtggc	Protospacer
.****.************ ***  ***.* .*

500. spacer 2.11|613717|32|NC_016109|CRT matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 8, identity: 0.75

cccactagagcgagcacgacttcgcggtcccg--	CRISPR spacer
tccaccagagcgagcacgtctt--cggccgtggc	Protospacer
.****.************ ***  ***.* .*

501. spacer 2.11|613717|32|NC_016109|CRT matches to NZ_CP015851 (Ralstonia solanacearum strain YC40-M plasmid, complete sequence) position: , mismatch: 8, identity: 0.75

cccactagagcgagcacgacttcgcggtcccg--	CRISPR spacer
tccaccagagcgagcacgtctt--cggccgtggc	Protospacer
.****.************ ***  ***.* .*

502. spacer 2.11|613717|32|NC_016109|CRT matches to NZ_CP022795 (Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

cccactagagcgagcacgacttcgcggtcccg--	CRISPR spacer
tccaccagagcgagcacgtctt--cggccgtggc	Protospacer
.****.************ ***  ***.* .*

503. spacer 2.11|613717|32|NC_016109|CRT matches to NZ_CP052085 (Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.75

cccactagagcgagcacgacttcgcggtcccg--	CRISPR spacer
tccaccagagcgagcacgtctt--cggccgtggc	Protospacer
.****.************ ***  ***.* .*

504. spacer 2.11|613717|32|NC_016109|CRT matches to NZ_CP021765 (Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

cccactagagcgagcacgacttcgcggtcccg--	CRISPR spacer
tccaccagagcgagcacgtctt--cggccgtggc	Protospacer
.****.************ ***  ***.* .*

505. spacer 2.11|613717|32|NC_016109|CRT matches to NZ_CP052077 (Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.75

cccactagagcgagcacgacttcgcggtcccg--	CRISPR spacer
tccaccagagcgagcacgtctt--cggccgtggc	Protospacer
.****.************ ***  ***.* .*

506. spacer 2.11|613717|32|NC_016109|CRT matches to NZ_CP052087 (Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.75

cccactagagcgagcacgacttcgcggtcccg--	CRISPR spacer
tccaccagagcgagcacgtctt--cggccgtggc	Protospacer
.****.************ ***  ***.* .*

507. spacer 2.11|613717|32|NC_016109|CRT matches to NZ_CP052127 (Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.75

cccactagagcgagcacgacttcgcggtcccg--	CRISPR spacer
tccaccagagcgagcacgtctt--cggccgtggc	Protospacer
.****.************ ***  ***.* .*

508. spacer 2.11|613717|32|NC_016109|CRT matches to NZ_CP052079 (Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.75

cccactagagcgagcacgacttcgcggtcccg--	CRISPR spacer
tccaccagagcgagcacgtctt--cggccgtggc	Protospacer
.****.************ ***  ***.* .*

509. spacer 2.11|613717|32|NC_016109|CRT matches to NZ_CP052089 (Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.75

cccactagagcgagcacgacttcgcggtcccg--	CRISPR spacer
tccaccagagcgagcacgtctt--cggccgtggc	Protospacer
.****.************ ***  ***.* .*

510. spacer 2.11|613717|32|NC_016109|CRT matches to NZ_CP052125 (Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.75

cccactagagcgagcacgacttcgcggtcccg--	CRISPR spacer
tccaccagagcgagcacgtctt--cggccgtggc	Protospacer
.****.************ ***  ***.* .*

511. spacer 2.11|613717|32|NC_016109|CRT matches to NZ_CP052123 (Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.75

cccactagagcgagcacgacttcgcggtcccg--	CRISPR spacer
tccaccagagcgagcacgtctt--cggccgtggc	Protospacer
.****.************ ***  ***.* .*

512. spacer 2.11|613717|32|NC_016109|CRT matches to NZ_CP052131 (Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.75

cccactagagcgagcacgacttcgcggtcccg--	CRISPR spacer
tccaccagagcgagcacgtctt--cggccgtggc	Protospacer
.****.************ ***  ***.* .*

513. spacer 2.11|613717|32|NC_016109|CRT matches to NZ_CP052081 (Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.75

cccactagagcgagcacgacttcgcggtcccg--	CRISPR spacer
tccaccagagcgagcacgtctt--cggccgtggc	Protospacer
.****.************ ***  ***.* .*

514. spacer 2.11|613717|32|NC_016109|CRT matches to NZ_CP052083 (Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.75

cccactagagcgagcacgacttcgcggtcccg--	CRISPR spacer
tccaccagagcgagcacgtctt--cggccgtggc	Protospacer
.****.************ ***  ***.* .*

515. spacer 2.12|613778|32|NC_016109|CRT matches to MK765627 (Tortoise microvirus 74 isolate 74_SP_45, complete genome) position: , mismatch: 8, identity: 0.75

atgacgaccgggtcggccagcgacccggatcc	CRISPR spacer
gccacgaccgggtcggccaccggcccgcttgc	Protospacer
.. **************** **.****  * *

516. spacer 2.13|613107|33|NC_016109|CRISPRCasFinder matches to NC_010997 (Rhizobium etli CIAT 652 plasmid pC, complete sequence) position: , mismatch: 8, identity: 0.758

gccgtcgacggcctgaccgacgacgagggcgcg	CRISPR spacer
ttcttcgagggcccgaccgacgacgagggcatt	Protospacer
 .* **** ****.****************..

517. spacer 2.13|613107|33|NC_016109|CRISPRCasFinder matches to MT521991 (Streptomyces phage Eklok, complete genome) position: , mismatch: 8, identity: 0.758

gccgtcgacggcctgaccgacgacgagggcgcg	CRISPR spacer
ctcggtctcggcctgaccgacgacgggggcgcc	Protospacer
 .** .  *****************.******

518. spacer 2.13|613107|33|NC_016109|CRISPRCasFinder matches to MT451981 (Streptomyces phage Vondra, complete genome) position: , mismatch: 8, identity: 0.758

gccgtcgacggcctgaccgacgacgagggcgcg	CRISPR spacer
ctcggtctcggcctgaccgacgacgggggcgcc	Protospacer
 .** .  *****************.******

519. spacer 2.13|613107|33|NC_016109|CRISPRCasFinder matches to MT521993 (Gordonia phage RedWattleHog, complete genome) position: , mismatch: 8, identity: 0.758

gccgtcgacggcctgaccgacgacgagggcgcg	CRISPR spacer
gactactacggcctgaccgacgaggaaggcgtc	Protospacer
* *  * **************** **.****.

520. spacer 2.13|613107|33|NC_016109|CRISPRCasFinder matches to MN586040 (Gordonia phage Stormageddon, complete genome) position: , mismatch: 8, identity: 0.758

gccgtcgacggcctgaccgacgacgagggcgcg	CRISPR spacer
gactactacggcctgaccgacgaggaaggcgtc	Protospacer
* *  * **************** **.****.

521. spacer 2.16|613290|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 8, identity: 0.758

cgacctggacgcggtgcgcgccgcgttcgccgc	CRISPR spacer
cgcgctggacgcggtgcacgccgccttcgaact	Protospacer
**  *************.****** ****   .

522. spacer 2.16|613290|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NZ_CP029835 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed5, complete sequence) position: , mismatch: 8, identity: 0.758

cgacctggacgcggtgcgcgccgcgttcgccgc	CRISPR spacer
caagggcgacgcggtgcgcgccggattcgccgt	Protospacer
*.*    **************** .*******.

523. spacer 2.16|613290|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NZ_CP054615 (Azospirillum oryzae strain KACC 14407 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.758

cgacctggacgcggtgcgcgccgcgttcgccgc	CRISPR spacer
caagggcgacgcggtgcgcgccggcttcgccgt	Protospacer
*.*    ****************  *******.

524. spacer 2.16|613290|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NC_015314 (Pseudonocardia dioxanivorans CB1190 plasmid pPSED01, complete sequence) position: , mismatch: 8, identity: 0.758

cgacctggacgcggtgcgcgccgcgttcgccgc	CRISPR spacer
cgacctggacgtggtgcgggccgccgcgaccac	Protospacer
***********.****** *****  . .**.*

525. spacer 2.16|613290|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NZ_CP030074 (Streptomyces sp. ZFG47 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.758

cgacctggacgcggtgcgcgccgcgttcgccgc	CRISPR spacer
ctgcgagaccgcggtgcgcgccgccctcgccgc	Protospacer
* .*  *. *************** .*******

526. spacer 2.16|613290|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NC_016588 (Azospirillum lipoferum 4B plasmid AZO_p6, complete sequence) position: , mismatch: 8, identity: 0.758

cgacctggacgcggtgcgcgccgcgttcgccgc	CRISPR spacer
caagggcgacgcggtgcgcgccggcttcgccgt	Protospacer
*.*    ****************  *******.

527. spacer 2.18|613412|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NC_018022 (Mycolicibacterium chubuense NBB4 plasmid pMYCCH.01, complete sequence) position: , mismatch: 8, identity: 0.758

ctggtgtcgatcaggtcggcagcctcgccgagg	CRISPR spacer
gcccggtcgatcaggtcggcagtctcgcggagt	Protospacer
 .   *****************.***** ***

528. spacer 2.18|613412|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NC_018022 (Mycolicibacterium chubuense NBB4 plasmid pMYCCH.01, complete sequence) position: , mismatch: 8, identity: 0.758

ctggtgtcgatcaggtcggcagcctcgccgagg	CRISPR spacer
gcccggtcgatcaggtcggcagtctcgcggagt	Protospacer
 .   *****************.***** ***

529. spacer 2.18|613412|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NZ_CP054621 (Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence) position: , mismatch: 8, identity: 0.758

--ctggtgtcgatcaggtcggcagcctcgccgagg	CRISPR spacer
agccg--gtcgagcaggtcggcggcctcgccggat	Protospacer
  *.*  ***** *********.*********..

530. spacer 2.18|613412|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NZ_CP015008 (Aminobacter aminovorans strain KCTC 2477 plasmid pAA03, complete sequence) position: , mismatch: 8, identity: 0.758

ctggtgtcgatcaggtcggcagcctcgccgagg	CRISPR spacer
atcgagacgatcaggtcgaccgcctcgccgatc	Protospacer
 * * * ***********.* **********

531. spacer 2.18|613412|33|NC_016109|CRISPRCasFinder,PILER-CR matches to MH727593 (Acidovorax phage ACPWH, complete genome) position: , mismatch: 8, identity: 0.758

ctggtgtcgatcaggtcggcagcctcgccgagg	CRISPR spacer
atcttgtcgttcaggtcggcggcctcgcgcagt	Protospacer
 *  ***** **********.*******  **

532. spacer 2.20|613534|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NZ_CP015006 (Aminobacter aminovorans strain KCTC 2477 plasmid pAA01, complete sequence) position: , mismatch: 8, identity: 0.758

ggcgtcggtggcgaggagttcggtgggggtgag	CRISPR spacer
cgcatcggtggcgaggagttcggtgtctttctg	Protospacer
 **.*********************    *  *

533. spacer 2.24|613778|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NZ_CP053712 (Acetobacteraceae bacterium strain PAMC 26569 plasmid unnamed5, complete sequence) position: , mismatch: 8, identity: 0.758

atgacgaccgggtcggccagcgacccggatccg-	CRISPR spacer
tgaacgaccgggttggccagcgatcc-gatcaac	Protospacer
  .**********.*********.** **** .

534. spacer 3.4|623741|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to MH001453 (Mycobacterium phage Adonis, complete genome) position: , mismatch: 8, identity: 0.758

ccagcaggcggccggagccgagcgcgacgccta	CRISPR spacer
cgttgtgtcggccggattcgagcgcgacgccta	Protospacer
*     * ******** .***************

535. spacer 3.4|623741|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NC_014458 (Mycobacterium phage Angelica, complete genome) position: , mismatch: 8, identity: 0.758

ccagcaggcggccggagccgagcgcgacgccta	CRISPR spacer
cgttgtgtcggccggattcgagcgcgacgccta	Protospacer
*     * ******** .***************

536. spacer 3.4|623741|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to MG962364 (Mycobacterium phage Deby, complete genome) position: , mismatch: 8, identity: 0.758

ccagcaggcggccggagccgagcgcgacgccta	CRISPR spacer
cgttgtgtcggccggattcgagcgcgacgccta	Protospacer
*     * ******** .***************

537. spacer 3.4|623741|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to MF919532 (Mycobacterium phage Sulley, complete genome) position: , mismatch: 8, identity: 0.758

ccagcaggcggccggagccgagcgcgacgccta	CRISPR spacer
cgttgtgtcggccggattcgagcgcgacgccta	Protospacer
*     * ******** .***************

538. spacer 3.4|623741|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP029232 (Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence) position: , mismatch: 8, identity: 0.758

ccagcaggcggccggagccgagcgcgacgccta---	CRISPR spacer
ttagcaggcggccggaaccgagc---acgcgcaatt	Protospacer
..**************.******   **** .*

539. spacer 3.11|624168|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to MH001451 (Mycobacterium phage Nairb, complete genome) position: , mismatch: 8, identity: 0.758

ccgggacagcggcggccggggctgcgggctgct	CRISPR spacer
ctgctggcgctgcggccggcgctgcgggctgct	Protospacer
*.*  .  ** ******** *************

540. spacer 3.11|624168|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to MF155936 (Mycobacterium phage ZenTime222, complete genome) position: , mismatch: 8, identity: 0.758

ccgggacagcggcggccggggctgcgggctgct	CRISPR spacer
ctgctggcgctgcggccggcgctgcgggctgct	Protospacer
*.*  .  ** ******** *************

541. spacer 3.11|624168|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to MK494089 (Mycobacterium phage Ibrahim, complete genome) position: , mismatch: 8, identity: 0.758

ccgggacagcggcggccggggctgcgggctgct	CRISPR spacer
ctgctggcgctgcggccggcgctgcgggctgct	Protospacer
*.*  .  ** ******** *************

542. spacer 3.11|624168|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NC_024135 (Mycobacterium phage Bernal13, complete genome) position: , mismatch: 8, identity: 0.758

ccgggacagcggcggccggggctgcgggctgct	CRISPR spacer
ctgctggcgctgcggccggcgctgcgggctgct	Protospacer
*.*  .  ** ******** *************

543. spacer 3.11|624168|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to KM591905 (Mycobacterium phage RonRayGun, complete genome) position: , mismatch: 8, identity: 0.758

ccgggacagcggcggccggggctgcgggctgct	CRISPR spacer
ctgctggcgctgcggccggcgctgcgggctgct	Protospacer
*.*  .  ** ******** *************

544. spacer 3.11|624168|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to MN735432 (Mycobacteriophage Whitty, complete genome) position: , mismatch: 8, identity: 0.758

ccgggacagcggcggccggggctgcgggctgct	CRISPR spacer
ctgctggcgctgcggccggcgctgcgggctgct	Protospacer
*.*  .  ** ******** *************

545. spacer 3.11|624168|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP016083 (Streptomyces sp. SAT1 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.758

ccgggacagcggcggccggggctgcgggctgct	CRISPR spacer
cggtcacagcggcggccggtgcggcgggccggg	Protospacer
* *  ************** ** ******.*

546. spacer 3.11|624168|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP030864 (Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.758

ccgggacagcggcggccggggctgcgggctgct	CRISPR spacer
gggcgcgaacggcggccggggcgtcgggctgct	Protospacer
  * *  *.*************  *********

547. spacer 3.11|624168|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP007214 (Burkholderia plantarii strain ATCC 43733 plasmid bpln_1p, complete sequence) position: , mismatch: 8, identity: 0.758

ccgggaca----gcggcggccggggctgcgggctgct	CRISPR spacer
----aacatggcgcggcggccgggtctgccggctgcg	Protospacer
    .***    ************ **** ******

548. spacer 3.14|624351|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP029555 (Chromobacterium sp. IIBBL 274-1 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.758

gccgaagccgcgctcatcgccgcccaccgcctc	CRISPR spacer
ccggccgccgcgctcatcgccgccaactgcatg	Protospacer
 * *  ****************** **.** *

549. spacer 3.14|624351|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP045204 (Citrobacter sp. NMI7904_11 plasmid pCTEL-1, complete sequence) position: , mismatch: 8, identity: 0.758

gccgaagccgcgctcatcgccgcccaccgcctc	CRISPR spacer
gccgcagcggcgctcatcgccgccggcaccccg	Protospacer
**** *** *************** .*  **.

550. spacer 3.14|624351|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 8, identity: 0.758

gccgaagccgcgctcatcgccgcccaccgcctc	CRISPR spacer
ttcgtcgaggcgctgatcgccgcccaccgcatc	Protospacer
 .**  *  ***** *************** **

551. spacer 3.14|624351|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP030128 (Indioceanicola profundi strain SCSIO 08040 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.758

gccgaagccgcgctcatcgccgcccaccgcctc	CRISPR spacer
gccgaagccgagctcattgccgccgtccccgat	Protospacer
********** ******.******  ** *  .

552. spacer 3.14|624351|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NC_016591 (Burkholderia sp. YI23 plasmid byi_2p, complete sequence) position: , mismatch: 8, identity: 0.758

----gccgaagccgcgctcatcgccgcccaccgcctc	CRISPR spacer
cttcgcc----ccgcgcccatcgccgaccaccgccct	Protospacer
    ***    ******.******** ********..

553. spacer 3.15|624412|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP019037 (Massilia putida strain 6NM-7 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.758

gggcgtgtacccggaggccgggctgcagatgtc	CRISPR spacer
gatcgccggcccggcggccggcctgcagatgtc	Protospacer
*. **.  .***** ****** ***********

554. spacer 3.18|624595|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP019037 (Massilia putida strain 6NM-7 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.758

gggcgtgtacccggaggccgggctgcagatgtc	CRISPR spacer
gatcgccggcccggcggccggcctgcagatgtc	Protospacer
*. **.  .***** ****** ***********

555. spacer 3.21|624778|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_LR134446 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 4, complete sequence) position: , mismatch: 8, identity: 0.758

ccggcccggggcgcccgccgccggggcggagag	CRISPR spacer
caccgccgcggcgcgcgccgccggggcggacgg	Protospacer
*    *** ***** *************** .*

556. spacer 3.21|624778|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022363 (Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence) position: , mismatch: 8, identity: 0.758

ccggcccggggcgcccgccgccggggcggagag	CRISPR spacer
actacgcggggcgcccgccgctggggctgaccg	Protospacer
 * .* ***************.***** **  *

557. spacer 3.21|624778|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP054621 (Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence) position: , mismatch: 8, identity: 0.758

ccggcccggggcgcccgccgccggggcggagag	CRISPR spacer
ccggcccggcgcgcccgccaccggcgatgcgca	Protospacer
********* *********.**** *  * * .

558. spacer 3.21|624778|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032346 (Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.758

ccggcccggggcgcccgccgccggggcggagag	CRISPR spacer
tccctccgggccgcccgccggcggggcggggcg	Protospacer
.*  .***** ********* ********.* *

559. spacer 3.23|624900|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP020539 (Sphingobium herbicidovorans strain MH plasmid pMSHV, complete sequence) position: , mismatch: 8, identity: 0.758

ctcggcgaggcgggcggacgtcatgcggacgag	CRISPR spacer
ctgggcgaggcggtcggacgtcattgtcgcgcg	Protospacer
** ********** **********    .** *

560. spacer 3.26|625083|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP006369 (Aureimonas sp. AU20 plasmid pAU20b, complete sequence) position: , mismatch: 8, identity: 0.758

tcgcccggcgccacgctcaaggacctgctgctg	CRISPR spacer
atcctcggcgccacgcgtaaggacctgctgcgc	Protospacer
 . *.*********** .*************

561. spacer 3.26|625083|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP017244 (Rhizobium etli 8C-3 plasmid pRsp8C3c, complete sequence) position: , mismatch: 8, identity: 0.758

tcgcccggcgccacgctcaaggacctgctgctg	CRISPR spacer
tcgcccggcgccacgcgaaaggacacatcgcgg	Protospacer
****************  ****** ....** *

562. spacer 3.27|625144|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to MH271305 (Gordonia phage Morrissey, complete genome) position: , mismatch: 8, identity: 0.758

ccgctggaccgggctcaccggcgcgcgccccgg	CRISPR spacer
ccagcggaccgggctcaccggcgagagcctgga	Protospacer
**. .****************** * ***. *.

563. spacer 3.30|625327|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NC_016624 (Azospirillum lipoferum 4B plasmid AZO_p5, complete sequence) position: , mismatch: 8, identity: 0.758

cccatccccgacggccgcgcgctgttcctggcc	CRISPR spacer
ctgctggccgacggcggcacgctgttcctggac	Protospacer
*.  *  ******** **.************ *

564. spacer 3.30|625327|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP054620 (Azospirillum oryzae strain KACC 14407 plasmid unnamed5, complete sequence) position: , mismatch: 8, identity: 0.758

cccatccccgacggccgcgcgctgttcctggcc	CRISPR spacer
ctgctggccgacggcggcacgctgttcctggac	Protospacer
*.  *  ******** **.************ *

565. spacer 3.30|625327|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP054620 (Azospirillum oryzae strain KACC 14407 plasmid unnamed5, complete sequence) position: , mismatch: 8, identity: 0.758

cccatccccgacggccgcgcgctgttcctggcc	CRISPR spacer
aagaccgccgacggcggcacgctgttcctggac	Protospacer
   *.* ******** **.************ *

566. spacer 3.30|625327|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_LR594663 (Variovorax sp. RA8 plasmid 2) position: , mismatch: 8, identity: 0.758

cccatccccgacggccgcgcgctgttcctggcc	CRISPR spacer
gccctggccggcggcctcgcgctgttcctggtg	Protospacer
 ** *  ***.***** **************.

567. spacer 3.30|625327|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.758

cccatccccgacggccgcgcgctgttcctggcc	CRISPR spacer
cggacgcccgagggccgggcgctgttcctgcgc	Protospacer
*  *. ***** ***** ************  *

568. spacer 3.31|625388|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP053022 (Sphingobium yanoikuyae strain YC-XJ2 plasmid p-A-Sy, complete sequence) position: , mismatch: 8, identity: 0.758

gatcggcctcggcgggatcggcgacaccctgaa	CRISPR spacer
gatcggcatcggcgcgatcggcgacgcgatcgc	Protospacer
******* ****** **********.*  * .

569. spacer 3.31|625388|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP024424 (Paracoccus yeei strain TT13 plasmid pTT13-2, complete sequence) position: , mismatch: 8, identity: 0.758

gatcggcct----cggcgggatcggcgacaccctgaa	CRISPR spacer
----ggcgctggacggcgggatcggcgacaagctgaa	Protospacer
    *** .    *****************  *****

570. spacer 3.31|625388|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP034351 (Streptomyces sp. W1SF4 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.758

gatcggcctcggcgggatcggcgacaccctgaa	CRISPR spacer
gacggcactcggcgggatcgccgacgccctggc	Protospacer
**. *  ************* ****.*****.

571. spacer 3.31|625388|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP017104 (Rhizobium gallicum strain IE4872 plasmid pRgalIE4872c, complete sequence) position: , mismatch: 8, identity: 0.758

gatcggcctcggcgggatcggcgacaccctgaa	CRISPR spacer
gcacgttgtcgtcgggttcggcgacaccctgag	Protospacer
*  ** . *** **** ***************.

572. spacer 3.31|625388|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NC_042014 (Arthrobacter phage Piccoletto, complete genome) position: , mismatch: 8, identity: 0.758

gatcggcctcggcgggatcggcgacaccctgaa	CRISPR spacer
cgccgggctctgcgggatcggcgacacgcgcaa	Protospacer
 ..*** *** **************** *  **

573. spacer 3.33|625510|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP017426 (Arthrobacter sp. ZXY-2 plasmid pZXY25, complete sequence) position: , mismatch: 8, identity: 0.758

cgatgagggcctggcgctcagccgggctacggg	CRISPR spacer
ccttgcgtgcctggcgctcagccgggctggcgt	Protospacer
*  ** * ********************.  *

574. spacer 3.33|625510|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP040819 (Paraoceanicella profunda strain D4M1 plasmid pD4M1A, complete sequence) position: , mismatch: 8, identity: 0.758

cgatgagggcctggcgctcagccgggctacggg---	CRISPR spacer
gcatgagggcctgccgctcatccggg---tgggcac	Protospacer
  *********** ****** *****   .***

575. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP016613 (Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gcacaggacagcagcagcccggcggcaacggc	Protospacer
.  *   .****************** *****

576. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP021449 (Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gcacaggacagcagcagcccggcggcaacggc	Protospacer
.  *   .****************** *****

577. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to CP023013 (Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gcacaggacagcagcagcccggcggcaacggc	Protospacer
.  *   .****************** *****

578. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP049790 (Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gcacaggacagcagcagcccggcggcaacggc	Protospacer
.  *   .****************** *****

579. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP049794 (Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gcacaggacagcagcagcccggcggcaacggc	Protospacer
.  *   .****************** *****

580. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP049788 (Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gcacaggacagcagcagcccggcggcaacggc	Protospacer
.  *   .****************** *****

581. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP022766 (Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gcacaggacagcagcagcccggcggcaacggc	Protospacer
.  *   .****************** *****

582. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP039340 (Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gcacaggacagcagcagcccggcggcaacggc	Protospacer
.  *   .****************** *****

583. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP021763 (Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gcacaggacagcagcagcccggcggcaacggc	Protospacer
.  *   .****************** *****

584. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP015116 (Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gcacaggacagcagcagcccggcggcaacggc	Protospacer
.  *   .****************** *****

585. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP016555 (Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gcacaggacagcagcagcccggcggcaacggc	Protospacer
.  *   .****************** *****

586. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP049792 (Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gcacaggacagcagcagcccggcggcaacggc	Protospacer
.  *   .****************** *****

587. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP052069 (Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gcacaggacagcagcagcccggcggcaacggc	Protospacer
.  *   .****************** *****

588. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP016915 (Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gcacaggacagcagcagcccggcggcaacggc	Protospacer
.  *   .****************** *****

589. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP016905 (Ralstonia solanacearum strain KACC 10709 plasmid unnamed1) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gcacaggacagcagcagcccggcggcaacggc	Protospacer
.  *   .****************** *****

590. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gcacaggacagcagcagcccggcggcaacggc	Protospacer
.  *   .****************** *****

591. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP022769 (Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gcacaggacagcagcagcccggcggcaacggc	Protospacer
.  *   .****************** *****

592. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP015851 (Ralstonia solanacearum strain YC40-M plasmid, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gcacaggacagcagcagcccggcggcaacggc	Protospacer
.  *   .****************** *****

593. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NC_013855 (Azospirillum sp. B510 plasmid pAB510a, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
cggttggccagcagcagcccggcggctccggc	Protospacer
 * ..   ******************* ****

594. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP022773 (Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gcacaggacagcagcagcccggcggcaacggc	Protospacer
.  *   .****************** *****

595. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP022783 (Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gcacaggacagcagcagcccggcggcaacggc	Protospacer
.  *   .****************** *****

596. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP022791 (Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gcacaggacagcagcagcccggcggcaacggc	Protospacer
.  *   .****************** *****

597. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP022795 (Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gcacaggacagcagcagcccggcggcaacggc	Protospacer
.  *   .****************** *****

598. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP052071 (Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gcacaggacagcagcagcccggcggcaacggc	Protospacer
.  *   .****************** *****

599. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP022482 (Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gcacaggacagcagcagcccggcggcaacggc	Protospacer
.  *   .****************** *****

600. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP009763 (Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gcacaggacagcagcagcccggcggcaacggc	Protospacer
.  *   .****************** *****

601. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to CP023015 (Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gcacaggacagcagcagcccggcggcaacggc	Protospacer
.  *   .****************** *****

602. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP022779 (Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gcacaggacagcagcagcccggcggcaacggc	Protospacer
.  *   .****************** *****

603. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP052075 (Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gcacaggacagcagcagcccggcggcaacggc	Protospacer
.  *   .****************** *****

604. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP052085 (Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gcacaggacagcagcagcccggcggcaacggc	Protospacer
.  *   .****************** *****

605. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP052095 (Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gcacaggacagcagcagcccggcggcaacggc	Protospacer
.  *   .****************** *****

606. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP052105 (Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gcacaggacagcagcagcccggcggcaacggc	Protospacer
.  *   .****************** *****

607. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP021765 (Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gcacaggacagcagcagcccggcggcaacggc	Protospacer
.  *   .****************** *****

608. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP052077 (Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gcacaggacagcagcagcccggcggcaacggc	Protospacer
.  *   .****************** *****

609. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP052087 (Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gcacaggacagcagcagcccggcggcaacggc	Protospacer
.  *   .****************** *****

610. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP052097 (Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gcacaggacagcagcagcccggcggcaacggc	Protospacer
.  *   .****************** *****

611. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP052115 (Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gcacaggacagcagcagcccggcggcaacggc	Protospacer
.  *   .****************** *****

612. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP052127 (Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gcacaggacagcagcagcccggcggcaacggc	Protospacer
.  *   .****************** *****

613. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP052079 (Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gcacaggacagcagcagcccggcggcaacggc	Protospacer
.  *   .****************** *****

614. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP052089 (Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gcacaggacagcagcagcccggcggcaacggc	Protospacer
.  *   .****************** *****

615. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP052093 (Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gcacaggacagcagcagcccggcggcaacggc	Protospacer
.  *   .****************** *****

616. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP052101 (Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gcacaggacagcagcagcccggcggcaacggc	Protospacer
.  *   .****************** *****

617. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP052099 (Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gcacaggacagcagcagcccggcggcaacggc	Protospacer
.  *   .****************** *****

618. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP052107 (Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gcacaggacagcagcagcccggcggcaacggc	Protospacer
.  *   .****************** *****

619. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP022781 (Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gcacaggacagcagcagcccggcggcaacggc	Protospacer
.  *   .****************** *****

620. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP052117 (Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gcacaggacagcagcagcccggcggcaacggc	Protospacer
.  *   .****************** *****

621. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP052125 (Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gcacaggacagcagcagcccggcggcaacggc	Protospacer
.  *   .****************** *****

622. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP022793 (Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gcacaggacagcagcagcccggcggcaacggc	Protospacer
.  *   .****************** *****

623. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP022785 (Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gcacaggacagcagcagcccggcggcaacggc	Protospacer
.  *   .****************** *****

624. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP022787 (Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gcacaggacagcagcagcccggcggcaacggc	Protospacer
.  *   .****************** *****

625. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP022756 (Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gcacaggacagcagcagcccggcggcaacggc	Protospacer
.  *   .****************** *****

626. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP052129 (Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gcacaggacagcagcagcccggcggcaacggc	Protospacer
.  *   .****************** *****

627. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP052121 (Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gcacaggacagcagcagcccggcggcaacggc	Protospacer
.  *   .****************** *****

628. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP052123 (Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gcacaggacagcagcagcccggcggcaacggc	Protospacer
.  *   .****************** *****

629. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP052131 (Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gcacaggacagcagcagcccggcggcaacggc	Protospacer
.  *   .****************** *****

630. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to CP011998 (Ralstonia solanacearum strain YC45 plasmid, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gcacaggacagcagcagcccggcggcaacggc	Protospacer
.  *   .****************** *****

631. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP052073 (Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gcacaggacagcagcagcccggcggcaacggc	Protospacer
.  *   .****************** *****

632. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP052081 (Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gcacaggacagcagcagcccggcggcaacggc	Protospacer
.  *   .****************** *****

633. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP052083 (Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gcacaggacagcagcagcccggcggcaacggc	Protospacer
.  *   .****************** *****

634. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP052109 (Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gcacaggacagcagcagcccggcggcaacggc	Protospacer
.  *   .****************** *****

635. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP052091 (Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gcacaggacagcagcagcccggcggcaacggc	Protospacer
.  *   .****************** *****

636. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP052111 (Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gcacaggacagcagcagcccggcggcaacggc	Protospacer
.  *   .****************** *****

637. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP052103 (Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gcacaggacagcagcagcccggcggcaacggc	Protospacer
.  *   .****************** *****

638. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP052119 (Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gcacaggacagcagcagcccggcggcaacggc	Protospacer
.  *   .****************** *****

639. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP052113 (Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gcacaggacagcagcagcccggcggcaacggc	Protospacer
.  *   .****************** *****

640. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP032343 (Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
cggccccgcagcagcgccccggcggctcgccc	Protospacer
 * ************. **********    *

641. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP030127 (Indioceanicola profundi strain SCSIO 08040 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
ggccgccgcagcagcagcacggcggagatcgt	Protospacer
.*** ************* ******  *. *.

642. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP030129 (Indioceanicola profundi strain SCSIO 08040 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
ggccgccgcagcagcagcacggcggagatcgt	Protospacer
.*** ************* ******  *. *.

643. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP032348 (Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
cggccccgcagcagcgccccggcggctcgccc	Protospacer
 * ************. **********    *

644. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP012917 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
cggccccgcagcagcgccccggcggctcgccc	Protospacer
 * ************. **********    *

645. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP035710 (Sphaerotilus natans subsp. sulfidivorans strain D-507 plasmid pSna507_unt10, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
tggcccagcagcagcaggccggcggcttccag	Protospacer
 * *** ********** ********* * .

646. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
agcccgagcagcagcagcccggccagttcgca	Protospacer
*****  **************** . * **

647. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
agcccgagcagcagcagcccggccagttcgca	Protospacer
*****  **************** . * **

648. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP012399 (Chelatococcus sp. CO-6 plasmid pCO-6, complete sequence) position: , mismatch: 8, identity: 0.75

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gcctcgcttagcagcagccaggcggccacggc	Protospacer
. *.* * .********** ******.*****

649. spacer 8.1|7220782|31|NC_016109|CRISPRCasFinder matches to NZ_AP022602 (Mycobacterium gallinarum strain JCM 6399 plasmid pJCM6399) position: , mismatch: 8, identity: 0.742

tcagcaggtcgtccgtatcggtggcgacagc	CRISPR spacer
acgtgaactcgtccggatcggtgtcgacagc	Protospacer
 *.  *. ******* ******* *******

650. spacer 8.1|7220782|31|NC_016109|CRISPRCasFinder matches to MG589384 (Enterobacter phage phi63_307, complete genome) position: , mismatch: 8, identity: 0.742

tcagcaggtcgtccgtatcggtggcgacagc	CRISPR spacer
tcagcacgtcttccgtatcggtgtatacgat	Protospacer
****** *** ************   **...

651. spacer 8.1|7220782|31|NC_016109|CRISPRCasFinder matches to KR080195 (Mycobacterium phage Phayonce, complete genome) position: , mismatch: 8, identity: 0.742

tcagcaggtcgtccgtatcggtggcgacagc	CRISPR spacer
tcgaggcgtcgtcgatatcggtggcgacagt	Protospacer
**.. . ****** .***************.

652. spacer 8.1|7220782|31|NC_016109|CRISPRCasFinder matches to MK759884 (Salmonella phage vB_SenM_SB18, complete genome) position: , mismatch: 8, identity: 0.742

tcagcaggtcgtccgtatcggtggcgacagc	CRISPR spacer
tcagcacgtcttccgtatcggtgtatacgat	Protospacer
****** *** ************   **...

653. spacer 8.1|7220782|31|NC_016109|CRISPRCasFinder matches to NC_015292 (Erwinia phage phiEa104, complete genome) position: , mismatch: 8, identity: 0.742

tcagcaggtcgtccgtatcggtggcgacagc	CRISPR spacer
tcagcacgtcttccgtatcggtgtatacgat	Protospacer
****** *** ************   **...

654. spacer 8.1|7220782|31|NC_016109|CRISPRCasFinder matches to MH426725 (Erwinia phage SunLIRen, complete genome) position: , mismatch: 8, identity: 0.742

tcagcaggtcgtccgtatcggtggcgacagc	CRISPR spacer
tcagcacgtcttccgtatcggtgtatacgat	Protospacer
****** *** ************   **...

655. spacer 8.1|7220782|31|NC_016109|CRISPRCasFinder matches to FQ482083 (Erwinia amylovora phage phiEa104 complete genome) position: , mismatch: 8, identity: 0.742

tcagcaggtcgtccgtatcggtggcgacagc	CRISPR spacer
tcagcacgtcttccgtatcggtgtatacgat	Protospacer
****** *** ************   **...

656. spacer 8.1|7220782|31|NC_016109|CRISPRCasFinder matches to HQ728263 (Erwinia phage vB_EamM-M7, complete genome) position: , mismatch: 8, identity: 0.742

tcagcaggtcgtccgtatcggtggcgacagc	CRISPR spacer
tcagcacgtcttccgtatcggtgtatacgat	Protospacer
****** *** ************   **...

657. spacer 8.1|7220782|31|NC_016109|CRISPRCasFinder matches to NC_011811 (Erwinia phage phiEa21-4, complete genome) position: , mismatch: 8, identity: 0.742

tcagcaggtcgtccgtatcggtggcgacagc	CRISPR spacer
tcagcacgtcttccgtatcggtgtatacgat	Protospacer
****** *** ************   **...

658. spacer 8.1|7220782|31|NC_016109|CRISPRCasFinder matches to MN604407 (Salmonella phage ST-3, complete genome) position: , mismatch: 8, identity: 0.742

tcagcaggtcgtccgtatcggtggcgacagc	CRISPR spacer
tcagcacgtcttccgtatcggtgtatacgat	Protospacer
****** *** ************   **...

659. spacer 8.1|7220782|31|NC_016109|CRISPRCasFinder matches to MK770412 (Salmonella phage SE5, complete genome) position: , mismatch: 8, identity: 0.742

tcagcaggtcgtccgtatcggtggcgacagc	CRISPR spacer
tcagcacgtcttccgtatcggtgtgtacgat	Protospacer
****** *** ************   **...

660. spacer 9.4|7273190|31|NC_016109|CRISPRCasFinder matches to NZ_CP028348 (Novosphingobium sp. THN1 plasmid pTHN, complete sequence) position: , mismatch: 8, identity: 0.742

ggtcgaacacgccgtcggtctgcgcgcgccg	CRISPR spacer
cgccgaacacggcgtcggtctgcacgccggt	Protospacer
 *.******** ***********.***

661. spacer 9.4|7273190|31|NC_016109|CRISPRCasFinder matches to NZ_CP039905 (Agrobacterium tumefaciens strain CFBP6623 plasmid pAtCFBP6623a, complete sequence) position: , mismatch: 8, identity: 0.742

ggtcgaacacgccgtcggtctgcgcgcgccg	CRISPR spacer
gcgggaacaagccgtcggtctgcgcgagatc	Protospacer
*   ***** **************** * .

662. spacer 9.4|7273190|31|NC_016109|CRISPRCasFinder matches to NZ_CP018229 (Rhizobium leguminosarum strain Vaf-108 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

ggtcgaacacgccgtcggtctgcgcgcgccg	CRISPR spacer
cgcggaacacgtcgtcggtcttcgcgccagg	Protospacer
 *. *******.********* *****   *

663. spacer 9.4|7273190|31|NC_016109|CRISPRCasFinder matches to NZ_CP016290 (Rhizobium leguminosarum strain Vaf10 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.742

ggtcgaacacgccgtcggtctgcgcgcgccg	CRISPR spacer
cgcggaacacgtcgtcggtcttcgcgccagg	Protospacer
 *. *******.********* *****   *

664. spacer 9.4|7273190|31|NC_016109|CRISPRCasFinder matches to NC_010625 (Paraburkholderia phymatum STM815 plasmid pBPHY01, complete sequence) position: , mismatch: 8, identity: 0.742

ggtcgaacacgccgtcggtctgcgcgcgccg	CRISPR spacer
ggatgagcacgccgtcgctctgcgcgcaaac	Protospacer
** .**.********** *********.

665. spacer 9.7|7273373|31|NC_016109|CRISPRCasFinder matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 8, identity: 0.742

tgcagcaggcggtccgcggtgccgggcgcga	CRISPR spacer
ggcagcaggcgctgcgcggtgccggcccgcc	Protospacer
 ********** * *********** *

666. spacer 9.7|7273373|31|NC_016109|CRISPRCasFinder matches to LN997843 (Streptomyces reticuli genome assembly TUE45, plasmid : II) position: , mismatch: 8, identity: 0.742

tgcagcaggcggtccgcggtgccgggcgcga	CRISPR spacer
ccgaccgcgccgtccgcggtgccgggcgcgg	Protospacer
.  * *. ** *******************.

667. spacer 9.7|7273373|31|NC_016109|CRISPRCasFinder matches to NZ_CP044283 (Rhodococcus erythropolis strain X5 plasmid pRhX5, complete sequence) position: , mismatch: 8, identity: 0.742

tgcagcaggcggtccgcggtgccgggcgcga	CRISPR spacer
cgagggtcgcgattcgcggtgccgggcgcga	Protospacer
.* .*   ***.*.*****************

668. spacer 9.7|7273373|31|NC_016109|CRISPRCasFinder matches to NZ_CP041045 (Paracoccus sp. AK26 plasmid pAK1, complete sequence) position: , mismatch: 8, identity: 0.742

tgcagcaggcggtccgcggtgccgggcgcga	CRISPR spacer
agcagcaggcgggccgcagtgccgattacgc	Protospacer
 *********** ****.******. ..**

669. spacer 9.7|7273373|31|NC_016109|CRISPRCasFinder matches to NZ_LR134459 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 17, complete sequence) position: , mismatch: 8, identity: 0.742

tgcagcaggcggtccgcggtgccgggcgcga	CRISPR spacer
cggccgaggcggtccgcggtgtcggtcgcca	Protospacer
.*    ***************.*** *** *

670. spacer 9.7|7273373|31|NC_016109|CRISPRCasFinder matches to NZ_AP022339 (Mameliella alba strain KU6B plasmid pKUB112, complete sequence) position: , mismatch: 8, identity: 0.742

---tgcagcaggcggtccgcggtgccgggcgcga	CRISPR spacer
gcgtgcagc---cgggccgcggtgccgggctgtt	Protospacer
   ******   *** **************

671. spacer 9.9|7273495|31|NC_016109|CRISPRCasFinder matches to NZ_LR134460 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 18, complete sequence) position: , mismatch: 8, identity: 0.742

tagtgatcacgaggccgagccaggtggtcat	CRISPR spacer
gcccgatcacgatgccgagccagctggcgat	Protospacer
   .******** ********** ***. **

672. spacer 9.11|7273627|31|NC_016109|CRISPRCasFinder matches to NZ_CP054606 (Sulfitobacter pseudonitzschiae strain H46 plasmid unnamed7, complete sequence) position: , mismatch: 8, identity: 0.742

gcatcggcggcgcgatggagcaggagcccat	CRISPR spacer
ggatcggcggcgcgacggagcgggaagtctc	Protospacer
* *************.*****.***. .* .

673. spacer 9.13|7273749|31|NC_016109|CRISPRCasFinder matches to NZ_CP011665 (Streptomyces sp. Mg1 plasmid pSMg1-1, complete sequence) position: , mismatch: 8, identity: 0.742

cgacgccgcgggtccggatcaccgcgacgta	CRISPR spacer
cgacgccgcggatccggatcaccacccgccg	Protospacer
***********.***********.*    ..

674. spacer 9.13|7273749|31|NC_016109|CRISPRCasFinder matches to NZ_CP017105 (Rhizobium gallicum strain IE4872 plasmid pRgalIE4872d, complete sequence) position: , mismatch: 8, identity: 0.742

cgacgccgcgggtccggatcaccgcgacgta	CRISPR spacer
tcacgccgctggtccggatcaccgcctggcg	Protospacer
. ******* ***************   *..

675. spacer 9.13|7273749|31|NC_016109|CRISPRCasFinder matches to NZ_CP021410 (Celeribacter manganoxidans strain DY25 plasmid pDY25-F, complete sequence) position: , mismatch: 8, identity: 0.742

cgacgccgcgggtccggatcaccgcgacgta	CRISPR spacer
tctcgccgcgggtccggatcaacacgcggga	Protospacer
.  ****************** *.**  * *

676. spacer 9.13|7273749|31|NC_016109|CRISPRCasFinder matches to NZ_CP030762 (Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

cgacgccgcgggtccggatcaccgcgacgta	CRISPR spacer
ggacgccacgggtcctgatcaccgacaagct	Protospacer
 ******.******* ********  * *.

677. spacer 9.13|7273749|31|NC_016109|CRISPRCasFinder matches to MH536819 (Gordonia phage Fury, complete genome) position: , mismatch: 8, identity: 0.742

cgacgccgcgggtccggatcaccgcgacgta	CRISPR spacer
cactgtcgccggtccggatcaccgcggcgct	Protospacer
*. .*.*** ****************.**.

678. spacer 9.13|7273749|31|NC_016109|CRISPRCasFinder matches to MH576960 (Gordonia phage Pleakley, complete genome) position: , mismatch: 8, identity: 0.742

cgacgccgcgggtccggatcaccgcgacgta	CRISPR spacer
cactgtcgccggtccggatcaccgcggcgct	Protospacer
*. .*.*** ****************.**.

679. spacer 9.14|7273810|31|NC_016109|CRISPRCasFinder matches to NC_014120 (Paraburkholderia sp. CCGE1002 plasmid pBC201, complete sequence) position: , mismatch: 8, identity: 0.742

acgcctaccgcaccgtcgccgcccagctccg	CRISPR spacer
aacgtgaccgcgccgtcgccgcccagatcct	Protospacer
*   . *****.************** ***

680. spacer 9.14|7273810|31|NC_016109|CRISPRCasFinder matches to MN234179 (Gordonia phage Pipp, complete genome) position: , mismatch: 8, identity: 0.742

acgcctaccgcaccgtcgccgcccagctccg	CRISPR spacer
gcggtcgccgcatcgtcgccgcccagctcgt	Protospacer
.** ...*****.****************

681. spacer 9.14|7273810|31|NC_016109|CRISPRCasFinder matches to MK501729 (Gordonia phage Walrus, complete genome) position: , mismatch: 8, identity: 0.742

acgcctaccgcaccgtcgccgcccagctccg	CRISPR spacer
gcggtcgccgcatcgtcgccgcccagctcgt	Protospacer
.** ...*****.****************

682. spacer 9.14|7273810|31|NC_016109|CRISPRCasFinder matches to NC_022125 (Rhodococcus erythropolis CCM2595 plasmid pRECF1, complete sequence) position: , mismatch: 8, identity: 0.742

acgcctaccgcaccgtcgccgcccagctccg	CRISPR spacer
tcgagcgccgcagcgtcgccgctcagctccc	Protospacer
 **  ..***** *********.*******

683. spacer 9.14|7273810|31|NC_016109|CRISPRCasFinder matches to NZ_CP015205 (Rhodococcus sp. 008 plasmid pR8C2, complete sequence) position: , mismatch: 8, identity: 0.742

acgcctaccgcaccgtcgccgcccagctccg	CRISPR spacer
gcgagcgccgcagcgtcgccgctcagctccc	Protospacer
.**  ..***** *********.*******

684. spacer 9.14|7273810|31|NC_016109|CRISPRCasFinder matches to NC_015057 (Granulicella tundricola MP5ACTX9 plasmid pACIX901, complete sequence) position: , mismatch: 8, identity: 0.742

acgcctaccgcaccgtcgccgcccagctccg	CRISPR spacer
ccgcctacctcaccgtcgtcgccctctacct	Protospacer
 ******** ********.*****  . **

685. spacer 9.14|7273810|31|NC_016109|CRISPRCasFinder matches to NZ_CP025960 (Rhodococcus qingshengii strain djl-6-2 plasmid pDJL1, complete sequence) position: , mismatch: 8, identity: 0.742

acgcctaccgcaccgtcgccgcccagctccg	CRISPR spacer
gcgagcgccgcagcgtcgccgctcagctccc	Protospacer
.**  ..***** *********.*******

686. spacer 9.14|7273810|31|NC_016109|CRISPRCasFinder matches to NZ_CP011297 (Rhodococcus erythropolis strain BG43 plasmid pRLLBG43, complete sequence) position: , mismatch: 8, identity: 0.742

acgcctaccgcaccgtcgccgcccagctccg	CRISPR spacer
gcgagcgccgcagcgtcgccgctcagctccc	Protospacer
.**  ..***** *********.*******

687. spacer 9.14|7273810|31|NC_016109|CRISPRCasFinder matches to NZ_CP034352 (Streptomyces sp. W1SF4 plasmid p2, complete sequence) position: , mismatch: 8, identity: 0.742

acgcctaccgcaccgtcgccgcccagctccg	CRISPR spacer
acgcgttccgcaccgtcgccgcctccgtctc	Protospacer
**** * ****************.   **.

688. spacer 9.14|7273810|31|NC_016109|CRISPRCasFinder matches to NZ_CP017300 (Rhodococcus sp. YL-1 plasmid pYLC1, complete sequence) position: , mismatch: 8, identity: 0.742

acgcctaccgcaccgtcgccgcccagctccg	CRISPR spacer
gcgagcgccgcagcgtcgccgctcagctccc	Protospacer
.**  ..***** *********.*******

689. spacer 9.14|7273810|31|NC_016109|CRISPRCasFinder matches to NZ_LR134465 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 23, complete sequence) position: , mismatch: 8, identity: 0.742

acgcctaccgcaccgtcgccgcccagctccg	CRISPR spacer
acgcctaccgcatcgtcgacgccgacgacat	Protospacer
************.***** **** *   *

690. spacer 9.14|7273810|31|NC_016109|CRISPRCasFinder matches to NC_016586 (Azospirillum lipoferum 4B plasmid AZO_p2, complete sequence) position: , mismatch: 8, identity: 0.742

acgcctaccgcaccgtcgccgcccagctccg	CRISPR spacer
acgcctaccccaccgtcaccgcctcggccgc	Protospacer
********* *******.*****. * .*

691. spacer 9.15|7273871|31|NC_016109|CRISPRCasFinder matches to MK433272 (Gordonia phage IDyn, complete genome) position: , mismatch: 8, identity: 0.742

acgtccggacgctggcgcactcgacgtacag	CRISPR spacer
ccagccggacgctggcgcagtcgacggtcta	Protospacer
 *. *************** ******  * .

692. spacer 9.15|7273871|31|NC_016109|CRISPRCasFinder matches to NZ_CP015738 (Shinella sp. HZN7 plasmid pShin-02, complete sequence) position: , mismatch: 8, identity: 0.742

acgtccggacgctggcgcactcgacgtacag	CRISPR spacer
cgctcctgacgctggcgctctcgacggtcat	Protospacer
   *** *********** *******  **

693. spacer 9.16|7273932|31|NC_016109|CRISPRCasFinder matches to NZ_CP046906 (Streptomyces sp. QHH-9511 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.742

gctccagccagtacggcagccactcggagag	CRISPR spacer
tgtccacccaggacggcagccactccggctg	Protospacer
  **** **** ************* *.  *

694. spacer 9.17|7273993|31|NC_016109|CRISPRCasFinder matches to NZ_CP021083 (Deinococcus ficus strain CC-FR2-10 plasmid pDFI2, complete sequence) position: , mismatch: 8, identity: 0.742

cgccgaccgcgcccaggaggagctggtccgc	CRISPR spacer
cgccgaccgcgccgagcaggagcgcgtggaa	Protospacer
************* ** ******  **  .

695. spacer 9.17|7273993|31|NC_016109|CRISPRCasFinder matches to NZ_LR134467 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 25, complete sequence) position: , mismatch: 8, identity: 0.742

cgccgaccgcgcccaggaggagctggtccgc	CRISPR spacer
gccggagcgcgcccaggaggatctggtggtc	Protospacer
  * ** ************** *****   *

696. spacer 9.17|7273993|31|NC_016109|CRISPRCasFinder matches to NZ_LR723672 (Rhizobium flavum strain YW14 plasmid 3) position: , mismatch: 8, identity: 0.742

cgccgaccgcgcccaggaggagctggtccgc	CRISPR spacer
cggtcaccccgcccaggaggagccggtcgag	Protospacer
** . *** **************.**** .

697. spacer 9.17|7273993|31|NC_016109|CRISPRCasFinder matches to KX961385 (Bordetella virus LK3, complete genome) position: , mismatch: 8, identity: 0.742

cgccgaccgcgcccaggaggagctggtccgc	CRISPR spacer
cttcgagcgcgcccgggaggagctggagaac	Protospacer
* .*** *******.***********   .*

698. spacer 9.17|7273993|31|NC_016109|CRISPRCasFinder matches to KY000220 (Bordetella phage FP1, complete genome) position: , mismatch: 8, identity: 0.742

cgccgaccgcgcccaggaggagctggtccgc	CRISPR spacer
cttcgagcgcgcccgggaggagctggagaac	Protospacer
* .*** *******.***********   .*

699. spacer 9.17|7273993|31|NC_016109|CRISPRCasFinder matches to KY000221 (Bordetella phage CN1, complete genome) position: , mismatch: 8, identity: 0.742

cgccgaccgcgcccaggaggagctggtccgc	CRISPR spacer
cttcgagcgcgcccgggaggagctggagaac	Protospacer
* .*** *******.***********   .*

700. spacer 9.17|7273993|31|NC_016109|CRISPRCasFinder matches to NC_047877 (Bordetella phage CN2, complete genome) position: , mismatch: 8, identity: 0.742

cgccgaccgcgcccaggaggagctggtccgc	CRISPR spacer
cttcgagcgcgcccgggaggagctggagaac	Protospacer
* .*** *******.***********   .*

701. spacer 9.17|7273993|31|NC_016109|CRISPRCasFinder matches to NC_047879 (Bordetella phage MW2, complete genome) position: , mismatch: 8, identity: 0.742

cgccgaccgcgcccaggaggagctggtccgc	CRISPR spacer
cttcgagcgcgcccgggaggagctggagaac	Protospacer
* .*** *******.***********   .*

702. spacer 9.21|7273189|32|NC_016109|CRT matches to NZ_LR134452 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 10, complete sequence) position: , mismatch: 8, identity: 0.75

cggtcgaacacgccgtcggtctgcgcgcgccg	CRISPR spacer
agctgctccacgccgtcgatctccgcgcgccg	Protospacer
 * *    **********.*** *********

703. spacer 9.21|7273189|32|NC_016109|CRT matches to NZ_CP016082 (Streptomyces sp. SAT1 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

cggtcgaacacgccgtcggtctgcgcgcgccg	CRISPR spacer
ttggcgaacacgcggtcggcctgcgcggtcag	Protospacer
. * ********* *****.*******  * *

704. spacer 9.24|7273372|32|NC_016109|CRT matches to NZ_CP039697 (Novosphingobium sp. ABRDHK2 plasmid pABRDHK22, complete sequence) position: , mismatch: 8, identity: 0.75

gtgcagcaggcggtccgcggtgccgggcgcga	CRISPR spacer
ttccagcaggcggtgcgcggtgccggcgatca	Protospacer
 * *********** ***********  .. *

705. spacer 9.24|7273372|32|NC_016109|CRT matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 8, identity: 0.75

gtgcagcaggcggtccgcggtgccgggcgcga	CRISPR spacer
gggcagcaggcgctgcgcggtgccggcccgcc	Protospacer
* ********** * *********** *

706. spacer 9.24|7273372|32|NC_016109|CRT matches to NZ_AP022339 (Mameliella alba strain KU6B plasmid pKUB112, complete sequence) position: , mismatch: 8, identity: 0.75

---gtgcagcaggcggtccgcggtgccgggcgcga	CRISPR spacer
cgcgtgcagc---cgggccgcggtgccgggctgtt	Protospacer
   *******   *** **************

707. spacer 9.24|7273372|32|NC_016109|CRT matches to NZ_CP006995 (Methylobacterium sp. AMS5 plasmid pAMS5c, complete sequence) position: , mismatch: 8, identity: 0.75

gtgcagcaggcggtccgcggtgccgggcgcga	CRISPR spacer
atgaggttggcggtccgcgatgccgtgcgcgg	Protospacer
.** .*. ***********.***** *****.

708. spacer 9.26|7273494|32|NC_016109|CRT matches to NZ_LR134460 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 18, complete sequence) position: , mismatch: 8, identity: 0.75

gtagtgatcacgaggccgagccaggtggtcat	CRISPR spacer
ggcccgatcacgatgccgagccagctggcgat	Protospacer
*   .******** ********** ***. **

709. spacer 9.30|7273748|32|NC_016109|CRT matches to NZ_CP017105 (Rhizobium gallicum strain IE4872 plasmid pRgalIE4872d, complete sequence) position: , mismatch: 8, identity: 0.75

gcgacgccgcgggtccggatcaccgcgacgta	CRISPR spacer
gtcacgccgctggtccggatcaccgcctggcg	Protospacer
*. ******* ***************   *..

710. spacer 9.30|7273748|32|NC_016109|CRT matches to NZ_CP021410 (Celeribacter manganoxidans strain DY25 plasmid pDY25-F, complete sequence) position: , mismatch: 8, identity: 0.75

gcgacgccgcgggtccggatcaccgcgacgta	CRISPR spacer
gtctcgccgcgggtccggatcaacacgcggga	Protospacer
*.  ****************** *.**  * *

711. spacer 9.30|7273748|32|NC_016109|CRT matches to MH536819 (Gordonia phage Fury, complete genome) position: , mismatch: 8, identity: 0.75

gcgacgccgcgggtccggatcaccgcgacgta	CRISPR spacer
gcactgtcgccggtccggatcaccgcggcgct	Protospacer
**. .*.*** ****************.**.

712. spacer 9.30|7273748|32|NC_016109|CRT matches to MH576960 (Gordonia phage Pleakley, complete genome) position: , mismatch: 8, identity: 0.75

gcgacgccgcgggtccggatcaccgcgacgta	CRISPR spacer
gcactgtcgccggtccggatcaccgcggcgct	Protospacer
**. .*.*** ****************.**.

713. spacer 9.31|7273809|32|NC_016109|CRT matches to NC_022599 (Micrococcus sp. V7 plasmid pLMV7, complete sequence) position: , mismatch: 8, identity: 0.75

gacgcctaccgcaccgtcgccgcccagctccg	CRISPR spacer
ccccggcaccgcaccgtcgccgccaagcgccg	Protospacer
  *   .***************** *** ***

714. spacer 9.31|7273809|32|NC_016109|CRT matches to NZ_CP034352 (Streptomyces sp. W1SF4 plasmid p2, complete sequence) position: , mismatch: 8, identity: 0.75

gacgcctaccgcaccgtcgccgcccagctccg	CRISPR spacer
gacgcgttccgcaccgtcgccgcctccgtctc	Protospacer
***** * ****************.   **.

715. spacer 9.31|7273809|32|NC_016109|CRT matches to NC_016623 (Azospirillum lipoferum 4B plasmid AZO_p3, complete sequence) position: , mismatch: 8, identity: 0.75

gacgcctaccgcaccgtcgccgcccagctccg	CRISPR spacer
gaggcctaccgcaccgccgccgccgccatcgt	Protospacer
** *************.*******    **

716. spacer 9.31|7273809|32|NC_016109|CRT matches to NZ_CP054616 (Azospirillum oryzae strain KACC 14407 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

gacgcctaccgcaccgtcgccgcccagctccg	CRISPR spacer
gaggcctaccgcaccgccgccgccgccatcgt	Protospacer
** *************.*******    **

717. spacer 9.31|7273809|32|NC_016109|CRT matches to NC_016586 (Azospirillum lipoferum 4B plasmid AZO_p2, complete sequence) position: , mismatch: 8, identity: 0.75

gacgcctaccgcaccgtcgccgcccagctccg	CRISPR spacer
gacgcctaccccaccgtcaccgcctcggccgc	Protospacer
********** *******.*****. * .*

718. spacer 9.32|7273870|32|NC_016109|CRT matches to NZ_CP015738 (Shinella sp. HZN7 plasmid pShin-02, complete sequence) position: , mismatch: 8, identity: 0.75

cacgtccggacgctggcgcactcgacgtacag	CRISPR spacer
ccgctcctgacgctggcgctctcgacggtcat	Protospacer
*   *** *********** *******  **

719. spacer 9.33|7273931|32|NC_016109|CRT matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

tgctccagccagtacggcagccactcggagag	CRISPR spacer
cgcaccagccagtacggcagccacgccaggcc	Protospacer
.** ******************** * ..*

720. spacer 9.34|7273992|32|NC_016109|CRT matches to NZ_CP021083 (Deinococcus ficus strain CC-FR2-10 plasmid pDFI2, complete sequence) position: , mismatch: 8, identity: 0.75

acgccgaccgcgcccaggaggagctggtccgc	CRISPR spacer
acgccgaccgcgccgagcaggagcgcgtggaa	Protospacer
************** ** ******  **  .

721. spacer 9.34|7273992|32|NC_016109|CRT matches to NZ_CP034472 (Pantoea agglomerans strain CFSAN047153 plasmid pCFSAN047153_3, complete sequence) position: , mismatch: 8, identity: 0.75

acgccgaccgcgcccaggaggagctggtccgc	CRISPR spacer
cgcccgagcgcgcgcaggaggagctgtcgcgc	Protospacer
   **** ***** ************ . ***

722. spacer 9.34|7273992|32|NC_016109|CRT matches to NZ_CP034477 (Pantoea agglomerans strain CFSAN047154 plasmid pCFSAN047154_3, complete sequence) position: , mismatch: 8, identity: 0.75

acgccgaccgcgcccaggaggagctggtccgc	CRISPR spacer
cgcccgagcgcgcgcaggaggagctgtcgcgc	Protospacer
   **** ***** ************ . ***

723. spacer 9.37|7273188|33|NC_016109|PILER-CR matches to NZ_LR134452 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 10, complete sequence) position: , mismatch: 8, identity: 0.758

gcggtcg-aacacgccgtcggtctgcgcgcgccg	CRISPR spacer
-cagctgctccacgccgtcgatctccgcgcgccg	Protospacer
 *.*..*   **********.*** *********

724. spacer 9.40|7273371|33|NC_016109|PILER-CR matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 8, identity: 0.758

agtgcagcaggcggtccgcggtgccgggcgcga	CRISPR spacer
tcgccagcaggcggtccacggcgccgggcgccc	Protospacer
    *************.***.*********

725. spacer 9.40|7273371|33|NC_016109|PILER-CR matches to NC_005838 (Thermus thermophilus HB27 plasmid pTT27, complete sequence) position: , mismatch: 8, identity: 0.758

agtgcagcaggcggtccgcggtgccgggcgcga	CRISPR spacer
tcgccagcaggcggtccacggcgccgggcgccc	Protospacer
    *************.***.*********

726. spacer 9.46|7273747|33|NC_016109|PILER-CR matches to NZ_CP032322 (Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.758

ggcgacgccgcgggtccggatcaccgcgacgta	CRISPR spacer
cgcgtcgccgcgggtcaggatcaccagcacgcc	Protospacer
 *** *********** ********.  ***.

727. spacer 9.46|7273747|33|NC_016109|PILER-CR matches to NZ_CP022367 (Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence) position: , mismatch: 8, identity: 0.758

ggcgacgccgcgggtccggatcaccgcgacgta	CRISPR spacer
cgcgtcgccgcgggtcaggatcaccagcacgcc	Protospacer
 *** *********** ********.  ***.

728. spacer 9.46|7273747|33|NC_016109|PILER-CR matches to NZ_CP007794 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence) position: , mismatch: 8, identity: 0.758

ggcgacgccgcgggtccggatcaccgcgacgta	CRISPR spacer
cgcgtcgccgcgggtcaggatcaccagcacgcc	Protospacer
 *** *********** ********.  ***.

729. spacer 9.46|7273747|33|NC_016109|PILER-CR matches to NZ_CP032340 (Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.758

ggcgacgccgcgggtccggatcaccgcgacgta	CRISPR spacer
cgcgtcgccgcgggtcaggatcaccagcacgcc	Protospacer
 *** *********** ********.  ***.

730. spacer 9.46|7273747|33|NC_016109|PILER-CR matches to NZ_CP032346 (Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.758

ggcgacgccgcgggtccggatcaccgcgacgta	CRISPR spacer
cgcgtcgccgcgggtcaggatcaccagcacgcc	Protospacer
 *** *********** ********.  ***.

731. spacer 9.46|7273747|33|NC_016109|PILER-CR matches to NZ_CP012915 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence) position: , mismatch: 8, identity: 0.758

ggcgacgccgcgggtccggatcaccgcgacgta	CRISPR spacer
cgcgtcgccgcgggtcaggatcaccagcacgcc	Protospacer
 *** *********** ********.  ***.

732. spacer 9.47|7273808|33|NC_016109|PILER-CR matches to NZ_CP049749 (Rhodococcus fascians A21d2 plasmid pA21d2, complete sequence) position: , mismatch: 8, identity: 0.758

ggacgcct-----accgcaccgtcgccgcccagctccg	CRISPR spacer
-----cccgcagaaccgcaccgtcgccgccctgcaccg	Protospacer
     **.     ****************** ** ***

733. spacer 9.47|7273808|33|NC_016109|PILER-CR matches to NC_016623 (Azospirillum lipoferum 4B plasmid AZO_p3, complete sequence) position: , mismatch: 8, identity: 0.758

ggacgcctaccgcaccgtcgccgcccagctccg	CRISPR spacer
ggaggcctaccgcaccgccgccgccgccatcgt	Protospacer
*** *************.*******    **

734. spacer 9.47|7273808|33|NC_016109|PILER-CR matches to NZ_CP054616 (Azospirillum oryzae strain KACC 14407 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.758

ggacgcctaccgcaccgtcgccgcccagctccg	CRISPR spacer
ggaggcctaccgcaccgccgccgccgccatcgt	Protospacer
*** *************.*******    **

735. spacer 2.1|613107|32|NC_016109|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 9, identity: 0.719

gccgtcgacggcctgaccgacgacgagggcgc	CRISPR spacer
tcgctcgaagacctgaccgacgacgagttccg	Protospacer
 *  **** *.****************  *

736. spacer 2.1|613107|32|NC_016109|CRT matches to NZ_AP014705 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence) position: , mismatch: 9, identity: 0.719

gccgtcgacggcctgaccgacgacgagggcgc	CRISPR spacer
ctcatcgagggcctgaccgaggacgagatcct	Protospacer
 .*.**** *********** ******. * .

737. spacer 2.1|613107|32|NC_016109|CRT matches to NZ_CP032349 (Azospirillum brasilense strain MTCC4039 plasmid p3, complete sequence) position: , mismatch: 9, identity: 0.719

gccgtcgacggcctgaccgacgacgagggcgc	CRISPR spacer
catctcgacatcctgaccgacgacgagaaggc	Protospacer
  . *****. ****************.. **

738. spacer 2.1|613107|32|NC_016109|CRT matches to FJ937737 (Burkholderia cenocepacia phage BcepIL02, complete genome) position: , mismatch: 9, identity: 0.719

gccgtcgacggcctgaccgacgacgagggcgc	CRISPR spacer
cttttgagcggcctgaccgacgaggagcgcgc	Protospacer
 .. * ..*************** *** ****

739. spacer 2.1|613107|32|NC_016109|CRT matches to NC_012743 (Burkholderia phage BcepIL02, complete genome) position: , mismatch: 9, identity: 0.719

gccgtcgacggcctgaccgacgacgagggcgc	CRISPR spacer
cttttgagcggcctgaccgacgaggagcgcgc	Protospacer
 .. * ..*************** *** ****

740. spacer 2.1|613107|32|NC_016109|CRT matches to CP054921 (Streptomyces sp. NA03103 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

gccgtcgacggcctgaccgacgacgagggcgc	CRISPR spacer
gaggcgatcggcctgaccgacgccgagtgcga	Protospacer
*  *. . ************** **** ***

741. spacer 2.1|613107|32|NC_016109|CRT matches to NZ_CP027025 (Streptomyces sp. WAC00288 plasmid p3, complete sequence) position: , mismatch: 9, identity: 0.719

gccgtcgacggcctgaccgacgacgagggcgc	CRISPR spacer
ttcctcgccggcctgaccgccgacgagacagt	Protospacer
 .* *** *********** *******.  *.

742. spacer 2.1|613107|32|NC_016109|CRT matches to NZ_CP013345 (Sphingopyxis macrogoltabida strain 203N plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

gccgtcgacggcctgaccgacgacgagggcgc	CRISPR spacer
acggcgctggggctgatcgacgacgagggcgc	Protospacer
.* *.    ** ****.***************

743. spacer 2.1|613107|32|NC_016109|CRT matches to NC_007765 (Rhizobium etli CFN 42 plasmid p42e, complete sequence) position: , mismatch: 9, identity: 0.719

gccgtcgacggcctgaccgacgacgagggcgc	CRISPR spacer
ctcgccgacggcctgaccgaggacgtcatcac	Protospacer
 .**.*************** ****  . *.*

744. spacer 2.1|613107|32|NC_016109|CRT matches to NZ_CP039340 (Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence) position: , mismatch: 9, identity: 0.719

gccgtcgacggcctgaccgacgacgagggcgc	CRISPR spacer
gccggcgacgacctgaccgacgaaagcgcctt	Protospacer
**** *****.************ .. * * .

745. spacer 2.1|613107|32|NC_016109|CRT matches to NZ_CP020909 (Rhizobium etli strain NXC12 plasmid pRetNXC12c, complete sequence) position: , mismatch: 9, identity: 0.719

gccgtcgacggcctgaccgacgacgagggcgc	CRISPR spacer
ctcgccgacggcctgaccgaggacgtcatcac	Protospacer
 .**.*************** ****  . *.*

746. spacer 2.1|613107|32|NC_016109|CRT matches to NZ_CP025613 (Niveispirillum cyanobacteriorum strain TH16 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

gccgtcgacggcctgaccgacgacgagggcgc	CRISPR spacer
ggtctttccggcctgaccgaccgcgagggcga	Protospacer
* . *.  ************* .********

747. spacer 2.1|613107|32|NC_016109|CRT matches to NC_021908 (Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1d, complete sequence) position: , mismatch: 9, identity: 0.719

gccgtcgacggcctgaccgacgacgagggcgc	CRISPR spacer
ctcgccgacggcctgaccgaggacgtcatcac	Protospacer
 .**.*************** ****  . *.*

748. spacer 2.1|613107|32|NC_016109|CRT matches to NZ_CP017563 (Paraburkholderia sprentiae WSM5005 plasmid pl1WSM5005, complete sequence) position: , mismatch: 9, identity: 0.719

gccgtcgacggcctgaccgacgacgagggcgc-	CRISPR spacer
attcccgacggcctgaccgacga-gcaggtgct	Protospacer
... .****************** * .**.**

749. spacer 2.1|613107|32|NC_016109|CRT matches to LN997843 (Streptomyces reticuli genome assembly TUE45, plasmid : II) position: , mismatch: 9, identity: 0.719

gccgtcgacggcctgaccgacgacgagggcgc	CRISPR spacer
gtcttcgccggcctgaccgtcgacgagaatct	Protospacer
*.* *** *********** *******... .

750. spacer 2.2|613168|32|NC_016109|CRT matches to NZ_CP050098 (Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b4, complete sequence) position: , mismatch: 9, identity: 0.719

accacgcccgcccgtcgtcgccccagatgtcc	CRISPR spacer
ggaacgcctgaccgtcgtcgccccagagatat	Protospacer
.  *****.* **************** .* .

751. spacer 2.2|613168|32|NC_016109|CRT matches to NZ_CP021033 (Rhizobium sp. NXC14 plasmid pRspNXC14c, complete sequence) position: , mismatch: 9, identity: 0.719

accacgcccgcccgtcgtcgccccagatgtcc	CRISPR spacer
ggaacgcctggccgtcgtcgccccagagatag	Protospacer
.  *****.* **************** .*

752. spacer 2.2|613168|32|NC_016109|CRT matches to NZ_CP049731 (Rhizobium leguminosarum strain A1 plasmid pRL12, complete sequence) position: , mismatch: 9, identity: 0.719

accacgcccgcccgtcgtcgccccagatgtcc	CRISPR spacer
ggaacgcctgaccgtcgtcgccccagagatat	Protospacer
.  *****.* **************** .* .

753. spacer 2.2|613168|32|NC_016109|CRT matches to NC_007766 (Rhizobium etli CFN 42 plasmid p42f, complete sequence) position: , mismatch: 9, identity: 0.719

accacgcccgcccgtcgtcgccccagatgtcc	CRISPR spacer
ggaacgcctggccgtcgtcgccccagagatag	Protospacer
.  *****.* **************** .*

754. spacer 2.2|613168|32|NC_016109|CRT matches to NZ_CP053440 (Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eF, complete sequence) position: , mismatch: 9, identity: 0.719

accacgcccgcccgtcgtcgccccagatgtcc	CRISPR spacer
ggaacgcctgaccgtcgtcgccccagagatat	Protospacer
.  *****.* **************** .* .

755. spacer 2.2|613168|32|NC_016109|CRT matches to NZ_CP006990 (Rhizobium sp. IE4771 plasmid pRetIE4771d, complete sequence) position: , mismatch: 9, identity: 0.719

accacgcccgcccgtcgtcgccccagatgtcc	CRISPR spacer
ggaacgcctggccgtcgtcgccccagagatag	Protospacer
.  *****.* **************** .*

756. spacer 2.2|613168|32|NC_016109|CRT matches to NZ_CP021029 (Rhizobium sp. TAL182 plasmid pRetTAL182e, complete sequence) position: , mismatch: 9, identity: 0.719

accacgcccgcccgtcgtcgccccagatgtcc	CRISPR spacer
ggaacgcctgaccgtcgtcgccccagagatag	Protospacer
.  *****.* **************** .*

757. spacer 2.2|613168|32|NC_016109|CRT matches to NZ_CP013635 (Rhizobium sp. N324 plasmid pRspN324e, complete sequence) position: , mismatch: 9, identity: 0.719

accacgcccgcccgtcgtcgccccagatgtcc	CRISPR spacer
ggaacgcctggccgtcgtcgccccagagatag	Protospacer
.  *****.* **************** .*

758. spacer 2.2|613168|32|NC_016109|CRT matches to NZ_CP020911 (Rhizobium etli strain NXC12 plasmid pRetNXC12e, complete sequence) position: , mismatch: 9, identity: 0.719

accacgcccgcccgtcgtcgccccagatgtcc	CRISPR spacer
ggaacgcctggccgtcgtcgccccagagatag	Protospacer
.  *****.* **************** .*

759. spacer 2.2|613168|32|NC_016109|CRT matches to NZ_CP020952 (Rhizobium sp. CIAT894 plasmid pRheCIAT894e, complete sequence) position: , mismatch: 9, identity: 0.719

accacgcccgcccgtcgtcgccccagatgtcc	CRISPR spacer
ggaacgcctggccgtcgtcgccccagagatag	Protospacer
.  *****.* **************** .*

760. spacer 2.2|613168|32|NC_016109|CRT matches to NZ_CP013600 (Rhizobium sp. N741 plasmid pRspN741e, complete sequence) position: , mismatch: 9, identity: 0.719

accacgcccgcccgtcgtcgccccagatgtcc	CRISPR spacer
ggaacgcctgaccgtcgtcgccccagagatag	Protospacer
.  *****.* **************** .*

761. spacer 2.2|613168|32|NC_016109|CRT matches to NZ_CP013531 (Rhizobium phaseoli strain R723 plasmid pRphaR723d, complete sequence) position: , mismatch: 9, identity: 0.719

accacgcccgcccgtcgtcgccccagatgtcc	CRISPR spacer
ggaacgcctggccgtcgtcgccccagagataa	Protospacer
.  *****.* **************** .*

762. spacer 2.2|613168|32|NC_016109|CRT matches to NC_021911 (Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1f, complete sequence) position: , mismatch: 9, identity: 0.719

accacgcccgcccgtcgtcgccccagatgtcc	CRISPR spacer
ggaacgcctggccgtcgtcgccccagagatag	Protospacer
.  *****.* **************** .*

763. spacer 2.2|613168|32|NC_016109|CRT matches to NC_011368 (Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG201, complete sequence) position: , mismatch: 9, identity: 0.719

accacgcccgcccgtcgtcgccccagatgtcc	CRISPR spacer
ggaacgcctggccgtcgtcgccccagagatag	Protospacer
.  *****.* **************** .*

764. spacer 2.2|613168|32|NC_016109|CRT matches to NZ_CP013504 (Rhizobium esperanzae strain N561 plasmid pRspN561d, complete sequence) position: , mismatch: 9, identity: 0.719

accacgcccgcccgtcgtcgccccagatgtcc	CRISPR spacer
ggaacgcctgaccgtcgtcgccccagagatag	Protospacer
.  *****.* **************** .*

765. spacer 2.2|613168|32|NC_016109|CRT matches to NZ_CP013584 (Rhizobium phaseoli strain N261 plasmid pRphaN261d, complete sequence) position: , mismatch: 9, identity: 0.719

accacgcccgcccgtcgtcgccccagatgtcc	CRISPR spacer
ggaacgcctggccgtcgtcgccccagagataa	Protospacer
.  *****.* **************** .*

766. spacer 2.2|613168|32|NC_016109|CRT matches to NZ_CP013510 (Rhizobium sp. N1341 plasmid pRspN1341e, complete sequence) position: , mismatch: 9, identity: 0.719

accacgcccgcccgtcgtcgccccagatgtcc	CRISPR spacer
ggaacgcctgaccgtcgtcgccccagagatag	Protospacer
.  *****.* **************** .*

767. spacer 2.2|613168|32|NC_016109|CRT matches to NZ_CP013521 (Rhizobium sp. N113 plasmid pRspN113d, complete sequence) position: , mismatch: 9, identity: 0.719

accacgcccgcccgtcgtcgccccagatgtcc	CRISPR spacer
ggaacgcctgaccgtcgtcgccccagagatag	Protospacer
.  *****.* **************** .*

768. spacer 2.2|613168|32|NC_016109|CRT matches to NZ_CP013494 (Rhizobium sp. N6212 plasmid pRspN6212d, complete sequence) position: , mismatch: 9, identity: 0.719

accacgcccgcccgtcgtcgccccagatgtcc	CRISPR spacer
ggaacgcctgaccgtcgtcgccccagagatag	Protospacer
.  *****.* **************** .*

769. spacer 2.2|613168|32|NC_016109|CRT matches to NZ_CP013515 (Rhizobium sp. N1314 plasmid pRspN1314d, complete sequence) position: , mismatch: 9, identity: 0.719

accacgcccgcccgtcgtcgccccagatgtcc	CRISPR spacer
ggaacgcctgaccgtcgtcgccccagagatag	Protospacer
.  *****.* **************** .*

770. spacer 2.2|613168|32|NC_016109|CRT matches to NZ_CP054028 (Rhizobium sp. JKLM19E plasmid pPR19E01, complete sequence) position: , mismatch: 9, identity: 0.719

accacgcccgcccgtcgtcgccccagatgtcc	CRISPR spacer
gaaacgcctggccgtcgtcgccccagagataa	Protospacer
.  *****.* **************** .*

771. spacer 2.2|613168|32|NC_016109|CRT matches to NZ_CP013594 (Rhizobium sp. N871 plasmid pRspN871d, complete sequence) position: , mismatch: 9, identity: 0.719

accacgcccgcccgtcgtcgccccagatgtcc	CRISPR spacer
ggaacgcctgaccgtcgtcgccccagagatag	Protospacer
.  *****.* **************** .*

772. spacer 2.2|613168|32|NC_016109|CRT matches to CP007644 (Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803c, complete sequence) position: , mismatch: 9, identity: 0.719

accacgcccgcccgtcgtcgccccagatgtcc	CRISPR spacer
ggaacgcctggccgtcgtcgccccagagatag	Protospacer
.  *****.* **************** .*

773. spacer 2.2|613168|32|NC_016109|CRT matches to NC_010997 (Rhizobium etli CIAT 652 plasmid pC, complete sequence) position: , mismatch: 9, identity: 0.719

accacgcccgcccgtcgtcgccccagatgtcc	CRISPR spacer
ggaacgcctggccgtcgtcgccccagagataa	Protospacer
.  *****.* **************** .*

774. spacer 2.2|613168|32|NC_016109|CRT matches to NZ_CP013605 (Rhizobium sp. N731 plasmid pRspN731d, complete sequence) position: , mismatch: 9, identity: 0.719

accacgcccgcccgtcgtcgccccagatgtcc	CRISPR spacer
ggaacgcctgaccgtcgtcgccccagagatag	Protospacer
.  *****.* **************** .*

775. spacer 2.3|613229|32|NC_016109|CRT matches to NC_016624 (Azospirillum lipoferum 4B plasmid AZO_p5, complete sequence) position: , mismatch: 9, identity: 0.719

ccgacaacccgggggaagacggcgcgacgccg	CRISPR spacer
ttcgaagaccgggagaagacggcgcggcgccg	Protospacer
.. . *. *****.************.*****

776. spacer 2.4|613290|32|NC_016109|CRT matches to NZ_CP016083 (Streptomyces sp. SAT1 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.719

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
ttcgccggacggggtgcgcgccgcgatcggtg	Protospacer
.   *.***** ************* *** .*

777. spacer 2.4|613290|32|NC_016109|CRT matches to NZ_AP022607 (Mycobacterium branderi strain JCM 12687 plasmid pJCM12687) position: , mismatch: 9, identity: 0.719

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
cgaccgggatgcggtgcgcgccgaaaggccag	Protospacer
***** ***.************* .    * *

778. spacer 2.4|613290|32|NC_016109|CRT matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 9, identity: 0.719

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
gccgctggacgaggtgcgcgccacgttcgaac	Protospacer
    ******* **********.******

779. spacer 2.4|613290|32|NC_016109|CRT matches to CP047137 (Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
ggcaatggaagcgttgcgcgccgcgttcagct	Protospacer
 *   **** *** **************. *

780. spacer 2.4|613290|32|NC_016109|CRT matches to NZ_CP032054 (Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence) position: , mismatch: 9, identity: 0.719

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
gccgctggacgaggtgcgcgccacgttcgaac	Protospacer
    ******* **********.******

781. spacer 2.4|613290|32|NC_016109|CRT matches to NZ_CP016560 (Streptomyces clavuligerus strain F613-1 plasmid pSCL4, complete sequence) position: , mismatch: 9, identity: 0.719

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
gccgctggacgaggtgcgcgccacgttcgaac	Protospacer
    ******* **********.******

782. spacer 2.4|613290|32|NC_016109|CRT matches to NZ_CP007129 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence) position: , mismatch: 9, identity: 0.719

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
acgtccgaccgcgctgcgcgccgcgctcgccg	Protospacer
  ..*.*. **** ***********.******

783. spacer 2.4|613290|32|NC_016109|CRT matches to NZ_CP034351 (Streptomyces sp. W1SF4 plasmid p1, complete sequence) position: , mismatch: 9, identity: 0.719

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
gcggttcgccgcggtacgcgccgccttcgccg	Protospacer
  . .* * ******.******** *******

784. spacer 2.4|613290|32|NC_016109|CRT matches to NZ_CP035710 (Sphaerotilus natans subsp. sulfidivorans strain D-507 plasmid pSna507_unt10, complete sequence) position: , mismatch: 9, identity: 0.719

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
ggcggcggacgcggtgcgcgcctggttcgcgc	Protospacer
 *   .****************  ******

785. spacer 2.4|613290|32|NC_016109|CRT matches to NZ_CP030772 (Streptomyces sp. YIM 121038 plasmid pSSP121038, complete sequence) position: , mismatch: 9, identity: 0.719

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
cgacctggacgcgctgcgcggcgaactgcggg	Protospacer
************* ****** ** ..*    *

786. spacer 2.4|613290|32|NC_016109|CRT matches to NZ_CP013856 (Pseudonocardia sp. HH130630-07 plasmid pLS2-2, complete sequence) position: , mismatch: 9, identity: 0.719

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
cgaccgggacgcggtgctcgccgacctggaga	Protospacer
***** *********** *****  .* *  .

787. spacer 2.4|613290|32|NC_016109|CRT matches to NZ_CP024907 (Paraburkholderia caledonica strain PHRS4 plasmid pPHRS4, complete sequence) position: , mismatch: 9, identity: 0.719

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
acgcgcggacgcggcgcgcgccgcggtcgggg	Protospacer
  .* .********.********** ***  *

788. spacer 2.4|613290|32|NC_016109|CRT matches to NZ_CP040820 (Paraoceanicella profunda strain D4M1 plasmid pD4M1B, complete sequence) position: , mismatch: 9, identity: 0.719

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
tgccgcccacgccctgcgcgccgcgttcgcca	Protospacer
.* * .  ****  *****************.

789. spacer 2.4|613290|32|NC_016109|CRT matches to NC_008757 (Polaromonas naphthalenivorans CJ2 plasmid pPNAP01, complete sequence) position: , mismatch: 9, identity: 0.719

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
gcacctggacgcgctgcgcgcggcggccaagg	Protospacer
  *********** ******* *** .*.  *

790. spacer 2.4|613290|32|NC_016109|CRT matches to NC_017958 (Tistrella mobilis KA081020-065 plasmid pTM3, complete sequence) position: , mismatch: 9, identity: 0.719

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
ggatgcggacgcggtgcgcgcggctttcgaga	Protospacer
 **. .*************** ** ****  .

791. spacer 2.4|613290|32|NC_016109|CRT matches to NZ_CP026518 (Deinococcus sp. NW-56 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
cgccctggacgcgctgcgcgccgacatggtga	Protospacer
** ********** *********   * *. .

792. spacer 2.4|613290|32|NC_016109|CRT matches to MT188704 (Mesorhizobium phage Cp1R7A-A1, complete genome) position: , mismatch: 9, identity: 0.719

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
cgacctgaacgcggtgcgcaccgacgcgccca	Protospacer
*******.***********.***   .  **.

793. spacer 2.4|613290|32|NC_016109|CRT matches to MG757166 (Gordonia phage SuperSulley, complete genome) position: , mismatch: 9, identity: 0.719

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
cgacctcgacgccgtgcgcgccggtgatctcg	Protospacer
****** ***** **********    . .**

794. spacer 2.4|613290|32|NC_016109|CRT matches to MK937595 (Streptomyces phage Dubu, complete genome) position: , mismatch: 9, identity: 0.719

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
cgaccaggacgcggttcgcgccggggaccttc	Protospacer
***** ********* ******* *  * ..

795. spacer 2.6|613412|32|NC_016109|CRT matches to NZ_CP045385 (Ruegeria sp. THAF33 plasmid pTHAF33_a, complete sequence) position: , mismatch: 9, identity: 0.719

ctggtgtcgatcaggtcggcagcctcgccgag	CRISPR spacer
ggtgtgtcgatcaggtcgacagcctccagaat	Protospacer
   ***************.*******   .*

796. spacer 2.6|613412|32|NC_016109|CRT matches to NC_015583 (Novosphingobium sp. PP1Y plasmid Mpl, complete sequence) position: , mismatch: 9, identity: 0.719

ctggtgtcgatcaggtcggcagcctcgccgag	CRISPR spacer
tgctcggcgaacaggtcggcagcctcgtcgac	Protospacer
.   .* *** ****************.***

797. spacer 2.6|613412|32|NC_016109|CRT matches to NC_015583 (Novosphingobium sp. PP1Y plasmid Mpl, complete sequence) position: , mismatch: 9, identity: 0.719

ctggtgtcgatcaggtcggcagcctcgccgag	CRISPR spacer
tgctcggcgaacaggtcggcagcctcgtcgac	Protospacer
.   .* *** ****************.***

798. spacer 2.6|613412|32|NC_016109|CRT matches to NC_012987 (Methylorubrum extorquens AM1 plasmid p1METDI, complete sequence) position: , mismatch: 9, identity: 0.719

ctggtgtcgatcaggtcggcagcctcgccgag	CRISPR spacer
ttcgccgcgatcagttcggcaccctcgccgcc	Protospacer
.* *.  ******* ****** ********

799. spacer 2.6|613412|32|NC_016109|CRT matches to NZ_CP032347 (Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence) position: , mismatch: 9, identity: 0.719

ctggtgtcgatcaggtcggcagcctcgccgag	CRISPR spacer
gtggtgtcgctcaggtcggcggccatggccgc	Protospacer
 ******** **********.*** .* * .

800. spacer 2.6|613412|32|NC_016109|CRT matches to NC_047861 (Bordetella phage vB_BbrM_PHB04, complete genome) position: , mismatch: 9, identity: 0.719

ctggtgtcgatcaggtcggcagcctcgccgag	CRISPR spacer
ctggtttcgatcaggtcggcggcaaggaacaa	Protospacer
***** **************.**   *   *.

801. spacer 2.7|613473|32|NC_016109|CRT matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

tgctgtggaactgctgcggcacccacggctgg	CRISPR spacer
gatgctggaactgctgcggcacgcccggcctg	Protospacer
 ..  ***************** * ****. *

802. spacer 2.8|613534|32|NC_016109|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 9, identity: 0.719

ggcgtcggtggcgaggagttcggtgggggtga	CRISPR spacer
ggcgacggtggcgaggagttcggcgacccgcg	Protospacer
**** ******************.*.     .

803. spacer 2.8|613534|32|NC_016109|CRT matches to NZ_CP031163 (Deinococcus wulumuqiensis strain NEB 479 plasmid pDrdI, complete sequence) position: , mismatch: 9, identity: 0.719

ggcgtcggtggcgaggagttcggtgggggtga	CRISPR spacer
ttggtcggtggtgaggagttcggtggccaggg	Protospacer
   ********.**************  . *.

804. spacer 2.8|613534|32|NC_016109|CRT matches to NC_018022 (Mycolicibacterium chubuense NBB4 plasmid pMYCCH.01, complete sequence) position: , mismatch: 9, identity: 0.719

ggcgtcggtggcgaggagttcggtgggggtga	CRISPR spacer
ggagacggtggcgaggagttcggcgacgcgct	Protospacer
** * ******************.*. *

805. spacer 2.8|613534|32|NC_016109|CRT matches to NC_008703 (Mycobacterium sp. KMS plasmid pMKMS01, complete sequence) position: , mismatch: 9, identity: 0.719

ggcgtcggtggcgaggagttcggtgggggtga	CRISPR spacer
ggagacggtggcgaggagttcggcgacgcgtt	Protospacer
** * ******************.*. *

806. spacer 2.9|613595|32|NC_016109|CRT matches to NC_005241 (Cupriavidus necator H16 megaplasmid pHG1, complete sequence) position: , mismatch: 9, identity: 0.719

tcggcgagggtgtgctgggcgtcggcgtaggc	CRISPR spacer
ccgacgagggcgtgctgggcgtcgatgccatc	Protospacer
.**.******.*************..*. . *

807. spacer 2.9|613595|32|NC_016109|CRT matches to NZ_AP022334 (Methylosinus sp. C49 isolate Methylosinus sp. C49 plasmid pMSC49b, complete sequence) position: , mismatch: 9, identity: 0.719

tcggcgagggtgtgctgggcgtcggcgtaggc	CRISPR spacer
acggcgaggctgtgctgggcgacgctgagcgg	Protospacer
 ******** *********** ** .* . *

808. spacer 2.9|613595|32|NC_016109|CRT matches to NZ_CP039289 (Cupriavidus necator H16 plasmid pHG1, complete sequence) position: , mismatch: 9, identity: 0.719

tcggcgagggtgtgctgggcgtcggcgtaggc	CRISPR spacer
ccgacgagggcgtgctgggcgtcgatgccatc	Protospacer
.**.******.*************..*. . *

809. spacer 2.10|613656|32|NC_016109|CRT matches to NZ_CP016879 (Xanthomonas hortorum strain B07-007 plasmid pB07007, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgccgcgggtccgcagctccgcgagcag	CRISPR spacer
tgcacgccgcggttgcgcagctccgtcacgac	Protospacer
  ********** * **********. *  *

810. spacer 2.10|613656|32|NC_016109|CRT matches to NZ_CP042268 (Pseudomonas aeruginosa strain HOU1 plasmid pHOU1-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgccgcgggtccgcagctccgcgagcag	CRISPR spacer
ggcagcgagcgggtcagcagcaccgcgagcat	Protospacer
. **    ******* ***** *********

811. spacer 2.10|613656|32|NC_016109|CRT matches to NZ_CP018733 (Xanthomonas gardneri strain ICMP 7383 plasmid pICMP7383.2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgccgcgggtccgcagctccgcgagcag	CRISPR spacer
tgcacgccgcggttgcgcagctccgtcacgac	Protospacer
  ********** * **********. *  *

812. spacer 2.12|613778|32|NC_016109|CRT matches to NZ_CP014516 (Frondihabitans sp. PAMC 28766 strain SR6 plasmid 3, complete sequence) position: , mismatch: 9, identity: 0.719

atgacgaccgggtcggccagcgacccggatcc	CRISPR spacer
gcgttttccgggtcggtcaccgacccggatac	Protospacer
..* .  *********.** ********** *

813. spacer 2.12|613778|32|NC_016109|CRT matches to NC_042014 (Arthrobacter phage Piccoletto, complete genome) position: , mismatch: 9, identity: 0.719

atgacgaccgggtcggccagcgacccggatcc	CRISPR spacer
ctgccgaccgggacggccagcgacgcacgagc	Protospacer
 ** ******** *********** *. .  *

814. spacer 2.13|613107|33|NC_016109|CRISPRCasFinder matches to FJ937737 (Burkholderia cenocepacia phage BcepIL02, complete genome) position: , mismatch: 9, identity: 0.727

gccgtcgacggcctgaccgacgacgagggcgcg	CRISPR spacer
cttttgagcggcctgaccgacgaggagcgcgcg	Protospacer
 .. * ..*************** *** *****

815. spacer 2.13|613107|33|NC_016109|CRISPRCasFinder matches to NC_012743 (Burkholderia phage BcepIL02, complete genome) position: , mismatch: 9, identity: 0.727

gccgtcgacggcctgaccgacgacgagggcgcg	CRISPR spacer
cttttgagcggcctgaccgacgaggagcgcgcg	Protospacer
 .. * ..*************** *** *****

816. spacer 2.13|613107|33|NC_016109|CRISPRCasFinder matches to NZ_CP030864 (Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.727

gccgtcgacggcctgaccgacgacgagggcgcg	CRISPR spacer
ctcgacgccggcctgaccgacgacgaacgccgc	Protospacer
 .** ** ******************. **

817. spacer 2.13|613107|33|NC_016109|CRISPRCasFinder matches to MT498055 (Arthrobacter phage Bumble, complete genome) position: , mismatch: 9, identity: 0.727

gccgtcgacggcctgaccgacgacgagggcgcg	CRISPR spacer
accgtcgacggcctcaccgccgacggcgggatc	Protospacer
.************* **** *****. ** ..

818. spacer 2.15|613229|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NC_016624 (Azospirillum lipoferum 4B plasmid AZO_p5, complete sequence) position: , mismatch: 9, identity: 0.727

ccgacaacccgggggaagacggcgcgacgccga	CRISPR spacer
ttcgaagaccgggagaagacggcgcggcgccga	Protospacer
.. . *. *****.************.******

819. spacer 2.16|613290|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NZ_CP034351 (Streptomyces sp. W1SF4 plasmid p1, complete sequence) position: , mismatch: 9, identity: 0.727

cgacctggacgcggtgcgcgccgcgttcgccgc	CRISPR spacer
gcggttcgccgcggtacgcgccgccttcgccgc	Protospacer
  . .* * ******.******** ********

820. spacer 2.16|613290|33|NC_016109|CRISPRCasFinder,PILER-CR matches to MK801727 (Gordonia phage ThankyouJordi, complete genome) position: , mismatch: 9, identity: 0.727

cgacctggacgcggtgcgcgccgcgttcgccgc	CRISPR spacer
catgtgggacgcggtgcgcaccgcgttccccaa	Protospacer
*.  . *************.******** **.

821. spacer 2.16|613290|33|NC_016109|CRISPRCasFinder,PILER-CR matches to MK875793 (Gordonia phage WelcomeAyanna, complete genome) position: , mismatch: 9, identity: 0.727

cgacctggacgcggtgcgcgccgcgttcgccgc	CRISPR spacer
catgtgggacgcggtgcgcaccgcgttccccaa	Protospacer
*.  . *************.******** **.

822. spacer 2.16|613290|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NZ_CP032828 (Sphingomonas sp. YZ-8 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.727

--cgacctggacgcggtgcgcgccgcgttcgccgc	CRISPR spacer
attggtc--aactcggtgcgcgccgcgatcgccga	Protospacer
  .*..*  .** ************** ******

823. spacer 2.16|613290|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NZ_CP007129 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence) position: , mismatch: 9, identity: 0.727

cgacctggacgcggtgcgcgccgcgttcgccgc	CRISPR spacer
acgtccgaccgcgctgcgcgccgcgctcgccgc	Protospacer
  ..*.*. **** ***********.*******

824. spacer 2.16|613290|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NZ_CP035710 (Sphaerotilus natans subsp. sulfidivorans strain D-507 plasmid pSna507_unt10, complete sequence) position: , mismatch: 9, identity: 0.727

cgacctggacgcggtgcgcgccgcgttcgccgc	CRISPR spacer
ggcggcggacgcggtgcgcgcctggttcgcgcc	Protospacer
 *   .****************  ******  *

825. spacer 2.16|613290|33|NC_016109|CRISPRCasFinder,PILER-CR matches to MN693668 (Marine virus AFVG_250M1112, complete genome) position: , mismatch: 9, identity: 0.727

cgacctggacgcggtgcgcgccgcgttcgccgc	CRISPR spacer
ggagggccgcgcggagcgcggcgcgttcgccgc	Protospacer
 **     .***** ***** ************

826. spacer 2.18|613412|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NZ_CP015009 (Aminobacter aminovorans strain KCTC 2477 plasmid pAA04, complete sequence) position: , mismatch: 9, identity: 0.727

ctggtgtcgatcaggtcggcagcctcgccgagg	CRISPR spacer
atcgacacgatcaggtcgaccgcctcgccgatc	Protospacer
 * *   ***********.* **********

827. spacer 2.18|613412|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NZ_AP018921 (Pseudonocardia autotrophica strain NBRC 12743 plasmid pPA12743CP, complete sequence) position: , mismatch: 9, identity: 0.727

-----ctggtgtcgatcaggtcggcagcctcgccgagg	CRISPR spacer
aacagcag-----gatcaggtcggctgccccgccgagc	Protospacer
     * *     ************ ***.*******

828. spacer 2.18|613412|33|NC_016109|CRISPRCasFinder,PILER-CR matches to KR053197 (Gordonia phage GRU3, complete genome) position: , mismatch: 9, identity: 0.727

ctggtgtcgatcaggtcggcagcctcgccgagg	CRISPR spacer
ccgtagtcgatcaggtcggcggccttgccctct	Protospacer
*.*  ***************.****.***

829. spacer 2.18|613412|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NZ_CP020539 (Sphingobium herbicidovorans strain MH plasmid pMSHV, complete sequence) position: , mismatch: 9, identity: 0.727

ctggtgtcgatcaggtcggcagcctcgccgagg	CRISPR spacer
aggaagtcgatcagttcggcaacctcgccaggt	Protospacer
  *. ********* ******.*******..*

830. spacer 2.19|613473|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.727

tgctgtggaactgctgcggcacccacggctgga	CRISPR spacer
gatgctggaactgctgcggcacgcccggcctga	Protospacer
 ..  ***************** * ****. **

831. spacer 2.21|613595|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NZ_CP032340 (Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence) position: , mismatch: 9, identity: 0.727

tcggcgagggtgtgctgggcgtcggcgtaggcg	CRISPR spacer
tcggcgacggtgtgctgtgcgtcgagttcacca	Protospacer
******* ********* ******.  * . *.

832. spacer 2.21|613595|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NZ_CP012915 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence) position: , mismatch: 9, identity: 0.727

tcggcgagggtgtgctgggcgtcggcgtaggcg	CRISPR spacer
tcggcgacggtgtgctgtgcgtcgagttcacca	Protospacer
******* ********* ******.  * . *.

833. spacer 2.24|613778|33|NC_016109|CRISPRCasFinder,PILER-CR matches to MK765627 (Tortoise microvirus 74 isolate 74_SP_45, complete genome) position: , mismatch: 9, identity: 0.727

atgacgaccgggtcggccagcgacccggatccg	CRISPR spacer
gccacgaccgggtcggccaccggcccgcttgca	Protospacer
.. **************** **.****  * *.

834. spacer 3.2|623619|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP046574 (Rhodococcus sp. WAY2 plasmid pRWAY02, complete sequence) position: , mismatch: 9, identity: 0.727

cgggacggccgaggggaggacgtcgtgtccctc	CRISPR spacer
accgacggccgcggggtggacgtcgtggtcgac	Protospacer
   ******** **** ********** .*  *

835. spacer 3.3|623680|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP017148 (Bosea vaviloviae strain Vaf18 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.727

cggtcgtggtgccggagacggtgatgctggggg	CRISPR spacer
tggacgtgctgccggagacggtgatctacgacg	Protospacer
.** **** **************** .  *. *

836. spacer 3.4|623741|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP042332 (Bosea sp. F3-2 plasmid pB32-1, complete sequence) position: , mismatch: 9, identity: 0.727

ccagcaggcggccggagccgagcgcgacgccta	CRISPR spacer
gtgttgggcggccggagccgagcgcggcgccgg	Protospacer
 .. ..********************.**** .

837. spacer 3.4|623741|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP026093 (Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.727

ccagcaggcggccggagccgagcgcgacgccta	CRISPR spacer
tcagcaggcggccgatgccgagcgccagcgaaa	Protospacer
.*************. ********* *     *

838. spacer 3.4|623741|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP029358 (Azospirillum sp. CFH 70021 plasmid unnamed3) position: , mismatch: 9, identity: 0.727

ccagcaggcggccggagccgagcgcgacgccta	CRISPR spacer
cacgggggcgggcggcgccgagcgcgacgcgct	Protospacer
*  * .***** *** ************** .

839. spacer 3.4|623741|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NC_014309 (Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome) position: , mismatch: 9, identity: 0.727

ccagcaggcggccggagccgagcgcgacgccta	CRISPR spacer
tcagcaggcggccgatgccgagcgccagcgaaa	Protospacer
.*************. ********* *     *

840. spacer 3.4|623741|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP021767 (Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.727

ccagcaggcggccggagccgagcgcgacgccta	CRISPR spacer
tcagcaggcggccgatgccgagcgccagcgaaa	Protospacer
.*************. ********* *     *

841. spacer 3.11|624168|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NC_024970 (Streptomyces aureofaciens strain CCM3239 plasmid pSA3239, complete sequence) position: , mismatch: 9, identity: 0.727

ccgggacagcggcggccggggctgcgggctgct	CRISPR spacer
ggggtgatgcggcggccggggcggccggctgcc	Protospacer
  ** .  ************** ** ******.

842. spacer 3.11|624168|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_KJ396772 (Streptomyces lavendulae subsp. lavendulae strain CCM3239 plasmid pSA3239, complete sequence) position: , mismatch: 9, identity: 0.727

ccgggacagcggcggccggggctgcgggctgct	CRISPR spacer
ggggtgatgcggcggccggggcggccggctgcc	Protospacer
  ** .  ************** ** ******.

843. spacer 3.11|624168|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013856 (Pseudonocardia sp. HH130630-07 plasmid pLS2-2, complete sequence) position: , mismatch: 9, identity: 0.727

ccgggacagcggcggccggggctgcgggctgct	CRISPR spacer
ctcggacagcggcggccgggacagcggtcgcgg	Protospacer
*. *****************.* **** *

844. spacer 3.11|624168|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP024986 (Streptomyces lavendulae subsp. lavendulae strain CCM 3239 plasmid pSA3239, complete sequence) position: , mismatch: 9, identity: 0.727

ccgggacagcggcggccggggctgcgggctgct	CRISPR spacer
ggggtgatgcggcggccggggcggccggctgcc	Protospacer
  ** .  ************** ** ******.

845. spacer 3.11|624168|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP025188 (Roseomonas mucosa strain AD2 plasmid p1-AD2, complete sequence) position: , mismatch: 9, identity: 0.727

ccgggacagcggcggccggggctgcgggctgct	CRISPR spacer
gtgggacatcggcggcgggggctgcgcggtaaa	Protospacer
 .****** ******* ********* * *.

846. spacer 3.14|624351|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 9, identity: 0.727

gccgaagccgcgctcatcgccgcccaccgcctc	CRISPR spacer
aaggaagccgcgctcgtcgccgcctacaccccg	Protospacer
.  ************.********.**  **.

847. spacer 3.15|624412|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_LR134467 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 25, complete sequence) position: , mismatch: 9, identity: 0.727

gggcgtgtacccggaggccgggctgcagatgtc	CRISPR spacer
cggcgtgcacccggacgccgggctgggcgtcgc	Protospacer
 ******.******* ********* . .*  *

848. spacer 3.17|624534|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_LT984809 (Cupriavidus taiwanensis isolate Cupriavidus taiwanensis STM 8555 plasmid I, complete sequence) position: , mismatch: 9, identity: 0.727

tcgctgctggcggcgcggcgattcaacccaccg	CRISPR spacer
tccctgctggcggcgcggagattccgacgttcc	Protospacer
** *************** ***** . *  .*

849. spacer 3.18|624595|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_LR134467 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 25, complete sequence) position: , mismatch: 9, identity: 0.727

gggcgtgtacccggaggccgggctgcagatgtc	CRISPR spacer
cggcgtgcacccggacgccgggctgggcgtcgc	Protospacer
 ******.******* ********* . .*  *

850. spacer 3.20|624717|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP023071 (Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence) position: , mismatch: 9, identity: 0.727

gggtctcgcgatcctggccaggatcggactcgt	CRISPR spacer
cagtctcgcgagcctggcaaggatcgtcggctt	Protospacer
 .********* ****** *******    * *

851. spacer 3.21|624778|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP039965 (Pseudorhodobacter sp. S12M18 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.727

ccggcccggggcgcccgccgccggggcggagag	CRISPR spacer
ccggcccggggcgcctgccgcccggtacatggc	Protospacer
***************.****** **   . *.

852. spacer 3.21|624778|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP041045 (Paracoccus sp. AK26 plasmid pAK1, complete sequence) position: , mismatch: 9, identity: 0.727

ccggcccggggcgcccgccgccggggcggagag	CRISPR spacer
tgtcgccggggcgcccgccgcctgcgcggatcg	Protospacer
.    ***************** * *****  *

853. spacer 3.21|624778|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NC_011143 (Phenylobacterium zucineum HLK1 plasmid, complete sequence) position: , mismatch: 9, identity: 0.727

ccggcccggggcgcccgccgccggggcggagag	CRISPR spacer
ccggccaggggcgcccaccgccggtctcccggg	Protospacer
****** *********.*******  .   *.*

854. spacer 3.21|624778|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP030864 (Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.727

ccggcccggggcgcccgccgccggggcggagag	CRISPR spacer
ggtggccggggctgccgccgccggggcggcggc	Protospacer
   * *******  *************** *.

855. spacer 3.21|624778|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NC_017311 (Desulfovibrio vulgaris RCH1 plasmid pDEVAL01, complete sequence) position: , mismatch: 9, identity: 0.727

ccggcccggggcgcccgccgccggggcggagag	CRISPR spacer
gccctacggggcgcccccctccggggcggacgg	Protospacer
 *  . ********** ** ********** .*

856. spacer 3.21|624778|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032347 (Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence) position: , mismatch: 9, identity: 0.727

ccggcccggggcgcccgccgccggggcggagag	CRISPR spacer
actatgcggggcgcccgccgctggggctgaccg	Protospacer
 * .. ***************.***** **  *

857. spacer 3.21|624778|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP045548 (Streptomyces sp. SYP-A7193 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.727

ccggcccggggcgcccgccgccggggcggagag	CRISPR spacer
gtgtgccggggcggccgacgccggggcggtggc	Protospacer
 .*  ******** *** *********** *.

858. spacer 3.21|624778|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NC_005863 (Desulfovibrio vulgaris str. Hildenborough plasmid pDV, complete sequence) position: , mismatch: 9, identity: 0.727

ccggcccggggcgcccgccgccggggcggagag	CRISPR spacer
gccctacggggcgcccccctccggggcggacgg	Protospacer
 *  . ********** ** ********** .*

859. spacer 3.21|624778|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP041605 (Streptomyces sp. S1D4-14 plasmid pS1D4-14.1, complete sequence) position: , mismatch: 9, identity: 0.727

ccggcccggggcgcccgccgccggggcggagag	CRISPR spacer
tgcgtccggggcgcccggcgcgggggcggcgga	Protospacer
.  *.************ *** ******* *..

860. spacer 3.21|624778|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NC_008741 (Desulfovibrio vulgaris DP4 plasmid pDVUL01, complete sequence) position: , mismatch: 9, identity: 0.727

ccggcccggggcgcccgccgccggggcggagag	CRISPR spacer
gccctacggggcgcccccctccggggcggacgg	Protospacer
 *  . ********** ** ********** .*

861. spacer 3.24|624961|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 9, identity: 0.727

cgcggtggacaggctgaccacgctggtgggtga	CRISPR spacer
cgcggtgaacaagctgaccacgctcgacagcct	Protospacer
*******.***.************ *  .*.

862. spacer 3.24|624961|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP007796 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p3, complete sequence) position: , mismatch: 9, identity: 0.727

cgcggtggacaggctgaccacgctggtgggtga	CRISPR spacer
ccggctggacgggctgaccccgctggtggcgtt	Protospacer
*  * *****.******** *********

863. spacer 3.24|624961|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032325 (Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence) position: , mismatch: 9, identity: 0.727

cgcggtggacaggctgaccacgctggtgggtga	CRISPR spacer
ccggctggacgggctgaccccgctggtggcgtt	Protospacer
*  * *****.******** *********

864. spacer 3.26|625083|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to MN234199 (Mycobacterium phage Ekdilam, complete genome) position: , mismatch: 9, identity: 0.727

tcgcccggcgccacgctcaaggacctgctgctg	CRISPR spacer
ctgaccggcgccacgctcgacgacctgccgaac	Protospacer
..* **************.* *******.*

865. spacer 3.30|625327|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP015742 (Shinella sp. HZN7 plasmid pShin-06, complete sequence) position: , mismatch: 9, identity: 0.727

cccatccccgacggccgcgcgctgttcctggcc	CRISPR spacer
tggatctccgacgcccgcgcgctgttcgccggc	Protospacer
.  ***.****** ************* . * *

866. spacer 3.31|625388|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NC_013858 (Azospirillum sp. B510 plasmid pAB510d, complete sequence) position: , mismatch: 9, identity: 0.727

gatcggcctcggcgggatcggcgacaccctgaa	CRISPR spacer
cacgcgcctcggccggatcggcgacaccccatt	Protospacer
 *.  ******** ***************..

867. spacer 3.31|625388|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP030772 (Streptomyces sp. YIM 121038 plasmid pSSP121038, complete sequence) position: , mismatch: 9, identity: 0.727

gatcggcctcggcgggatcggcgac-----accctgaa	CRISPR spacer
catcgacctcggcgggaccggcgactggtggcc-----	Protospacer
 ****.***********.*******     .**

868. spacer 3.31|625388|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP051182 (Thalassobius gelatinovorus strain NEB572 plasmid pAge77, complete sequence) position: , mismatch: 9, identity: 0.727

gatcggcctcggcgggatcggcgacaccctgaa	CRISPR spacer
gatcagccgcggcgggatcggcgatatgatcgc	Protospacer
****.*** ***************.*.  * .

869. spacer 3.33|625510|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP007050 (Rhizobium leguminosarum bv. trifolii WSM1689 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.727

cgatgagggcctggcgctcagccgggctacggg	CRISPR spacer
tttcgaggagctggcgctcagccgggctcaggc	Protospacer
.  .****. ******************  **

870. spacer 3.33|625510|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NC_012852 (Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132504, complete sequence) position: , mismatch: 9, identity: 0.727

cgatgagggcctggcgctcagccgggctacggg	CRISPR spacer
tctcgaggagctggcgctcagccgggctcaggc	Protospacer
.  .****. ******************  **

871. spacer 3.33|625510|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP054025 (Rhizobium sp. JKLM12A2 plasmid pPR12A204, complete sequence) position: , mismatch: 9, identity: 0.727

cgatgagggcctggcgctcagccgggctacggg	CRISPR spacer
tctcgaggagctggcgctcagccgggctcaggc	Protospacer
.  .****. ******************  **

872. spacer 3.36|625693|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP044283 (Rhodococcus erythropolis strain X5 plasmid pRhX5, complete sequence) position: , mismatch: 9, identity: 0.727

caccgacttgacgaggtcggtctcgttgacgtc	CRISPR spacer
gaagcctttgacgaagtcgatctcgttgacgcc	Protospacer
 *    .*******.****.***********.*

873. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP021357 (Rhodococcus sp. S2-17 plasmid pRB11, complete sequence) position: , mismatch: 9, identity: 0.719

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gtcaacagcagcggcagcccggcggcgacgag	Protospacer
. *  * *****.************* ***.

874. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP023450 (Rhizorhabdus dicambivorans strain Ndbn-20 plasmid p1, complete sequence) position: , mismatch: 9, identity: 0.719

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gttgcccgcagcagaaacccggcggcttcctc	Protospacer
. . ********** *.********** *  *

875. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_AP017658 (Sphingobium cloacae strain JCM 10874 plasmid pSCLO_4, complete sequence) position: , mismatch: 9, identity: 0.719

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gttgcccgcagcagaaacccggcggcttcctc	Protospacer
. . ********** *.********** *  *

876. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP010956 (Sphingobium sp. YBL2 plasmid 2pYBL2-2, complete sequence) position: , mismatch: 9, identity: 0.719

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gttgcccgcagcagaaacccggcggcttcttc	Protospacer
. . ********** *.********** *  *

877. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP013071 (Sphingobium indicum B90A plasmid pSRL1, complete sequence) position: , mismatch: 9, identity: 0.719

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gttgcccgcagcagaaacccggcggcttcctc	Protospacer
. . ********** *.********** *  *

878. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NC_012520 (Rhodococcus opacus B4 plasmid pROB01, complete sequence) position: , mismatch: 9, identity: 0.719

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gtcaacagcagcggcagcccggcggcgacgag	Protospacer
. *  * *****.************* ***.

879. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NC_015595 (Sphingobium chlorophenolicum L-1 plasmid pSPHCH01, complete sequence) position: , mismatch: 9, identity: 0.719

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gttgcccgcagcagaaacccggcggcttcctc	Protospacer
. . ********** *.********** *  *

880. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NC_008271 (Rhodococcus jostii RHA1 plasmid pRHL3, complete sequence) position: , mismatch: 9, identity: 0.719

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gtcaacagcagcggcagcccggcggcgacgag	Protospacer
. *  * *****.************* ***.

881. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP046254 (Sphingobium sp. CAP-1 plasmid p1, complete sequence) position: , mismatch: 9, identity: 0.719

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gttgcccgcagcagaaacccggcggcttcctc	Protospacer
. . ********** *.********** *  *

882. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NC_015974 (Sphingobium sp. SYK-6 plasmid pSLPG, complete sequence) position: , mismatch: 9, identity: 0.719

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gttgcccgcagcagaaacccggcggcttcctc	Protospacer
. . ********** *.********** *  *

883. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP029832 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
ctccgccgcagcggcagcccggcggaggaagc	Protospacer
  ** *******.************  . .**

884. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to CP021182 (Sphingomonas wittichii DC-6 plasmid pDC01, complete sequence) position: , mismatch: 9, identity: 0.719

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gttgcccgcagcagaaacccggcggcttcctc	Protospacer
. . ********** *.********** *  *

885. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP005085 (Sphingobium sp. TKS plasmid pTK1, complete sequence) position: , mismatch: 9, identity: 0.719

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gttgcccgcagcagaaacccggcggcttcctc	Protospacer
. . ********** *.********** *  *

886. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP018225 (Tardibacter chloracetimidivorans strain JJ-A5 plasmid pHSL4, complete sequence) position: , mismatch: 9, identity: 0.719

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gttgcccgcagcagaaacccggcggcttcctc	Protospacer
. . ********** *.********** *  *

887. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP030074 (Streptomyces sp. ZFG47 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
cacgcgtccagcagcagcccggcggacacggg	Protospacer
 .* * . ***************** .****

888. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP013265 (Sphingobium baderi strain DE-13 plasmid pDE1, complete sequence) position: , mismatch: 9, identity: 0.719

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gttgcccgcagcagaaacccggcggcttcctc	Protospacer
. . ********** *.********** *  *

889. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP041018 (Sphingobium fuliginis ATCC 27551 plasmid pSF1, complete sequence) position: , mismatch: 9, identity: 0.719

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gttgcccgcagcagaaacccggcggcttcctc	Protospacer
. . ********** *.********** *  *

890. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to LN997845 (Streptomyces reticuli genome assembly TUE45, plasmid : IV) position: , mismatch: 9, identity: 0.719

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
cgaccccgcaggagctgcccggcggcctccag	Protospacer
 * ******** *** **********. * .

891. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to MH744423 (Mycobacterium phage Saguaro, complete genome) position: , mismatch: 9, identity: 0.719

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
agcccgcgcagccgcagcccggccaccgccca	Protospacer
***** ****** ********** .*..*

892. spacer 8.1|7220782|31|NC_016109|CRISPRCasFinder matches to NZ_CP032695 (Rhizobium jaguaris strain CCGE525 plasmid pRCCGE525c, complete sequence) position: , mismatch: 9, identity: 0.71

tcagcaggtcgtccgtatcggtggcgacagc	CRISPR spacer
tcagcaggttgtccgtataggtggaatggat	Protospacer
*********.******** ***** .  ...

893. spacer 9.4|7273190|31|NC_016109|CRISPRCasFinder matches to NC_010625 (Paraburkholderia phymatum STM815 plasmid pBPHY01, complete sequence) position: , mismatch: 9, identity: 0.71

ggtcgaacacgccgtcggtctgcgcgcgccg	CRISPR spacer
ggtcgaacccgccgtcggcctgcagcccttc	Protospacer
******** *********.****.  * ..

894. spacer 9.4|7273190|31|NC_016109|CRISPRCasFinder matches to NZ_CP015322 (Mesorhizobium amorphae CCNWGS0123 plasmid pM0123d, complete sequence) position: , mismatch: 9, identity: 0.71

ggtcgaacacgccgtcggtctgcgcgcgccg	CRISPR spacer
tgtcgaacacggcatcggtctgcggcttctc	Protospacer
 ********** *.**********  . *.

895. spacer 9.11|7273627|31|NC_016109|CRISPRCasFinder matches to NZ_CP040821 (Paraoceanicella profunda strain D4M1 plasmid pD4M1C, complete sequence) position: , mismatch: 9, identity: 0.71

gcatcggcggcgcgatggagcaggagcccat	CRISPR spacer
ggccgcgcgtggcgatggagcaggagcccga	Protospacer
*  .  ***  ******************.

896. spacer 9.11|7273627|31|NC_016109|CRISPRCasFinder matches to NZ_CP035419 (Leisingera sp. NJS204 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.71

gcatcggcggcgcgatggagcaggagcccat	CRISPR spacer
ttgccggcggcgccatggagccggagcaagt	Protospacer
 ...********* ******* *****  .*

897. spacer 9.12|7273688|31|NC_016109|CRISPRCasFinder matches to NC_014838 (Pantoea sp. At-9b plasmid pPAT9B01, complete sequence) position: , mismatch: 9, identity: 0.71

gattgggtgcgccccccggtatgcaccacag	CRISPR spacer
agttgggtgcgcaccccgttatgcaggctgg	Protospacer
..********** ***** ******   ..*

898. spacer 9.13|7273749|31|NC_016109|CRISPRCasFinder matches to JX100810 (Caulobacter phage CcrColossus, complete genome) position: , mismatch: 9, identity: 0.71

cgacgccgcgggtccggatcaccgcgacgta	CRISPR spacer
tgacgccgcgcatccggatcaccgatgccgg	Protospacer
.********* .************  .*  .

899. spacer 9.14|7273810|31|NC_016109|CRISPRCasFinder matches to NZ_LN832562 (Paracoccus aminovorans isolate JCM7685 plasmid IV, complete sequence) position: , mismatch: 9, identity: 0.71

acgcctaccgcaccgtcgccgcccagctccg	CRISPR spacer
acgccgcccgcaccgtcgccgcctcctcgcc	Protospacer
*****  ****************.  .. *

900. spacer 9.14|7273810|31|NC_016109|CRISPRCasFinder matches to NZ_CP044217 (Mesorhizobium sp. NIBRBAC000500504 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

acgcctaccgcaccgtcgccgcccagctccg	CRISPR spacer
cccgataccgcatcgtcgccgcgcagctggt	Protospacer
 *   *******.********* *****

901. spacer 9.14|7273810|31|NC_016109|CRISPRCasFinder matches to NZ_CP032342 (Azospirillum brasilense strain MTCC4038 plasmid p3, complete sequence) position: , mismatch: 9, identity: 0.71

acgcctaccgcaccgtcgccgcccagctccg	CRISPR spacer
acgccaacggcaccgtcgccgccggcaacaa	Protospacer
***** ** ************** .   * .

902. spacer 9.14|7273810|31|NC_016109|CRISPRCasFinder matches to NZ_CP033321 (Azospirillum brasilense strain Cd plasmid p3, complete sequence) position: , mismatch: 9, identity: 0.71

acgcctaccgcaccgtcgccgcccagctccg	CRISPR spacer
acgccaacggcaccgtcgccgccggcaacaa	Protospacer
***** ** ************** .   * .

903. spacer 9.14|7273810|31|NC_016109|CRISPRCasFinder matches to NZ_CP033315 (Azospirillum brasilense strain Sp 7 plasmid p3, complete sequence) position: , mismatch: 9, identity: 0.71

acgcctaccgcaccgtcgccgcccagctccg	CRISPR spacer
acgccaacggcaccgtcgccgccggcaacaa	Protospacer
***** ** ************** .   * .

904. spacer 9.15|7273871|31|NC_016109|CRISPRCasFinder matches to NZ_CP021357 (Rhodococcus sp. S2-17 plasmid pRB11, complete sequence) position: , mismatch: 9, identity: 0.71

acgtccggacgctggcgcactcgacgtacag	CRISPR spacer
cggtcgggacgctcgcgcactcgacccgctt	Protospacer
  *** ******* *********** ..*

905. spacer 9.15|7273871|31|NC_016109|CRISPRCasFinder matches to NZ_CP046573 (Rhodococcus sp. WAY2 plasmid pRWAY01, complete sequence) position: , mismatch: 9, identity: 0.71

acgtccggacgctggcgcactcgacgtacag	CRISPR spacer
cggtcgggacgctcgcgcactcgacccgctt	Protospacer
  *** ******* *********** ..*

906. spacer 9.17|7273993|31|NC_016109|CRISPRCasFinder matches to MH271305 (Gordonia phage Morrissey, complete genome) position: , mismatch: 9, identity: 0.71

cgccgaccgcgcccaggaggagctggtccgc	CRISPR spacer
tctgggccgcgcccaggatgagcttgtcccg	Protospacer
. . *.************ ***** ****

907. spacer 9.21|7273189|32|NC_016109|CRT matches to NZ_CP028348 (Novosphingobium sp. THN1 plasmid pTHN, complete sequence) position: , mismatch: 9, identity: 0.719

cggtcgaacacgccgtcggtctgcgcgcgccg	CRISPR spacer
tcgccgaacacggcgtcggtctgcacgccggt	Protospacer
. *.******** ***********.***

908. spacer 9.21|7273189|32|NC_016109|CRT matches to NZ_CP018229 (Rhizobium leguminosarum strain Vaf-108 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

cggtcgaacacgccgtcggtctgcgcgcgccg	CRISPR spacer
gcgcggaacacgtcgtcggtcttcgcgccagg	Protospacer
  *. *******.********* *****   *

909. spacer 9.21|7273189|32|NC_016109|CRT matches to NZ_CP016290 (Rhizobium leguminosarum strain Vaf10 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.719

cggtcgaacacgccgtcggtctgcgcgcgccg	CRISPR spacer
gcgcggaacacgtcgtcggtcttcgcgccagg	Protospacer
  *. *******.********* *****   *

910. spacer 9.21|7273189|32|NC_016109|CRT matches to NC_010625 (Paraburkholderia phymatum STM815 plasmid pBPHY01, complete sequence) position: , mismatch: 9, identity: 0.719

cggtcgaacacgccgtcggtctgcgcgcgccg	CRISPR spacer
gggatgagcacgccgtcgctctgcgcgcaaac	Protospacer
 ** .**.********** *********.

911. spacer 9.21|7273189|32|NC_016109|CRT matches to NZ_CP015322 (Mesorhizobium amorphae CCNWGS0123 plasmid pM0123d, complete sequence) position: , mismatch: 9, identity: 0.719

cggtcgaacacgccgtcggtctgcgcgcgccg	CRISPR spacer
ctgtcgaacacggcatcggtctgcggcttctc	Protospacer
* ********** *.**********  . *.

912. spacer 9.24|7273372|32|NC_016109|CRT matches to NZ_LR134459 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 17, complete sequence) position: , mismatch: 9, identity: 0.719

gtgcagcaggcggtccgcggtgccgggcgcga	CRISPR spacer
ccggccgaggcggtccgcggtgtcggtcgcca	Protospacer
 .*    ***************.*** *** *

913. spacer 9.24|7273372|32|NC_016109|CRT matches to NZ_CP044283 (Rhodococcus erythropolis strain X5 plasmid pRhX5, complete sequence) position: , mismatch: 9, identity: 0.719

gtgcagcaggcggtccgcggtgccgggcgcga	CRISPR spacer
ccgagggtcgcgattcgcggtgccgggcgcga	Protospacer
 .* .*   ***.*.*****************

914. spacer 9.24|7273372|32|NC_016109|CRT matches to NZ_CP041045 (Paracoccus sp. AK26 plasmid pAK1, complete sequence) position: , mismatch: 9, identity: 0.719

gtgcagcaggcggtccgcggtgccgggcgcga	CRISPR spacer
cagcagcaggcgggccgcagtgccgattacgc	Protospacer
  *********** ****.******. ..**

915. spacer 9.28|7273626|32|NC_016109|CRT matches to NZ_CP035419 (Leisingera sp. NJS204 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

ggcatcggcggcgcgatggagcaggagcccat	CRISPR spacer
gttgccggcggcgccatggagccggagcaagt	Protospacer
* ...********* ******* *****  .*

916. spacer 9.28|7273626|32|NC_016109|CRT matches to NZ_CP054606 (Sulfitobacter pseudonitzschiae strain H46 plasmid unnamed7, complete sequence) position: , mismatch: 9, identity: 0.719

ggcatcggcggcgcgatggagcaggagcccat	CRISPR spacer
cggatcggcggcgcgacggagcgggaagtctc	Protospacer
 * *************.*****.***. .* .

917. spacer 9.28|7273626|32|NC_016109|CRT matches to NZ_CP040821 (Paraoceanicella profunda strain D4M1 plasmid pD4M1C, complete sequence) position: , mismatch: 9, identity: 0.719

ggcatcggcggc-----gcgatggagcaggagcccat	CRISPR spacer
-----tggccgcgcgtggcgatggagcaggagcccga	Protospacer
     .*** **     ******************.

918. spacer 9.30|7273748|32|NC_016109|CRT matches to NZ_CP011665 (Streptomyces sp. Mg1 plasmid pSMg1-1, complete sequence) position: , mismatch: 9, identity: 0.719

gcgacgccgcgggtccggatcaccgcgacgta	CRISPR spacer
tcgacgccgcggatccggatcaccacccgccg	Protospacer
 ***********.***********.*    ..

919. spacer 9.30|7273748|32|NC_016109|CRT matches to NZ_CP030762 (Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

gcgacgccgcgggtccggatcaccgcgacgta	CRISPR spacer
cggacgccacgggtcctgatcaccgacaagct	Protospacer
  ******.******* ********  * *.

920. spacer 9.31|7273809|32|NC_016109|CRT matches to NZ_CP017300 (Rhodococcus sp. YL-1 plasmid pYLC1, complete sequence) position: , mismatch: 9, identity: 0.719

gacgcctaccgcaccgtcgccgcccagctccg	CRISPR spacer
cgcgagcgccgcagcgtcgccgctcagctccc	Protospacer
 .**  ..***** *********.*******

921. spacer 9.31|7273809|32|NC_016109|CRT matches to NC_022125 (Rhodococcus erythropolis CCM2595 plasmid pRECF1, complete sequence) position: , mismatch: 9, identity: 0.719

gacgcctaccgcaccgtcgccgcccagctccg	CRISPR spacer
ctcgagcgccgcagcgtcgccgctcagctccc	Protospacer
  **  ..***** *********.*******

922. spacer 9.31|7273809|32|NC_016109|CRT matches to NZ_CP015205 (Rhodococcus sp. 008 plasmid pR8C2, complete sequence) position: , mismatch: 9, identity: 0.719

gacgcctaccgcaccgtcgccgcccagctccg	CRISPR spacer
agcgagcgccgcagcgtcgccgctcagctccc	Protospacer
..**  ..***** *********.*******

923. spacer 9.31|7273809|32|NC_016109|CRT matches to NC_015057 (Granulicella tundricola MP5ACTX9 plasmid pACIX901, complete sequence) position: , mismatch: 9, identity: 0.719

gacgcctaccgcaccgtcgccgcccagctccg	CRISPR spacer
cccgcctacctcaccgtcgtcgccctctacct	Protospacer
  ******** ********.*****  . **

924. spacer 9.31|7273809|32|NC_016109|CRT matches to NZ_LR134465 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 23, complete sequence) position: , mismatch: 9, identity: 0.719

gacgcctaccgcaccgtcgccgcccagctccg	CRISPR spacer
tacgcctaccgcatcgtcgacgccgacgacat	Protospacer
 ************.***** **** *   *

925. spacer 9.31|7273809|32|NC_016109|CRT matches to NZ_CP025960 (Rhodococcus qingshengii strain djl-6-2 plasmid pDJL1, complete sequence) position: , mismatch: 9, identity: 0.719

gacgcctaccgcaccgtcgccgcccagctccg	CRISPR spacer
agcgagcgccgcagcgtcgccgctcagctccc	Protospacer
..**  ..***** *********.*******

926. spacer 9.31|7273809|32|NC_016109|CRT matches to NZ_CP011297 (Rhodococcus erythropolis strain BG43 plasmid pRLLBG43, complete sequence) position: , mismatch: 9, identity: 0.719

gacgcctaccgcaccgtcgccgcccagctccg	CRISPR spacer
cgcgagcgccgcagcgtcgccgctcagctccc	Protospacer
 .**  ..***** *********.*******

927. spacer 9.32|7273870|32|NC_016109|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 9, identity: 0.719

-cacgtccggacgctggcgcactcgacgtacag	CRISPR spacer
gcat-cccggacgcggccgcactcgacgtcgcc	Protospacer
 **. .******** * ************

928. spacer 9.33|7273931|32|NC_016109|CRT matches to NZ_CP046906 (Streptomyces sp. QHH-9511 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

tgctccagccagtacggcagccactcggagag	CRISPR spacer
atgtccacccaggacggcagccactccggctg	Protospacer
   **** **** ************* *.  *

929. spacer 9.34|7273992|32|NC_016109|CRT matches to NZ_LR134467 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 25, complete sequence) position: , mismatch: 9, identity: 0.719

acgccgaccgcgcccaggaggagctggtccgc	CRISPR spacer
ggccggagcgcgcccaggaggatctggtggtc	Protospacer
.  * ** ************** *****   *

930. spacer 9.34|7273992|32|NC_016109|CRT matches to NZ_LR723672 (Rhizobium flavum strain YW14 plasmid 3) position: , mismatch: 9, identity: 0.719

acgccgaccgcgcccaggaggagctggtccgc	CRISPR spacer
tcggtcaccccgcccaggaggagccggtcgag	Protospacer
 ** . *** **************.**** .

931. spacer 9.34|7273992|32|NC_016109|CRT matches to KX961385 (Bordetella virus LK3, complete genome) position: , mismatch: 9, identity: 0.719

acgccgaccgcgcccaggaggagctggtccgc	CRISPR spacer
gcttcgagcgcgcccgggaggagctggagaac	Protospacer
.* .*** *******.***********   .*

932. spacer 9.34|7273992|32|NC_016109|CRT matches to KY000220 (Bordetella phage FP1, complete genome) position: , mismatch: 9, identity: 0.719

acgccgaccgcgcccaggaggagctggtccgc	CRISPR spacer
gcttcgagcgcgcccgggaggagctggagaac	Protospacer
.* .*** *******.***********   .*

933. spacer 9.34|7273992|32|NC_016109|CRT matches to KY000221 (Bordetella phage CN1, complete genome) position: , mismatch: 9, identity: 0.719

acgccgaccgcgcccaggaggagctggtccgc	CRISPR spacer
gcttcgagcgcgcccgggaggagctggagaac	Protospacer
.* .*** *******.***********   .*

934. spacer 9.34|7273992|32|NC_016109|CRT matches to NC_047877 (Bordetella phage CN2, complete genome) position: , mismatch: 9, identity: 0.719

acgccgaccgcgcccaggaggagctggtccgc	CRISPR spacer
gcttcgagcgcgcccgggaggagctggagaac	Protospacer
.* .*** *******.***********   .*

935. spacer 9.34|7273992|32|NC_016109|CRT matches to NC_047879 (Bordetella phage MW2, complete genome) position: , mismatch: 9, identity: 0.719

acgccgaccgcgcccaggaggagctggtccgc	CRISPR spacer
gcttcgagcgcgcccgggaggagctggagaac	Protospacer
.* .*** *******.***********   .*

936. spacer 9.40|7273371|33|NC_016109|PILER-CR matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 9, identity: 0.727

agtgcagcaggcggtccgcggtgccgggcgcga	CRISPR spacer
tgggcagcaggcgctgcgcggtgccggcccgcc	Protospacer
 * ********** * *********** *

937. spacer 9.47|7273808|33|NC_016109|PILER-CR matches to NZ_CP034352 (Streptomyces sp. W1SF4 plasmid p2, complete sequence) position: , mismatch: 9, identity: 0.727

ggacgcctaccgcaccgtcgccgcccagctccg	CRISPR spacer
cgacgcgttccgcaccgtcgccgcctccgtctc	Protospacer
 ***** * ****************.   **.

938. spacer 9.47|7273808|33|NC_016109|PILER-CR matches to NC_014120 (Paraburkholderia sp. CCGE1002 plasmid pBC201, complete sequence) position: , mismatch: 9, identity: 0.727

ggacgcctaccgcaccgtcgccgcccagctccg	CRISPR spacer
gcaacgtgaccgcgccgtcgccgcccagatcct	Protospacer
* *   . *****.************** ***

939. spacer 9.47|7273808|33|NC_016109|PILER-CR matches to NC_016586 (Azospirillum lipoferum 4B plasmid AZO_p2, complete sequence) position: , mismatch: 9, identity: 0.727

ggacgcctaccgcaccgtcgccgcccagctccg	CRISPR spacer
cgacgcctaccccaccgtcaccgcctcggccgc	Protospacer
 ********** *******.*****. * .*

940. spacer 2.1|613107|32|NC_016109|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 10, identity: 0.688

gccgtcgacggcctgaccgacgacgagggcgc	CRISPR spacer
cggctcgacggcctctccgacgacgagtactt	Protospacer
    **********  *********** .* .

941. spacer 2.1|613107|32|NC_016109|CRT matches to NZ_CP019037 (Massilia putida strain 6NM-7 plasmid unnamed2, complete sequence) position: , mismatch: 10, identity: 0.688

gccgtcgacggcctgaccgacgacgagggcgc	CRISPR spacer
aacccgaacggcctgaccgaagacgagcgccg	Protospacer
. * . .************* ****** **

942. spacer 2.1|613107|32|NC_016109|CRT matches to CP030179 (Xanthomonas citri pv. punicae strain LMG 859 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

gccgtcgacggcctgaccgacgacgagggcgc	CRISPR spacer
ggaacgcttggcctgaccgaccaggagggcgc	Protospacer
*  ..   .************ * ********

943. spacer 2.1|613107|32|NC_016109|CRT matches to NZ_CP045721 (Pantoea eucalypti strain LMG 24197 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.688

gccgtcgacggcctgaccgacgacgagggcgc	CRISPR spacer
gagatcgacagcctgaccgacgaggagtttaa	Protospacer
*  .*****.************* ***  ..

944. spacer 2.1|613107|32|NC_016109|CRT matches to NZ_CP032344 (Azospirillum brasilense strain MTCC4038 plasmid p5, complete sequence) position: , mismatch: 10, identity: 0.688

gccgtcgacggcctgaccgacgacgagggcgc	CRISPR spacer
ctgctcgacagcctgaccgacgaccagcccca	Protospacer
 .  *****.************** **  *

945. spacer 2.1|613107|32|NC_016109|CRT matches to NZ_CP033323 (Azospirillum brasilense strain Cd plasmid p5, complete sequence) position: , mismatch: 10, identity: 0.688

gccgtcgacggcctgaccgacgacgagggcgc	CRISPR spacer
ctgctcgacagcctgaccgacgaccagcccca	Protospacer
 .  *****.************** **  *

946. spacer 2.1|613107|32|NC_016109|CRT matches to NZ_CP033317 (Azospirillum brasilense strain Sp 7 plasmid p5, complete sequence) position: , mismatch: 10, identity: 0.688

gccgtcgacggcctgaccgacgacgagggcgc	CRISPR spacer
ctgctcgacagcctgaccgacgaccagcccca	Protospacer
 .  *****.************** **  *

947. spacer 2.1|613107|32|NC_016109|CRT matches to NZ_CP012919 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p5, complete sequence) position: , mismatch: 10, identity: 0.688

gccgtcgacggcctgaccgacgacgagggcgc	CRISPR spacer
ctgctcgacagcctgaccgacgaccagcccca	Protospacer
 .  *****.************** **  *

948. spacer 2.1|613107|32|NC_016109|CRT matches to NZ_CP022517 (Pantoea vagans strain FBS135 plasmid pPant1, complete sequence) position: , mismatch: 10, identity: 0.688

gccgtcgacggcctgaccgacgacgagggcgc	CRISPR spacer
gagatcgacagcctgaccgacgaggagtttaa	Protospacer
*  .*****.************* ***  ..

949. spacer 2.1|613107|32|NC_016109|CRT matches to MH779500 (Mycobacterium phage Crownjwl, complete genome) position: , mismatch: 10, identity: 0.688

gccgtcgacggcctgaccgacgacgagggcgc	CRISPR spacer
gagctcaacggcatgaccgacgacgagcttcg	Protospacer
*   **.***** **************  .

950. spacer 2.1|613107|32|NC_016109|CRT matches to MT776813 (Mycobacterium phage Magic8, complete genome) position: , mismatch: 10, identity: 0.688

gccgtcgacggcctgaccgacgacgagggcgc	CRISPR spacer
gagctcaacggcatgaccgacgacgagcttcg	Protospacer
*   **.***** **************  .

951. spacer 2.1|613107|32|NC_016109|CRT matches to MK279883 (Mycobacterium phage Struggle, complete genome) position: , mismatch: 10, identity: 0.688

gccgtcgacggcctgaccgacgacgagggcgc	CRISPR spacer
gagctcaacggcatgaccgacgacgagcttcg	Protospacer
*   **.***** **************  .

952. spacer 2.1|613107|32|NC_016109|CRT matches to MT897902 (Mycobacterium phage Boehler, complete genome) position: , mismatch: 10, identity: 0.688

gccgtcgacggcctgaccgacgacgagggcgc	CRISPR spacer
gagctcaacggcatgaccgacgacgagcttcg	Protospacer
*   **.***** **************  .

953. spacer 2.4|613290|32|NC_016109|CRT matches to NZ_CP039340 (Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence) position: , mismatch: 10, identity: 0.688

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
gcgttcggacgccgtgcgcgccgcgtccgcgt	Protospacer
  ....****** *************.***

954. spacer 2.4|613290|32|NC_016109|CRT matches to NZ_CP032322 (Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence) position: , mismatch: 10, identity: 0.688

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
ggtgatggacgcggtgcgggcggcgttccggc	Protospacer
 *   ************* ** ******

955. spacer 2.4|613290|32|NC_016109|CRT matches to NZ_CP033874 (Caulobacter sp. FWC26 plasmid p2) position: , mismatch: 10, identity: 0.688

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
tcgcaaggacgccgagcgcgccgcgttcgagc	Protospacer
. .*  ****** * **************

956. spacer 2.4|613290|32|NC_016109|CRT matches to NZ_CP017753 (Cupriavidus sp. USMAHM13 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.688

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
tgacctcgacgcggtgcgcgtcgcccagatct	Protospacer
.***** *************.*** .  ..*

957. spacer 2.5|613351|32|NC_016109|CRT matches to NZ_CP035089 (Pseudomonas sp. 11K1 plasmid p11K1, complete sequence) position: , mismatch: 10, identity: 0.688

cagcactgcgtcctgacctacagggtcaacct	CRISPR spacer
gtgcactacgtcctgaactacagggctgcttt	Protospacer
  *****.******** ********... ..*

958. spacer 2.6|613412|32|NC_016109|CRT matches to NC_017792 (Deinococcus gobiensis I-0 plasmid P4, complete sequence) position: , mismatch: 10, identity: 0.688

ctggtgtcgatcaggtcggcagcctcgccgag	CRISPR spacer
tcatcggcgaccagctcggcagcctcgccgga	Protospacer
... .* ***.*** ***************..

959. spacer 2.6|613412|32|NC_016109|CRT matches to MH744420 (Streptomyces phage Kromp, complete genome) position: , mismatch: 10, identity: 0.688

ctggtgtcgatcaggtcggcagcctcgccgag	CRISPR spacer
tccttctcgatcagctcggcggcctcgccctc	Protospacer
..  * ******** *****.********

960. spacer 2.6|613412|32|NC_016109|CRT matches to AY576796 (Actinoplanes phage phiAsp2, complete genome) position: , mismatch: 10, identity: 0.688

ctggtgtcgatcaggtcggcagcctcgccgag	CRISPR spacer
accagggcgatcaggtcggcggtctcgccgtt	Protospacer
 . . * *************.*.*******

961. spacer 2.8|613534|32|NC_016109|CRT matches to NZ_CP032343 (Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence) position: , mismatch: 10, identity: 0.688

ggcgtcggtggcgaggagttcggtgggggtga	CRISPR spacer
tgcgtcggtggcgagccgttcggtctccgccg	Protospacer
 **************  *******    *. .

962. spacer 2.8|613534|32|NC_016109|CRT matches to NZ_CP032230 (Streptomyces seoulensis strain KCTC 9819 plasmid unnamed) position: , mismatch: 10, identity: 0.688

ggcgtcggtggcgaggagttcggtgggggtga	CRISPR spacer
ctcggcggtggcgaggagtgcggtgtgccgcc	Protospacer
  ** ************** ***** *

963. spacer 2.8|613534|32|NC_016109|CRT matches to NZ_CP012917 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence) position: , mismatch: 10, identity: 0.688

ggcgtcggtggcgaggagttcggtgggggtga	CRISPR spacer
tgcgtcggtggcgagccgttcggtctccgccg	Protospacer
 **************  *******    *. .

964. spacer 2.12|613778|32|NC_016109|CRT matches to NZ_CP053712 (Acetobacteraceae bacterium strain PAMC 26569 plasmid unnamed5, complete sequence) position: , mismatch: 10, identity: 0.688

atgacgaccgggtcggccagcgacccggatcc	CRISPR spacer
tgaacgaccgggttggccagcgatccgatcaa	Protospacer
  .**********.*********.***. .

965. spacer 2.14|613168|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NZ_CP050098 (Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b4, complete sequence) position: , mismatch: 10, identity: 0.697

accacgcccgcccgtcgtcgccccagatgtccg	CRISPR spacer
ggaacgcctgaccgtcgtcgccccagagatatc	Protospacer
.  *****.* **************** .* .

966. spacer 2.14|613168|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NZ_CP021033 (Rhizobium sp. NXC14 plasmid pRspNXC14c, complete sequence) position: , mismatch: 10, identity: 0.697

accacgcccgcccgtcgtcgccccagatgtccg	CRISPR spacer
ggaacgcctggccgtcgtcgccccagagatagc	Protospacer
.  *****.* **************** .*

967. spacer 2.14|613168|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NZ_CP049731 (Rhizobium leguminosarum strain A1 plasmid pRL12, complete sequence) position: , mismatch: 10, identity: 0.697

accacgcccgcccgtcgtcgccccagatgtccg	CRISPR spacer
ggaacgcctgaccgtcgtcgccccagagatatc	Protospacer
.  *****.* **************** .* .

968. spacer 2.14|613168|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NC_007766 (Rhizobium etli CFN 42 plasmid p42f, complete sequence) position: , mismatch: 10, identity: 0.697

accacgcccgcccgtcgtcgccccagatgtccg	CRISPR spacer
ggaacgcctggccgtcgtcgccccagagatagc	Protospacer
.  *****.* **************** .*

969. spacer 2.14|613168|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NZ_CP053440 (Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eF, complete sequence) position: , mismatch: 10, identity: 0.697

accacgcccgcccgtcgtcgccccagatgtccg	CRISPR spacer
ggaacgcctgaccgtcgtcgccccagagatatc	Protospacer
.  *****.* **************** .* .

970. spacer 2.14|613168|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NZ_CP006990 (Rhizobium sp. IE4771 plasmid pRetIE4771d, complete sequence) position: , mismatch: 10, identity: 0.697

accacgcccgcccgtcgtcgccccagatgtccg	CRISPR spacer
ggaacgcctggccgtcgtcgccccagagatagc	Protospacer
.  *****.* **************** .*

971. spacer 2.14|613168|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NZ_CP021029 (Rhizobium sp. TAL182 plasmid pRetTAL182e, complete sequence) position: , mismatch: 10, identity: 0.697

accacgcccgcccgtcgtcgccccagatgtccg	CRISPR spacer
ggaacgcctgaccgtcgtcgccccagagatagc	Protospacer
.  *****.* **************** .*

972. spacer 2.14|613168|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NZ_CP013635 (Rhizobium sp. N324 plasmid pRspN324e, complete sequence) position: , mismatch: 10, identity: 0.697

accacgcccgcccgtcgtcgccccagatgtccg	CRISPR spacer
ggaacgcctggccgtcgtcgccccagagatagc	Protospacer
.  *****.* **************** .*

973. spacer 2.14|613168|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NZ_CP020911 (Rhizobium etli strain NXC12 plasmid pRetNXC12e, complete sequence) position: , mismatch: 10, identity: 0.697

accacgcccgcccgtcgtcgccccagatgtccg	CRISPR spacer
ggaacgcctggccgtcgtcgccccagagatagc	Protospacer
.  *****.* **************** .*

974. spacer 2.14|613168|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NZ_CP020952 (Rhizobium sp. CIAT894 plasmid pRheCIAT894e, complete sequence) position: , mismatch: 10, identity: 0.697

accacgcccgcccgtcgtcgccccagatgtccg	CRISPR spacer
ggaacgcctggccgtcgtcgccccagagatagc	Protospacer
.  *****.* **************** .*

975. spacer 2.14|613168|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NZ_CP013600 (Rhizobium sp. N741 plasmid pRspN741e, complete sequence) position: , mismatch: 10, identity: 0.697

accacgcccgcccgtcgtcgccccagatgtccg	CRISPR spacer
ggaacgcctgaccgtcgtcgccccagagatagc	Protospacer
.  *****.* **************** .*

976. spacer 2.14|613168|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NZ_CP013531 (Rhizobium phaseoli strain R723 plasmid pRphaR723d, complete sequence) position: , mismatch: 10, identity: 0.697

accacgcccgcccgtcgtcgccccagatgtccg	CRISPR spacer
ggaacgcctggccgtcgtcgccccagagataac	Protospacer
.  *****.* **************** .*

977. spacer 2.14|613168|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NC_021911 (Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1f, complete sequence) position: , mismatch: 10, identity: 0.697

accacgcccgcccgtcgtcgccccagatgtccg	CRISPR spacer
ggaacgcctggccgtcgtcgccccagagatagc	Protospacer
.  *****.* **************** .*

978. spacer 2.14|613168|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NC_011368 (Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG201, complete sequence) position: , mismatch: 10, identity: 0.697

accacgcccgcccgtcgtcgccccagatgtccg	CRISPR spacer
ggaacgcctggccgtcgtcgccccagagatagc	Protospacer
.  *****.* **************** .*

979. spacer 2.14|613168|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NZ_CP013504 (Rhizobium esperanzae strain N561 plasmid pRspN561d, complete sequence) position: , mismatch: 10, identity: 0.697

accacgcccgcccgtcgtcgccccagatgtccg	CRISPR spacer
ggaacgcctgaccgtcgtcgccccagagatagc	Protospacer
.  *****.* **************** .*

980. spacer 2.14|613168|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NZ_CP013584 (Rhizobium phaseoli strain N261 plasmid pRphaN261d, complete sequence) position: , mismatch: 10, identity: 0.697

accacgcccgcccgtcgtcgccccagatgtccg	CRISPR spacer
ggaacgcctggccgtcgtcgccccagagataac	Protospacer
.  *****.* **************** .*

981. spacer 2.14|613168|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NZ_CP013510 (Rhizobium sp. N1341 plasmid pRspN1341e, complete sequence) position: , mismatch: 10, identity: 0.697

accacgcccgcccgtcgtcgccccagatgtccg	CRISPR spacer
ggaacgcctgaccgtcgtcgccccagagatagc	Protospacer
.  *****.* **************** .*

982. spacer 2.14|613168|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NZ_CP013521 (Rhizobium sp. N113 plasmid pRspN113d, complete sequence) position: , mismatch: 10, identity: 0.697

accacgcccgcccgtcgtcgccccagatgtccg	CRISPR spacer
ggaacgcctgaccgtcgtcgccccagagatagc	Protospacer
.  *****.* **************** .*

983. spacer 2.14|613168|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NZ_CP013494 (Rhizobium sp. N6212 plasmid pRspN6212d, complete sequence) position: , mismatch: 10, identity: 0.697

accacgcccgcccgtcgtcgccccagatgtccg	CRISPR spacer
ggaacgcctgaccgtcgtcgccccagagatagc	Protospacer
.  *****.* **************** .*

984. spacer 2.14|613168|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NZ_CP013515 (Rhizobium sp. N1314 plasmid pRspN1314d, complete sequence) position: , mismatch: 10, identity: 0.697

accacgcccgcccgtcgtcgccccagatgtccg	CRISPR spacer
ggaacgcctgaccgtcgtcgccccagagatagc	Protospacer
.  *****.* **************** .*

985. spacer 2.14|613168|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NZ_CP054028 (Rhizobium sp. JKLM19E plasmid pPR19E01, complete sequence) position: , mismatch: 10, identity: 0.697

accacgcccgcccgtcgtcgccccagatgtccg	CRISPR spacer
gaaacgcctggccgtcgtcgccccagagataac	Protospacer
.  *****.* **************** .*

986. spacer 2.14|613168|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NZ_CP013594 (Rhizobium sp. N871 plasmid pRspN871d, complete sequence) position: , mismatch: 10, identity: 0.697

accacgcccgcccgtcgtcgccccagatgtccg	CRISPR spacer
ggaacgcctgaccgtcgtcgccccagagatagc	Protospacer
.  *****.* **************** .*

987. spacer 2.14|613168|33|NC_016109|CRISPRCasFinder,PILER-CR matches to CP007644 (Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803c, complete sequence) position: , mismatch: 10, identity: 0.697

accacgcccgcccgtcgtcgccccagatgtccg	CRISPR spacer
ggaacgcctggccgtcgtcgccccagagatagc	Protospacer
.  *****.* **************** .*

988. spacer 2.14|613168|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NC_010997 (Rhizobium etli CIAT 652 plasmid pC, complete sequence) position: , mismatch: 10, identity: 0.697

accacgcccgcccgtcgtcgccccagatgtccg	CRISPR spacer
ggaacgcctggccgtcgtcgccccagagataac	Protospacer
.  *****.* **************** .*

989. spacer 2.14|613168|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NZ_CP013605 (Rhizobium sp. N731 plasmid pRspN731d, complete sequence) position: , mismatch: 10, identity: 0.697

accacgcccgcccgtcgtcgccccagatgtccg	CRISPR spacer
ggaacgcctgaccgtcgtcgccccagagatagc	Protospacer
.  *****.* **************** .*

990. spacer 2.16|613290|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 10, identity: 0.697

cgacctggacgcggtgcgcgccgcgttcgccgc	CRISPR spacer
gccgctggacgaggtgcgcgccacgttcgaacg	Protospacer
    ******* **********.******

991. spacer 2.16|613290|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NZ_CP032054 (Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence) position: , mismatch: 10, identity: 0.697

cgacctggacgcggtgcgcgccgcgttcgccgc	CRISPR spacer
gccgctggacgaggtgcgcgccacgttcgaacg	Protospacer
    ******* **********.******

992. spacer 2.16|613290|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NZ_CP016560 (Streptomyces clavuligerus strain F613-1 plasmid pSCL4, complete sequence) position: , mismatch: 10, identity: 0.697

cgacctggacgcggtgcgcgccgcgttcgccgc	CRISPR spacer
gccgctggacgaggtgcgcgccacgttcgaacg	Protospacer
    ******* **********.******

993. spacer 2.18|613412|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NC_015583 (Novosphingobium sp. PP1Y plasmid Mpl, complete sequence) position: , mismatch: 10, identity: 0.697

ctggtgtcgatcaggtcggcagcctcgccgagg	CRISPR spacer
tgctcggcgaacaggtcggcagcctcgtcgacc	Protospacer
.   .* *** ****************.***

994. spacer 2.18|613412|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NC_015583 (Novosphingobium sp. PP1Y plasmid Mpl, complete sequence) position: , mismatch: 10, identity: 0.697

ctggtgtcgatcaggtcggcagcctcgccgagg	CRISPR spacer
tgctcggcgaacaggtcggcagcctcgtcgacc	Protospacer
.   .* *** ****************.***

995. spacer 3.4|623741|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NC_024970 (Streptomyces aureofaciens strain CCM3239 plasmid pSA3239, complete sequence) position: , mismatch: 10, identity: 0.697

ccagcaggcggccggagccgagcgcgacgccta	CRISPR spacer
ggacaaggcggccgaagccgagcgggacgtgct	Protospacer
  *  *********.********* ****. .

996. spacer 3.4|623741|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_KJ396772 (Streptomyces lavendulae subsp. lavendulae strain CCM3239 plasmid pSA3239, complete sequence) position: , mismatch: 10, identity: 0.697

ccagcaggcggccggagccgagcgcgacgccta	CRISPR spacer
ggacaaggcggccgaagccgagcgggacgtgct	Protospacer
  *  *********.********* ****. .

997. spacer 3.4|623741|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP024986 (Streptomyces lavendulae subsp. lavendulae strain CCM 3239 plasmid pSA3239, complete sequence) position: , mismatch: 10, identity: 0.697

ccagcaggcggccggagccgagcgcgacgccta	CRISPR spacer
ggacaaggcggccgaagccgagcgggacgtgct	Protospacer
  *  *********.********* ****. .

998. spacer 3.10|624107|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NC_015583 (Novosphingobium sp. PP1Y plasmid Mpl, complete sequence) position: , mismatch: 10, identity: 0.697

ccggcccgggatccacgtcgaggacatcgtgaa	CRISPR spacer
gaaggccgggatgcgcgtcgaggacatcgacct	Protospacer
  .* ******* *.**************

999. spacer 3.10|624107|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to MK929790 (Caulobacter phage RW, complete genome) position: , mismatch: 10, identity: 0.697

ccggcccgggatccacgtcgaggacatcgtgaa	CRISPR spacer
tgaacggatgatcgacggcgaggacatcgtgaa	Protospacer
. ..*  . **** *** ***************

1000. spacer 3.10|624107|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to MK929790 (Caulobacter phage RW, complete genome) position: , mismatch: 10, identity: 0.697

ccggcccgggatccacgtcgaggacatcgtgaa	CRISPR spacer
tgaacggatgatcgacggcgaggacatcgtgaa	Protospacer
. ..*  . **** *** ***************

1001. spacer 3.11|624168|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP030864 (Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence) position: , mismatch: 10, identity: 0.697

ccgggacagcggcggccggggctgcgggctgct	CRISPR spacer
ggtacgcggcgggggccggggccgcgggctgcg	Protospacer
   . .*.**** *********.*********

1002. spacer 3.14|624351|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP026333 (Pseudomonas sp. XWY-1 plasmid pXWY, complete sequence) position: , mismatch: 10, identity: 0.697

gccgaagccgcgctcatcgccgcccaccgcctc	CRISPR spacer
gattgtcccgccttcatcgccgcccaccgccag	Protospacer
* . .  **** .******************

1003. spacer 3.14|624351|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to MK496050 (Pseudomonas sp. strain FFUP_PS_41 plasmid pJBCL41, complete sequence) position: , mismatch: 10, identity: 0.697

gccgaagccgcgctcatcgccgcccaccgcctc	CRISPR spacer
gattgtcccgccttcatcgccgcccaccgccag	Protospacer
* . .  **** .******************

1004. spacer 3.14|624351|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP016850 (Pseudomonas sp. TMW 2.1634 plasmid pL21564-1, complete sequence) position: , mismatch: 10, identity: 0.697

gccgaagccgcgctcatcgccgcccaccgcctc	CRISPR spacer
gattgtcccgccttcatcgccgcccaccgccag	Protospacer
* . .  **** .******************

1005. spacer 3.14|624351|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to MK977708 (Mycobacterium phage Fulbright, complete genome) position: , mismatch: 10, identity: 0.697

gccgaagccgcgctcatcgccgcccaccgcctc	CRISPR spacer
gccgacgccgcgcgcatcgccgcctggtccgag	Protospacer
***** ******* **********.. . *

1006. spacer 3.14|624351|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to MG099948 (Mycobacterium phage Philonius, complete genome) position: , mismatch: 10, identity: 0.697

gccgaagccgcgctcatcgccgcccaccgcctc	CRISPR spacer
gccgacgccgcgcgcatcgccgcctggtccgag	Protospacer
***** ******* **********.. . *

1007. spacer 3.14|624351|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to MH926055 (Mycobacterium phage Chewbacca, complete genome) position: , mismatch: 10, identity: 0.697

gccgaagccgcgctcatcgccgcccaccgcctc	CRISPR spacer
gccgacgccgcgcgcatcgccgcctggtccgag	Protospacer
***** ******* **********.. . *

1008. spacer 3.14|624351|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to MT723932 (Mycobacterium phage Schnauzer, complete genome) position: , mismatch: 10, identity: 0.697

gccgaagccgcgctcatcgccgcccaccgcctc	CRISPR spacer
gccgacgccgcgcgcatcgccgcctggtccgag	Protospacer
***** ******* **********.. . *

1009. spacer 3.14|624351|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to KU935726 (Mycobacterium phage Xerxes, complete genome) position: , mismatch: 10, identity: 0.697

gccgaagccgcgctcatcgccgcccaccgcctc	CRISPR spacer
gccgacgccgcgcgcatcgccgcctggtccgag	Protospacer
***** ******* **********.. . *

1010. spacer 3.14|624351|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to KU935730 (Mycobacterium phage Pipsqueaks, complete genome) position: , mismatch: 10, identity: 0.697

gccgaagccgcgctcatcgccgcccaccgcctc	CRISPR spacer
gccgacgccgcgcgcatcgccgcctggtccgag	Protospacer
***** ******* **********.. . *

1011. spacer 3.14|624351|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to MH316570 (Mycobacterium phage Silvafighter, complete genome) position: , mismatch: 10, identity: 0.697

gccgaagccgcgctcatcgccgcccaccgcctc	CRISPR spacer
gccgacgccgcgcgcatcgccgcctggtccgag	Protospacer
***** ******* **********.. . *

1012. spacer 3.14|624351|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to MK524518 (Mycobacterium phage Smurph, complete genome) position: , mismatch: 10, identity: 0.697

gccgaagccgcgctcatcgccgcccaccgcctc	CRISPR spacer
gccgacgccgcgcgcatcgccgcctggtccgag	Protospacer
***** ******* **********.. . *

1013. spacer 3.14|624351|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to MK524515 (Mycobacterium phage Parmesanjohn, complete genome) position: , mismatch: 10, identity: 0.697

gccgaagccgcgctcatcgccgcccaccgcctc	CRISPR spacer
gccgacgccgcgcgcatcgccgcctggtccgag	Protospacer
***** ******* **********.. . *

1014. spacer 3.14|624351|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to MH697585 (Mycobacterium phage Gex, complete genome) position: , mismatch: 10, identity: 0.697

gccgaagccgcgctcatcgccgcccaccgcctc	CRISPR spacer
gccgacgccgcgcgcatcgccgcctggtccgag	Protospacer
***** ******* **********.. . *

1015. spacer 3.14|624351|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to KM588359 (Mycobacterium phage Carcharodon, complete genome) position: , mismatch: 10, identity: 0.697

gccgaagccgcgctcatcgccgcccaccgcctc	CRISPR spacer
gccgacgccgcgcgcatcgccgcctggtccgag	Protospacer
***** ******* **********.. . *

1016. spacer 3.14|624351|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to MH697576 (Mycobacterium phage Aggie, complete genome) position: , mismatch: 10, identity: 0.697

gccgaagccgcgctcatcgccgcccaccgcctc	CRISPR spacer
gccgacgccgcgcgcatcgccgcctggtccgag	Protospacer
***** ******* **********.. . *

1017. spacer 3.14|624351|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to MH697593 (Mycobacterium phage Tapioca, complete genome) position: , mismatch: 10, identity: 0.697

gccgaagccgcgctcatcgccgcccaccgcctc	CRISPR spacer
gccgacgccgcgcgcatcgccgcctggtccgag	Protospacer
***** ******* **********.. . *

1018. spacer 3.14|624351|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to KU935729 (Mycobacterium phage SkinnyPete, complete genome) position: , mismatch: 10, identity: 0.697

gccgaagccgcgctcatcgccgcccaccgcctc	CRISPR spacer
gccgacgccgcgcgcatcgccgcctggtccgag	Protospacer
***** ******* **********.. . *

1019. spacer 3.14|624351|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to JN256079 (Mycobacterium phage Charlie, complete genome) position: , mismatch: 10, identity: 0.697

gccgaagccgcgctcatcgccgcccaccgcctc	CRISPR spacer
gccgacgccgcgcgcatcgccgcctggtccgag	Protospacer
***** ******* **********.. . *

1020. spacer 3.16|624473|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP018634 (Salmonella enterica subsp. enterica serovar Enteritidis strain 49-2444 plasmid pSE49-2444, complete sequence) position: , mismatch: 10, identity: 0.697

ccgggagccgcggcaggagatggtcagccgggc	CRISPR spacer
ccgggagcggctgcaggagatggtgtgtgacct	Protospacer
******** ** ************  *. .  .

1021. spacer 3.19|624656|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP018634 (Salmonella enterica subsp. enterica serovar Enteritidis strain 49-2444 plasmid pSE49-2444, complete sequence) position: , mismatch: 10, identity: 0.697

ccgggagccgcggcaggagatggtcagccgggc	CRISPR spacer
ccgggagcggctgcaggagatggtgtgtgacct	Protospacer
******** ** ************  *. .  .

1022. spacer 3.23|624900|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NC_012586 (Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence) position: , mismatch: 10, identity: 0.697

ctcggcgaggcgggcggacgtcatgcggacgag	CRISPR spacer
tccggcgatgcgggccgacgtcatgctcgacat	Protospacer
..****** ****** **********  .  *

1023. spacer 3.25|625022|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP012477 (Arthrobacter sp. ERGS1:01 isolate water plasmid unnamed2, complete sequence) position: , mismatch: 10, identity: 0.697

gcggggcacgaccccggccgaggacaaggcgta	CRISPR spacer
cggcggcacggccccggccggggacaagttccc	Protospacer
  * ******.*********.******* . .

1024. spacer 3.30|625327|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 10, identity: 0.697

cccatccccgacggccgcgcgctgttcctggcc	CRISPR spacer
gaggacaccgacggttgcgcgctgttcctggtg	Protospacer
   . * *******..***************.

1025. spacer 3.30|625327|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 10, identity: 0.697

cccatccccgacggccgcgcgctgttcctggcc	CRISPR spacer
gaggacaccgacggttgcgcgctgttcctggtg	Protospacer
   . * *******..***************.

1026. spacer 3.31|625388|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 10, identity: 0.697

gatcggcctcggcgggatcggcgacaccctgaa	CRISPR spacer
gatcggcatcggcgggatgggcgaggtctaccg	Protospacer
******* ********** ***** ..*.   .

1027. spacer 3.34|625571|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP018464 (Xanthomonas euvesicatoria strain LMG930 plasmid pLMG930.1, complete sequence) position: , mismatch: 10, identity: 0.697

cggacgagggcccgtgcggcaacgccacccacc	CRISPR spacer
tccgctcgggcctgggcggcaacgccacccaga	Protospacer
.  .*  *****.* ****************

1028. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP044425 (Paracoccus pantotrophus strain DSM 2944 plasmid pPAN2, complete sequence) position: , mismatch: 10, identity: 0.688

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
tcatgcgccagcagcagcccggcggcgatggt	Protospacer
   . *  ****************** *.**.

1029. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP007129 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence) position: , mismatch: 10, identity: 0.688

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
gccatgagcagcagcagcccgacggcgacgag	Protospacer
. * .  **************.**** ***.

1030. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to NZ_CP010410 (Xanthomonas sacchari strain R1 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
ccacctcgcagcagccgcccggcggcagcacg	Protospacer
   **.********* ********** .*.

1031. spacer 5.1|2749100|32|NC_016109|CRISPRCasFinder matches to MN586006 (Mycobacterium phage Bachome, complete genome) position: , mismatch: 10, identity: 0.688

agcccccgcagcagcagcccggcggctacggc	CRISPR spacer
cgtccccgcagcagcagggcggcggcggtcag	Protospacer
 *.**************  ******* .. .

1032. spacer 9.11|7273627|31|NC_016109|CRISPRCasFinder matches to NZ_LR594673 (Variovorax sp. PBL-E5 plasmid 3) position: , mismatch: 10, identity: 0.677

gcatcggcggcgcgatggagcaggagcccat	CRISPR spacer
taggcggcggcgcgatcaagcaggagcaggg	Protospacer
  . ************ .*********  .

1033. spacer 9.15|7273871|31|NC_016109|CRISPRCasFinder matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 10, identity: 0.677

acgtccggacgctggcgcactcgacgtacag	CRISPR spacer
catcccggacgcggccgcactcgacgtcgcc	Protospacer
   .******** * ************

1034. spacer 9.16|7273932|31|NC_016109|CRISPRCasFinder matches to NC_010510 (Methylobacterium radiotolerans JCM 2831 plasmid pMRAD01, complete sequence) position: , mismatch: 10, identity: 0.677

gctccagccagtacggcagccactcggagag	CRISPR spacer
tgctcagccagtacggcagcgacacggtcga	Protospacer
  ..**************** ** ***  ..

1035. spacer 9.17|7273993|31|NC_016109|CRISPRCasFinder matches to MH271318 (Gordonia phage Trine, complete genome) position: , mismatch: 10, identity: 0.677

cgccgaccgcgcccaggaggagctggtccgc	CRISPR spacer
tctgcgccgcgccgaggatgagctggtcccg	Protospacer
. .  .******* **** **********

1036. spacer 9.21|7273189|32|NC_016109|CRT matches to NC_010625 (Paraburkholderia phymatum STM815 plasmid pBPHY01, complete sequence) position: , mismatch: 10, identity: 0.688

cggtcgaacacgccgtcggtctgcgcgcgccg	CRISPR spacer
tggtcgaacccgccgtcggcctgcagcccttc	Protospacer
.******** *********.****.  * ..

1037. spacer 9.21|7273189|32|NC_016109|CRT matches to KY006853 (Erythrobacter phage vB_EliS_R6L, complete genome) position: , mismatch: 10, identity: 0.688

cggtcgaacacgccgtcggtctgcgcgcgccg	CRISPR spacer
cggtcgtccacgccgtcggtctgaatcgaatg	Protospacer
******  *************** ..  . .*

1038. spacer 9.29|7273687|32|NC_016109|CRT matches to NC_014838 (Pantoea sp. At-9b plasmid pPAT9B01, complete sequence) position: , mismatch: 10, identity: 0.688

ggattgggtgcgccccccggtatgcaccacag	CRISPR spacer
cagttgggtgcgcaccccgttatgcaggctgg	Protospacer
 ..********** ***** ******   ..*

1039. spacer 9.30|7273748|32|NC_016109|CRT matches to JX100810 (Caulobacter phage CcrColossus, complete genome) position: , mismatch: 10, identity: 0.688

gcgacgccgcgggtccggatcaccgcgacgta	CRISPR spacer
ctgacgccgcgcatccggatcaccgatgccgg	Protospacer
 .********* .************  .*  .

1040. spacer 9.31|7273809|32|NC_016109|CRT matches to NZ_LN832562 (Paracoccus aminovorans isolate JCM7685 plasmid IV, complete sequence) position: , mismatch: 10, identity: 0.688

gacgcctaccgcaccgtcgccgcccagctccg	CRISPR spacer
aacgccgcccgcaccgtcgccgcctcctcgcc	Protospacer
.*****  ****************.  .. *

1041. spacer 9.31|7273809|32|NC_016109|CRT matches to NZ_CP044217 (Mesorhizobium sp. NIBRBAC000500504 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

gacgcctaccgcaccgtcgccgcccagctccg	CRISPR spacer
tcccgataccgcatcgtcgccgcgcagctggt	Protospacer
  *   *******.********* *****

1042. spacer 9.31|7273809|32|NC_016109|CRT matches to NZ_CP032342 (Azospirillum brasilense strain MTCC4038 plasmid p3, complete sequence) position: , mismatch: 10, identity: 0.688

gacgcctaccgcaccgtcgccgcccagctccg	CRISPR spacer
aacgccaacggcaccgtcgccgccggcaacaa	Protospacer
.***** ** ************** .   * .

1043. spacer 9.31|7273809|32|NC_016109|CRT matches to NZ_CP033321 (Azospirillum brasilense strain Cd plasmid p3, complete sequence) position: , mismatch: 10, identity: 0.688

gacgcctaccgcaccgtcgccgcccagctccg	CRISPR spacer
aacgccaacggcaccgtcgccgccggcaacaa	Protospacer
.***** ** ************** .   * .

1044. spacer 9.31|7273809|32|NC_016109|CRT matches to NZ_CP033315 (Azospirillum brasilense strain Sp 7 plasmid p3, complete sequence) position: , mismatch: 10, identity: 0.688

gacgcctaccgcaccgtcgccgcccagctccg	CRISPR spacer
aacgccaacggcaccgtcgccgccggcaacaa	Protospacer
.***** ** ************** .   * .

1045. spacer 9.32|7273870|32|NC_016109|CRT matches to NZ_CP021357 (Rhodococcus sp. S2-17 plasmid pRB11, complete sequence) position: , mismatch: 10, identity: 0.688

cacgtccggacgctggcgcactcgacgtacag	CRISPR spacer
tcggtcgggacgctcgcgcactcgacccgctt	Protospacer
.  *** ******* *********** ..*

1046. spacer 9.32|7273870|32|NC_016109|CRT matches to NZ_CP046573 (Rhodococcus sp. WAY2 plasmid pRWAY01, complete sequence) position: , mismatch: 10, identity: 0.688

cacgtccggacgctggcgcactcgacgtacag	CRISPR spacer
tcggtcgggacgctcgcgcactcgacccgctt	Protospacer
.  *** ******* *********** ..*

1047. spacer 9.34|7273992|32|NC_016109|CRT matches to MH271305 (Gordonia phage Morrissey, complete genome) position: , mismatch: 10, identity: 0.688

acgccgaccgcgcccaggaggagctggtccgc	CRISPR spacer
ttctgggccgcgcccaggatgagcttgtcccg	Protospacer
 . . *.************ ***** ****

1048. spacer 9.37|7273188|33|NC_016109|PILER-CR matches to NZ_CP028348 (Novosphingobium sp. THN1 plasmid pTHN, complete sequence) position: , mismatch: 10, identity: 0.697

gcggtcgaacacgccgtcggtctgcgcgcgccg	CRISPR spacer
ctcgccgaacacggcgtcggtctgcacgccggt	Protospacer
 . *.******** ***********.***

1049. spacer 9.37|7273188|33|NC_016109|PILER-CR matches to KY006853 (Erythrobacter phage vB_EliS_R6L, complete genome) position: , mismatch: 10, identity: 0.697

gcggtcgaacacgccgtcggtctgcgcgcgccg	CRISPR spacer
gcggtcgtccacgccgtcggtctgaatcgaatg	Protospacer
*******  *************** ..  . .*

1050. spacer 2.9|613595|32|NC_016109|CRT matches to NZ_CP050953 (Rhodococcus sp. DMU1 plasmid unnamed) position: , mismatch: 11, identity: 0.656

tcggcgagggtgtgctgggcgtcggcgtaggc	CRISPR spacer
acggcgagggtgtgcttgtcgtcgatcagaat	Protospacer
 *************** * *****..  ....

1051. spacer 2.12|613778|32|NC_016109|CRT matches to NZ_CP013744 (Streptomyces sp. CdTB01 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.656

atgacgaccgggtcggccagcgacccggatcc	CRISPR spacer
gctcggacctgctcggccagcgacccgggcag	Protospacer
..   **** * ****************..

1052. spacer 2.12|613778|32|NC_016109|CRT matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 11, identity: 0.656

atgacgaccgggtcggccagcgacccggatcc	CRISPR spacer
gccgagaccggctcggccagcgactcggcgat	Protospacer
.. . ****** ************.***   .

1053. spacer 2.16|613290|33|NC_016109|CRISPRCasFinder,PILER-CR matches to NZ_CP039340 (Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence) position: , mismatch: 11, identity: 0.667

cgacctggacgcggtgcgcgccgcgttcgccgc	CRISPR spacer
gcgttcggacgccgtgcgcgccgcgtccgcgta	Protospacer
  ....****** *************.***

1054. spacer 3.4|623741|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NC_023285 (Streptomyces sp. F8 plasmid pFRL5, complete sequence) position: , mismatch: 11, identity: 0.667

ccagcaggcggccggagccgagcgcgacgccta	CRISPR spacer
gggtcaggcggccgaagtcgagcgcgaccgtgg	Protospacer
  . **********.**.**********  . .

1055. spacer 3.7|623924|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP017750 (Cupriavidus sp. USMAA2-4 plasmid unnamed1, complete sequence) position: , mismatch: 11, identity: 0.667

ccggctgccgccgctggtgaaggtgaagccgat	CRISPR spacer
tgccttgccgccgctggtcacggtgaagcgatc	Protospacer
.   .************* * ******** . .

1056. spacer 3.7|623924|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP017753 (Cupriavidus sp. USMAHM13 plasmid unnamed1, complete sequence) position: , mismatch: 11, identity: 0.667

ccggctgccgccgctggtgaaggtgaagccgat	CRISPR spacer
tgccttgccgccgctggtcacggtgaagcgatc	Protospacer
.   .************* * ******** . .

1057. spacer 3.21|624778|33|NC_016109|PILER-CR,CRISPRCasFinder,CRT matches to NC_016586 (Azospirillum lipoferum 4B plasmid AZO_p2, complete sequence) position: , mismatch: 11, identity: 0.667

----ccggcccggggcgcccgccgccggggcggagag	CRISPR spacer
gccgccgcccc--ggcgccgggcggcccggcgcag--	Protospacer
    *** ***  ****** * ** *  **** **

1058. spacer 9.28|7273626|32|NC_016109|CRT matches to NZ_LR594673 (Variovorax sp. PBL-E5 plasmid 3) position: , mismatch: 11, identity: 0.656

ggcatcggcggcgcgatggagcaggagcccat	CRISPR spacer
ataggcggcggcgcgatcaagcaggagcaggg	Protospacer
.  . ************ .*********  .

1059. spacer 9.33|7273931|32|NC_016109|CRT matches to NC_010510 (Methylobacterium radiotolerans JCM 2831 plasmid pMRAD01, complete sequence) position: , mismatch: 11, identity: 0.656

tgctccagccagtacggcagccactcggagag	CRISPR spacer
ctgctcagccagtacggcagcgacacggtcga	Protospacer
.  ..**************** ** ***  ..

1060. spacer 9.34|7273992|32|NC_016109|CRT matches to MH271318 (Gordonia phage Trine, complete genome) position: , mismatch: 11, identity: 0.656

acgccgaccgcgcccaggaggagctggtccgc	CRISPR spacer
ttctgcgccgcgccgaggatgagctggtcccg	Protospacer
 . .  .******* **** **********

1061. spacer 2.4|613290|32|NC_016109|CRT matches to NZ_CP035502 (Sphingosinicella sp. BN140058 plasmid p1, complete sequence) position: , mismatch: 14, identity: 0.562

cgacctggacgcggtgcgcgccgcgttcgccg	CRISPR spacer
cggtcgcgacggcgcgcgccgcgtcctggtcg	Protospacer
**..*  ****  *.****  **. .* *.**

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

2423561 : 2485313

environmental_halophage(20.0%)

transposase,protease

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014135320.1\|2423561_2424377_+\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_014135321.1\|2424373_2424655_+	Lrp/AsnC ligand binding domain-containing protein	NA	NA	NA	NA
WP_014135322.1\|2424662_2426030_-	aminotransferase class V-fold PLP-dependent enzyme	Q2XUY6	environmental_halophage	1.1e-42	34.2
WP_014135323.1\|2426308_2427388_-	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	3.7e-43	35.0
WP_014135324.1\|2427528_2427954_-	hypothetical protein	NA	NA	NA	NA
WP_014135325.1\|2428259_2428880_+	heme-copper oxidase subunit III	NA	NA	NA	NA
WP_014135326.1\|2428971_2429793_+	c-type cytochrome	NA	NA	NA	NA
WP_106437640.1\|2429801_2430857_+	Rieske 2Fe-2S domain-containing protein	NA	NA	NA	NA
WP_014135328.1\|2430853_2432512_+	ubiquinol-cytochrome c reductase cytochrome b subunit	NA	NA	NA	NA
WP_014135329.1\|2432621_2432990_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_014135330.1\|2433048_2434650_-	amidohydrolase	NA	NA	NA	NA
WP_033258133.1\|2434675_2435308_-	TetR family transcriptional regulator C-terminal domain-containing protein	NA	NA	NA	NA
WP_014135332.1\|2435417_2436878_+	cytosine permease	NA	NA	NA	NA
WP_014135333.1\|2436933_2438184_-	L,D-transpeptidase family protein	NA	NA	NA	NA
WP_014135334.1\|2438415_2438832_-	cytochrome c oxidase subunit 4	NA	NA	NA	NA
WP_014135336.1\|2440603_2441461_-	cytochrome c oxidase subunit II	NA	NA	NA	NA
WP_014135337.1\|2441824_2443249_+	aminotransferase class V-fold PLP-dependent enzyme	NA	NA	NA	NA
WP_014135338.1\|2443262_2444240_-	carbohydrate kinase family protein	NA	NA	NA	NA
WP_014135339.1\|2444443_2444662_+	hypothetical protein	NA	NA	NA	NA
WP_014135340.1\|2444756_2445377_+	hypothetical protein	NA	NA	NA	NA
WP_014135341.1\|2445460_2445814_-	iron-sulfur cluster insertion protein ErpA	NA	NA	NA	NA
WP_033258111.1\|2446020_2446902_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_033258136.1\|2446918_2448265_-	glutamate decarboxylase	S4W1T5	Pandoravirus	4.8e-24	32.4
WP_014135344.1\|2448431_2448905_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_014135345.1\|2448989_2449916_-	NADP-dependent oxidoreductase	NA	NA	NA	NA
WP_014135346.1\|2450097_2451279_+	quinolinate synthase NadA	NA	NA	NA	NA
WP_014135347.1\|2451351_2451645_-	hypothetical protein	NA	NA	NA	NA
WP_081539371.1\|2451673_2452462_-	PspA/IM30 family protein	NA	NA	NA	NA
WP_014135349.1\|2452666_2453269_+	DUF3043 domain-containing protein	NA	NA	NA	NA
WP_033258113.1\|2453469_2454180_+	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_014135351.1\|2454239_2454440_-	hypothetical protein	NA	NA	NA	NA
WP_014135352.1\|2454539_2455100_+	bifunctional adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase	NA	NA	NA	NA
WP_014135353.1\|2455111_2456230_+	nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase	NA	NA	NA	NA
WP_014135354.1\|2456267_2457092_+	adenosylcobinamide-GDP ribazoletransferase	NA	NA	NA	NA
WP_033258115.1\|2457317_2458814_+	leucyl aminopeptidase	Q6GYZ8	Mycoplasma_phage	2.0e-42	37.5
WP_014135356.1\|2459199_2460588_+	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	5.3e-34	28.2
WP_014135357.1\|2460646_2462413_+	2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase	NA	NA	NA	NA
WP_014135358.1\|2462599_2463115_+	DUF4240 domain-containing protein	NA	NA	NA	NA
WP_033258116.1\|2463157_2463865_-	hypothetical protein	NA	NA	NA	NA
WP_014135360.1\|2463981_2464485_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_033258117.1\|2464551_2465475_+	TIGR01777 family protein	NA	NA	NA	NA
WP_014135362.1\|2465862_2467188_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_051055774.1\|2467238_2468684_-	hypothetical protein	NA	NA	NA	NA
WP_014135364.1\|2469151_2469925_+	3-hydroxybutyrate dehydrogenase	NA	NA	NA	NA
WP_014135365.1\|2470136_2472029_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_033258143.1\|2472234_2473008_+	lipoyl(octanoyl) transferase LipB	NA	NA	NA	NA
WP_014135367.1\|2473125_2474082_+	lipoyl synthase	NA	NA	NA	NA
WP_158413053.1\|2474258_2474411_+	hypothetical protein	NA	NA	NA	NA
WP_033258118.1\|2474579_2475266_+	DUF4191 domain-containing protein	NA	NA	NA	NA
WP_014135370.1\|2475410_2476325_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_014135371.1\|2476388_2476856_-	RDD family protein	NA	NA	NA	NA
WP_014135372.1\|2477237_2478650_+	type I glutamate--ammonia ligase	NA	NA	NA	NA
WP_041293896.1\|2479056_2479671_-\|transposase	transposase	NA	NA	NA	NA
WP_014135374.1\|2479580_2480120_-	winged helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_014135375.1\|2480186_2481125_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_033260452.1\|2481217_2481616_-	type IV toxin-antitoxin system AbiEi family antitoxin domain-containing protein	NA	NA	NA	NA
WP_106437641.1\|2482575_2483366_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_014135380.1\|2484161_2485313_+\|transposase	ISAs1 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_016109

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection