CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NC_017368	Helicobacter pylori F16, complete genome	3 crisprs	cas14j,c2c9_V-U4,DEDDh	1	3	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_017368_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_017368_1

138261-138358

Orphan

Consensus_repeat	Method
CTTTCTTGTTCTAACTCTATCTCACTCTTATTTGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_017368_1

>merge|NC_017368|1|138261-138358|CRISPRCasFinder
CTTTCTTGTTCTAACTCTATCTCACTCTTATTTGCTTTTTGTTTTTCTTGTTCTGTTTTCTGTCTTTCTTGTTCTAACTCTATCCCACTCTTATTTGC

>NC_017368|1|1|138261-138358|CRISPRCasFinder
CTTTCTTGTTCTAACTCTATCTCACTCTTATTTGC	TTTTTGTTTTTCTTGTTCTGTTTTCTGT
CTTTCTTGTTCTAACTCTATCCCACTCTTATTTGC

Protein	Signature genes	Signature genes Name	Protein_function
NC_017368.1\|WP_001269094.1\|138861_141300_-\|pyruvate,-water-dikinase	unknown	unknown	gnl\|CDD\|235809
NC_017368.1\|WP_000154798.1\|130264_130561_+\|hypothetical-protein	unknown	unknown	unknown
NC_017368.1\|WP_001271749.1\|141657_143496_+\|threonine--tRNA-ligase	unknown	unknown	gnl\|CDD\|237050
NC_017368.1\|WP_000521040.1\|126087_127950_-\|molecular-chaperone-DnaK	unknown	unknown	gnl\|CDD\|234715
NC_017368.1\|WP_000750181.1\|144923_145784_+\|outer-membrane-protein	unknown	unknown	gnl\|CDD\|280099
NC_017368.1\|WP_000259573.1\|128555_129386_-\|HrcA-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|235174
NC_017368.1\|WP_000072708.1\|151493_152843_+\|3-deoxy-7-phosphoheptulonate-synthase-class-II	unknown	unknown	gnl\|CDD\|366662
NC_017368.1\|WP_000009993.1\|132531_134076_-\|flagellin-B	unknown	unknown	gnl\|CDD\|237440
NC_017368.1\|WP_000089218.1\|143492_144104_+\|translation-initiation-factor-IF-3	unknown	unknown	gnl\|CDD\|129272
NC_017368.1\|WP_000046339.1\|150071_151313_-\|HAAAP-family-serine/threonine-permease	unknown	unknown	gnl\|CDD\|273283
NC_017368.1\|WP_014535729.1\|130585_132469_-\|motility-associated-factor-glycosyltransferase-family-protein	unknown	unknown	gnl\|CDD\|225324
NC_017368.1\|WP_014535728.1\|129605_130244_+\|class-II-aldolase/adducin-family-protein	unknown	unknown	gnl\|CDD\|180279
NC_017368.1\|WP_000821557.1\|146985_147855_+\|hypothetical-protein	unknown	unknown	unknown
NC_017368.1\|WP_001125542.1\|144084_144279_+\|50S-ribosomal-protein-L35	unknown	unknown	gnl\|CDD\|234676
NC_017368.1\|WP_001264173.1\|144373_144724_+\|50S-ribosomal-protein-L20	unknown	unknown	gnl\|CDD\|179959
NC_017368.1\|WP_000146033.1\|148704_150072_-\|L-serine-ammonia-lyase	unknown	unknown	gnl\|CDD\|273233
NC_017368.1\|WP_000650915.1\|127980_128556_-\|nucleotide-exchange-factor-GrpE	unknown	unknown	gnl\|CDD\|184538
NC_017368.1\|WP_001040814.1\|136444_137380_+\|radical-SAM-protein	unknown	unknown	gnl\|CDD\|223803
NC_017368.1\|WP_014535726.1\|124347_125265_-\|cysteine-synthase-family-protein	unknown	unknown	gnl\|CDD\|107204
NC_017368.1\|WP_000681485.1\|134241_136452_+\|type-I-DNA-topoisomerase	unknown	unknown	gnl\|CDD\|235516

Protein	Function_ID	Function_description	E-value
NC_017368.1\|WP_001269094.1\|138861_141300_-\|pyruvate,-water-dikinase	gnl\|CDD\|235809	PRK06464, PRK06464, phosphoenolpyruvate synthase; Validated.	0
NC_017368.1\|WP_000259573.1\|128555_129386_-\|HrcA-family-transcriptional-regulator	gnl\|CDD\|235174	PRK03911, PRK03911, HrcA family transcriptional regulator.	4.41469e-120
NC_017368.1\|WP_001271749.1\|141657_143496_+\|threonine--tRNA-ligase	gnl\|CDD\|237050	PRK12305, thrS, threonyl-tRNA synthetase; Reviewed.	0
NC_017368.1\|WP_000521040.1\|126087_127950_-\|molecular-chaperone-DnaK	gnl\|CDD\|234715	PRK00290, dnaK, molecular chaperone DnaK; Provisional.	0
NC_017368.1\|WP_000750181.1\|144923_145784_+\|outer-membrane-protein	gnl\|CDD\|280099	pfam01856, HP_OMP, Helicobacter outer membrane protein. This family seems confined to Helicobacter. It is predicted to be an outer membrane protein based on its pattern of alternating hydrophobic amino acids similar to porins.	1.92221e-49
NC_017368.1\|WP_000072708.1\|151493_152843_+\|3-deoxy-7-phosphoheptulonate-synthase-class-II	gnl\|CDD\|366662	pfam01474, DAHP_synth_2, Class-II DAHP synthetase family. Members of this family are aldolase enzymes that catalyze the first step of the shikimate pathway.	0
NC_017368.1\|WP_000009993.1\|132531_134076_-\|flagellin-B	gnl\|CDD\|237440	PRK13588, PRK13588, flagellin B; Provisional.	0
NC_017368.1\|WP_000089218.1\|143492_144104_+\|translation-initiation-factor-IF-3	gnl\|CDD\|129272	TIGR00168, Translation_initiation_factor_IF-3, translation initiation factor IF-3. infC uses abnormal initiation codons such as AUA, AUC, and CUG which render its expression particularly sensitive to excess of its gene product IF-3 thereby regulating its own expression [Protein synthesis, Translation factors].	1.96689e-75
NC_017368.1\|WP_000046339.1\|150071_151313_-\|HAAAP-family-serine/threonine-permease	gnl\|CDD\|273283	TIGR00814, membrane_transport_protein_YhjV, serine transporter. The Hydroxy/Aromatic Amino Acid Permease (HAAAP) Family- serine/threonine subfamily (TC 2.A.42.2) The HAAAP family includes well characterized aromatic amino acid:H+ symport permeases and hydroxy amino acid permeases. This subfamily is specific for hydroxy amino acid transporters and includes the serine permease, SdaC, of E. coli, and the threonine permease, TdcC, of E. coli.//added GO terms, none avaialbelf or ser/thr specifically [SS 2/6/05] [Transport and binding proteins, Amino acids, peptides and amines].	1.42014e-177
NC_017368.1\|WP_014535729.1\|130585_132469_-\|motility-associated-factor-glycosyltransferase-family-protein	gnl\|CDD\|225324	COG2604, COG2604, Uncharacterized protein conserved in bacteria [Function unknown].	0
NC_017368.1\|WP_014535728.1\|129605_130244_+\|class-II-aldolase/adducin-family-protein	gnl\|CDD\|180279	PRK05834, PRK05834, hypothetical protein; Provisional.	3.05235e-109
NC_017368.1\|WP_001125542.1\|144084_144279_+\|50S-ribosomal-protein-L35	gnl\|CDD\|234676	PRK00172, rpmI, 50S ribosomal protein L35; Reviewed.	1.81419e-15
NC_017368.1\|WP_001264173.1\|144373_144724_+\|50S-ribosomal-protein-L20	gnl\|CDD\|179959	PRK05185, rplT, 50S ribosomal protein L20; Provisional.	8.98522e-61
NC_017368.1\|WP_000146033.1\|148704_150072_-\|L-serine-ammonia-lyase	gnl\|CDD\|273233	TIGR00720, hypothetical_protein_NEICINOT_00681, L-serine dehydratase, iron-sulfur-dependent, single chain form. This enzyme is also called serine deaminase and L-serine dehydratase 1. L-serine ammonia-lyase converts serine into pyruvate in the gluconeogenesis pathway from serine. This enzyme is comprised of a single chain in Escherichia coli, Mycobacterium tuberculosis, and several other species, but has separate alpha and beta chains in Bacillus subtilis and related species. The beta and alpha chains are homologous to the N-terminal and C-terminal regions, respectively, but are rather deeply branched in a UPGMA tree. This enzyme requires iron and dithiothreitol for activation in vitro, and is a predicted 4Fe-4S protein. Escherichia coli Pseudomonas aeruginosa have two copies of this protein. [Energy metabolism, Amino acids and amines, Energy metabolism, Glycolysis/gluconeogenesis].	0
NC_017368.1\|WP_000650915.1\|127980_128556_-\|nucleotide-exchange-factor-GrpE	gnl\|CDD\|184538	PRK14149, PRK14149, heat shock protein GrpE; Provisional.	6.76302e-101
NC_017368.1\|WP_001040814.1\|136444_137380_+\|radical-SAM-protein	gnl\|CDD\|223803	COG0731, COG0731, Fe-S oxidoreductases [Energy production and conversion].	1.84348e-86
NC_017368.1\|WP_014535726.1\|124347_125265_-\|cysteine-synthase-family-protein	gnl\|CDD\|107204	cd01561, CBS_like, CBS_like: This subgroup includes Cystathionine beta-synthase (CBS) and Cysteine synthase. CBS is a unique heme-containing enzyme that catalyzes a pyridoxal 5'-phosphate (PLP)-dependent condensation of serine and homocysteine to give cystathionine. Deficiency of CBS leads to homocystinuria, an inherited disease of sulfur metabolism characterized by increased levels of the toxic metabolite homocysteine. Cysteine synthase on the other hand catalyzes the last step of cysteine biosynthesis. This subgroup also includes an O-Phosphoserine sulfhydrylase found in hyperthermophilic archaea which produces L-cysteine from sulfide and the more thermostable O-phospho-L-serine.	4.31741e-139
NC_017368.1\|WP_000681485.1\|134241_136452_+\|type-I-DNA-topoisomerase	gnl\|CDD\|235516	PRK05582, PRK05582, type I DNA topoisomerase.	0

>NC_017368.1|WP_001040814.1|136444_137380_+|radical-SAM-protein
MAKENPPVVFGPVLSRRFGKSLGVDLSPSKKQCNYNCIYCELGKAKPIERMEEVIEVKTLISTIQNALNNLTTPIDVLTITANGEPTLYPHLLELIQSIKPFLKGVKTLILSNGSLFYEPKVQQALKEFDIVKFSLDAVDLKAFERVDKPYSKDIDKILEGILSFSQIYQGQLVAEVLLIKGVNDSANNLKLIAAFLKKINTARVDLSTIDRPSSFKAPKLSEDELLKCSLFFEGLCVSLPKRTATQADQAKKLISCGIDELLALISRRPLSTEEAPLILDPNAFKHLETLLNHKQITIKKVGSLEFYCAF
>NC_017368.1|WP_000681485.1|134241_136452_+|type-I-DNA-topoisomerase
MKHLIIVESPAKAKTIKNFLDKNYEVIASKGHVRDLSKFALGIKIDETGFTPNYVVDKDHKELVKQIIELSKKASTTYIATDEDREGEAIGYHVACLIGGKLESYPRIVFHEITQNAILNALKTPRQIDMSKVNAQQARRFLDRIVGFKLSSLISSKITKGLSAGRVQSAALKLVIDKEREIKAFKPLTYFTLDAYFESHLEAQLISYKGNKLKAQELIDKKKAQEIKNELEKESYTISSIIKKSKKSPTPPPFMTSTLQQSASSLLGFSPTKTMSIAQKLYEGVTTPQGVMGVITYMRTDSLNIAKEALEEARNKILKDYGKDYLPPKAKVYSSKNKNAQEAHEAIRPTSIILEPNALKDYLKPEELKLYTLIYKRFLASQMQDALFESQSVVVACEKGEFKASGRKLLFDGYYKILGNDDKDKLLPNLKENDPIKLEKLESNAHVTEPPARYSEASLIKVLESLGIGRPSTYAPTISLLQNRDYIKVEKKQISALESAFKVIEILEKHFEEIVDSKFSASLEEELDNIAQNKADYQQVLKDFYYPFMDKIEAGKKNIISQKVHEKTGQSCPKCGGELVKKNSRYGEFIACNNYPKCKYVKQTENANDGAKQELCEKCGGEMVQKFSRNGAFLACNNYPECKNTKSLKNTPNANETIEGVKCPECGGDIALKKSRKGSFYGCNNYPKCNFLSNHKPINKRCEKCHYLMSERIYRKKKAHECIQCKERVFLEEDDG
>NC_017368.1|WP_000009993.1|132531_134076_-|flagellin-B
MSFRINTNIAALTSHAVGVQNNRDLSSSLEKLSSGLRINKAADDSSGMAIADSLRSQSANLGQAIRNANDAIGMVQTADKAMDEQIKILDTIKTKAVQAAQDGQTLESRKALQSDIQRLLEELDNIANTTSFNGQQMLSGSFSNKEFQIGAYSNTTVKASIGSTSSDKIGHVRMETSSFSAEGMLASAAAQNLTEVGLNFKQVNGVNDYKIETVRISTSAGTGIGALSEIINRFSNTLGVRASYNVMATGGTPVQSGTVKDLTINGVEIGTVNDVHKNDADGRLINAINSVKDRTGVEASLDIQGRINLHSIDGRAISVHATSASGQVFGGGNFAGISGTQHAVIGRLTLTRTDARDIIVSGVNFSHVGFHSAQGVAEYTVNLRAVRGIFDANVASAAGANANGAQAETNSQGIGAGVTSLKGAMIVMDMADSARTQLDKIRSDMGSVQMELVTTINNISVTQVNVKAAESQIRDVDFAEESANFSKYNILAQSGSFAMAQANAVQQNVLRLLQ
>NC_017368.1|WP_014535729.1|130585_132469_-|motility-associated-factor-glycosyltransferase-family-protein
MDIYQKNLQALFKKDPLLFAQLKAIKENKKYEVFLGNDSANFNLLDKETNTPLFEKSPLDSSLELYKNSEIYMLYPYLYYFGLGNGVFYRLLLGNENLKRLVVIEPEIEVIFIVLNLLDFSTEILENRLILLHAAFCNYNMIASLFDMDKKSRLYARMYDLKLFNAYYERYSHQMIEINQHFTRALEHGAISVGNDAKDALIGIKQHAANLPEVIKSPSLVDFVNALKNRDTAIIVSTGPSLNKQLPLLKEIAPYATLFCIDASFPILAKAGIKPDIVLSLERVDLTAKFYEETPLDFQEGVIFALTSIVHKRLIQAIKKGVKQFSFRPFGYTNLFGLHQYGYVGIGMSAANMAYELVVHSRFKRCVFIGQDLSFSQSGNSHANGAIYGDREIKPKKDKDKIFTEKYGGNGEVETTLVWKLFLEFFEKDIFNTPYKLEVINATEGGARIKGTKEMPFKGACEKIDKSKPKPPINLTYPTKSEQAKNLRIAKQKCEEIIKYANEKKTQVEEVFLKVAPFLEEVEKLHEEKKLEELDFKKLENLSAEIDNIKELFDDKQFNSYFMDAIQSYIFHQELHIAEIVCKKTNNEDELRAKQLEYIYAHKYWLFSLAGGIDCVIEAIKMALREW
>NC_017368.1|WP_000154798.1|130264_130561_+|hypothetical-protein
MTINTHYTPNFTQLQTLNNINNDATIKDRNQVEQDLQQSSVQDGFSQDNTQNAPDFDRLQALNTINNDGEIKDKSQVAKNLIDGENIPEIYSSLDTYA
>NC_017368.1|WP_014535728.1|129605_130244_+|class-II-aldolase/adducin-family-protein
MISMNTHTRGIDSNLIHSLQSISLSMFRKGFFGLYQGSISARIGTNQFVINKRNAVFDQLNENTLLVLHDKIDYRWKEASLDSPIHASVYREFLDAKFIAYARPPYSLAYSLRHNRLLPRDYLGYRSLGEEVAIFNPKDYDSWQERADTEILRQLQESKKYFVFIKGCGIFAYHRELSKLMEVFDLIENSCKVLRLGDLMDYCYNDDPRLSV
>NC_017368.1|WP_000259573.1|128555_129386_-|HrcA-family-transcriptional-regulator
MVVDEIFQIMMLRRIKVGSNLDKKESLLDAFVKTYLQILEPISSKRLKELANLKISCATIRNYFQTLSKEGMLYQAHSSGARLPTFKAFENYWQKSLHFEVLRVNEKRLKSASENFGLFTLLKKPSLERLERVIECEKRFLILDFLAFSCTLGYSVKMEKFLLELVGRSVKEVHSIAASVNALSLARQLERLEYSNTQITRFNLMGLKTLLNSPLFFDILGGKVLERLKKPLHFIEPDCMLVTCPIEFQNKRMQLLCVGKLESDYEGFFQTISKEE
>NC_017368.1|WP_000650915.1|127980_128556_-|nucleotide-exchange-factor-GrpE
MKDEHNQEHNHLSQEEPESCKKACACNEQQGEEMQEASEKECEIKEDFELKYQEMREKYLRAHADFENVKKRLERDKSMALEYAYEKIALDLLPVIDALLGAHRSAIEVDKESTLTKGLELTMEKLHEVLAKHGIEGIECLEEFDPNFHNAIMQVKSEEKENGKIVQVLQQGYKYKGRVLRPAMVSIAKND
>NC_017368.1|WP_000521040.1|126087_127950_-|molecular-chaperone-DnaK
MGKVIGIDLGTTNSAMAVYEGNEAKIIANKEGKNTTPSIVAFTDKGEILVGESAKRQAVTNPEKTIYSIKRIMGLMFNEDKAKEAEKRLPYKIVDRNGACAIEISGKVYTPQEISAKILMKLKEDAESYLGESVTEAVITVPAYFNDSQRKATKEAGTIAGLNVLRIINEPTSAALAYGLDKKESEKIMVYDLGGGTFDVTVLETGDNVVEVLATGGDAFLGGDDFDNRVIDFLASEFKSETGIEIKNDVMALQRLKEAAENAKKELSSAMETEINLPFITADATGPKHLVKKLTRAKFESLTEDLVEETISKIESVIKDAGLTKNEISEVVMVGGSTRIPKVQERVKAFISKELNKSVNPDEVVAVGASIQGGVLKGDVKDVLLLDVTPLSLGIETLGGVMTKVIDRGTTIPAKKSQVFSTAEDNQPAVSIMVLQGERELARDNKSLGKFDLQGIAPAPRGVPQIEVTFDIDANGILTVSAQDKNTGKSQEIKISGSSGLSDSEIEKMVKDAELHKEEDARKKEVIEARNHADSLAHQTQKSLDEHKTNLNENDANEIQNAINALKECVKNDNATKAELEDKTKALAQAAQKLGEAMANKNNAEQPKKKDDDVIDAEVE
>NC_017368.1|WP_014535726.1|124347_125265_-|cysteine-synthase-family-protein
MIITTMQDAIGRTPVFKFTSKDYPIPTKSAIYAKLEHLNPGGSIKDRLGQYLIEEGFRTGKITSKTTIIEPTAGNTGIALALVALKHHLKTIFVVPEKFSTEKQQIMRALGAKVINTPTSEGILGAIKKSKELAESIPDSYLPLQFENPNNPAAYYHTLAPEIVQELGAGLTSFVAGIGSGGTFVGTARYLKERIPTIRLIGVEPEGSILNGGEPGPHEIEGIGVEFIPPFFANLDIDGFETISDEEGFSYTRKLAKKNGLLVGSSSGAAFVAALKEAQRLPEGSQVLTIFPDVADRYLSKGIYL
>NC_017368.1|WP_001269094.1|138861_141300_-|pyruvate,-water-dikinase
MRYIKFFKELNNKNVNLVGGKNASIGEMFQELVPIGIKVPDGFAITSEAYWYLLEQGGAKQKIIELLENVDATEIDVLKIRSKQIRELIFGTPFPSDLRDEIFQAYEILSQQYHMKEADVAVRSSATAEDLPDASFAGQQDTYLNIKGKTELIHYIKSCLASLFTDRAISYRASRGFDHLKVALSVGVQKMVRADKGSAGVMFSIDTETGFKDAVFITSAWGLGENVVGGTINPDEFYVFKPTLEQNKRPIIKRQLGNKTQKMVYAPRGSEHPTRNIKTTKKEWQSFSLSDEDVLILAKYAIEIEKHYSKEAKQYRPMDIEWAKDGDSGEIFIVQARPETVQSQKTKEESQVFEKFKFKNPNEKKEIILQGRAIGSKIGSGKVRIINDLEHMNSFKEGEILVTDNTDPDWEPCMKKASAVITNRGGRTCHAAIVAREIGVPAIVGVSGATDSLYTGMEITVSCAEGEEGYVYAGIYEHEIERVELSNMQETQTKIYINIGNPEKAFSFSQLPNHGVGLARMEMIILNQIKAHPLALVDLHHKKSVKEKNEIENLMAGYANPKDFFVKKIAEGIGMISAAFYPKPVIVRTSDFKSNEYMRMLGGSSYEPNEENPMLGYRGASRYYSESYNEAFSWECEALALVREEMGLTNMKVMIPFLRTIEEGKKVLEILRKNNLESGKNGLEIYIMCELPVNVILADDFLSLFDGFSIGSNDLTQLTLGVDRDSELVSHVFDERNEAMLKMFKKAIEACKRHNKYCGICGQAPSDYPEVTEFLVKEGITSISLNPDSVIPTWNAVAKLEKELKDHGLTAH
>NC_017368.1|WP_001271749.1|141657_143496_+|threonine--tRNA-ligase
MSAELIAVYKDEQIIDLESAKALGLSDGIKALNGTEPIYFDDSPLALEVIRHSCAHLLAQSLKALYPDAKFFVGPVVEEGFYYDFKTASKISEEDLPKIEAKMKEFAKLKLAITKEVLTREQALERFKGDELKHAVMSKISGDKFGVYQQGEFEDLCKGPHLPNTRFLNHFKLTKLAGAYLGGDENNEMLIRIYGIAFATKEGLKDYLFQIEEAKKRDHRKLGVELGLFSFNDEIGAGLPLWLPKGARLRKRIEDLLSKALLLRGYEPVKGPEILKSDVWKISGHYDNYKENMYFTTIDEQEYGIKPMNCVGHIKVYQSALHSYRDLPLRFYEYGVVHRHEKSGVLHGLLRVREFTQDDAHIFCSFEQIQSEVSAILDFTHKIMQAFDFSYEMELSTRPAKSIGDDKVWEKATNALKEALKEHRIDYKIDEGGGAFYGPKIDIKITDALKRKWQCGTIQVDMNLPERFKLAFTNECNHAEQPVMIHRAILGSFERFIAILSEHFGGNFPFFVAPTQIALIPINEEHHVFALKLKEELKKRDIFVEVLDKNDSLNKKVRSAEKQKIPMILVLGNEEMESEILSIRDREKQAQYKMPLKEFLNMVESKMQEVSF
>NC_017368.1|WP_000089218.1|143492_144104_+|translation-initiation-factor-IF-3
MSRNEVLLNGDINFKEVRCVGDNGEVYGIISSKEALNIAQNLGLDLVLISASAKPPVCKVMDYNKFRYQNEKKIKEAKKKQKQIEIKEIKLSTQIAQNDINYKVKHAREFIESNKHVKFKVVLKGRESQNSKAGLDVLFRVQTMMQDLANPEKEPKTEGRFVSWMFVPKAKEAPKNEKKTKENNPPFNRINLMKGEDHAKNED
>NC_017368.1|WP_001125542.1|144084_144279_+|50S-ribosomal-protein-L35
MPKMKTNRGASKRFKVKKNLIKRGSAFKSHILTKKSPKRKANLNAPKHVHHTNAHSVMSLLCRA
>NC_017368.1|WP_001264173.1|144373_144724_+|50S-ribosomal-protein-L20
MRVKTGVVRRRRHKKVLKLARGFYSGRRKHFRKAKEQLERSMYYAFRDRKQKKREFRSLWVVRINAACRMHNTSYSRFMHALKVAGVELDRKVLADMAMNDMQAFESVLESVKEYL
>NC_017368.1|WP_000750181.1|144923_145784_+|outer-membrane-protein
MKKSVIVGAISLAMTSLLSAETPKQEKAIKTSPTKKGERNAAFIGIDYQLGMLSTTAQNCSHGNCNGNQSGAYGSNTPNMPTASNPTGGLTHGALGTRGYKGLSNQQYAINGFGFVVGYKHFFKKSPQFGMRYYGFFDFASSYYKYYTYNDYGMRDARKGSQNFMFGYGAGTDVLFNPAIFNRENLHFGFFVGVAIGGTSWGPTNYYFKDLADEYRGSFHPSNFQVLVNGGIRLGTKHQGFEIGLKIQTIRNNYYTASADNVPEGTTYRFTFHRPYAFYWRYIVSF
>NC_017368.1|WP_000821557.1|146985_147855_+|hypothetical-protein
MKRILFFLVATTFLLRAETDSATINTTVDPNVMFSESSTGNVKKDRKRVLKDMVNLEKERVKNFNQYSETKMSKGDLSAFGAFFKGSLESCVDQKICYYEHKNGKVSFVVNDREKFYKYVLKDLGTELSLPLFNWLYKGSDFGALHEQFGDMYDGYIKYLISMVRISQKEKARKLDAVTLKKMEDQAKKDTETAFQKRGSGELESHTDSPEFISSSKKVQNASNPDLDPTTNANALKETASKELEISSKKEKKPKKKRRLSKKEKQQQALQQEFERQISDSSKSENIAK
>NC_017368.1|WP_000146033.1|148704_150072_-|L-serine-ammonia-lyase
MASFSILSIFKIGVGPSSSHTIGPMEAGARFCGLLKGVLDQVMRVQITLHGSLALTGKGHLSDEAVLIGLHGIYANELEIATKKALLHEALENKVLKLADQHCIHFDYSKDLIFDNKPLARHQNALILKAFNAKNEVLKEETYYSVGGGFVYTEKELDNLSEEGENESIAYDFSSAKELLELCQKHQKNIAEIVRLREEAMKNRPDAMMAKIYHAMLECYDNGANSKEKYLPGSLRVTRLAPSIKTRLEKHPTSGKDPLALIDYISLYARAIAEENASGGKVVTAPTNGACAVVPSVLLYAKNHLFENLSQKAINDFLLTSAAIGYLYKKNASLSGAEAGCQAEIGVASSMAAGGLACLCQATTQQVLIASEIAMEHHLGLTCDPVGGLVQIPCIERNVLGAIKAISASKLALEDEYKPKVSLDEVIATMYATGKDMNEKYKETSLGGLAKTLKC
>NC_017368.1|WP_000046339.1|150071_151313_-|HAAAP-family-serine/threonine-permease
MAQEKALIRDPKKLNAFDLRWMASLFGTAVGAGILFLPIRAGGHGIWAIVVMSAIIFPLTYLGHRALAYFIGSKDKEDITMVVRSHFGAQWGFLITLLYFFAIYPICLAYGVGITNVFDHFFTNQLHLAPFHRGLLAVALVSLMMLVMVFNATIVTRICNALVYPLCLILLLFSLYLIPYWQGANLFVMPSFKEFVLAIWLTLPVLVFSFNHSPIISTFTQNVEKEYGAFKEYKLNQIELGTSLMLLGFVMFFVFSCVMCLNADDFMKAREQNIPILSYFANTLNNPLINYAGPVVAFLAIFSSFFGHYYGAKEGLEGIIIQSLKLKKASKTLSVSVMIFLWLTITLVAYINPNILDFIENLGGPIIALILFVMPMIAFYSVSSLKRFRNLKVDIFVFVFGSLTALSVFLGLF
>NC_017368.1|WP_000072708.1|151493_152843_+|3-deoxy-7-phosphoheptulonate-synthase-class-II
MSNTTWSPASWHSFKIEQHPTYKDKQELERVKKELRSYPPLVFAGEARNLQERLAQVIDNKAFLLQGGDCAESFSQFSANRIKDMFKVMMQMAIVLTFAGSIPIVKVGRIAGQFAKPRSNATEILDDEEVLSYRGDIINGISKKEREPKPERMLKAYHQSVATLNLIRAFAQGGLANLEQVHRFNLDFVKNNDFGQKYQQIADRITQALGFMQACGVEIEKTPILREVEFYTSHEALLLHYEEPLVRKDSLTNQFYDCSAHMLWIGERTRDPKGAHVEFLRGVCNPIGVKIGPNASVSEVLELCDVLNPHNIKGRLNLIVRMGSKTIKERLPKLLQGVLKEKRHILWSIDPMHGNTVKTSLGVKTRAFDSVLDEVKSFFEIHRAEGSLASGVHLEMTGENVTECIGGSQAITEEGLSCHYYTQCDPRLNATQALELAFLIAGMLKKQRA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_017368_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_017368_2

347256-347365

Orphan

Consensus_repeat	Method
GAAAGGCTCTCTAGCGTTACTGAAGA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_017368_2

>merge|NC_017368|2|347256-347365|CRISPRCasFinder
GAAAGGCTCTCTAGCGTTACTGAAGAAATTATCGCCAAAAAGCAAGAAGAAACCCAACGTCAAGAAGCCCCAGAGGATACGCTTGAAAGGCTCTCTAGCATTACTGAAGA

>NC_017368|2|2|347256-347365|CRISPRCasFinder
GAAAGGCTCTCTAGCGTTACTGAAGA	AATTATCGCCAAAAAGCAAGAAGAAACCCAACGTCAAGAAGCCCCAGAGGATACGCTT
GAAAGGCTCTCTAGCATTACTGAAGA

Protein	Signature genes	Signature genes Name	Protein_function
NC_017368.1\|WP_000599228.1\|345342_345747_+\|Holliday-junction-resolvase-RuvX	unknown	unknown	gnl\|CDD\|234639
NC_017368.1\|WP_041200704.1\|345879_346350_+\|Sel1-repeat-protein	unknown	unknown	gnl\|CDD\|276807
NC_017368.1\|WP_001117103.1\|350726_351608_-\|RluA-family-pseudouridine-synthase	unknown	unknown	gnl\|CDD\|223638
NC_017368.1\|WP_000742587.1\|340040_340583_+\|UDP-4-amino-4,-6-dideoxy-N-acetyl-beta-L-altrosamine-N-acetyltransferase	unknown	unknown	gnl\|CDD\|274661
NC_017368.1\|WP_000426619.1\|349579_350683_+\|hypothetical-protein	unknown	unknown	unknown
NC_017368.1\|WP_014535757.1\|347899_348091_+\|hypothetical-protein	unknown	unknown	unknown
NC_017368.1\|WP_001207563.1\|342481_343474_+\|ketol-acid-reductoisomerase	unknown	unknown	gnl\|CDD\|235491
NC_017368.1\|WP_000056309.1\|358502_359279_+\|flagellar-assembly-protein-FliH	unknown	unknown	gnl\|CDD\|235850
NC_017368.1\|WP_000833900.1\|340515_341454_-\|tetraacyldisaccharide-4'-kinase	unknown	unknown	gnl\|CDD\|224577
NC_017368.1\|WP_000373216.1\|353168_354785_-\|CTP-synthase-(glutamine-hydrolyzing)	unknown	unknown	gnl\|CDD\|235437
NC_017368.1\|WP_000841128.1\|344545_345346_+\|DNA-protecting-protein-DprA	unknown	unknown	gnl\|CDD\|273238
NC_017368.1\|WP_000810725.1\|351607_353158_-\|single-stranded-DNA-specific-exonuclease-RecJ	unknown	unknown	gnl\|CDD\|273193
NC_017368.1\|WP_000201844.1\|357484_358516_+\|flagellar-motor-switch-protein-FliG	unknown	unknown	gnl\|CDD\|272961
NC_017368.1\|WP_000699916.1\|346537_346876_+\|hypothetical-protein	unknown	unknown	unknown
NC_017368.1\|WP_001168259.1\|341450_342233_-\|NAD+-synthase	unknown	unknown	gnl\|CDD\|184435
NC_017368.1\|WP_000829942.1\|355050_355719_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|239486
NC_017368.1\|WP_001019102.1\|343497_344304_+\|septum-site-determining-protein-MinD	unknown	unknown	gnl\|CDD\|225447
NC_017368.1\|WP_000051412.1\|344300_344534_+\|cell-division-topological-specificity-factor-MinE	unknown	unknown	gnl\|CDD\|188120
NC_017368.1\|WP_000364709.1\|355762_357466_+\|flagellar-M-ring-protein-FliF	unknown	unknown	gnl\|CDD\|129310
NC_017368.1\|WP_000119825.1\|348804_349590_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NC_017368.1\|WP_000599228.1\|345342_345747_+\|Holliday-junction-resolvase-RuvX	gnl\|CDD\|234639	PRK00109, PRK00109, Holliday junction resolvase RuvX.	8.31405e-37
NC_017368.1\|WP_041200704.1\|345879_346350_+\|Sel1-repeat-protein	gnl\|CDD\|276807	sd00010, SLR, Sel1-like repeat. Sel1-like repeats (SLRs) share similar alpha-helical conformations with Tetratricopeptide repeats (TPRs), but with different consensus sequence lengths and superhelical topologies. SLRs contain 36 to 44 amino acids and are present in bacteria and eukaryotes but not in archaea. SLR proteins are involved in a variety of functions, and many serve as adaptor proteins for the assembly of macromolecular complexes. The SLR family was named after the Caenorhabditis elegans Sel1 protein which is predicted to fold into 11 SLRs, a transmembrane domain, and an N-terminal signal sequence. The human Sel1L protein contains an additional fibronectin type-II domain and an N-terminal PEST sequence. Its downregulation is associated with the development of breast and pancreatic carcinomas.	2.39099e-37
NC_017368.1\|WP_001117103.1\|350726_351608_-\|RluA-family-pseudouridine-synthase	gnl\|CDD\|223638	COG0564, RluA, Pseudouridylate synthases, 23S RNA-specific [Translation, ribosomal structure and biogenesis].	7.48374e-65
NC_017368.1\|WP_000373216.1\|353168_354785_-\|CTP-synthase-(glutamine-hydrolyzing)	gnl\|CDD\|235437	PRK05380, pyrG, CTP synthetase; Validated.	0
NC_017368.1\|WP_001207563.1\|342481_343474_+\|ketol-acid-reductoisomerase	gnl\|CDD\|235491	PRK05479, PRK05479, ketol-acid reductoisomerase; Provisional.	5.69388e-177
NC_017368.1\|WP_000833900.1\|340515_341454_-\|tetraacyldisaccharide-4'-kinase	gnl\|CDD\|224577	COG1663, LpxK, Tetraacyldisaccharide-1-P 4'-kinase [Cell envelope biogenesis, outer membrane].	9.96276e-89
NC_017368.1\|WP_000841128.1\|344545_345346_+\|DNA-protecting-protein-DprA	gnl\|CDD\|273238	TIGR00732, Protein_smf, DNA protecting protein DprA. Disruption of this gene in both Haemophilus influenzae and Helicobacter pylori drastically reduces the efficiency of transformation with exogenous DNA, but with different levels of effect on chromosomal (linear) and plasmid (circular) DNA. This difference suggests the DprA is not active in recombination, and it has been shown not to affect DNA binding, leaving the intermediate step in natural transformation, DNA processing. In Strep. pneumoniae, inactivation of dprA had no effect on the uptake of DNA. All of these data indicated that DprA is required at a later stage in transformation. Subsequently DprA and RecA were both shown in S. pneumoniae to be required to protect incoming ssDNA from immediate degradation. Role of DprA in non-transformable species is not known. The gene symbol smf was assigned in E. coli, but without assignment of function. [Cellular processes, DNA transformation].	1.90916e-93
NC_017368.1\|WP_000742587.1\|340040_340583_+\|UDP-4-amino-4,-6-dideoxy-N-acetyl-beta-L-altrosamine-N-acetyltransferase	gnl\|CDD\|274661	TIGR03585, PseH, UDP-4-amino-4,6-dideoxy-N-acetyl-beta-L-altrosamine N-acetyltransferase. Sequences in this family are members of the pfam00583 (GNAT) superfamily of acetyltransferases and are proposed to perform a N-acetylation step in the process of pseudaminic acid biosynthesis in Campylobacter species. This gene is commonly observed in apparent operons with other genes responsible for the biosynthesis of pseudaminic acid and as a component of flagellar and exopolysaccharide biosynthesis loci. Significantly, many genomes containing other components of this pathway lack this gene, indicating that some other N-acetyl transferases may be incolved and/or the step is optional, resulting in a non-acetylated pseudaminic acid variant sugar.	3.82909e-60
NC_017368.1\|WP_000810725.1\|351607_353158_-\|single-stranded-DNA-specific-exonuclease-RecJ	gnl\|CDD\|273193	TIGR00644, recJ, single-stranded-DNA-specific exonuclease RecJ. All proteins in this family are 5'-3' single-strand DNA exonucleases. These proteins are used in some aspects of mismatch repair, recombination, and recombinational repair. [DNA metabolism, DNA replication, recombination, and repair].	0
NC_017368.1\|WP_000056309.1\|358502_359279_+\|flagellar-assembly-protein-FliH	gnl\|CDD\|235850	PRK06669, fliH, flagellar assembly protein H; Validated.	8.06246e-64
NC_017368.1\|WP_001168259.1\|341450_342233_-\|NAD+-synthase	gnl\|CDD\|184435	PRK13980, PRK13980, NAD synthetase; Provisional.	1.69172e-122
NC_017368.1\|WP_000829942.1\|355050_355719_+\|hypothetical-protein	gnl\|CDD\|239486	cd03392, PAP2_like_2, PAP2_like_2 proteins. PAP2 is a super-family of phosphatases and haloperoxidases. This subgroup, which is specific to bacteria, lacks functional characterization and may act as a membrane-associated lipid phosphatase.	3.97684e-11
NC_017368.1\|WP_001019102.1\|343497_344304_+\|septum-site-determining-protein-MinD	gnl\|CDD\|225447	COG2894, MinD, Septum formation inhibitor-activating ATPase [Cell division and chromosome partitioning].	4.30895e-150
NC_017368.1\|WP_000051412.1\|344300_344534_+\|cell-division-topological-specificity-factor-MinE	gnl\|CDD\|188120	TIGR01215, Cell_division_topological_specificity_factor, cell division topological specificity factor MinE. This protein is involved in the process of cell division. This protein prevents the proteins MinC and MinD to inhibit cell division at internal sites, but allows inhibiton at polar sites. This allows for correct cell division at the proper sites. [Cellular processes, Cell division].	1.39865e-25
NC_017368.1\|WP_000364709.1\|355762_357466_+\|flagellar-M-ring-protein-FliF	gnl\|CDD\|129310	TIGR00206, Flagellar_M-ring_protein, flagellar basal-body M-ring protein/flagellar hook-basal body protein (fliF). Component of the M (cytoplasmic associated) ring, one of four rings (L,P,S,M) which make up the flagellar hook-basal body which is a major portion of the flagellar organelle. Although the basic structure of the flagella appears to be similar for all bacteria, additional rings and structures surrounding the basal body have been observed for some bacteria (eg Vibrio cholerae and Treponema pallidum). [Cellular processes, Chemotaxis and motility].	0
NC_017368.1\|WP_000201844.1\|357484_358516_+\|flagellar-motor-switch-protein-FliG	gnl\|CDD\|272961	TIGR00207, Flagellar_motor_switch_protein_FliG, flagellar motor switch protein FliG. The fliG protein along with fliM and fliN interact to form the switch complex of the bacterial flagellar motor located at the base of the basal body. This complex interacts with chemotaxis proteins (eg CHEY). In addition the complex interacts with other components of the motor that determine the direction of flagellar rotation. The model contains putative members of the fliG family at scores of less than 100 from Agrobacterium radiobacter and Sinorhizobium meliloti as well as fliG-like genes from treponema pallidum and Borrelia burgdorferi. That is why the suggested cutoff is set at 20 but was set at 100 to construct the family. [Cellular processes, Chemotaxis and motility].	6.29368e-164

>NC_017368.1|WP_000699916.1|346537_346876_+|hypothetical-protein
MKIMHQVMDFLDSCKQTIQKNSNEALQKTKRALFKEKSQKIREQAVKIVEKRLKKEGMKLSDFNEEELKIMFEAEEKRLLEQIHAKESEENQEKSAKHFKEVWERGDNEQER
>NC_017368.1|WP_041200704.1|345879_346350_+|Sel1-repeat-protein
MAEPNPEELFNLGMLSYDKQDFSKARKYFEKACDLNISGGCGALGVLYYNGEGVEKNLTKAFCFYSKACDLNNGSGCGGLGFLYGSGKGVEKNLIKAAYLYSRACELKDGWGCSFLEVLYYNGDGVKQDSKKAVALFEKACKLGYKKACEMLKELR
>NC_017368.1|WP_000599228.1|345342_345747_+|Holliday-junction-resolvase-RuvX
MILACDVGLKRIGIATLLNGVILPLEAILRHNRNQASRDLSDLLREKNIQVLVVGKPNESYADTNAHIEHFIKLLDFKGEIVFINEDRSSIEAYENLEHLGKKNKRLAIKDGRLDSLSACRILERYCQQVLKKR
>NC_017368.1|WP_000841128.1|344545_345346_+|DNA-protecting-protein-DprA
MKSNFQYSTLENIPKAFDILKDPPKKLYCAGDIKLLDAPLKVAIIGTRRPTPYSKQHTITLARELAKNGAVIVSGGALGVDIIAQENALPKTIMLSPCSLDLIYPTNNHKVIQEIVQNGLILSEYEKDFMPVKGSFLARNRLVIALSDAVIIPQADLKSGSMSSARLAQKYQKPLFVLPQRLNESDGTNELLEKGQAQGIFNIQNFINTLLKDYHLKEMPEIKDEFLEYCAKNPSYEEAYLKFGDKLLEYELLGKIKRINHIVVLA
>NC_017368.1|WP_000051412.1|344300_344534_+|cell-division-topological-specificity-factor-MinE
MSLFDFFKNKGSAATATDRLKLILAKERTLNLPYMEEMRKEIIAVIQKYTKSSDIHFKTLDGNQSVETIEVEIILPK
>NC_017368.1|WP_001019102.1|343497_344304_+|septum-site-determining-protein-MinD
MAIVVTITSGKGGVGKSTTTANLAIGLAESGKKVVAVDFDIGLRNLDMILGLENRIVYDVVDVMEKNCNLSQALITDKKTKNLSFLAASQSKDKNVLDKEKVAILINALRADFDYILIDSPAGIESGFEHAILHADMALVVVTPEVSSLRDSDRVIGIIDAKSNRAKKGMEVHKHLIINRLKPELVANGEMVSIEEVLKILCLPLIGIIPEDSHIISATNKGEPVIRTDCESAKAYQRITRRILGEEVEYVEFKPKKGFFSALKGIFS
>NC_017368.1|WP_001207563.1|342481_343474_+|ketol-acid-reductoisomerase
MALPIYYDKDIDLGVIQSLQVGIIGYGAQGEAQALNLRDSKVRARIGLYQGSLSSSKAKAEGFEVLEVKELVQQSDLIMALLPDELHKEVLEKEVIPFLKDGQIVGFAHGFSVHFNQVVLPKGVGAILVAPKGPGSALREEYLKNRGLYHLIAIEQESSKNNAKAVALSYAKAMGGGRMGVLETSFKEECESDLFGEQAVLCGGLEAIVRMGFETLIKAGYPEELAYFECVHEVKLVADLLHYKGVEGLRKHISNTAEFGAIKAREPMGNLLEKRMQKILKKIQNGLFAKDFLLEKSLNYPRLNTERKALKETKIEQIGEILRAPFNHKK
>NC_017368.1|WP_001168259.1|341450_342233_-|NAD+-synthase
MQKDYQKLIAYLYDFLEKEAQKRGFKKVVYGLSGGLDSAVVGVLCQRVFKENAHALLMPSLVSMPESKTDALDLCETFSIPYTEYSIAPYDAIFSSHFKDASLTRKGNFCARLRMAFLYDYSLKSDSLVIGTSNKSERMLGYGTLFGDLACAINPIGELFKTEVYELACHLNIPKKILNKPPSADLFVGQSDEKDLGYPYSVIDPLLKDIEALFQNKPIHLETLTQLGYDEILVKNIISRIQKNAFKLELPTIAQKFNPK
>NC_017368.1|WP_000833900.1|340515_341454_-|tetraacyldisaccharide-4'-kinase
MKSDKPFLERYFYDPTLLQKGLIFALYPFSLIYQCIATLKRKTAKKHDFKIPLISIGNLIAGGSGKTPFILETAPRYQEVAVVSRGYQRDSKGLVVVSVKGNLLVSQQTAGDEAYLLALNLKQASVIVSEKRELGVLKALELGSKIVFLDDGFRFNFNQFNLLLKPKVPPYYPFCLPSGLYRESIKSYKEAHLVITEDKDYKRITSISHPTERMLLVTAIANPSRLDAFLPKEVVKKLYFRDHAPFDLKLLEKEFYQNNATSLLVTSKDLVKLQDCNLPLSVLNLKLEICSKILEQIDHYILSYPCNTKEHL
>NC_017368.1|WP_000742587.1|340040_340583_+|UDP-4-amino-4,-6-dideoxy-N-acetyl-beta-L-altrosamine-N-acetyltransferase
MKKNYCYKNIQAIDFTYLNDEEKLLVLEFRNHPNTALWMYSAFISLKTHLQFIEDLKNSPNHRYFLFKEEGVYLGVGSITKINFFHKHGYLGIYKNPFLKNRGETILKALERIAFEEFQLNSLHLEVMENNFKAIAFYEKNHYELEGRLKGFISKEKEFIDVLLYYKDKKGYNDRSALKF
>NC_017368.1|WP_014535757.1|347899_348091_+|hypothetical-protein
MGLELKSKSVMPYFFNEYNLTKNANREEPERLRKQVIFILMRTPKGREILKEYLNEGCILLGE
>NC_017368.1|WP_000119825.1|348804_349590_+|hypothetical-protein
MSYFFKIILGTSVIVGVLLGLWRWTYDKSCFSLVFVLLILGIVAYSYISLKMHQRECFANCYVDKKSCLFPMLKSPIIVSCFYFIFSIFTSISIAYSVLDYNWMMWGLVFLTIVVCVAVFGMFEKMLKNIIKEDYLMLMSREASSLVGIFFFVGLSCYVIYTNNMPSYLKLGLIDTIKAASDSIYSSCDYTDYFLKAKKMLEGFAWWGMFKAESMGMNKGFMVVGWVVFIIYNALSGIAISRLSAQIIYCLSKYFRGECGK
>NC_017368.1|WP_000426619.1|349579_350683_+|hypothetical-protein
MENDVKEDLEQARPKLELEKQKQELEKLTQEKEQEIKKKEGRKYIYIIIIIIILFMLYPILSSITYDEPSQAIKTAHTKTILEILPDPISDLIKNNLDSHQQEISDLLSSSKDKMYSKVDAQIDNLFDPIENNVDKFLDWHYSLKGNYSEPALLAAKKLDLSVEDALFNKLQEKFLGADYKQRLKTMTDNISDAFISLLRQHKKDTEKIATQGVADIPQVVESLKNIDDQIERDLKLKMRFAAAIGATAGVGAGKLMKRLVPKLVEKLGTKLGAKVGAKFLAKFGIAVGGVLSTLGADVALNYIDEWLHRDEFKKEILNNINEMKKNLKESYKISFDNSITKFSQEFQKDLKNIKTISVQAHVEKLK
>NC_017368.1|WP_001117103.1|350726_351608_-|RluA-family-pseudouridine-synthase
MPFVEEEFEILKPIKALFFVRDVLKCSLKEAQRHLDKQRLKQNQQAVRKSQMIQGVVSLIHFRPNEKTQALVFETKDFGVFDKPPQVYTHPKGYFYHESLLDCIQSHFGKNAHPAHRLDYETSGLVLAGKTLQSAKDLKALFMQKKVKKTYLVLAHGLVDRSIVIDKPILTPQNIQKDLRIKSKISPLGKPSTTLVEPLSYNPFLDISLLKITPITGRTHQIRLHLSSVNHRIVGEGLYGVIDENAREYLQLKRENNAPLLMLHAASLEFEFKGAIYKITSPMPKRFMPFLKD
>NC_017368.1|WP_000810725.1|351607_353158_-|single-stranded-DNA-specific-exonuclease-RecJ
MKQKLKAQIKERVASIAYKEKGFPSPFLFKDLKKAALKIIEAMRANTEILVVGDYDADGVISSTIMAKFFESLNYKHVRIVIPNRFIDGYGISKKFLEKHHAPLIITVDNGISAFEAARFCKEKNYTLIITDHHCLHHDEVPDAYAVINPKQPDCDFIQKEVCGALVAFYLCYGIHQLLGKEKSHSSELLCLAGVATIADMMPLTFFNRFLVSKALYFLQKESLGAMGFLRQREVFRKRSLKASDISFSIAPLINSAGRMQDAKMALDFLSANNFQDGYFLYERLKACNMKRKMIQQQIFEEAFKHAMVGEKIIVAFKDDWHEGVLGIVASKLVEATQKPSLVFTFKEGVYKGSARSSSNIDLIDALNGVSSLLLGYGGHRQACGLSVGKNNIISLFETLENFDFKILPFCEKEPPLTLTLKDIDRELLEIIEAGEPYGQENPEPLFQAQNLEVIEEKIIKESHQVLRFKDKKCVKEAIYFNTERFLKAGEKVSAIFSVELDEYSNEPKMFVKSLL
>NC_017368.1|WP_000373216.1|353168_354785_-|CTP-synthase-(glutamine-hydrolyzing)
MDRAKFIFVTGGVLSSLGKGISSSSIATLLQHCNYQVSILKIDPYINIDPGTMSPLEHGEVFVTSDGAETDLDIGHYERFLNRNLTRLNNFTTGQIFSSVIENERKGEYLGKTIQIVPHVTDEIKRRIKSAAKGLDFLIVEVGGTVGDMEGMFYLEAIRQLKLELGNEKVINVHVTLIPYIQTTNELKTKPTQHSVQELRRLGVTPQIILARSPKPLDKELKNKIALSCDVEQDSVIVATDTKSIYACPILFLQEGILTPIARRFNLNKLHPKMAAWNTLVEKIIAPKHKVKIGFVGKYLSLKESYKSLIEALIHAGAHLDTQVNIEWLDSENFNEKTDLEGVDAILVPGGFGERGIEGKICAIQRARLEKLPFLGICLGMQLAIVEFCRNVLGLKGANSTEFNQRCEYPVVYLIEDFIDQNHQKQVRTYNSPLGGTMRLGEYECEIVPNSLLEKAYKKPSIKERHRHRYEINPKYRQEWENKGLKVVGFGANHLIEAIELEDHPFFVGVQFHPEFTSRLQSPNPIILDFIKSALHKS
>NC_017368.1|WP_000829942.1|355050_355719_+|hypothetical-protein
MAENSFKNVSTQPKVFFLLQVKTLFLLGGVFSAFFILMVGLVFFDYTHSMDNAIFNFACSTSLNSSPILTLILQNAARLGSSQFVLPLSLLVGVFLSLYCRNLALGVWFVLSVVLFEALLESLKHLLVHSIQWLSRNANFPNATALSLTLFYGLLVLLIPHLITHQTLKNILFYSLFGLILLIGLALIVLGVSFSSVLGGFCLGALGACFSIGIYLSVFQKI
>NC_017368.1|WP_000364709.1|355762_357466_+|flagellar-M-ring-protein-FliF
MDLKVLLQRIVDFFIKLNKKQKIALIAAGVLITALLVFLLLYPFKEKDYAQGGYGVLFERLDSSDNALILQHLQQNQIPYKILKDDTILIPKDKVYEERITLASQGIPKTSKVGFEIFDTKDFGATDFDQNIKLIRAIEGELSRTIESLNPILKANVHIAIPKDSVFVAKEVPPSASVMLKLKPDMKLSPTQILGIKNLIAAAVPKLTTENVKIVNENGESIGEGDILENSKELALEQLRYKQNFENILENKIVNILAPIVGGKNKVVARVNAEFDFSQKKSTKETFDPNNVVRSEQNLEEKKEGAPKKQVGGVPGVVSNIGPVQGLKDNKEPEKYEKSQNTTNYEVGKTISEIKGEFGTLVRLNAAVVVDGKYKIALKDGANTLEYEPLSDESLKKINALVKQAIGYNQNRGDDVAVSNFEFNPMAPMLDNATLSEKIMHKTQKVLGSFTPLIKYILVFIVLFIFYKKVIVPFSERMLEVVPDEDKEVKSMFEEMDEEEDELNKLGDLRKKVEDQLGLNATFSEEEVRYEIVLEKIRGTLKERPDEIAMLFKLLIKDEISSDSAKG
>NC_017368.1|WP_000201844.1|357484_358516_+|flagellar-motor-switch-protein-FliG
MATKLTPKQKAQLDELSMSEKIAILLIQVGEDATGEILRHLDIDSITEISKQIVQLNGTDKQIGAAVLEEFFAIFQSNQYINTGGLEYARELLTRTLGSEEARKVMDKLTKSLQTQKNFAYLGKIKPQQLADFIINEHPQTIALILAHMEAPNAAETLSYFPDEMKAEISIRMANLGEISPQVVKRVSTVLENKLESLTSYKIEVGGLRAVAEIFNRLGQKSAKTTLARIESVDNKLAGAIKEMMFTFEDISKLDNFAIREILKVADKKDLSLALKTSTQDLTDKFLNNMSSRAAEQFVEEMQYLGAVKIKDVDVAQRKIIEIVQSLQEKGVIQTGEEEDVIE
>NC_017368.1|WP_000056309.1|358502_359279_+|flagellar-assembly-protein-FliH
MSLNSRKNLIQKDQLNKHDIQKYEFKSMANLPHKTNPNNASLETPNPKEPLEKKAIENDLIDCLLKKTDELSSHLVKLQMQFEKAQEESKALIENAKNDGYKIGFKEGEEKMRNELTHSVNEEKNQLLHAISALDEKMKKSEDHLMALEKELSAIAIDIAKEVILKEVEDNSQKVALALAEELLKNVLDATDIHLKVNPLDYPYLNERLQNASKIKLESNEAISKGGVMITSSNGSLDGNLMERFKTLKESVLENFKV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_017368_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_017368_3

951395-951599

Orphan

I-B

Consensus_repeat	Method
TTCAATCAAGGCACTTACAACTTTAATA	PILER-CR
TTCAATCAAGGCACTTACAACTTTA	CRT

3 spacers

The CRISPR arrays of NC_017368_3

>merge|NC_017368|3|951395-951599|PILER-CR,CRT
TTCAATCAAGGCACTTACAAATTCACTAACAGCGCTAACTTAAACTTCAACAACAGCGCTTTCAATCAAGGGACTTACAACTTTAATAGCGCTCAATCTGTTTTTGAAAACAGCAATTTCAATCAAGGCACTTATAGCTTTACTGACAATACAGGTTTAAACTTTAATAACGACACCTTCAATCAAGGCACTTACAACTTTAATA

>NC_017368|3|1|951395-951599|PILER-CR
TTCAATCAAGGCACTTACAAATTCACTA	ACAGCGCTAACTTAAACTTCAACAACAGCGCT
TTCAATCAAGGGACTTACAACTTTAATA	GCGCTCAATCTGTTTTTGAAAACAGCAAT
TTCAATCAAGGCACTTATAGCTTTACTG	ACAATACAGGTTTAAACTTTAATAACGACACCTTC
AATCAAGGCACTTACAACTTTAATA

>NC_017368|3|1|951395-951596|CRT
TTCAATCAAGGCACTTACAAATTCA	CTAACAGCGCTAACTTAAACTTCAACAACAGCGCT
TTCAATCAAGGGACTTACAACTTTA	ATAGCGCTCAATCTGTTTTTGAAAACAGCAAT
TTCAATCAAGGCACTTATAGCTTTA	CTGACAATACAGGTTTAAACTTTAATAACGACACC
TTCAATCAAGGCACTTACAACTTTA

Protein	Signature genes	Signature genes Name	Protein_function
NC_017368.1\|WP_000722446.1\|963467_964271_+\|5'/3'-nucleotidase-SurE	unknown	unknown	gnl\|CDD\|234732
NC_017368.1\|WP_001172993.1\|957850_958954_+\|Hop-family-outer-membrane-protein-HopJ/HopK	unknown	unknown	gnl\|CDD\|280099
NC_017368.1\|WP_001230027.1\|944919_945351_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|376519
NC_017368.1\|WP_000398303.1\|932497_933649_+\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|223897
NC_017368.1\|WP_001240247.1\|948707_949400_-\|Bax-inhibitor-1/YccA-family-protein	unknown	unknown	gnl\|CDD\|198414
NC_017368.1\|WP_162470248.1\|961050_962001_+\|zinc-metalloprotease-HtpX	unknown	unknown	gnl\|CDD\|235081
NC_017368.1\|WP_000812616.1\|938389_939982_+\|Hop-family-adhesin-AlpB	unknown	unknown	gnl\|CDD\|280099
NC_017368.1\|WP_001248483.1\|940524_942069_-\|outer-membrane-beta-barrel-protein-HofG	unknown	unknown	gnl\|CDD\|334957
NC_017368.1\|WP_001099638.1\|959358_959940_+\|recombination-protein-RecR	unknown	unknown	gnl\|CDD\|273176
NC_017368.1\|WP_001052410.1\|959936_961082_+\|tRNA-pseudouridine(13)-synthase-TruD	unknown	unknown	gnl\|CDD\|272903
NC_017368.1\|WP_000592386.1\|936829_938368_+\|Hop-family-adhesin-AlpA	unknown	unknown	gnl\|CDD\|280099
NC_017368.1\|WP_000688632.1\|949543_950539_+\|type-I-glyceraldehyde-3-phosphate-dehydrogenase	unknown	unknown	gnl\|CDD\|273675
NC_017368.1\|WP_001126475.1\|945355_948613_-\|carbamoyl-phosphate-synthase-large-subunit	unknown	unknown	gnl\|CDD\|235393
NC_017368.1\|WP_000042167.1\|964267_964927_+\|hypothetical-protein	unknown	unknown	unknown
NC_017368.1\|WP_001115888.1\|959006_959213_-\|4-oxalocrotonate-tautomerase-family-protein	unknown	unknown	gnl\|CDD\|129125
NC_017368.1\|WP_001064317.1\|962559_963471_+\|polyprenyl-synthetase-family-protein	unknown	unknown	gnl\|CDD\|223220
NC_017368.1\|WP_000426978.1\|962001_962544_+\|GTP-cyclohydrolase-I-FolE	unknown	unknown	gnl\|CDD\|129173
NC_017368.1\|WP_000894559.1\|933652_935683_+\|ATP-dependent-helicase	unknown	unknown	gnl\|CDD\|223288
NC_017368.1\|WP_014535828.1\|964930_965533_+\|6-pyruvoyl-tetrahydropterin-synthase-family-protein	unknown	unknown	gnl\|CDD\|223792
NC_017368.1\|WP_000998473.1\|942307_944746_-\|TonB-dependent-receptor	unknown	unknown	gnl\|CDD\|224544

Protein	Function_ID	Function_description	E-value
NC_017368.1\|WP_000722446.1\|963467_964271_+\|5'/3'-nucleotidase-SurE	gnl\|CDD\|234732	PRK00346, surE, 5'(3')-nucleotidase/polyphosphatase; Provisional.	3.20818e-126
NC_017368.1\|WP_001172993.1\|957850_958954_+\|Hop-family-outer-membrane-protein-HopJ/HopK	gnl\|CDD\|280099	pfam01856, HP_OMP, Helicobacter outer membrane protein. This family seems confined to Helicobacter. It is predicted to be an outer membrane protein based on its pattern of alternating hydrophobic amino acids similar to porins.	3.51717e-46
NC_017368.1\|WP_001230027.1\|944919_945351_-\|hypothetical-protein	gnl\|CDD\|376519	pfam01300, Sua5_yciO_yrdC, Telomere recombination. This domain has been shown to bind preferentially to dsRNA. The domain is found in SUA5 as well as HypF and YrdC. It has also been shown to be required for telomere recombniation in yeast.	0.000998031
NC_017368.1\|WP_000398303.1\|932497_933649_+\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|223897	COG0827, COG0827, Adenine-specific DNA methylase [DNA replication, recombination, and repair].	4.40599e-52
NC_017368.1\|WP_001240247.1\|948707_949400_-\|Bax-inhibitor-1/YccA-family-protein	gnl\|CDD\|198414	cd10432, BI-1-like_bacterial, Bacterial BAX inhibitor (BI)-1/YccA-like proteins. This family is comprised of bacterial relatives of the mammalian members of the BAX inhibitor (BI)-1 like family of small transmembrane proteins, which have been shown to have an antiapoptotic effect either by stimulating the antiapoptotic function of Bcl-2, a well-characterized oncogene, or by inhibiting the proapoptotic effect of Bax, another member of the Bcl-2 family. In plants, BI-1 like proteins play a role in pathogen resistance. A characterized prokaryotic member, Escherichia coli YccA, has been shown to interact with ATP-dependent protease FtsH, which degrades abnormal membrane proteins as part of a quality control mechanism to keep the integrity of biological membranes.	4.213e-52
NC_017368.1\|WP_162470248.1\|961050_962001_+\|zinc-metalloprotease-HtpX	gnl\|CDD\|235081	PRK02870, PRK02870, heat shock protein HtpX; Provisional.	0
NC_017368.1\|WP_000812616.1\|938389_939982_+\|Hop-family-adhesin-AlpB	gnl\|CDD\|280099	pfam01856, HP_OMP, Helicobacter outer membrane protein. This family seems confined to Helicobacter. It is predicted to be an outer membrane protein based on its pattern of alternating hydrophobic amino acids similar to porins.	1.04826e-52
NC_017368.1\|WP_001248483.1\|940524_942069_-\|outer-membrane-beta-barrel-protein-HofG	gnl\|CDD\|334957	pfam02521, HP_OMP_2, Putative outer membrane protein. This family consists of putative outer membrane proteins from Helicobacter pylori (campylobacter pylori).	8.79741e-179
NC_017368.1\|WP_001099638.1\|959358_959940_+\|recombination-protein-RecR	gnl\|CDD\|273176	TIGR00615, Recombination_protein_RecR, recombination protein RecR. All proteins in this family for which functions are known are involved in the initiation of recombination and recombinational repair. RecF is also required. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). [DNA metabolism, DNA replication, recombination, and repair].	3.78543e-98
NC_017368.1\|WP_001052410.1\|959936_961082_+\|tRNA-pseudouridine(13)-synthase-TruD	gnl\|CDD\|272903	TIGR00094, tRNA_pseudouridine_synthase_D, tRNA pseudouridine synthase, TruD family. an EGAD loading error caused one member to be called surE, but that's an adjacent gene. MJ11364 is a strong partial match from 50 to 230 aa. [Protein synthesis, tRNA and rRNA base modification].	1.58495e-139
NC_017368.1\|WP_000592386.1\|936829_938368_+\|Hop-family-adhesin-AlpA	gnl\|CDD\|280099	pfam01856, HP_OMP, Helicobacter outer membrane protein. This family seems confined to Helicobacter. It is predicted to be an outer membrane protein based on its pattern of alternating hydrophobic amino acids similar to porins.	1.85224e-54
NC_017368.1\|WP_000688632.1\|949543_950539_+\|type-I-glyceraldehyde-3-phosphate-dehydrogenase	gnl\|CDD\|273675	TIGR01534, Glyceraldehyde-3-phosphate_dehydrogenase, glyceraldehyde-3-phosphate dehydrogenase, type I. This model represents glyceraldehyde-3-phosphate dehydrogenase (GAPDH), the enzyme responsible for the interconversion of 1,3-diphosphoglycerate and glyceraldehyde-3-phosphate, a central step in glycolysis and gluconeogenesis. Forms exist which utilize NAD (EC 1.2.1.12), NADP (EC 1.2.1.13) or either (1.2.1.59). In some species, NAD- and NADP- utilizing forms exist, generally being responsible for reactions in the anabolic and catabolic directions respectively. Two Pfam models cover the two functional domains of this protein; pfam00044 represents the N-terminal NAD(P)-binding domain and pfam02800 represents the C-terminal catalytic domain. An additional form of gap gene is found in gamma proteobacteria and is responsible for the conversion of erythrose-4-phosphate (E4P) to 4-phospho-erythronate in the biosynthesis of pyridoxine. This pathway of pyridoxine biosynthesis appears to be limited, however, to a relatively small number of bacterial species although it is prevalent among the gamma-proteobacteria. This enzyme is described by TIGR001532. These sequences generally score between trusted and noise to this GAPDH model due to the close evolutionary relationship. There exists the possiblity that some forms of GAPDH may be bifunctional and act on E4P in species which make pyridoxine and via hydroxythreonine and lack a separate E4PDH enzyme (for instance, the GAPDH from Bacillus stearothermophilus has been shown to posess a limited E4PD activity as well as a robust GAPDH activity). There are a great number of sequences in the databases which score between trusted and noise to this model, nearly all of them due to fragmentary sequences. It seems that study of this gene has been carried out in many species utilizing PCR probes which exclude the extreme ends of the consenses used to define this model. The noise level is set relative not to E4PD, but the next closest outliers, the class II GAPDH's (found in archaea, TIGR01546) and aspartate semialdehyde dehydrogenase (ASADH, TIGR01296) both of which have highest-scoring hits around -225 to the prior model. [Energy metabolism, Glycolysis/gluconeogenesis].	4.25625e-159
NC_017368.1\|WP_001126475.1\|945355_948613_-\|carbamoyl-phosphate-synthase-large-subunit	gnl\|CDD\|235393	PRK05294, carB, carbamoyl-phosphate synthase large subunit.	0
NC_017368.1\|WP_001115888.1\|959006_959213_-\|4-oxalocrotonate-tautomerase-family-protein	gnl\|CDD\|129125	TIGR00013, Probable_tautomerase_K2, 4-oxalocrotonate tautomerase family enzyme. 4-oxalocrotonate tautomerase is a homohexamer in which each monomer is very small, at about 62 amino acids. Pro-1 of the mature protein serves as a general base. The enzyme functions in meta-cleavage pathways of aromatic hydrocarbon catabolism. Because several Arg residues located near the active site in the crystal structure of Pseudomonas putida are not conserved among all members of this family, because the literature describes a general role in the isomerization of beta,gamma-unsaturated enones to their alpha,beta-isomers, and because of the presence of fairly distantly related paralogs in Campylobacter jejuni, the family is regarded as not necessarily uniform in function. [Energy metabolism, Other].	4.5194e-26
NC_017368.1\|WP_001064317.1\|962559_963471_+\|polyprenyl-synthetase-family-protein	gnl\|CDD\|223220	COG0142, IspA, Geranylgeranyl pyrophosphate synthase [Coenzyme metabolism].	1.11335e-76
NC_017368.1\|WP_000426978.1\|962001_962544_+\|GTP-cyclohydrolase-I-FolE	gnl\|CDD\|129173	TIGR00063, GTP_cyclohydrolase_1, GTP cyclohydrolase I. alternate names: Punch (Drosophila),GTP cyclohydrolase I (EC 3.5.4.16) catalyzes the biosynthesis of formic acid and dihydroneopterin triphosphate from GTP. This reaction is the first step in the biosynthesis of tetrahydrofolate in prokaryotes, of tetrahydrobiopterin in vertebrates, and of pteridine-containing pigments in insects. [Biosynthesis of cofactors, prosthetic groups, and carriers, Folic acid].	1.7643e-105
NC_017368.1\|WP_000894559.1\|933652_935683_+\|ATP-dependent-helicase	gnl\|CDD\|223288	COG0210, UvrD, Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair].	8.99683e-134
NC_017368.1\|WP_014535828.1\|964930_965533_+\|6-pyruvoyl-tetrahydropterin-synthase-family-protein	gnl\|CDD\|223792	COG0720, COG0720, 6-pyruvoyl-tetrahydropterin synthase [Coenzyme metabolism].	1.95567e-21
NC_017368.1\|WP_000998473.1\|942307_944746_-\|TonB-dependent-receptor	gnl\|CDD\|224544	COG1629, CirA, Outer membrane receptor proteins, mostly Fe transport [Inorganic ion transport and metabolism].	1.19823e-34

>NC_017368.1|WP_000688632.1|949543_950539_+|type-I-glyceraldehyde-3-phosphate-dehydrogenase
MKIFINGFGRIGRCVLRAILERSDNPNLEVIGINDPANWEILAYLLEHDSAHGLLNKEARYSNHKLIIGSLEIPVFNSINDLKDVDVIIECSGKFLEPKTLENYLLLGAKKVLLSAPFMGEYDEKQYPTLVYGVNHSLYQNQAIVSNASCTTNAIAPICAILDKAFGIKEGMLTTIHSYTSDQKLIDLAHPLDKRRSRAAASNIIPTTTKAALALHKVLPNLKNKMHGHSVRVPSLDVSMIDLSLFLEKKAPKDPINDLLIEASKGVLKGVLEIDLKERVSSDFISNPSSVIIAPDLTFTLENMVKIMGWYDNEWGYSHRLVDMAQFMYHY
>NC_017368.1|WP_001240247.1|948707_949400_-|Bax-inhibitor-1/YccA-family-protein
MALYDRANSHNAYAENSLLHDSELVGFVKTTYKFFAGSLLLATIGALLGLMNFQAVVQYKWVFFIAEIAAFFGLMFSKSKPGLNLFMLFAFTSLSGVTLVPLLGMVIAKAGLGAIWQALGMTTIVFGLMSVYALKTKNDLANMGKMLFIALIVVVVCSLINLFLGSPMFQVVIAGASAILFSLYIAYDTQNIVKGMYDSPIDAAVSLYLDFLNVFISILQIIGIFSDRDK
>NC_017368.1|WP_001126475.1|945355_948613_-|carbamoyl-phosphate-synthase-large-subunit
MPKRTDISNILLIGSGPIVIGQACEFDYSGTQSCKTLKFLGYRVILINSNPATVMTDPEFSHQTYIQPITPENIAAIIEKEKIDAILPTMGGQTALNAVMQMHQKGMLEGVELLGAKIEAIKKGEDRQAFKEAMLKIGMDLPRGRYAYSELEALEAINEIGFPAIIRASFTLAGGGSGVAYNIEEFQELAKNALDASPINEILIEESLLGWKEYEMEVIRDNKDNCIIVCCIENIDPMGVHTGDSITIAPSLTLTDKEYQRMRDASFAILREIGVDTGGSNVQFAIHPETLRMVVIEMNPRVSRSSALASKATGFPIAKVATMLAVGFSLDEIQNDITNTPASFEPSLDYIVVKIPRFAFEKFAGVSSTLGTSMKSIGEVMAIGGNFLEALQKALCSLENNWLGFESLSKDLEMIKKEIRRPNFKRLLYIADAFRLGVCVDEVFELCQIDRWFLSQIQKLVKTEESINSSVLTDAKKLRGLKNLGFSDARIAAKIKENENLEVSPFEVELARMHLQIAPHFEEVDTCAAEFLSLTPYLYSTYAPNPLPPIENKQEKQEKKILIIGSGPNRIGQGIEFDYCCVHASFALKDLNIKSVMLNCNPETVSTDYDTSDTLYFEPIHFECVKSIIQREHVDGIIVHFGGQTPLKLAKDLAKMQAPIIGTPFKVIDIAEDREKFSLFLKELDIKQPENGMAKSVDEAYSIANVIGFPIIVRPSYVLGGQHMQILENIEELHHYLESVTHALEVSSKNPLLIDKFLEKAVELDVDAICDKKEVYIAGILQHIEEAGIHSGDSACFIPSTLRAEILDEIERVSAKIALHLGVVGLLNIQFAVHDNTLYLIEVNPRASRTVPFLSKALGVPLAKVATRVMVLKDLKEALKFYDKKNIVGYSKGVYKPKMPHFVALKEAVFPFNKLYGSDLILGPEMKSTGEVMGIARSLGLAFFKAQTACFNPIKNKGLIFVSIKDKDKEEACVLMKRLVQLGFELCATEGTHKALEKAGVESLKVLKISEGRPNVMDLMMNGEISMAINTSDHKSQDDAKLIRASVLKNHVSYFTTLSAIEVLILALEESSKEDELLALQDYLK
>NC_017368.1|WP_001230027.1|944919_945351_-|hypothetical-protein
MALVYLVQSDTTIGLLSKDSEKLNALKNRPKNQSVLIESADFTTLKSLVRAPNAFKNLIRRSAKTTFIYPNSKAVRVVRGRHGDFLKRFKTLYSTSANLTQCAYDKKIASKLADVIVSDERGLFESSSSKIFRLYKGKKVRVR
>NC_017368.1|WP_000998473.1|942307_944746_-|TonB-dependent-receptor
MNDKRFRKYWSFSIFLSLLGMFELEAKEEEKEERQKEKKIKKKNAQHTLGKVTTQAAKIFNYNNQTTISSKELERRQANQISDMFRRNPNINVGGGAVIAQKIYVRGIEDRLARVTVDGAAQMGASYGHQGNTIIDPGMLKSVVVTKGAAQASAGPMALIGAIKMETRSASDFIPKGKDYAMSGAVTFLTNFGDRETVMGAYRNNHFDVLLYYTHQNIFYYRDGDNATKDLFRPKADNKVTGSPSEQNNVMAKINGYLSERDALTLSYNMTRDNANRPLRANFTGTFLPYSCGDFNAFPNEKNPSDCLFENDASLFKTYSVNLVHNVSLNYEREGGSRFGDPKLKINGYTSIRNVQIDPLFRPNDIAASIPFTPNPELGEENECVAQGGIYDAVKQTCSITFKSLGGGSVVANKNLFIINSGFNANVIHTIDHKNDNLFEYGLNYQNLTTFDKAIPNSELVKPGDAPDACLRVMGPNDPNMNGRCQRNGATANVVGVYAQANYTLHPMVTLGAGTRYDVYTLVDKDWQLHITQGFSPSAALNVSPLENLNFRLSYAYVTRGPMPGGLVWMRQDNLRYNRNLKPEIGQNVEFNTEYSSQYFDFRAAGFVQLISNYINQFSSTLFVTNLPAKDIIYVPGYEVSGTAKYKGFSLGLSVARSWPSLKGRLIADVYELAATTGNVFILTASYTIPRTGLSITWLSRFVTDLSYCSYSPYRNGPTDIDRRPSNCPKTPGIFHVHKPGYGVSSFFVTYKPTYKKLKGLSLNAVFNNVFNQQYIDQASPVMSPDEPNQDKYARGMAEPGFNARFEISYKF
>NC_017368.1|WP_001248483.1|940524_942069_-|outer-membrane-beta-barrel-protein-HofG
MRQEKYFLTSSLSLLSFLCCPAEAFDYRFSGRVENFSKIGFNNSQINTKKGIYPTESFIDIVTLAQVKVNLLPKGTENHRLSFSLGGAIAAIPYDKTKNDINQANGKIFGSIVENFIGGYHGYFFNKYLGPAYAGTSQSASYHARPYVVDTAFLRYDYKDVFGFKAGRYEANIDFMSGSNQGWEVYYQPYKTETQRLRFWWWSSFGRGLAFNSWIYEFFATVPYLKKGGNPNNSNDFINYGWHGITTTYSYKGLDAQFFYYFAPKTYNAPGFKLVYDTNRNFENVGFRSQSMIMTTFPLYYRGWYNPETKTYSLEDSTPHGSLLGRNGVTLNIRQVFWWDNFNWSIGLYNTFGNSDAFLGSHTMPRGNNTSYIGNEISITTRHAGMIGYDFWDNTAYDGLADAITNANTFTFYTSVGGIHKRFAWHVFGRVSHANKNALGQLGRANEYSLQFNASYAFTESVFLNFRITYYGARINKGYQVGYFGAPKFNNPDGDFSANYQDRSYMMTNLTLKF
>NC_017368.1|WP_000812616.1|938389_939982_+|Hop-family-adhesin-AlpB
MKQNLKPFKMIKENLMTQSQKVRFLAPLSLALSLSFNQVGAEEDGGFMTFGYELGQVVQQVKNPGKIKAEELAGLLNSTTTNNTNINIAGTGGNVAGTLGNLFMNQLGNLIDLYPTLNTSSIHQCGATNNGSSGASATTAAATNNSPCFQGNLSLYNEMVSSIKTLNQDLKNNIFQGNNNTTSANLSNQLSELNAASVYLTYMNSFLNANNQAGGIFQNKTNQAYGNDVTAQQIAYILKQASVTMGPSGNGGAAGAFLDAALAQHVFNSANAGNDLSAKEFTSLVQNIVNTSNNALTLANNANISNSTGYQVSYGGNIDQACSTQLLNNTTNTLAKVAALNNELKANPWLGNFAAGNSSQVNAFNGFITKIGYKQFFGENKNVGLRYYGFFSYNGAGVGNGPTYNQVNLLTYGVGTDVLYNVFSRSFGSRSLNAGFFGGIQLAGDTYISTLRNSPQLASRPTATKFQFLFDVGLRMNFGILKKDLKSHNQHSIEIGVQVPTIYNTYYKAGGAEVKYYRPYSVYWVYGYAF
>NC_017368.1|WP_000592386.1|936829_938368_+|Hop-family-adhesin-AlpA
MIKKNKTLFLSLALCASISYAEDDGGFFTVGYQLGQVMQDVQNPGGTKRDELARELNAGVTNNILNNNTGGNVAGALSNAFSQYLYSLLGAYPEKLNGNDVSANALLGGAVGSGTCAAAGTAGGNSLNTQSACTAAGYYWLPSLSDRVLSTIGSQTNYGTDTNFPNMQQQLTYLNAANVFFNAMNKALETKSGTGGATGSNGQTYSQQAIQYLQGQQNILNNAANLLKQDELLLEAFNSAVAANIGNKEFNSAVFTGLVQGIIDQSQSVYNELSKNPISGSAVNSAGINNNQANAVQGRASQLSNALYNAQVTLDKINALNNQVRSMPYLPQFRAGNSRSTNILNGFYTKVGYKQFFGKKRNIGLRYYGFFSYNGASVGFRSTQNNVGLYTYGVGTDVLYNIFSRSYQNRSVDMGFFSGIQLAGETFQSTLRDDPNVKLHGKVNNTHFQFLFDFGMRMNFGKLDGKSNRHNQHTVEFGVVVPTIYNTYYKSAGTTVKYFRPYSVYWSYGYSF
>NC_017368.1|WP_000894559.1|933652_935683_+|ATP-dependent-helicase
MLETLQLNPEQLKAAKALKGYNLVIASAGTGKTSTIVGRILYLLDNGIKPEEILLLTFTNKASNEMIARVAKYSKSSSKIEAGTFHAVAYRYLKEHYPNLSLKQPKELKKLLESIVDTKNALTDDDKKPYTSQHLYALYSLYTNALKQEDFSAWLSHKNPEHTPYAAFYENILDEFENTKKKHNYIDYNDLLLLFKQAMLERPSPYKEVLCDEFQDTNPLQESILDAINPPSLFCVGDYDQSIYAFNGADISIISNFTQKYKNARVFTLTKNYRSSKEILDLANQVIQRNERIYPKNLEVVKSGHFNKPALLNYNDNIAQCQDIAKRIVMRKNFKEVAVIFRNNASADQLEAALRSHNVPSKRKGSASFFESKEVALALDICALIFNPKDIMAAIHVLSHISDIGSNTAKDIHEALMLLGNGDLKLALTHPSKEAKIYTKKKEITSMGLFEEIFALENSSRFNSVIDKAFHSHPVLMHPKISLNGAKMLGDFFILYTKAPTHSPSALIKHILESAFFQTFKTRLLKERSKNKDGSYNEFKKLQAQKRFNEKMDLLSSLAKNYQNLGRFLNGTLIGSSEATQGEGVNLLSVHASKGLEFKDVYIIDLMEGRFPNHKLMNTGGGIEEERRLFYVAITRAKENLWLSYAKNELRENAKPKEHKPSVFLYEAGLLKPDLK
>NC_017368.1|WP_000398303.1|932497_933649_+|class-I-SAM-dependent-methyltransferase
MEGFLYQLDIKTLGQVFTPKNIVDFMLTLKQNHGSVLEPSTGDGSFLKHLKKAVGIEIDPKICPKNALCMDFFDYPLENQFDTIIGNPPYVKHKDIAPSTKEKLHYSLFDERSNLYLFFIEKAIKHLKPKGELIFITPRDFLKSTSSVKLNELIYKEGTITHFFELGDQKVFPNAMPNCVIFRFCKGNFSRITNDCLQFLCKKGILYFLNQSYTQKLSEVFKVKVGAVSGCDKIFKNEKYGNLEFVTSITKRTNVLEKMVFVNKPNDYLLQHKDSLMQRKIKKFNENNWFEWGRMHHISPKKRIYVNTKTRQKNPFFIHQCPNYDGSILALFPYNQNLDLQNLCDKLNAINWQELGFVCDGRFLFSQRSLENALLPKDFLNLG
>NC_017368.1|WP_001172993.1|957850_958954_+|Hop-family-outer-membrane-protein-HopJ/HopK
MQKTLFSLSLPLFLFLSCCIAEENGAYASVGFEYSISHAIQHNNPFLNQERIQIISNAQNKIYKLNQVKNEITSMPNTFAYINNNLKNHSQLTPTEMQAEKYYLQSTFQNIEKIIALSGGVASNPQLVQALEKIQEPTTNPLEFEENLKNLEVQFNQSQNRMLSSLSSQIAQISNSLNAFDPNSYSKNISNMYGVTLNVGYKHFFTKKKNQGFRYYLFYDYGYTNFGFVGNGFDGLGKMNNHLYGLGIDYLYNFIDNAQKHSSVGFYAGFALAGSSWVGSGLSMWVSETDFINHYLTGYQAKMHTSFFQIPLNFGVRVNVNRHNGFEMGLKIPLAVNSFYETHGKGLNTSLFFKRLVVFNVSYVYSF
>NC_017368.1|WP_001115888.1|959006_959213_-|4-oxalocrotonate-tautomerase-family-protein
MPFINIKLVPENGGPTNEQKQQLIEGVSDLMVKVLNKNKASVVVIIDEVDSNNYGLGGESVHHLRQKN
>NC_017368.1|WP_001099638.1|959358_959940_+|recombination-protein-RecR
MNTYKNSLNHFLNLVDCLEKIPNVGKKSAFKMAYHLGLENPYLALRITHALENALENLKTCASCNALSESEVCEICSDESRQNSQLCMVLHPRDVFILEDLKDFLGRYYVLNSIEEVDFNALEKRLIEENIKEIIFAFPPTLANDSLMLYIEDKLQHFHLTFTKIAQGVPTGVNFENIDSVSLSRAFNSRIKA
>NC_017368.1|WP_001052410.1|959936_961082_+|tRNA-pseudouridine(13)-synthase-TruD
MNLNFMPLLHAYNHASIDFHFNSSARDFCVHEVPLYEFSNTGEHAVIQVRKSGLSTLEMLQIFSQILGVRIAELGYAGLKDKNALTTQFISLPKKYAPLLEKNTHNLQERNLKILSLNYHHNKIKLGHLKGNRFFMRFKKMTPLNAQKTEQVLEQIVQFGMPNYFGPQRFGKFNDNHQEGLKILQNQTKFAHQKLNAFLISSYQSYLFNALLSKRLEISKIISAFSVKENLEFFKQKNLNINPNTLKALKNQAHPFKILEGDVMCHYPYGKFFDALELEKESERFLKKEAVPTGLLDGKKALYAKNLSLEIEKEFQHNLLSSHAKTLGSRRFFWVFVENITSQYVKEKAQFELGFYLPKGSYASALLKEIKHEKGENNDEF
>NC_017368.1|WP_162470248.1|961050_962001_+|zinc-metalloprotease-HtpX
MRKEKIMTNFEKIIAQNRLKTNAVLATYCVIFAFIGLLVDVIRINANDLGIALFKLMTFQIFPTITMIMFLVAFVIIVVCVQNFSSIMLSGDEYKLIDSSKVLSSKENQIHRLLLELLEEAKLHFEPKLYIIKAPYMNAFASGWNESNSLIALTSALIERLDRDELKAVIAHELSHIRHNDIRLTMCVGILSNIMLLAANFSVYFFMGNRKNSGANLARMILLVLQIILPFITLLLQMYLSRTREYMADSGAAFLMHDNKPMIRALQKISNDYKENDYKDTDTNSTRSAAYLFSAEMFSTHPSIKNRIQSLSRRVI
>NC_017368.1|WP_000426978.1|962001_962544_+|GTP-cyclohydrolase-I-FolE
MENFFNQFFENIGEDKNREGLKETPKRVQELWKFLYKGYKEDPRVALKSAYFQGVCDEMIVAQNIEFYSTCEHHLLPFLGNISLGYIPKEKIVGISAIAKLIEIYSRRLQIQERLTTQIAETFDEIIEPRGVIVVCEAKHLCMSMQGVQKQNAIIKTSVLKGLFKKDPKTRAEFIQLLKS
>NC_017368.1|WP_001064317.1|962559_963471_+|polyprenyl-synthetase-family-protein
MNNPNLSFYYNECERFESFLNHHHLHLESFHPYLEKAFFEMVLNGGKRFRPKLFLAVLCALVGQKDYSNQQTEYFKIALSIECLHTYSLIHDDLPCMDNAALRRNHPTLHAKYDETTAVLIGDALNTYSFELLSNSLLESHIIVELIKILSANGGIKGMVLGQVLDCYFENTPLNLEQLTFLHEHKTAKLISASLMMGLVASGIKDEELFKWLQAFGLKMGLCFQVLDDIIDVTQDEEESGKTTHLDSAKNSFVNLLGLEEASGYAQTLKTEVLDDLNLLKPAYPSLQENLNALLNTLFKGKT
>NC_017368.1|WP_000722446.1|963467_964271_+|5'/3'-nucleotidase-SurE
MKKILLTNDDGYHAKGIKALEQALEEMAEIYVVAPKHEKSACSQCITITAPLRAEKIKGKEGRHYRIDDGTPSDCVYLAINELFKHVCFDLVISGINLGSNMGEDTIYSGTVAGAIEGTIQGVPSIAISQILSNKNKNTPLSFDLAQKIIQDLVQNIFTKGYPLKGRKLLNVNVPNCSLQEYKGECITPKGYRLYKKEVHKRTDPKNESYFWLGLHPLEWQKRENEDRLSDFDAIASNHVSITPLNLDLTSYDDLKNLESWHKGMLK
>NC_017368.1|WP_000042167.1|964267_964927_+|hypothetical-protein
MSKNQRLAFLGLIVGVLFFFSACQHRLHMGYYSEVTGDYLFNYNSTIVVAYDRSDAMTSYYINVIVYELQKLGFYNVFTQAEFPLDKAKNVIYARIVRNISAVPFYQYNYQLIDQVNKPCYFLGGQFYCSQTPTDYYAINGFSEQILMSANSHFILDWYDVVLQKRVLYVDGSVSGRTCGYQMLYRDLIKSTIKRIDFNRPERYYYNLRLPLYQPCYRE
>NC_017368.1|WP_014535828.1|964930_965533_+|6-pyruvoyl-tetrahydropterin-synthase-family-protein
MVIRRLYQFCASHVVRNCSSLKCAQNIHGHNYEVEVFIETNRLDSANMALDFGLMQQEMQVFIESFDHAHHFWDKESDEFQRFIENHCVRYVKCSFNLSAESYALMFLYYLTRILQKSVFSNNEGELKISSVRVHETKNGYAESFLKDLENPHFKSLVHQNCVSFSQGIQNLWHDKEFFNKIISDEKQCFFHAKPPHQIP

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	NC_017368.1	138170-138197	2	0.929

1. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to position: 138170-138197, mismatch: 2, identity: 0.929

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttttgtttttcttgttctgtcttttgt	Protospacer
*********************.**.***

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	NZ_CP019918	Borreliella burgdorferi strain PAbe plasmid p_cp32-5-1, complete sequence	20481-20508	3	0.893
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	NZ_CP019918	Borreliella burgdorferi strain PAbe plasmid p_cp32-5-1, complete sequence	51224-51251	3	0.893
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	NC_000948	Borreliella burgdorferi B31 plasmid cp32-1, complete sequence	27272-27299	3	0.893
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	NC_000953	Borreliella burgdorferi B31 plasmid cp32-8, complete sequence	27407-27434	3	0.893
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	NZ_CP019846	Borreliella burgdorferi plasmid cp32-1, complete sequence	27248-27275	3	0.893
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	NZ_CP019849	Borreliella burgdorferi plasmid cp32-5, complete sequence	27196-27223	3	0.893
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	NZ_CP019756	Borreliella burgdorferi strain B31_NRZ isolate B31 plasmid p_cp32-1_1, complete sequence	27197-27224	3	0.893
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	NZ_CP019756	Borreliella burgdorferi strain B31_NRZ isolate B31 plasmid p_cp32-1_1, complete sequence	57940-57967	3	0.893
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	NZ_CP030046	Enterococcus faecalis strain C54 plasmid pC54, complete sequence	26261-26288	3	0.893
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	NC_018979	Borrelia burgdorferi 297 plasmid 297_cp32-12, complete sequence	27344-27371	4	0.857
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	NC_018981	Borrelia burgdorferi 297 plasmid 297_cp32-5, complete sequence	27185-27212	4	0.857
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	NC_019003	Borrelia burgdorferi 297 plasmid 297_cp32-1, complete sequence	27451-27478	4	0.857
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	MN693011	Marine virus AFVG_117M58, complete genome	42494-42521	4	0.857
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	KX119177	Helicobacter phage SwA626G, complete genome	7846-7873	4	0.857
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	NZ_CP013848	Clostridium botulinum strain Af650 plasmid pRSJ14_1, complete sequence	19034-19061	4	0.857
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	MG649966	Vibrio virus Ceto, complete genome	72538-72565	5	0.821
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	NC_042094	Vibrio phage Ceto, complete genome	72538-72565	5	0.821
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	NZ_CP007453	Peptoclostridium acidaminophilum DSM 3953 strain al-2 plasmid EAL2_808p, complete sequence	746219-746246	5	0.821
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	KT345706	Vibrio phage vB_VorS-PVo5, complete genome	3117-3144	5	0.821
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	NZ_CP031899	Escherichia coli O113:H21 strain FWSEC0010 plasmid unnamed1, complete sequence	38845-38872	5	0.821
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	NZ_CP028382	Escherichia coli strain RM10466 plasmid pRM10466-1, complete sequence	117776-117803	5	0.821
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	NZ_CP027441	Escherichia coli strain 2012C-4502 plasmid unnamed, complete sequence	54657-54684	5	0.821
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	NZ_CP027372	Escherichia coli strain 2015C-3905 plasmid unnamed	59642-59669	5	0.821
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	NC_007365	Escherichia coli EH41 plasmid pO113, complete sequence	123821-123848	5	0.821
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	NZ_CP024291	Escherichia coli O178:H19 strain 2012C-4431 plasmid unnamed2, complete sequence	34562-34589	5	0.821
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	KM983328	Clostridium phage phiCT453B, complete genome	32388-32415	5	0.821
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	MH648920	Microviridae sp. isolate cthi004, complete genome	3998-4025	5	0.821
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	MN694392	Marine virus AFVG_250M8, complete genome	25571-25598	5	0.821
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	NZ_CP027585	Escherichia coli strain 00-3076 plasmid unnamed, complete sequence	50665-50692	5	0.821
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	NZ_CP027451	Escherichia coli strain 2014C-3097 plasmid unnamed2, complete sequence	53900-53927	5	0.821
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	MN694558	Marine virus AFVG_250M9, complete genome	14015-14042	5	0.821
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	MN694640	Marine virus AFVG_250M10, complete genome	14023-14050	5	0.821
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	NC_049857	Lactococcus phage P1048, complete genome	14007-14034	5	0.821
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	DQ222855	Bacillus anthracis phage Gamma isolate 53, complete genome	27056-27083	5	0.821
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	DQ289555	Bacillus anthracis phage W Beta, complete genome	29856-29883	5	0.821
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	NC_007814	Bacillus phage Fah, complete genome	29663-29690	5	0.821
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	DQ150593	Bacillus anthracis bacteriophage Fah, complete sequence	29663-29690	5	0.821
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	DQ222853	Bacillus anthracis phage Gamma isolate 51, complete genome	27695-27722	5	0.821
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	DQ221100	Bacteriophage gamma putative terminase small subunit, putative terminase large subunit, putative portal protein, putative prohead protease, putative phage structural protein, putative DNA packaging protein, putative head-tail adaptor, phage related proteins, putative major tail protein, phage related protein, putative tail tape measure protein, phage related protein, putative minor structural protein, putative holin, N-acetylmuramoyl-L-alanine amidase (PlyG), putative lipoprotein, putative transcriptional regulator, conserved hypothetical proteins, FtsK/SpoIIIE family protein, phage related protein, conserved hypothetical protein, putative transcriptional regulator, putative site-specific recombinase, conserved hypothetical protein, putative transcriptional regulators, putative antirepressor, conserved hypothetical protein, putative DNA replication proteins, conserved hypothetical protein, phage related proteins, conserved hypothetical protein, putative transglycosylase, and putative endonuclease genes, complete cds	29663-29690	5	0.821
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	DQ221100	Bacteriophage gamma putative terminase small subunit, putative terminase large subunit, putative portal protein, putative prohead protease, putative phage structural protein, putative DNA packaging protein, putative head-tail adaptor, phage related proteins, putative major tail protein, phage related protein, putative tail tape measure protein, phage related protein, putative minor structural protein, putative holin, N-acetylmuramoyl-L-alanine amidase (PlyG), putative lipoprotein, putative transcriptional regulator, conserved hypothetical proteins, FtsK/SpoIIIE family protein, phage related protein, conserved hypothetical protein, putative transcriptional regulator, putative site-specific recombinase, conserved hypothetical protein, putative transcriptional regulators, putative antirepressor, conserved hypothetical protein, putative DNA replication proteins, conserved hypothetical protein, phage related proteins, conserved hypothetical protein, putative transglycosylase, and putative endonuclease genes, complete cds	29699-29726	5	0.821
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	DQ222851	Bacillus anthracis phage Cherry, complete genome	27057-27084	5	0.821
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	DQ289556	Bacillus anthracis phage Gamma isolate d'Herelle, complete genome	27824-27851	5	0.821
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	NC_007734	Bacillus phage WBeta, complete genome	29856-29883	5	0.821
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	KY963369	Bacillus phage Tavor_SA, complete genome	31225-31252	5	0.821
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	NC_007458	Bacillus phage Gamma, complete genome	27695-27722	5	0.821
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	MN694140	Marine virus AFVG_250M934, complete genome	599-626	5	0.821
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	KX119203	Helicobacter phage PtB89G, complete genome	7673-7700	5	0.821
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	NZ_CP024036	Bacillus aryabhattai strain K13 plasmid unnamed1	45218-45245	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	NZ_CP023318	Bacillus megaterium strain A plasmid p1, complete sequence	55711-55738	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	KF302032	UNVERIFIED: Pseudoalteromonas phage HS5, complete genome	33345-33372	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	HM588722	Pseudoalteromonas phage H105/1, complete genome	23153-23180	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	NZ_CP014118	Staphylococcus epidermidis strain FDAARGOS_153 plasmid unnamed1, complete sequence	17118-17145	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	KF302033	UNVERIFIED: Pseudoalteromonas phage HS1, complete genome	32949-32976	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	NZ_CP015592	Bacillus cereus strain AR156 plasmid pAR460, complete sequence	355566-355593	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	NZ_CP033793	Bacillus sp. FDAARGOS_527 plasmid unnamed6, complete sequence	14569-14596	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	AP014285	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S24-C125, * SEQUENCING IN PROGRESS *	3556-3583	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	AP013502	Uncultured Mediterranean phage uvMED DNA, complete genome, group G2, isolate: uvMED-CGR-C14A-MedDCM-OCT-S23-C10	26363-26390	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	AP013505	Uncultured Mediterranean phage uvMED DNA, complete genome, group G2, isolate: uvMED-CGR-C14A-MedDCM-OCT-S38-C26	26580-26607	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	AP013504	Uncultured Mediterranean phage uvMED DNA, complete genome, group G2, isolate: uvMED-CGR-C14A-MedDCM-OCT-S34-C29	25322-25349	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	AP013795	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C14A-MedDCM-OCT-S43-C156, * SEQUENCING IN PROGRESS *	9013-9040	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	AP013506	Uncultured Mediterranean phage uvMED DNA, complete genome, group G2, isolate: uvMED-CGR-C14A-MedDCM-OCT-S42-C35	12735-12762	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	AP013786	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C14A-MedDCM-OCT-S31-C108, * SEQUENCING IN PROGRESS *	5206-5233	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	GU943055	Uncultured phage MedDCM-OCT-S04-C26 genomic sequence	24780-24807	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	AP013791	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C14A-MedDCM-OCT-S36-C101, * SEQUENCING IN PROGRESS *	11837-11864	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	LC425524	Uncultured phage DNA, contig: NODE656	5827-5854	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	AP013793	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C14A-MedDCM-OCT-S39-C151, * SEQUENCING IN PROGRESS *	6939-6966	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	AP013787	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C14A-MedDCM-OCT-S32-C104, * SEQUENCING IN PROGRESS *	11837-11864	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	NZ_LR214999	Mycoplasma conjunctivae strain NCTC10147 plasmid 3	59451-59478	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	LR214965	Mycoplasma fermentans strain NCTC10117 genome assembly, plasmid: 11	49043-49070	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	MK449010	Streptococcus phage Javan90, complete genome	1430-1457	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	AP013783	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C14A-MedDCM-OCT-S24-C161, * SEQUENCING IN PROGRESS *	6579-6606	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	MK448798	Streptococcus phage Javan533, complete genome	1434-1461	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	KX011028	Staphylococcus phage pSco-10, complete genome	78754-78781	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	MF775688	Lactococcus phage LP0004b, complete genome	19976-20003	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	MK448681	Streptococcus phage Javan141, complete genome	1432-1459	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	AP014448	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C14A-MedDCM-OCT-S35-C81, * SEQUENCING IN PROGRESS *, 2 ordered pieces	13384-13411	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	AP013794	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C14A-MedDCM-OCT-S41-C142, * SEQUENCING IN PROGRESS *	7352-7379	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	MN871511	UNVERIFIED: Vibrio phage vspsw1, complete genome	103528-103555	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	MF775694	Lactococcus phage LP0212, complete genome	19517-19544	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	MF775696	Lactococcus phage LP0509, complete genome	19517-19544	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	AP013796	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C14A-MedDCM-OCT-S44-C315, * SEQUENCING IN PROGRESS *	593-620	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	MF448557	Lactococcus phage 37201, complete genome	20495-20522	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	NC_013155	Lactococcus phage CB13, complete genome	20020-20047	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	MN871505	UNVERIFIED: Vibrio phage ValDsh2, complete genome	8286-8313	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	KP793102	Lactococcus phage 936 group phage PhiA.16, complete genome	18682-18709	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	MF775701	Lactococcus phage LP1110, complete genome	19517-19544	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	MF775693	Lactococcus phage LP0209, complete genome	19517-19544	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	MN693111	Marine virus AFVG_25M354, complete genome	29951-29978	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	NC_049402	Lactococcus phage 38507, complete genome	18189-18216	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	MF775697	Lactococcus phage LP0604, complete genome	19517-19544	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	MF775699	Lactococcus phage LP1005, complete genome	19516-19543	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	MT442039	Vibrio phage vB_ValS_X1, partial genome	8134-8161	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	MF775700	Lactococcus phage LP1011, complete genome	19517-19544	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	KP793103	Lactococcus phage 936 group phage Phi19, complete genome	18681-18708	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	NC_049423	Lactococcus phage LP0903, complete genome	20003-20030	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	NC_049401	Lactococcus phage 38503, complete genome	16805-16832	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	KP793104	Lactococcus phage 936 group phage PhiB1127, complete genome	18884-18911	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	KP793109	Lactococcus phage 936 group phage PhiC0139, complete genome	18884-18911	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	NC_049414	Lactococcus phage 96403, complete genome	16903-16930	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	AP013503	Uncultured Mediterranean phage uvMED DNA, complete genome, group G2, isolate: uvMED-CGR-C14A-MedDCM-OCT-S29-C22	32253-32280	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	MK301439	Lactococcus phage AV09, complete genome	18682-18709	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	MF775691	Lactococcus phage LP0109, complete genome	19527-19554	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	MN871510	UNVERIFIED: Vibrio phage valsw3, complete genome	92198-92225	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	KP793106	Lactococcus phage 936 group phage PhiA1127, complete genome	19127-19154	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	AP013785	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C14A-MedDCM-OCT-S30-C161, * SEQUENCING IN PROGRESS *	7141-7168	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	AP013789	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C14A-MedDCM-OCT-S33-C266, * SEQUENCING IN PROGRESS *	593-620	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	MK448783	Streptococcus phage Javan503, complete genome	1355-1382	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	MK448967	Streptococcus phage Javan510, complete genome	1434-1461	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	MH925094	UNVERIFIED: Vibrio phage VspSw_1, complete genome	8333-8360	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	KY349816	Streptococcus phage Str01, complete genome	23599-23626	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	NC_049369	Lactococcus phage 936 group phage PhiLj, complete genome	18695-18722	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	MK448833	Streptococcus phage Javan87, complete genome	1430-1457	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	NC_049482	Lactococcus phage CHPC362, complete genome	19002-19029	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	MF775702	Lactococcus phage LP1407, complete genome	19497-19524	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	AP013784	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C14A-MedDCM-OCT-S27-C105, * SEQUENCING IN PROGRESS *	10391-10418	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	NC_004588	Streptococcus prophage 315.5, complete genome	1583-1610	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	MF775695	Lactococcus phage LP0304, complete genome	19517-19544	6	0.786
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	NC_018878	Bacillus thuringiensis Bt407 plasmid BTB_502p, complete sequence	410314-410341	7	0.75
NC_017368_1	1.1\|138296\|28\|NC_017368\|CRISPRCasFinder	138296-138323	28	NZ_CP014848	Bacillus thuringiensis strain HD12 plasmid pHD120017, complete sequence	10847-10874	7	0.75
NC_017368_3	3.2\|951483\|29\|NC_017368\|PILER-CR	951483-951511	29	NZ_CP045274	Bacillus megaterium strain FDU301 plasmid pFDU301B, complete sequence	87743-87771	7	0.759
NC_017368_3	3.2\|951483\|29\|NC_017368\|PILER-CR	951483-951511	29	NZ_CP032533	Bacillus megaterium NCT-2 plasmid pNCT2_5, complete sequence	27069-27097	7	0.759
NC_017368_3	3.2\|951483\|29\|NC_017368\|PILER-CR	951483-951511	29	NZ_CP009921	Bacillus megaterium NBRC 15308 = ATCC 14581 plasmid pBMV_2, complete sequence	185364-185392	7	0.759
NC_017368_3	3.2\|951483\|29\|NC_017368\|PILER-CR	951483-951511	29	NZ_CP035095	Bacillus megaterium NBRC 15308 = ATCC 14581 plasmid unnamed1, complete sequence	291584-291612	7	0.759
NC_017368_3	3.2\|951483\|29\|NC_017368\|PILER-CR	951483-951511	29	NZ_CP022523	Pseudoalteromonas sp. NC201 plasmid pNC201, complete sequence	752261-752289	8	0.724
NC_017368_3	3.2\|951483\|29\|NC_017368\|PILER-CR	951483-951511	29	NC_028671	Enterococcus phage vB_EfaS_IME197, complete genome	17500-17528	8	0.724
NC_017368_3	3.5\|951480\|32\|NC_017368\|CRT	951480-951511	32	NZ_CP045274	Bacillus megaterium strain FDU301 plasmid pFDU301B, complete sequence	87743-87774	9	0.719
NC_017368_3	3.5\|951480\|32\|NC_017368\|CRT	951480-951511	32	NZ_CP032533	Bacillus megaterium NCT-2 plasmid pNCT2_5, complete sequence	27066-27097	9	0.719
NC_017368_3	3.5\|951480\|32\|NC_017368\|CRT	951480-951511	32	NZ_CP009921	Bacillus megaterium NBRC 15308 = ATCC 14581 plasmid pBMV_2, complete sequence	185364-185395	9	0.719
NC_017368_3	3.5\|951480\|32\|NC_017368\|CRT	951480-951511	32	NZ_CP022523	Pseudoalteromonas sp. NC201 plasmid pNC201, complete sequence	752261-752292	9	0.719
NC_017368_3	3.5\|951480\|32\|NC_017368\|CRT	951480-951511	32	NZ_CP035095	Bacillus megaterium NBRC 15308 = ATCC 14581 plasmid unnamed1, complete sequence	291581-291612	9	0.719
NC_017368_3	3.5\|951480\|32\|NC_017368\|CRT	951480-951511	32	NC_028671	Enterococcus phage vB_EfaS_IME197, complete genome	17497-17528	10	0.688

1. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to NZ_CP019918 (Borreliella burgdorferi strain PAbe plasmid p_cp32-5-1, complete sequence) position: , mismatch: 3, identity: 0.893

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttttgtttttcttgttctgcttttcgt	Protospacer
********************.***..**

2. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to NZ_CP019918 (Borreliella burgdorferi strain PAbe plasmid p_cp32-5-1, complete sequence) position: , mismatch: 3, identity: 0.893

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttttgtttttcttgttctgcttttcgt	Protospacer
********************.***..**

3. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to NC_000948 (Borreliella burgdorferi B31 plasmid cp32-1, complete sequence) position: , mismatch: 3, identity: 0.893

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttttgtttttcttgttctgcttttcgt	Protospacer
********************.***..**

4. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to NC_000953 (Borreliella burgdorferi B31 plasmid cp32-8, complete sequence) position: , mismatch: 3, identity: 0.893

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttttgtttttcttgttctgcttttcgt	Protospacer
********************.***..**

5. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to NZ_CP019846 (Borreliella burgdorferi plasmid cp32-1, complete sequence) position: , mismatch: 3, identity: 0.893

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttttgtttttcttgttctgcttttcgt	Protospacer
********************.***..**

6. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to NZ_CP019849 (Borreliella burgdorferi plasmid cp32-5, complete sequence) position: , mismatch: 3, identity: 0.893

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttttgtttttcttgttctgcttttcgt	Protospacer
********************.***..**

7. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to NZ_CP019756 (Borreliella burgdorferi strain B31_NRZ isolate B31 plasmid p_cp32-1_1, complete sequence) position: , mismatch: 3, identity: 0.893

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttttgtttttcttgttctgcttttcgt	Protospacer
********************.***..**

8. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to NZ_CP019756 (Borreliella burgdorferi strain B31_NRZ isolate B31 plasmid p_cp32-1_1, complete sequence) position: , mismatch: 3, identity: 0.893

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttttgtttttcttgttctgcttttcgt	Protospacer
********************.***..**

9. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to NZ_CP030046 (Enterococcus faecalis strain C54 plasmid pC54, complete sequence) position: , mismatch: 3, identity: 0.893

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tgtttgtttttctggttcttttttctgt	Protospacer
* *********** ***** ********

10. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to NC_018979 (Borrelia burgdorferi 297 plasmid 297_cp32-12, complete sequence) position: , mismatch: 4, identity: 0.857

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttttgtttttctttttctgcttttcgt	Protospacer
************** *****.***..**

11. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to NC_018981 (Borrelia burgdorferi 297 plasmid 297_cp32-5, complete sequence) position: , mismatch: 4, identity: 0.857

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttttgtttttctttttctgcttttcgt	Protospacer
************** *****.***..**

12. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to NC_019003 (Borrelia burgdorferi 297 plasmid 297_cp32-1, complete sequence) position: , mismatch: 4, identity: 0.857

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttttgtttttctttttctgcttttcgt	Protospacer
************** *****.***..**

13. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to MN693011 (Marine virus AFVG_117M58, complete genome) position: , mismatch: 4, identity: 0.857

tttttgtttttcttgttctgttttctgt	CRISPR spacer
ttttggtttttctttttctgtttttttt	Protospacer
**** ********* *********.* *

14. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to KX119177 (Helicobacter phage SwA626G, complete genome) position: , mismatch: 4, identity: 0.857

tttttgtttttcttgttctgttttctgt-	CRISPR spacer
tttttgtttttgttgttcta-tttctatg	Protospacer
*********** *******. *****.*

15. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to NZ_CP013848 (Clostridium botulinum strain Af650 plasmid pRSJ14_1, complete sequence) position: , mismatch: 4, identity: 0.857

tttttgtttttcttgttctgttttctgt-	CRISPR spacer
ttttagtttttcttcttctg-tttctata	Protospacer
**** ********* ***** *****.*

16. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to MG649966 (Vibrio virus Ceto, complete genome) position: , mismatch: 5, identity: 0.821

tttttgtttttcttgttctgttttctgt	CRISPR spacer
attttgttttccttcttctgttttctca	Protospacer
 *********.*** ***********

17. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to NC_042094 (Vibrio phage Ceto, complete genome) position: , mismatch: 5, identity: 0.821

tttttgtttttcttgttctgttttctgt	CRISPR spacer
attttgttttccttcttctgttttctca	Protospacer
 *********.*** ***********

18. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to NZ_CP007453 (Peptoclostridium acidaminophilum DSM 3953 strain al-2 plasmid EAL2_808p, complete sequence) position: , mismatch: 5, identity: 0.821

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttttgtttttattgttatgttttcgac	Protospacer
*********** ***** ******* ..

19. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to KT345706 (Vibrio phage vB_VorS-PVo5, complete genome) position: , mismatch: 5, identity: 0.821

tttttgtttttcttgttctgttttctgt	CRISPR spacer
attttgttttccttcttctgttttctca	Protospacer
 *********.*** ***********

20. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to NZ_CP031899 (Escherichia coli O113:H21 strain FWSEC0010 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttttgtttttctttttttgtttttctt	Protospacer
************** **.******.. *

21. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to NZ_CP028382 (Escherichia coli strain RM10466 plasmid pRM10466-1, complete sequence) position: , mismatch: 5, identity: 0.821

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttttgtttttctttttttgtttttctt	Protospacer
************** **.******.. *

22. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to NZ_CP027441 (Escherichia coli strain 2012C-4502 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.821

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttttgtttttctttttttgtttttctt	Protospacer
************** **.******.. *

23. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to NZ_CP027372 (Escherichia coli strain 2015C-3905 plasmid unnamed) position: , mismatch: 5, identity: 0.821

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttttgtttttctttttttgtttttctt	Protospacer
************** **.******.. *

24. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to NC_007365 (Escherichia coli EH41 plasmid pO113, complete sequence) position: , mismatch: 5, identity: 0.821

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttttgtttttctttttttgtttttctt	Protospacer
************** **.******.. *

25. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to NZ_CP024291 (Escherichia coli O178:H19 strain 2012C-4431 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.821

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttttgtttttctttttttgtttttctt	Protospacer
************** **.******.. *

26. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to KM983328 (Clostridium phage phiCT453B, complete genome) position: , mismatch: 5, identity: 0.821

tttttgtttttcttgttctgttttctgt	CRISPR spacer
attttgtttttcttcttctgttatccat	Protospacer
 ************* ******* **..*

27. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to MH648920 (Microviridae sp. isolate cthi004, complete genome) position: , mismatch: 5, identity: 0.821

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttttgtttttcttgatctgcttttgat	Protospacer
*************** ****.***. .*

28. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to MN694392 (Marine virus AFVG_250M8, complete genome) position: , mismatch: 5, identity: 0.821

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttttctttttcttgttttgttttttaa	Protospacer
***** ***********.******.*.

29. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to NZ_CP027585 (Escherichia coli strain 00-3076 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.821

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttttgtttttctttttttgtttttctt	Protospacer
************** **.******.. *

30. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to NZ_CP027451 (Escherichia coli strain 2014C-3097 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.821

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttttgtttttctttttttgtttttctt	Protospacer
************** **.******.. *

31. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to MN694558 (Marine virus AFVG_250M9, complete genome) position: , mismatch: 5, identity: 0.821

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttttctttttcttgttttgttttttaa	Protospacer
***** ***********.******.*.

32. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to MN694640 (Marine virus AFVG_250M10, complete genome) position: , mismatch: 5, identity: 0.821

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttttctttttcttgttttgttttttaa	Protospacer
***** ***********.******.*.

33. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to NC_049857 (Lactococcus phage P1048, complete genome) position: , mismatch: 5, identity: 0.821

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttttgtttttccttttctgttttgttc	Protospacer
************.* ********* * .

34. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to DQ222855 (Bacillus anthracis phage Gamma isolate 53, complete genome) position: , mismatch: 5, identity: 0.821

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttttgtttttctttttctttttctttt	Protospacer
************** **** ***..* *

35. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to DQ289555 (Bacillus anthracis phage W Beta, complete genome) position: , mismatch: 5, identity: 0.821

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttttgtttttctttttctttttctttt	Protospacer
************** **** ***..* *

36. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to NC_007814 (Bacillus phage Fah, complete genome) position: , mismatch: 5, identity: 0.821

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttttgtttttctttttctttttctttt	Protospacer
************** **** ***..* *

37. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to DQ150593 (Bacillus anthracis bacteriophage Fah, complete sequence) position: , mismatch: 5, identity: 0.821

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttttgtttttctttttctttttctttt	Protospacer
************** **** ***..* *

38. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to DQ222853 (Bacillus anthracis phage Gamma isolate 51, complete genome) position: , mismatch: 5, identity: 0.821

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttttgtttttctttttctttttctttt	Protospacer
************** **** ***..* *

39. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to DQ221100 (Bacteriophage gamma putative terminase small subunit, putative terminase large subunit, putative portal protein, putative prohead protease, putative phage structural protein, putative DNA packaging protein, putative head-tail adaptor, phage related proteins, putative major tail protein, phage related protein, putative tail tape measure protein, phage related protein, putative minor structural protein, putative holin, N-acetylmuramoyl-L-alanine amidase (PlyG), putative lipoprotein, putative transcriptional regulator, conserved hypothetical proteins, FtsK/SpoIIIE family protein, phage related protein, conserved hypothetical protein, putative transcriptional regulator, putative site-specific recombinase, conserved hypothetical protein, putative transcriptional regulators, putative antirepressor, conserved hypothetical protein, putative DNA replication proteins, conserved hypothetical protein, phage related proteins, conserved hypothetical protein, putative transglycosylase, and putative endonuclease genes, complete cds) position: , mismatch: 5, identity: 0.821

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttttgtttttctttttctttttctttt	Protospacer
************** **** ***..* *

40. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to DQ221100 (Bacteriophage gamma putative terminase small subunit, putative terminase large subunit, putative portal protein, putative prohead protease, putative phage structural protein, putative DNA packaging protein, putative head-tail adaptor, phage related proteins, putative major tail protein, phage related protein, putative tail tape measure protein, phage related protein, putative minor structural protein, putative holin, N-acetylmuramoyl-L-alanine amidase (PlyG), putative lipoprotein, putative transcriptional regulator, conserved hypothetical proteins, FtsK/SpoIIIE family protein, phage related protein, conserved hypothetical protein, putative transcriptional regulator, putative site-specific recombinase, conserved hypothetical protein, putative transcriptional regulators, putative antirepressor, conserved hypothetical protein, putative DNA replication proteins, conserved hypothetical protein, phage related proteins, conserved hypothetical protein, putative transglycosylase, and putative endonuclease genes, complete cds) position: , mismatch: 5, identity: 0.821

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttttgtttttctttttctttttctttt	Protospacer
************** **** ***..* *

41. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to DQ222851 (Bacillus anthracis phage Cherry, complete genome) position: , mismatch: 5, identity: 0.821

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttttgtttttctttttctttttctttt	Protospacer
************** **** ***..* *

42. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to DQ289556 (Bacillus anthracis phage Gamma isolate d'Herelle, complete genome) position: , mismatch: 5, identity: 0.821

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttttgtttttctttttctttttctttt	Protospacer
************** **** ***..* *

43. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to NC_007734 (Bacillus phage WBeta, complete genome) position: , mismatch: 5, identity: 0.821

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttttgtttttctttttctttttctttt	Protospacer
************** **** ***..* *

44. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to KY963369 (Bacillus phage Tavor_SA, complete genome) position: , mismatch: 5, identity: 0.821

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttttctttttcttcttctgtttctttt	Protospacer
***** ******** ********..* *

45. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to NC_007458 (Bacillus phage Gamma, complete genome) position: , mismatch: 5, identity: 0.821

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttttgtttttctttttctttttctttt	Protospacer
************** **** ***..* *

46. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to MN694140 (Marine virus AFVG_250M934, complete genome) position: , mismatch: 5, identity: 0.821

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttttgtttttcctgttctttttcccgc	Protospacer
************.****** ***.*.*.

47. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to KX119203 (Helicobacter phage PtB89G, complete genome) position: , mismatch: 5, identity: 0.821

tttttgtttttcttgttctgttttctgt	CRISPR spacer
gttttgtttttcttgttctttgttgttt	Protospacer
 ****************** * ** * *

48. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to NZ_CP024036 (Bacillus aryabhattai strain K13 plasmid unnamed1) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
attttgttttttttgttatgttttcaag	Protospacer
 **********.***** ******* .

49. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to NZ_CP023318 (Bacillus megaterium strain A plasmid p1, complete sequence) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
attttgttttttttgttatgttttcaag	Protospacer
 **********.***** ******* .

50. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to KF302032 (UNVERIFIED: Pseudoalteromonas phage HS5, complete genome) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttctgtttttcttattctgtttttcag	Protospacer
***.**********.*********...

51. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to HM588722 (Pseudoalteromonas phage H105/1, complete genome) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttctgtttttcttattctgtttttcag	Protospacer
***.**********.*********...

52. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to NZ_CP014118 (Staphylococcus epidermidis strain FDAARGOS_153 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
ttgttgtttttcttgttctgttaaatca	Protospacer
** *******************   *

53. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to KF302033 (UNVERIFIED: Pseudoalteromonas phage HS1, complete genome) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttctgtttttcttattctgtttttcag	Protospacer
***.**********.*********...

54. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to NZ_CP015592 (Bacillus cereus strain AR156 plasmid pAR460, complete sequence) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
cttttgtttttcttgttccgcttttttc	Protospacer
.*****************.*.***.* .

55. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to NZ_CP033793 (Bacillus sp. FDAARGOS_527 plasmid unnamed6, complete sequence) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
ttcttctttttcttgttctgtttgattg	Protospacer
**.** *****************  *

56. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to AP014285 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S24-C125, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttttcttcttcttgttctgtttccata	Protospacer
***** **.**************.*

57. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to AP013502 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G2, isolate: uvMED-CGR-C14A-MedDCM-OCT-S23-C10) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
cagttgttcttcttgttcttttttcttt	Protospacer
.  *****.********** ****** *

58. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to AP013505 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G2, isolate: uvMED-CGR-C14A-MedDCM-OCT-S38-C26) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
cagttgttcttcttgttcttttttcttt	Protospacer
.  *****.********** ****** *

59. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to AP013504 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G2, isolate: uvMED-CGR-C14A-MedDCM-OCT-S34-C29) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
cagttgttcttcttgttcttttttcttt	Protospacer
.  *****.********** ****** *

60. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to AP013795 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C14A-MedDCM-OCT-S43-C156, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
cagttgttcttcttgttcttttttcttt	Protospacer
.  *****.********** ****** *

61. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to AP013506 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G2, isolate: uvMED-CGR-C14A-MedDCM-OCT-S42-C35) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
cagttgttcttcttgttcttttttcttt	Protospacer
.  *****.********** ****** *

62. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to AP013786 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C14A-MedDCM-OCT-S31-C108, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
cagttgttcttcttgttcttttttcttt	Protospacer
.  *****.********** ****** *

63. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to GU943055 (Uncultured phage MedDCM-OCT-S04-C26 genomic sequence) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
cagttgttcttcttgttcttttttcttt	Protospacer
.  *****.********** ****** *

64. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to AP013791 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C14A-MedDCM-OCT-S36-C101, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
cagttgttcttcttgttcttttttcttt	Protospacer
.  *****.********** ****** *

65. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to LC425524 (Uncultured phage DNA, contig: NODE656) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
ccgttgtttttcttgttctattttttct	Protospacer
.. ****************.****.* *

66. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to AP013793 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C14A-MedDCM-OCT-S39-C151, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
cagttgttcttcttgttcttttttcttt	Protospacer
.  *****.********** ****** *

67. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to AP013787 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C14A-MedDCM-OCT-S32-C104, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
cagttgttcttcttgttcttttttcttt	Protospacer
.  *****.********** ****** *

68. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to NZ_LR214999 (Mycoplasma conjunctivae strain NCTC10147 plasmid 3) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
attttgtttttcttgtttagttttagtt	Protospacer
 ****************. *****   *

69. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to LR214965 (Mycoplasma fermentans strain NCTC10117 genome assembly, plasmid: 11) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
attttgtttttcttgtttagttttagtt	Protospacer
 ****************. *****   *

70. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to MK449010 (Streptococcus phage Javan90, complete genome) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
attttgttttcctttttctgtttttagc	Protospacer
 *********.*** *********. *.

71. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to AP013783 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C14A-MedDCM-OCT-S24-C161, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
cagttgttcttcttgttcttttttcttt	Protospacer
.  *****.********** ****** *

72. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to MK448798 (Streptococcus phage Javan533, complete genome) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
attttgttttcctttttctgtttttagc	Protospacer
 *********.*** *********. *.

73. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to KX011028 (Staphylococcus phage pSco-10, complete genome) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
atgttgtttttcttggtctgtttttgat	Protospacer
 * ************ ********. .*

74. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to MF775688 (Lactococcus phage LP0004b, complete genome) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttttgtttttcttgctctttttagcat	Protospacer
***************.*** ***  ..*

75. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to MK448681 (Streptococcus phage Javan141, complete genome) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
attttgttttcctttttctgtttttagc	Protospacer
 *********.*** *********. *.

76. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to AP014448 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C14A-MedDCM-OCT-S35-C81, *** SEQUENCING IN PROGRESS ***, 2 ordered pieces) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
cagttgttcttcttgttcttttttcttt	Protospacer
.  *****.********** ****** *

77. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to AP013794 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C14A-MedDCM-OCT-S41-C142, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
cagttgttcttcttgttcttttttcttt	Protospacer
.  *****.********** ****** *

78. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to MN871511 (UNVERIFIED: Vibrio phage vspsw1, complete genome) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tgcttctttttcttgttctgtttgcttg	Protospacer
* .** ***************** **

79. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to MF775694 (Lactococcus phage LP0212, complete genome) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttttgtttttcttgctctttttagcat	Protospacer
***************.*** ***  ..*

80. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to MF775696 (Lactococcus phage LP0509, complete genome) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttttgtttttcttgctctttttagcat	Protospacer
***************.*** ***  ..*

81. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to AP013796 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C14A-MedDCM-OCT-S44-C315, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
cagttgttcttcttgttcttttttcttt	Protospacer
.  *****.********** ****** *

82. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to MF448557 (Lactococcus phage 37201, complete genome) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttttgtttttcttgctctttttagcat	Protospacer
***************.*** ***  ..*

83. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to NC_013155 (Lactococcus phage CB13, complete genome) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttttgtttttcttgctctttttagcat	Protospacer
***************.*** ***  ..*

84. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to MN871505 (UNVERIFIED: Vibrio phage ValDsh2, complete genome) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tgcttctttttcttgttctgtttgcttg	Protospacer
* .** ***************** **

85. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to KP793102 (Lactococcus phage 936 group phage PhiA.16, complete genome) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttttgtttttcttgctctttttagcat	Protospacer
***************.*** ***  ..*

86. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to MF775701 (Lactococcus phage LP1110, complete genome) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttttgtttttcttgctctttttagcat	Protospacer
***************.*** ***  ..*

87. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to MF775693 (Lactococcus phage LP0209, complete genome) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttttgtttttcttgctctttttagcat	Protospacer
***************.*** ***  ..*

88. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to MN693111 (Marine virus AFVG_25M354, complete genome) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttttgttttttttgttctttttctaat	Protospacer
***********.******* ***.. .*

89. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to NC_049402 (Lactococcus phage 38507, complete genome) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttttgtttttcttgctctttttagcat	Protospacer
***************.*** ***  ..*

90. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to MF775697 (Lactococcus phage LP0604, complete genome) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttttgtttttcttgctctttttagcat	Protospacer
***************.*** ***  ..*

91. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to MF775699 (Lactococcus phage LP1005, complete genome) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttttgtttttcttgctctttttagcat	Protospacer
***************.*** ***  ..*

92. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to MT442039 (Vibrio phage vB_ValS_X1, partial genome) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tgcttctttttcttgttctgtttgcttg	Protospacer
* .** ***************** **

93. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to MF775700 (Lactococcus phage LP1011, complete genome) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttttgtttttcttgctctttttagcat	Protospacer
***************.*** ***  ..*

94. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to KP793103 (Lactococcus phage 936 group phage Phi19, complete genome) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttttgtttttcttgctctttttagcat	Protospacer
***************.*** ***  ..*

95. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to NC_049423 (Lactococcus phage LP0903, complete genome) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttttgtttttcttgctctttttagcat	Protospacer
***************.*** ***  ..*

96. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to NC_049401 (Lactococcus phage 38503, complete genome) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttttgtttttcttgctctttttagcat	Protospacer
***************.*** ***  ..*

97. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to KP793104 (Lactococcus phage 936 group phage PhiB1127, complete genome) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttttgtttttcttgctctttttagcat	Protospacer
***************.*** ***  ..*

98. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to KP793109 (Lactococcus phage 936 group phage PhiC0139, complete genome) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttttgtttttcttgctctttttagcat	Protospacer
***************.*** ***  ..*

99. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to NC_049414 (Lactococcus phage 96403, complete genome) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttttgtttttcttgctctttttagcat	Protospacer
***************.*** ***  ..*

100. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to AP013503 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G2, isolate: uvMED-CGR-C14A-MedDCM-OCT-S29-C22) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
cagttgttcttcttgttcttttttcttt	Protospacer
.  *****.********** ****** *

101. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to MK301439 (Lactococcus phage AV09, complete genome) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttttgtttttcttgctctttttagcat	Protospacer
***************.*** ***  ..*

102. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to MF775691 (Lactococcus phage LP0109, complete genome) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttttgtttttcttgctctttttagcat	Protospacer
***************.*** ***  ..*

103. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to MN871510 (UNVERIFIED: Vibrio phage valsw3, complete genome) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tgcttctttttcttgttctgtttgcttg	Protospacer
* .** ***************** **

104. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to KP793106 (Lactococcus phage 936 group phage PhiA1127, complete genome) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttttgtttttcttgctctttttagcat	Protospacer
***************.*** ***  ..*

105. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to AP013785 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C14A-MedDCM-OCT-S30-C161, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
cagttgttcttcttgttcttttttcttt	Protospacer
.  *****.********** ****** *

106. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to AP013789 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C14A-MedDCM-OCT-S33-C266, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
cagttgttcttcttgttcttttttcttt	Protospacer
.  *****.********** ****** *

107. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to MK448783 (Streptococcus phage Javan503, complete genome) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
attttgttttcctttttctgtttttagc	Protospacer
 *********.*** *********. *.

108. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to MK448967 (Streptococcus phage Javan510, complete genome) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
attttgttttcctttttctgtttttagc	Protospacer
 *********.*** *********. *.

109. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to MH925094 (UNVERIFIED: Vibrio phage VspSw_1, complete genome) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tgcttctttttcttgttctgtttgcttg	Protospacer
* .** ***************** **

110. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to KY349816 (Streptococcus phage Str01, complete genome) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
attttgttttcctttttctgtttttagc	Protospacer
 *********.*** *********. *.

111. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to NC_049369 (Lactococcus phage 936 group phage PhiLj, complete genome) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttttgtttttcttgctctttttagcat	Protospacer
***************.*** ***  ..*

112. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to MK448833 (Streptococcus phage Javan87, complete genome) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
attttgttttcctttttctgtttttagc	Protospacer
 *********.*** *********. *.

113. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to NC_049482 (Lactococcus phage CHPC362, complete genome) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttttgtttttcttgctctttttagcat	Protospacer
***************.*** ***  ..*

114. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to MF775702 (Lactococcus phage LP1407, complete genome) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttttgtttttcttgctctttttagcat	Protospacer
***************.*** ***  ..*

115. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to AP013784 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C14A-MedDCM-OCT-S27-C105, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
cagttgttcttcttgttcttttttcttt	Protospacer
.  *****.********** ****** *

116. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to NC_004588 (Streptococcus prophage 315.5, complete genome) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
attttgttttcctttttctgtttttagc	Protospacer
 *********.*** *********. *.

117. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to MF775695 (Lactococcus phage LP0304, complete genome) position: , mismatch: 6, identity: 0.786

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttttgtttttcttgctctttttagcat	Protospacer
***************.*** ***  ..*

118. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to NC_018878 (Bacillus thuringiensis Bt407 plasmid BTB_502p, complete sequence) position: , mismatch: 7, identity: 0.75

tttttgtttttcttgttctgttttctgt	CRISPR spacer
aatttctttttctttttctgttttcaaa	Protospacer
  *** ******** ********** .

119. spacer 1.1|138296|28|NC_017368|CRISPRCasFinder matches to NZ_CP014848 (Bacillus thuringiensis strain HD12 plasmid pHD120017, complete sequence) position: , mismatch: 7, identity: 0.75

tttttgtttttcttgttctgttttctgt	CRISPR spacer
tttctgtttttcttgttttgtttgaatc	Protospacer
***.*************.*****    .

120. spacer 3.2|951483|29|NC_017368|PILER-CR matches to NZ_CP045274 (Bacillus megaterium strain FDU301 plasmid pFDU301B, complete sequence) position: , mismatch: 7, identity: 0.759

gcgctcaatctgtttttgaaaacagcaat	CRISPR spacer
ttgaccaatctgtttttgaaaactgtaaa	Protospacer
 .* .****************** *.**

121. spacer 3.2|951483|29|NC_017368|PILER-CR matches to NZ_CP032533 (Bacillus megaterium NCT-2 plasmid pNCT2_5, complete sequence) position: , mismatch: 7, identity: 0.759

gcgctcaatctgtttttgaaaacagcaat	CRISPR spacer
ttgaccaatctgtttttgaaaactgtaaa	Protospacer
 .* .****************** *.**

122. spacer 3.2|951483|29|NC_017368|PILER-CR matches to NZ_CP009921 (Bacillus megaterium NBRC 15308 = ATCC 14581 plasmid pBMV_2, complete sequence) position: , mismatch: 7, identity: 0.759

gcgctcaatctgtttttgaaaacagcaat	CRISPR spacer
ttgaccaatctgtttttgaaaactgtaaa	Protospacer
 .* .****************** *.**

123. spacer 3.2|951483|29|NC_017368|PILER-CR matches to NZ_CP035095 (Bacillus megaterium NBRC 15308 = ATCC 14581 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.759

gcgctcaatctgtttttgaaaacagcaat	CRISPR spacer
ttgaccaatctgtttttgaaaactgtaaa	Protospacer
 .* .****************** *.**

124. spacer 3.2|951483|29|NC_017368|PILER-CR matches to NZ_CP022523 (Pseudoalteromonas sp. NC201 plasmid pNC201, complete sequence) position: , mismatch: 8, identity: 0.724

gcgctcaatctgtttttgaaaacagcaat	CRISPR spacer
caaggcaatctccttttgaaaacagcaac	Protospacer
  .  ****** .***************.

125. spacer 3.2|951483|29|NC_017368|PILER-CR matches to NC_028671 (Enterococcus phage vB_EfaS_IME197, complete genome) position: , mismatch: 8, identity: 0.724

gcgctcaatctgtttttgaaaacagcaat	CRISPR spacer
atgctcaatctgttttagaaaaaagtgga	Protospacer
..************** ***** **...

126. spacer 3.5|951480|32|NC_017368|CRT matches to NZ_CP045274 (Bacillus megaterium strain FDU301 plasmid pFDU301B, complete sequence) position: , mismatch: 9, identity: 0.719

atagcgctcaatctgtttttgaaaacagcaat	CRISPR spacer
cttttgaccaatctgtttttgaaaactgtaaa	Protospacer
 *  .* .****************** *.**

127. spacer 3.5|951480|32|NC_017368|CRT matches to NZ_CP032533 (Bacillus megaterium NCT-2 plasmid pNCT2_5, complete sequence) position: , mismatch: 9, identity: 0.719

atagcgctcaatctgtttttgaaaacagcaat	CRISPR spacer
cttttgaccaatctgtttttgaaaactgtaaa	Protospacer
 *  .* .****************** *.**

128. spacer 3.5|951480|32|NC_017368|CRT matches to NZ_CP009921 (Bacillus megaterium NBRC 15308 = ATCC 14581 plasmid pBMV_2, complete sequence) position: , mismatch: 9, identity: 0.719

atagcgctcaatctgtttttgaaaacagcaat	CRISPR spacer
cttttgaccaatctgtttttgaaaactgtaaa	Protospacer
 *  .* .****************** *.**

129. spacer 3.5|951480|32|NC_017368|CRT matches to NZ_CP022523 (Pseudoalteromonas sp. NC201 plasmid pNC201, complete sequence) position: , mismatch: 9, identity: 0.719

----atagcgctcaatctgtttttgaaaacagcaat	CRISPR spacer
gatcaagg----caatctccttttgaaaacagcaac	Protospacer
    * .*    ****** .***************.

130. spacer 3.5|951480|32|NC_017368|CRT matches to NZ_CP035095 (Bacillus megaterium NBRC 15308 = ATCC 14581 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atagcgctcaatctgtttttgaaaacagcaat	CRISPR spacer
cttttgaccaatctgtttttgaaaactgtaaa	Protospacer
 *  .* .****************** *.**

131. spacer 3.5|951480|32|NC_017368|CRT matches to NC_028671 (Enterococcus phage vB_EfaS_IME197, complete genome) position: , mismatch: 10, identity: 0.688

atagcgctcaatctgtttttgaaaacagcaat	CRISPR spacer
ttgatgctcaatctgttttagaaaaaagtgga	Protospacer
 *...************** ***** **...

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_017368

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection