CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NC_016052	Tetragenococcus halophilus NBRC 12172, complete genome	1 crisprs	RT,csa3,DEDDh,cas3,DinG,cas14j	0	1	9	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_016052_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_016052_1

2344059-2344138

Orphan

Consensus_repeat	Method
GCCACCCGCCGGACCCTTACGTTCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_016052_1

>merge|NC_016052|1|2344059-2344138|CRISPRCasFinder
GCCACCCGCCGGACCCTTACGTTCCAGATTTGTATCGAGTTTAGTTTTGGTGCTCGCCACCCGCCGGACCCTTATGTTCC

>NC_016052|1|1|2344059-2344138|CRISPRCasFinder
GCCACCCGCCGGACCCTTACGTTCC	AGATTTGTATCGAGTTTAGTTTTGGTGCTC
GCCACCCGCCGGACCCTTATGTTCC

Protein	Signature genes	Signature genes Name	Protein_function
NC_016052.1\|WP_041591855.1\|2349167_2349785_-\|Crp/Fnr-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223736
NC_016052.1\|WP_014125715.1\|2353960_2354725_-\|iron-export-ABC-transporter-permease-subunit-FetB	unknown	unknown	gnl\|CDD\|377092
NC_016052.1\|WP_002307628.1\|2344266_2344818_-\|tyrosine-type-recombinase/integrase	unknown	unknown	gnl\|CDD\|271192
NC_016052.1\|WP_014125704.1\|2340386_2340764_-\|pyridoxamine-5'-phosphate-oxidase-family-protein	unknown	unknown	gnl\|CDD\|334450
NC_016052.1\|WP_002318453.1\|2353772_2353886_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|239737
NC_016052.1\|WP_014125700.1\|2336498_2338193_+\|oleate-hydratase	unknown	unknown	gnl\|CDD\|237575
NC_016052.1\|WP_014125701.1\|2338427_2339108_-\|IS6-like-element-ISTeha2-family-transposase	unknown	unknown	gnl\|CDD\|225853
NC_016052.1\|WP_003125439.1\|2347381_2347615_-\|heavy-metal-associated-domain-containing-protein	unknown	unknown	gnl\|CDD\|225328
NC_016052.1\|WP_041591854.1\|2348642_2348939_-\|hypothetical-protein	unknown	unknown	unknown
NC_016052.1\|WP_014125697.1\|2334567_2335410_-\|hypothetical-protein	unknown	unknown	unknown
NC_016052.1\|WP_014125693.1\|2331175_2331841_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|369777
NC_016052.1\|WP_014125716.1\|2355459_2355882_-\|cupin-domain-containing-protein	unknown	unknown	gnl\|CDD\|380352
NC_016052.1\|WP_002331383.1\|2333727_2334408_+\|IS6-like-element-IS1216-family-transposase	unknown	unknown	gnl\|CDD\|225853
NC_016052.1\|WP_014125694.1\|2332030_2333359_-\|IS4-family-transposase	unknown	unknown	gnl\|CDD\|376573
NC_016052.1\|WP_014125706.1\|2345157_2347062_-\|heavy-metal-translocating-P-type-ATPase	unknown	unknown	gnl\|CDD\|319774
NC_016052.1\|WP_014124169.1\|2342201_2343500_-\|group-II-intron-reverse-transcriptase/maturase	RT	pfam00078_RT_CAS-I:CAS-III	gnl\|CDD\|275209
NC_016052.1\|WP_014125699.1\|2336324_2336459_+\|hypothetical-protein	unknown	unknown	unknown
NC_016052.1\|WP_014125711.1\|2350059_2350632_-\|DNA-starvation/stationary-phase-protection-protein	unknown	unknown	gnl\|CDD\|153102
NC_016052.1\|WP_002307505.1\|2354721_2355375_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|182331
NC_016052.1\|WP_050989786.1\|2339241_2339943_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NC_016052.1\|WP_041591855.1\|2349167_2349785_-\|Crp/Fnr-family-transcriptional-regulator	gnl\|CDD\|223736	COG0664, Crp, cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms].	1.25672e-40
NC_016052.1\|WP_014125715.1\|2353960_2354725_-\|iron-export-ABC-transporter-permease-subunit-FetB	gnl\|CDD\|377092	pfam03649, UPF0014, Uncharacterized protein family (UPF0014).	1.11693e-83
NC_016052.1\|WP_002307628.1\|2344266_2344818_-\|tyrosine-type-recombinase/integrase	gnl\|CDD\|271192	cd01192, INT_C_like_3, Uncharacterized site-specific tyrosine recombinase, C-terminal catalytic domain. Tyrosine recombinase (integrase) belongs to a DNA breaking-rejoining enzyme superfamily. The catalytic domain contains six conserved active site residues. The recombination reaction involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA. Many DNA breaking-rejoining enzymes also have N-terminal domains, which show little sequence or structure similarity.	3.31368e-50
NC_016052.1\|WP_014125704.1\|2340386_2340764_-\|pyridoxamine-5'-phosphate-oxidase-family-protein	gnl\|CDD\|334450	pfam01243, Putative_PNPOx, Pyridoxamine 5'-phosphate oxidase. Family of domains with putative PNPOx function. Family members were predicted to encode pyridoxamine 5'-phosphate oxidase, based on sequence similarity. However, there is no experimental data to validate the predicted activity and purified proteins, such as yeast YLR456W and its paralogs, do not possess this activity, nor do they bind to flavin mononucleotide (FMN). To date, the only time functional oxidase activity has been experimentally demonstrated is when the sequences contain both pfam01243 and pfam10590. Moreover, some of the family members that contain both domains have been shown to be involved in phenazine biosynthesis. While some molecular function has been experimentally validated for the proteins containing both domains, the role performed by each domain on its own is unknown.	1.19844e-05
NC_016052.1\|WP_002318453.1\|2353772_2353886_-\|hypothetical-protein	gnl\|CDD\|239737	cd03768, SR_ResInv, Serine Recombinase (SR) family, Resolvase and Invertase subfamily, catalytic domain; members contain a C-terminal DNA binding domain. Serine recombinases catalyze site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and the enzyme. They are functionally versatile and include resolvases, invertases, integrases, and transposases. Resolvases and invertases affect resolution or inversion and comprise a major phylogenic group. Resolvases (e.g. Tn3, gamma-delta, and Tn5044) normally recombine two sites in direct repeat causing deletion of the DNA between the sites. Invertases (e.g. Gin and Hin) recombine sites in inverted repeat to invert the DNA between the sites. Cointegrate resolution with gamma-delta resolvase requires the formation of a synaptosome of three resolvase dimers bound to each of two res sites on the DNA. Also included in this subfamily are some putative integrases including a sequence from bacteriophage phi-FC1.	0.000222619
NC_016052.1\|WP_014125700.1\|2336498_2338193_+\|oleate-hydratase	gnl\|CDD\|237575	PRK13977, PRK13977, myosin-cross-reactive antigen; Provisional.	0
NC_016052.1\|WP_014125701.1\|2338427_2339108_-\|IS6-like-element-ISTeha2-family-transposase	gnl\|CDD\|225853	COG3316, COG3316, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	3.54272e-90
NC_016052.1\|WP_003125439.1\|2347381_2347615_-\|heavy-metal-associated-domain-containing-protein	gnl\|CDD\|225328	COG2608, CopZ, Copper chaperone [Inorganic ion transport and metabolism].	3.66086e-10
NC_016052.1\|WP_014125693.1\|2331175_2331841_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|369777	pfam08241, Methyltransf_11, Methyltransferase domain. Members of this family are SAM dependent methyltransferases.	1.27899e-07
NC_016052.1\|WP_014125716.1\|2355459_2355882_-\|cupin-domain-containing-protein	gnl\|CDD\|380352	cd02223, cupin_Bh2720-like, Bacillus halodurans Bh2720 and related proteins, cupin domain. This family includes bacterial, archaeal, and eukaryotic proteins similar to Bh2720, a Bacillus halodurans protein of unknown function with a cupin beta-barrel fold.	5.76388e-50
NC_016052.1\|WP_002331383.1\|2333727_2334408_+\|IS6-like-element-IS1216-family-transposase	gnl\|CDD\|225853	COG3316, COG3316, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	6.39712e-92
NC_016052.1\|WP_014125694.1\|2332030_2333359_-\|IS4-family-transposase	gnl\|CDD\|376573	pfam01609, DDE_Tnp_1, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction. This family contains transposases for IS4, IS421, IS5377, IS427, IS402, IS1355, IS5, which was original isolated in bacteriophage lambda.	2.77957e-10
NC_016052.1\|WP_014125706.1\|2345157_2347062_-\|heavy-metal-translocating-P-type-ATPase	gnl\|CDD\|319774	cd02079, P-type_ATPase_HM, P-type heavy metal-transporting ATPase. Heavy metal-transporting ATPases (Type IB ATPases) transport heavy metal ions (Cu(+), Cu(2+), Zn(2+), Cd(2+), Co(2+), etc.) across biological membranes. These ATPases include mammalian copper-transporting ATPases, ATP7A and ATP7B, Bacillus subtilis CadA which transports cadmium, zinc and cobalt out of the cell, Bacillus subtilis ZosA/PfeT which transports copper, and perhaps also zinc and ferrous iron, Archaeoglobus fulgidus CopA and CopB, Staphylococcus aureus plasmid pI258 CadA, a cadmium-efflux ATPase, and Escherichia coli ZntA which is selective for Pb(2+), Zn(2+), and Cd(2+). The characteristic N-terminal heavy metal associated (HMA) domain of this group is essential for the binding of metal ions. This family belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.	0
NC_016052.1\|WP_014124169.1\|2342201_2343500_-\|group-II-intron-reverse-transcriptase/maturase	gnl\|CDD\|275209	TIGR04416, hypothetical_protein, group II intron reverse transcriptase/maturase. Members of this protein family are multifunctional proteins encoded in most examples of bacterial group II introns. These group II introns are mobile selfish genetic elements, often with multiple highly identical copies per genome. Member proteins have an N-terminal reverse transcriptase (RNA-directed DNA polymerase) domain (pfam00078) followed by an RNA-binding maturase domain (pfam08388). Some members of this family may have an additional C-terminal DNA endonuclease domain that this model does not cover. A region of the group II intron ribozyme structure should be detectable nearby on the genome by Rfam model RF00029. [Mobile and extrachromosomal element functions, Other].	2.33449e-173
NC_016052.1\|WP_014125711.1\|2350059_2350632_-\|DNA-starvation/stationary-phase-protection-protein	gnl\|CDD\|153102	cd01043, DPS, DPS protein, ferritin-like diiron-binding domain. DPS (DNA Protecting protein under Starved conditions) domain is a member of a broad superfamily of ferritin-like diiron-carboxylate proteins. Some DPS proteins nonspecifically bind DNA, protecting it from cleavage caused by reactive oxygen species such as the hydroxyl radicals produced during oxidation of Fe(II) by hydrogen peroxide. These proteins assemble into dodecameric structures, some form DPS-DNA co-crystalline complexes, and possess iron and H2O2 detoxification capabilities. Expression of DPS is induced by oxidative or nutritional stress, including metal ion starvation. Members of the DPS family are homopolymers formed by 12 four-helix bundle subunits that assemble with 23 symmetry into a hollow shell. The DPS ferroxidase site is unusual in that it is not located in a four-helix bundle as in ferritin, but is shared by 2-fold symmetry-related subunits providing the iron ligands. Many DPS sequences (e.g., E. coli) display an N-terminal extension of variable length that contains two or three positively charged lysine residues that extends into the solvent and is thought to play an important role in the stabilization of the complex with DNA. DPS Listeria Flp, Bacillus anthracis Dlp-1 and Dlp-2, and Helicobacter pylori HP-NAP which lack the N-terminal extension, do not bind DNA. DPS proteins from Helicobacter pylori, Treponema pallidum, and Borrelia burgdorferi are highly immunogenic.	5.34601e-44
NC_016052.1\|WP_002307505.1\|2354721_2355375_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|182331	PRK10247, PRK10247, putative ABC transporter ATP-binding protein YbbL; Provisional.	6.39443e-82

>NC_016052.1|WP_014124169.1|2342201_2343500_-|group-II-intron-reverse-transcriptase/maturase
MRFIEKITSQQNMRQAIEQVKKNKGAPGVDKMTVDELDHYFYQHGHSLVQEIRSMTYRPKTVKRVYIPKPDGKQRPLGIPSVVDRVVQQATAQQLSRIFDVHFSESSYGFRPNRSAHQAIEKVLDYLNEGYEWLIDMDIEKYFDTVHHDKLISTLRERVKDRETLHLIRVFLKAGIMENGFVRPNETGVPQGGPLSPILANIYLDKLDKELEARGLYFVRYADDTDIFVKSERAANRVMKSITSWIERKLFLRVNVTKTKVVRPTQSQFLGFTFWKNQKGWQCKPSKVSKTKLYDKTKAILKRKQAVSRPLAVTFTKLNQTIRGWINYYRIGNMKTYLAKFGQWLRHKVRVIIIKQWKLPQRIYTNLQQLNRLFKCHFTKENIYKVANSRLGWYRKCGMDVVNFTLSPKVLAIKKKDRPGLVNPLNYYLNQA
>NC_016052.1|WP_014125704.1|2340386_2340764_-|pyridoxamine-5'-phosphate-oxidase-family-protein
MLSENFFKVIQHEGVVSVTSWGSSETPHVRCTWNSYLRITNDERILAPIAGFTSVQADMIKNDKVILTLGSREVEGFNGYQGTGFLIEGRARFLDTGEEFDQMKEDYPFMNKLLEVTVESQKQLL
>NC_016052.1|WP_050989786.1|2339241_2339943_+|hypothetical-protein
MEETKMKKNFKKLLGVTAVGAGLFLANPLTAEAHCDTEQGPVYDALQTSLEERSFDYIAHWVPEADEAELKTYFERTMSVKNKTKDAEINDLADDYLFENFVRIHRTSEGAPYTGISHEPVDPGVAAADESIEQESLAPLEEAGFVTDDNREHVEEVFTDLLETKIFETGDTEAGRAYVENYVTFTHLFEEGHDEAHEEEGHKEEQDAHTEEVNAESEETEGNWFTQLFSDWF
>NC_016052.1|WP_014125701.1|2338427_2339108_-|IS6-like-element-ISTeha2-family-transposase
MNHFKGKQFQKDVIIISVGYYLRYNLSYRDVQEMLYDRGINVSHTTIYRWVQEYGKLIYQIWKKKNRQSFYSWKMDETYIKIKGKWHYLYRAIDSEGMTLDIWLRRKRNTQSAYAFFKRLYKQFGEPKVIVTDKAPSIASAFRKLQKQGLYSETEHRTVKYLNNLIEQDHRPVKRRSKLYQSLRTASTTIKGIEALRGIYKKNRRNGTLFGFSVSTEIKVLMGIPA
>NC_016052.1|WP_014125700.1|2336498_2338193_+|oleate-hydratase
MQKKKAIMIGAGLSNMAAAVYLIQEGKWQGDQITFYSLDDHGSNDGAPTGDVTDEYWNKNHPMENQKGYVARGGRMLNYRTYVDLMDLLDRIPSATEPNMTAAEDTRDFDAKHRTFDKARLLEGGKGIIDGGHLGLNNKSRMLLTQMIMMSDSDEEKLDNVTIAEYFKEDPAFFESNFWYMWETTFAFRTRSSAQELRRYMHQMIYEFTQIEHLVGVNRTRYNQYESIMLPLINYLKEQGCHIVLDRLVTDWSFKDTTMQDKITVTGLHMLNVTTNQEEYVAVDDDTAVIFTNGSITDSATLGDLDTPAAENMDYGAASSLWKKAAEQFYNLGTPDKFFADRDASEWVSFTLTTKDHLLLNEITRITTQEPGNALNSFISTTPISPLHQKDVNMSIVVHHQPHFTSQKPNETVIWGYFLYPRRVGEFVTKPYIEMTGKEMVQELIGQLSKVDPGPGNIRDKEALIMDSVINNIPVYMPYASALFNNRAKSDRPKVIPAHSTNLAFTGEFVEQPYQMIFTEQSAVRSGEIAAFHFAGIPMSRLVPTPRYDKDLKTLARAAKKMFA
>NC_016052.1|WP_014125699.1|2336324_2336459_+|hypothetical-protein
MKKKMILSSIGLGIAAAGAGYLAKKTGFFEDDAWLYDEYDSTLN
>NC_016052.1|WP_014125697.1|2334567_2335410_-|hypothetical-protein
MTKKALRKVRLKIRNPRIAGDPKEEYLWYYDKGQTKNHVTIPVSQIKGVSRLSGYSWFELLNYSVLGVPPDIPLQSFNLNKIKFLNLLLLLETKDTRTVKQAYQKKDDITFHCYVKGDAKEYYGSEGNHRTITAKIYGWDVLKAQSVDYHVFNEQKYHELQLYKKQKAKIKALIAPLNLSIDNDDMIIFKFRECYKQINLSFEDLKRECDSASELNQTMNFIKESLQRVTSLVNFYRFLYQRYPQKLKKASYFLLEHSDPKKRQHCEKQLAKLIALKSVW
>NC_016052.1|WP_002331383.1|2333727_2334408_+|IS6-like-element-IS1216-family-transposase
MSHFKGKQFQQDVIIVAVGYYLRYNLSYREVQEILYDRGINVSHTTIYRWVQEYGKLLYQIWKKKNKKSFYSWKMDETYIKIKGKWHYLYRAIDADGLTLDIWLRKKRDTQAAYAFLKRLVKQFDEPKVVVTDKAPSITSAFKKLKEYGFYQGTEHRTIKYLNNLIEQDHRPVKRRNKFYRSLRTASTTIKGMEAIRGLYKKTRKEGTLFGFSVCTEIKVLLGIPA
>NC_016052.1|WP_014125694.1|2332030_2333359_-|IS4-family-transposase
MRATLLEFQDYVQEAQSIYLEDIREGNPQAFTRRRKITPYQLMLQMFAQKGRTQFSELLNFYRELETPLDISTVGFYKARMNYNPKAIQLMMKDYLSMIYENRASSLVKFNGYILTAIDGSTLTLPSSSENMEKYGVTNDALENSPVMARVSVLYDCINKLVIDTCVGAYASSERTFAAKHIDELKEMMRYPTITTFDRGYFSMRLVDQLIENKQKFVLRMDKRNLKRYSQQLSSGEDQMFDMTFDRKQTNYYRKDQRFRTKLMNTSYRLRFVKIPILRKDTNEWYNEVLLTNLTQEECSLEGLREIYRLRWEIETVYNVLKNRMKLEEFSGFRERLIFQDIYCCVWLYNLTMLHIMEVNESKAIPQERYKYEMKRNISISIGIIKTYFIQSIMGETYEKREESIIQMENLLTAYLVPFRPDRKARRQESKNKSRRSYRYTY
>NC_016052.1|WP_014125693.1|2331175_2331841_-|class-I-SAM-dependent-methyltransferase
MDTLPWDYLEIVRQYLKETDQLLDMGTGGGEVLLTLEHPGHKTSVTEGYLPNYQLCKEKLEPLGITVKFVKEDDVLSYKENTFDIIINRHEAFRLDEVYRTLKRGGIFITQQVGCENSRVLSKRLLKKELKVDLRNQLSYQLKQAEKIGFEVLNSDEFYAQLKFFDAGAIAYYASIIEWEFPDFSVEKCLEGLTELHYEIVKKGFVPSIEHRYMMVLGKSR
>NC_016052.1|WP_002307628.1|2344266_2344818_-|tyrosine-type-recombinase/integrase
MGYNVQPLRSQQEINDFLFCLRRNKNAERDVFLFLIGINSGLRMSDIVKLKKKDVITSKNPRIVEQKTGKTRILYLSSLQDLIHGYTAPLDPEAYLFPSTKGGHLEVNTVYQMFQKVAKLLGRDDIGTHTLRKTFGYHYYKKTKDVATLMEIFGHSSEKITKRYIGINEDEISETLLNFRLGF
>NC_016052.1|WP_014125706.1|2345157_2347062_-|heavy-metal-translocating-P-type-ATPase
MQQYILSKKNVITVISGLLIALGFFSHFVLENVGLSEWSLIIASVFGITPIAIQAFQAMKVKVISIDVLVSIAAIGALFIQNYEESAIVTFLFLFGHYLEQRTLNQTRSAIKELTEMAPESALKQMDNGEFEEVEVDDVDEGDILLVKTGAKVPVDGTVLTGEGHINEASITGEAVPVNKLADAEVFAGTILENGTIQIRADRVGEDTTFGKIIELVEEAQDSKSEAERFIDRFSKYYTPAVLVLAIVVWAFSQNIELAITILVLGCPGALVIGVPVSNVAGIGNGARNGVLLKGSEVIQDFSNVDTIVFDKTGTLTVGNPTVAATELYEKDSAETLGYLASVERESDHPLAKAVLNQIGETNFYPVEGTEVVKGGGIVSSVAGHRVAVGNVALMEKENVTLSKKVQRDVKRFEQQGNSLVLTAVDGELKVLMGIRDQVRPGVKANLQELKDLGVKNLVVLSGDNQGTVDVVAGELGLTEAHGHMLPEDKSAYIGKLQQRGQIVAFVGDGVNDSPSLALADIGIAMGSGTDVAIETSDVVLMNSNFSNLPHALGLVKATANNMKQNIAISIGVVLVLLTSVFFSEWMNMSIGMLVHEGSILVVIFNGMRLMKYKLKGRKEQKEVSAPAEKVKIS
>NC_016052.1|WP_003125439.1|2347381_2347615_-|heavy-metal-associated-domain-containing-protein
MEKAILQLETLSCPSCMQKIEGALKSVNGIDKDSIKVLFNSSKVKTNFDSAVTSIEEIQKAIENVGYPVLKAKVKAA
>NC_016052.1|WP_041591854.1|2348642_2348939_-|hypothetical-protein
MHCFWVIVAITLSAAGAFFVVPFTKNTIGGEAKTSNVVEADRLAMEKEEEVVKGAGVIGHGKVAYYEASDQGDKSVFTVWFPWSLAGILFSITMTRMT
>NC_016052.1|WP_041591855.1|2349167_2349785_-|Crp/Fnr-family-transcriptional-regulator
MDRIAGKAHTKHYQKGEFLFRSQEKDDALYIVNRGKVRIYRLSNSGKEQLVRILNPGDFTGEWTLFNPDAVHEEYAEATRDTSVCMIQQHDVQEFLKEYHAISLKLLGEMSQRLESSGRQTAQVAVESVITRLVLFLAENVEPEMGNSPTITLPMAKKDIASYLGTTPETISRQFGELEDEGLIQQLSGKRIKIQDLDDLLLYSE
>NC_016052.1|WP_014125711.1|2350059_2350632_-|DNA-starvation/stationary-phase-protection-protein
MTENKASQERTPQERLQEEQEHKEHVHHTKINAAAISDHLLGNMHTLHVKLHQYHWYVNGANFFTLHEKFEELYNQNEEWFDKLAERLIISGHKPASTTAEFEKYSMLSEDAINKYAKAEDMVENIIEDFRSTRELTIRAIRLVQDEGDDALEDTLIAFKNDLDKNIWMLQAFIGKEALEDDDAFDEDED
>NC_016052.1|WP_002318453.1|2353772_2353886_-|hypothetical-protein
MQKELHFLRKKDIFVIESLERLGRNYDEIFYIVQQLD
>NC_016052.1|WP_014125715.1|2353960_2354725_-|iron-export-ABC-transporter-permease-subunit-FetB
MTNNLEISNLSLLLSSVLLIVALLIDYKEKLGLGNDIFIAGIRAVVQLFLIGYVLSYVLRVDNNFLTLAMVLFIVFNASYNAHTRSEGINRSFKISTTAIGVGTALSLLILVFSGVIDWTPSQIVPITGMIASNAMTAIGVTYRSLNSKFTDQRQQVLEKLALGANKKQASMSIVRESVKTGMAPSIDRTKTVGLVSLPGMMSGFIFAGIDPVQAIRYQIVVMFMLISVTAISSFIASYMAYREFYNNRSQLII
>NC_016052.1|WP_002307505.1|2354721_2355375_-|ATP-binding-cassette-domain-containing-protein
MSDSLFQLEKVGFQANGNQILQDISFTVNKGEVIVFSGPSGSGKSTLLKLIGTLLSPTSGKIYYRGTDLQKIDPVEYRKEVSYFFQNASLFDETVQENLSFPARIREEGFDRERAKKLLERVQIPETYLSKEVKELSGGEKQRVALVRNLMYQPKVLLLDEVTSSLDQENRAIVLDLVRDMMKDQQTTVLAVTHNQEEIDQASRLITIKGGKMEESK
>NC_016052.1|WP_014125716.1|2355459_2355882_-|cupin-domain-containing-protein
MEIDYKDYGKKPYIINIEDATTGNDNYRTTIWTGSKLQVTVMSIQPGDDIGLEVHEGIDQFIRIEEGEGVCKMGPSKDNLHVQQKVMDDDAVFVPADMWHNIENTGDKPLRLYTIYAGPDHLEGTVHPTHEDAKNDPNEH

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_016052_1	1.1\|2344084\|30\|NC_016052\|CRISPRCasFinder	2344084-2344113	30	NZ_CP012367	Enterococcus durans strain KLDS 6.0933 plasmid unnamed 1, complete sequence	146688-146717	1	0.967
NC_016052_1	1.1\|2344084\|30\|NC_016052\|CRISPRCasFinder	2344084-2344113	30	NZ_LR135298	Enterococcus faecium isolate E7429 plasmid 2	167432-167461	1	0.967
NC_016052_1	1.1\|2344084\|30\|NC_016052\|CRISPRCasFinder	2344084-2344113	30	MT074686	Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence	186275-186304	1	0.967
NC_016052_1	1.1\|2344084\|30\|NC_016052\|CRISPRCasFinder	2344084-2344113	30	NZ_LR135279	Enterococcus faecium isolate E6975 plasmid 2	103672-103701	1	0.967
NC_016052_1	1.1\|2344084\|30\|NC_016052\|CRISPRCasFinder	2344084-2344113	30	NZ_LR135198	Enterococcus faecium isolate E6055 plasmid 2	171068-171097	1	0.967
NC_016052_1	1.1\|2344084\|30\|NC_016052\|CRISPRCasFinder	2344084-2344113	30	NZ_LR135182	Enterococcus faecium isolate E1774 plasmid 2	142467-142496	1	0.967
NC_016052_1	1.1\|2344084\|30\|NC_016052\|CRISPRCasFinder	2344084-2344113	30	NZ_AP022823	Enterococcus saigonensis strain VE80 plasmid pVE80-1, complete sequence	53066-53095	1	0.967
NC_016052_1	1.1\|2344084\|30\|NC_016052\|CRISPRCasFinder	2344084-2344113	30	NZ_LR135489	Enterococcus faecium isolate E8414 plasmid 2	177222-177251	1	0.967
NC_016052_1	1.1\|2344084\|30\|NC_016052\|CRISPRCasFinder	2344084-2344113	30	NZ_LR135365	Enterococcus faecium isolate E8195 plasmid 2	154418-154447	1	0.967
NC_016052_1	1.1\|2344084\|30\|NC_016052\|CRISPRCasFinder	2344084-2344113	30	NZ_LR135415	Enterococcus faecium isolate E8328 plasmid 2	187358-187387	1	0.967
NC_016052_1	1.1\|2344084\|30\|NC_016052\|CRISPRCasFinder	2344084-2344113	30	NZ_LR135395	Enterococcus faecium isolate E8290 plasmid 2	187358-187387	1	0.967
NC_016052_1	1.1\|2344084\|30\|NC_016052\|CRISPRCasFinder	2344084-2344113	30	NZ_LR135345	Enterococcus faecium isolate E8202 plasmid 2	136380-136409	1	0.967
NC_016052_1	1.1\|2344084\|30\|NC_016052\|CRISPRCasFinder	2344084-2344113	30	NZ_LR135409	Enterococcus faecium isolate E8284 plasmid 2	187358-187387	1	0.967
NC_016052_1	1.1\|2344084\|30\|NC_016052\|CRISPRCasFinder	2344084-2344113	30	NZ_LR135385	Enterococcus faecium isolate E7933 plasmid 2	185811-185840	1	0.967
NC_016052_1	1.1\|2344084\|30\|NC_016052\|CRISPRCasFinder	2344084-2344113	30	NZ_CP040704	Enterococcus faecium strain HOU503 plasmid p1, complete sequence	15466-15495	1	0.967
NC_016052_1	1.1\|2344084\|30\|NC_016052\|CRISPRCasFinder	2344084-2344113	30	NZ_CP044275	Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence	148562-148591	1	0.967
NC_016052_1	1.1\|2344084\|30\|NC_016052\|CRISPRCasFinder	2344084-2344113	30	NZ_CP018066	Enterococcus faecium strain E1 plasmid pE1_230, complete sequence	126403-126432	1	0.967
NC_016052_1	1.1\|2344084\|30\|NC_016052\|CRISPRCasFinder	2344084-2344113	30	NZ_AP019409	Enterococcus faecium strain SMVRE20 plasmid pSMVRE20L, complete sequence	129788-129817	1	0.967
NC_016052_1	1.1\|2344084\|30\|NC_016052\|CRISPRCasFinder	2344084-2344113	30	NC_020208	Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence	33035-33064	1	0.967
NC_016052_1	1.1\|2344084\|30\|NC_016052\|CRISPRCasFinder	2344084-2344113	30	NZ_MG674581	Enterococcus faecium strain HL1 plasmid pHLSA, complete sequence	114361-114390	1	0.967
NC_016052_1	1.1\|2344084\|30\|NC_016052\|CRISPRCasFinder	2344084-2344113	30	NZ_CP012385	Enterococcus durans strain KLDS 6.0930 plasmid unnamed 1, complete sequence	115076-115105	1	0.967
NC_016052_1	1.1\|2344084\|30\|NC_016052\|CRISPRCasFinder	2344084-2344113	30	NZ_LR135340	Enterococcus faecium isolate E7356 plasmid 2	61597-61626	1	0.967

1. spacer 1.1|2344084|30|NC_016052|CRISPRCasFinder matches to NZ_CP012367 (Enterococcus durans strain KLDS 6.0933 plasmid unnamed 1, complete sequence) position: , mismatch: 1, identity: 0.967

agatttgtatcgagtttagttttggtgctc	CRISPR spacer
ggatttgtatcgagtttagttttggtgctc	Protospacer
.*****************************

2. spacer 1.1|2344084|30|NC_016052|CRISPRCasFinder matches to NZ_LR135298 (Enterococcus faecium isolate E7429 plasmid 2) position: , mismatch: 1, identity: 0.967

agatttgtatcgagtttagttttggtgctc	CRISPR spacer
ggatttgtatcgagtttagttttggtgctc	Protospacer
.*****************************

3. spacer 1.1|2344084|30|NC_016052|CRISPRCasFinder matches to MT074686 (Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence) position: , mismatch: 1, identity: 0.967

agatttgtatcgagtttagttttggtgctc	CRISPR spacer
ggatttgtatcgagtttagttttggtgctc	Protospacer
.*****************************

4. spacer 1.1|2344084|30|NC_016052|CRISPRCasFinder matches to NZ_LR135279 (Enterococcus faecium isolate E6975 plasmid 2) position: , mismatch: 1, identity: 0.967

agatttgtatcgagtttagttttggtgctc	CRISPR spacer
ggatttgtatcgagtttagttttggtgctc	Protospacer
.*****************************

5. spacer 1.1|2344084|30|NC_016052|CRISPRCasFinder matches to NZ_LR135198 (Enterococcus faecium isolate E6055 plasmid 2) position: , mismatch: 1, identity: 0.967

agatttgtatcgagtttagttttggtgctc	CRISPR spacer
ggatttgtatcgagtttagttttggtgctc	Protospacer
.*****************************

6. spacer 1.1|2344084|30|NC_016052|CRISPRCasFinder matches to NZ_LR135182 (Enterococcus faecium isolate E1774 plasmid 2) position: , mismatch: 1, identity: 0.967

agatttgtatcgagtttagttttggtgctc	CRISPR spacer
ggatttgtatcgagtttagttttggtgctc	Protospacer
.*****************************

7. spacer 1.1|2344084|30|NC_016052|CRISPRCasFinder matches to NZ_AP022823 (Enterococcus saigonensis strain VE80 plasmid pVE80-1, complete sequence) position: , mismatch: 1, identity: 0.967

agatttgtatcgagtttagttttggtgctc	CRISPR spacer
ggatttgtatcgagtttagttttggtgctc	Protospacer
.*****************************

8. spacer 1.1|2344084|30|NC_016052|CRISPRCasFinder matches to NZ_LR135489 (Enterococcus faecium isolate E8414 plasmid 2) position: , mismatch: 1, identity: 0.967

agatttgtatcgagtttagttttggtgctc	CRISPR spacer
ggatttgtatcgagtttagttttggtgctc	Protospacer
.*****************************

9. spacer 1.1|2344084|30|NC_016052|CRISPRCasFinder matches to NZ_LR135365 (Enterococcus faecium isolate E8195 plasmid 2) position: , mismatch: 1, identity: 0.967

agatttgtatcgagtttagttttggtgctc	CRISPR spacer
ggatttgtatcgagtttagttttggtgctc	Protospacer
.*****************************

10. spacer 1.1|2344084|30|NC_016052|CRISPRCasFinder matches to NZ_LR135415 (Enterococcus faecium isolate E8328 plasmid 2) position: , mismatch: 1, identity: 0.967

agatttgtatcgagtttagttttggtgctc	CRISPR spacer
ggatttgtatcgagtttagttttggtgctc	Protospacer
.*****************************

11. spacer 1.1|2344084|30|NC_016052|CRISPRCasFinder matches to NZ_LR135395 (Enterococcus faecium isolate E8290 plasmid 2) position: , mismatch: 1, identity: 0.967

agatttgtatcgagtttagttttggtgctc	CRISPR spacer
ggatttgtatcgagtttagttttggtgctc	Protospacer
.*****************************

12. spacer 1.1|2344084|30|NC_016052|CRISPRCasFinder matches to NZ_LR135345 (Enterococcus faecium isolate E8202 plasmid 2) position: , mismatch: 1, identity: 0.967

agatttgtatcgagtttagttttggtgctc	CRISPR spacer
ggatttgtatcgagtttagttttggtgctc	Protospacer
.*****************************

13. spacer 1.1|2344084|30|NC_016052|CRISPRCasFinder matches to NZ_LR135409 (Enterococcus faecium isolate E8284 plasmid 2) position: , mismatch: 1, identity: 0.967

agatttgtatcgagtttagttttggtgctc	CRISPR spacer
ggatttgtatcgagtttagttttggtgctc	Protospacer
.*****************************

14. spacer 1.1|2344084|30|NC_016052|CRISPRCasFinder matches to NZ_LR135385 (Enterococcus faecium isolate E7933 plasmid 2) position: , mismatch: 1, identity: 0.967

agatttgtatcgagtttagttttggtgctc	CRISPR spacer
ggatttgtatcgagtttagttttggtgctc	Protospacer
.*****************************

15. spacer 1.1|2344084|30|NC_016052|CRISPRCasFinder matches to NZ_CP040704 (Enterococcus faecium strain HOU503 plasmid p1, complete sequence) position: , mismatch: 1, identity: 0.967

agatttgtatcgagtttagttttggtgctc	CRISPR spacer
ggatttgtatcgagtttagttttggtgctc	Protospacer
.*****************************

16. spacer 1.1|2344084|30|NC_016052|CRISPRCasFinder matches to NZ_CP044275 (Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence) position: , mismatch: 1, identity: 0.967

agatttgtatcgagtttagttttggtgctc	CRISPR spacer
ggatttgtatcgagtttagttttggtgctc	Protospacer
.*****************************

17. spacer 1.1|2344084|30|NC_016052|CRISPRCasFinder matches to NZ_CP018066 (Enterococcus faecium strain E1 plasmid pE1_230, complete sequence) position: , mismatch: 1, identity: 0.967

agatttgtatcgagtttagttttggtgctc	CRISPR spacer
ggatttgtatcgagtttagttttggtgctc	Protospacer
.*****************************

18. spacer 1.1|2344084|30|NC_016052|CRISPRCasFinder matches to NZ_AP019409 (Enterococcus faecium strain SMVRE20 plasmid pSMVRE20L, complete sequence) position: , mismatch: 1, identity: 0.967

agatttgtatcgagtttagttttggtgctc	CRISPR spacer
ggatttgtatcgagtttagttttggtgctc	Protospacer
.*****************************

19. spacer 1.1|2344084|30|NC_016052|CRISPRCasFinder matches to NC_020208 (Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence) position: , mismatch: 1, identity: 0.967

agatttgtatcgagtttagttttggtgctc	CRISPR spacer
ggatttgtatcgagtttagttttggtgctc	Protospacer
.*****************************

20. spacer 1.1|2344084|30|NC_016052|CRISPRCasFinder matches to NZ_MG674581 (Enterococcus faecium strain HL1 plasmid pHLSA, complete sequence) position: , mismatch: 1, identity: 0.967

agatttgtatcgagtttagttttggtgctc	CRISPR spacer
ggatttgtatcgagtttagttttggtgctc	Protospacer
.*****************************

21. spacer 1.1|2344084|30|NC_016052|CRISPRCasFinder matches to NZ_CP012385 (Enterococcus durans strain KLDS 6.0930 plasmid unnamed 1, complete sequence) position: , mismatch: 1, identity: 0.967

agatttgtatcgagtttagttttggtgctc	CRISPR spacer
ggatttgtatcgagtttagttttggtgctc	Protospacer
.*****************************

22. spacer 1.1|2344084|30|NC_016052|CRISPRCasFinder matches to NZ_LR135340 (Enterococcus faecium isolate E7356 plasmid 2) position: , mismatch: 1, identity: 0.967

agatttgtatcgagtttagttttggtgctc	CRISPR spacer
ggatttgtatcgagtttagttttggtgctc	Protospacer
.*****************************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

15806 : 24200

Staphylococcus_phage(28.57%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014123411.1\|15806_17099_+	adenylosuccinate synthase	L7Y4J5	Megavirus	5.2e-68	35.5
WP_014123412.1\|17216_18086_+	DegV family protein	A0A0N9SI50	Staphylococcus_phage	2.5e-13	30.9
WP_014123413.1\|18141_19764_-	ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	4.9e-47	26.2
WP_014123414.1\|19925_20123_-	hypothetical protein	NA	NA	NA	NA
WP_014123415.1\|20303_21551_-	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	3.0e-113	54.8
WP_014123416.1\|21547_22354_-	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	5.4e-39	37.3
WP_050989791.1\|22604_23453_-	aldo/keto reductase	A0A2H4PQR8	Staphylococcus_phage	2.1e-57	45.9
WP_014123418.1\|23699_24200_+	hypothetical protein	J9PV85	Bacillus_phage	5.0e-43	53.5

DBSCAN-SWA_2

120230 : 179301

Streptococcus_phage(71.43%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_050989733.1\|120230_122684_+\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	0.0e+00	68.9
WP_014123505.1\|122842_123259_-	Ohr family peroxiredoxin	NA	NA	NA	NA
WP_014123506.1\|123413_123632_-	hypothetical protein	NA	NA	NA	NA
WP_014123507.1\|123736_125236_-	UDP-N-acetylmuramyl-tripeptide synthetase	NA	NA	NA	NA
WP_014123508.1\|125418_127065_+	polysaccharide biosynthesis protein	NA	NA	NA	NA
WP_014123509.1\|127131_127851_+	rRNA pseudouridine synthase	NA	NA	NA	NA
WP_014123510.1\|127859_128714_-	RluA family pseudouridine synthase	NA	NA	NA	NA
WP_014123511.1\|128891_131051_+	PBP1A family penicillin-binding protein	NA	NA	NA	NA
WP_014123512.1\|131110_131452_+	YlbF family regulator	NA	NA	NA	NA
WP_014123513.1\|131545_132544_-	HesA/MoeB/ThiF family protein	NA	NA	NA	NA
WP_014123514.1\|132642_133122_+	cyclic pyranopterin monophosphate synthase MoaC	NA	NA	NA	NA
WP_014123515.1\|133321_134644_+\|transposase	IS1380 family transposase	A0A1X9I6F6	Streptococcus_phage	1.1e-94	43.0
WP_041591736.1\|135678_137430_+	sigma-54-dependent Fis family transcriptional regulator	NA	NA	NA	NA
WP_014123519.1\|137747_139100_+	dihydrolipoyl dehydrogenase	NA	NA	NA	NA
WP_014123520.1\|139115_140084_+	thiamine pyrophosphate-dependent dehydrogenase E1 component subunit alpha	NA	NA	NA	NA
WP_014123521.1\|140104_141133_+	alpha-ketoacid dehydrogenase subunit beta	NA	NA	NA	NA
WP_014123522.1\|141148_142351_+	2-oxo acid dehydrogenase subunit E2	NA	NA	NA	NA
WP_014123523.1\|142661_143858_-\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	8.3e-60	35.5
WP_103083389.1\|144227_145802_-	YfcC family protein	NA	NA	NA	NA
WP_014123525.1\|145917_146850_-	carbamate kinase	NA	NA	NA	NA
WP_014123526.1\|146867_147866_-	ornithine carbamoyltransferase	NA	NA	NA	NA
WP_014123527.1\|148008_148629_+	hypothetical protein	NA	NA	NA	NA
WP_014123528.1\|148824_150147_-\|transposase	IS1380 family transposase	A0A1X9I6F6	Streptococcus_phage	2.9e-90	41.4
WP_014123529.1\|150309_150987_+	ATP-binding protein	NA	NA	NA	NA
WP_014123530.1\|151001_151841_+	DNA-binding domain-containing protein	NA	NA	NA	NA
WP_014123533.1\|153574_154255_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.2e-108	83.6
WP_014123534.1\|154446_155013_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_014123535.1\|155061_157719_+	MMPL family transporter	NA	NA	NA	NA
WP_002319817.1\|157810_158491_-\|transposase	IS6-like element ISS1N family transposase	A0A1X9I6C6	Streptococcus_phage	2.5e-109	84.1
WP_103083400.1\|158536_158746_+	hypothetical protein	NA	NA	NA	NA
WP_014123537.1\|158768_159965_+	molybdopterin molybdotransferase MoeA	NA	NA	NA	NA
WP_014123538.1\|160105_160669_-	hypothetical protein	NA	NA	NA	NA
WP_014123539.1\|161039_162245_+	DNA repair exonuclease	NA	NA	NA	NA
WP_014123540.1\|162225_164889_+	AAA family ATPase	NA	NA	NA	NA
WP_014123541.1\|164936_165884_+	HD domain-containing protein	NA	NA	NA	NA
WP_014123542.1\|165957_166953_-	peptidyl-prolyl cis-trans isomerase	NA	NA	NA	NA
WP_014123543.1\|167081_167474_-	YtxH domain-containing protein	NA	NA	NA	NA
WP_081497473.1\|167475_167931_-	HIT family protein	D7NW73	Streptomyces_phage	2.8e-08	35.4
WP_014123545.1\|168077_168896_+	VOC family protein	NA	NA	NA	NA
WP_014123546.1\|168948_169944_+	serine hydrolase	NA	NA	NA	NA
WP_014123547.1\|169976_170930_+	mannose-6-phosphate isomerase, class I	NA	NA	NA	NA
WP_014123548.1\|171026_173297_-	glycoside hydrolase family 65 protein	NA	NA	NA	NA
WP_014123549.1\|173414_173879_-	PTS glucose transporter subunit IIA	NA	NA	NA	NA
WP_014123550.1\|173973_174657_-	glutamine amidotransferase	NA	NA	NA	NA
WP_014123551.1\|174649_176002_-	Mur ligase family protein	NA	NA	NA	NA
WP_014123552.1\|176256_177663_-	hypothetical protein	NA	NA	NA	NA
WP_014123553.1\|177882_179301_+\|transposase	ISLre2-like element ISTeha1 family transposase	NA	NA	NA	NA

DBSCAN-SWA_3

414865 : 459987

Streptococcus_phage(14.29%)

transposase,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014123800.1\|414865_415129_+\|transposase	transposase	NA	NA	NA	NA
WP_014123801.1\|415296_416727_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_041591757.1\|417559_418525_+	hypothetical protein	NA	NA	NA	NA
WP_014123804.1\|419504_419738_+	hypothetical protein	NA	NA	NA	NA
WP_014123805.1\|419734_420004_+	type II toxin-antitoxin system RelE/ParE family toxin	A0A1S5S8E8	Streptococcus_phage	6.7e-18	46.5
WP_014123806.1\|420436_420715_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
WP_014123807.1\|421140_421542_-	type II toxin-antitoxin system HicB family antitoxin	A0A0K2CYJ8	Paenibacillus_phage	2.5e-13	37.2
WP_014123808.1\|421580_421772_-	type II toxin-antitoxin system HicA family toxin	NA	NA	NA	NA
WP_014123810.1\|423125_423953_+	hypothetical protein	NA	NA	NA	NA
WP_014123811.1\|424021_424492_-	hypothetical protein	NA	NA	NA	NA
WP_041591758.1\|424804_425038_+	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_014123813.1\|425281_426712_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_014123814.1\|426736_427516_+	Fic family protein	D7RWK9	Brochothrix_phage	1.7e-05	27.3
WP_014123815.1\|427741_428104_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_014123816.1\|428096_428387_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_014123817.1\|428609_428837_+	hypothetical protein	NA	NA	NA	NA
WP_014123818.1\|428860_429073_+	DUF2922 domain-containing protein	NA	NA	NA	NA
WP_014123819.1\|429132_429930_+	glycoside hydrolase family 25	A0A222Z5F8	Bacillus_phage	8.4e-16	26.7
WP_014123820.1\|430372_431548_+	hypothetical protein	NA	NA	NA	NA
WP_014123821.1\|431614_431842_-	hypothetical protein	NA	NA	NA	NA
WP_014123822.1\|431841_432579_-	hypothetical protein	NA	NA	NA	NA
WP_014123824.1\|433585_434062_+	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_014123825.1\|434074_434359_+	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_014123826.1\|434375_435737_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_014123827.1\|435789_436296_+	hypothetical protein	NA	NA	NA	NA
WP_014123828.1\|436297_436942_+	class II aldolase/adducin family protein	NA	NA	NA	NA
WP_081497479.1\|437491_438457_+	sugar-binding protein	NA	NA	NA	NA
WP_014123830.1\|438474_440001_+	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	3.2e-16	29.0
WP_050989798.1\|440050_441166_+	sugar ABC transporter permease	NA	NA	NA	NA
WP_014123832.1\|441519_443133_+	FGGY-family carbohydrate kinase	NA	NA	NA	NA
WP_014123833.1\|443133_443832_+	L-ribulose-5-phosphate 4-epimerase	NA	NA	NA	NA
WP_014123834.1\|443861_445286_+	L-arabinose isomerase	NA	NA	NA	NA
WP_014123835.1\|445362_446730_+	sugar porter family MFS transporter	O13311	Aichi_virus	4.8e-27	28.5
WP_014123836.1\|446872_447916_+	galactose mutarotase	NA	NA	NA	NA
WP_014123837.1\|448084_449167_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_014123838.1\|449377_450484_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_014123839.1\|451348_452101_+	DeoR/GlpR transcriptional regulator	NA	NA	NA	NA
WP_014123840.1\|452174_453584_-	PTS glucitol transporter subunit IIA	NA	NA	NA	NA
WP_014123841.1\|453611_453917_-	PTS fructose transporter subunit IIB	NA	NA	NA	NA
WP_014123842.1\|453909_454413_-	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_014123843.1\|454609_455038_+	galactose-6-phosphate isomerase subunit LacA	NA	NA	NA	NA
WP_014123844.1\|455067_455583_+	galactose-6-phosphate isomerase subunit LacB	NA	NA	NA	NA
WP_014123845.1\|455582_456245_+	HAD family phosphatase	G3MA51	Bacillus_virus	1.0e-11	27.4
WP_014123846.1\|456265_457198_+	tagatose-6-phosphate kinase	NA	NA	NA	NA
WP_014123847.1\|457214_458186_+	tagatose-bisphosphate aldolase	NA	NA	NA	NA
WP_014123848.1\|458488_459595_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_069028690.1\|459885_459987_-\|holin	putative holin-like toxin	NA	NA	NA	NA

DBSCAN-SWA_4

576874 : 585280

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014123956.1\|576874_577648_+	Fe-S cluster assembly ATPase SufC	A0A1V0SE00	Indivirus	1.2e-06	25.1
WP_014123957.1\|577662_578955_+	Fe-S cluster assembly protein SufD	NA	NA	NA	NA
WP_014123958.1\|578951_580187_+	cysteine desulfurase	Q2XUY6	environmental_halophage	4.1e-110	48.1
WP_014123959.1\|580173_580647_+	SUF system NifU family Fe-S cluster assembly protein	A0A2H4N7M4	Lake_Baikal_phage	2.0e-09	29.2
WP_014123960.1\|580757_581462_+	NAD-dependent protein deacylase	S5M4R0	Bacillus_phage	1.4e-22	31.3
WP_014123961.1\|581688_583428_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.3e-42	29.5
WP_014123962.1\|583417_585280_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	3.7e-38	25.9

DBSCAN-SWA_5

595728 : 604015

Lactobacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_041591907.1\|595728_596967_-	NAD(P)H-dependent oxidoreductase	A0A2P0ZL82	Lactobacillus_phage	1.7e-63	62.9
WP_014123975.1\|596984_597593_-	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	3.7e-56	53.3
WP_014123976.1\|597792_598497_-	deoxynucleoside kinase	K4I4F1	Lactobacillus_phage	8.4e-44	40.2
WP_014123977.1\|598839_600309_+	peptide MFS transporter	A0A0P0IY73	Acinetobacter_phage	1.2e-81	40.7
WP_014123978.1\|600536_602249_+	ABC transporter ATP-binding protein	F2Y1V6	Organic_Lake_phycodnavirus	1.8e-07	22.3
WP_103083365.1\|602248_604015_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	5.7e-49	27.1

DBSCAN-SWA_6

842761 : 887345

Lactococcus_phage(15.79%)

tail,terminase,plate,integrase,transposase

attL 841071:841087|attR 867515:867531

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
841071:841087	attL	NA	NA	NA	NA
WP_103083395.1\|842761_843949_-\|integrase	site-specific integrase	A5GYP9	Lactococcus_phage	5.3e-75	43.6
WP_014124218.1\|844102_844501_-	hypothetical protein	NA	NA	NA	NA
WP_014124219.1\|844500_844986_-	hypothetical protein	NA	NA	NA	NA
WP_014124220.1\|845001_845571_-	hypothetical protein	NA	NA	NA	NA
WP_014124221.1\|845610_846081_-	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_014124222.1\|846085_846415_-	helix-turn-helix transcriptional regulator	A8ATJ9	Listeria_phage	2.8e-18	48.0
WP_014124223.1\|846579_846834_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_014124224.1\|846833_846992_+	hypothetical protein	NA	NA	NA	NA
WP_014124225.1\|847055_847574_+	hypothetical protein	NA	NA	NA	NA
WP_014124226.1\|847578_847797_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_014124227.1\|848028_848322_+	hypothetical protein	NA	NA	NA	NA
WP_014124228.1\|848324_849290_+	recombinase RecT	D7RWF9	Brochothrix_phage	4.8e-74	63.6
WP_014124229.1\|849261_850068_+	PD-(D/E)XK nuclease-like domain-containing protein	J7KGZ1	Streptococcus_phage	5.6e-60	50.6
WP_014124230.1\|850080_850812_+	DnaD domain protein	B8R680	Lactobacillus_phage	1.5e-24	56.2
WP_041591778.1\|850824_851631_+	ATP-binding protein	O03914	Lactobacillus_phage	5.2e-66	50.6
WP_014124232.1\|851642_851840_+	hypothetical protein	NA	NA	NA	NA
WP_014124233.1\|851844_852477_+	hypothetical protein	NA	NA	NA	NA
WP_014124234.1\|852515_852866_+	RusA family crossover junction endodeoxyribonuclease	A0A0A7S133	Clostridium_phage	4.9e-21	44.8
WP_014124235.1\|853011_853296_+	hypothetical protein	NA	NA	NA	NA
WP_103083396.1\|853299_853626_+	hypothetical protein	NA	NA	NA	NA
WP_041591779.1\|853625_854117_+	DUF1642 domain-containing protein	NA	NA	NA	NA
WP_014124238.1\|854118_854514_+	hypothetical protein	NA	NA	NA	NA
WP_014124239.1\|854526_854943_+	hypothetical protein	J7KJ21	Streptococcus_phage	6.3e-15	36.3
WP_041591780.1\|855022_855241_+	hypothetical protein	NA	NA	NA	NA
WP_014124242.1\|855385_855589_+	hypothetical protein	NA	NA	NA	NA
WP_014124243.1\|855585_856074_+	hypothetical protein	NA	NA	NA	NA
WP_014124244.1\|856150_856330_+	XtrA/YqaO family protein	NA	NA	NA	NA
WP_014124245.1\|856434_857013_+	hypothetical protein	A0A1L2JY33	Aeribacillus_phage	3.0e-07	31.1
WP_014124246.1\|857486_857726_+	hypothetical protein	NA	NA	NA	NA
WP_014124247.1\|857830_858433_+	hypothetical protein	NA	NA	NA	NA
WP_014124248.1\|858533_858770_-	hypothetical protein	NA	NA	NA	NA
WP_014124249.1\|858885_859470_+	helix-turn-helix domain-containing protein	A5GYP7	Lactococcus_phage	4.5e-43	47.4
WP_014124250.1\|859453_860914_+\|terminase	phage terminase large subunit	A5GYP8	Lactococcus_phage	1.9e-199	72.8
WP_014124251.1\|860910_862395_+	hypothetical protein	NA	NA	NA	NA
WP_050989753.1\|862327_863281_+	hypothetical protein	I6R1H0	Marinomonas_phage	6.9e-17	39.7
WP_014124253.1\|863353_863638_+	hypothetical protein	NA	NA	NA	NA
WP_014124254.1\|863746_864973_+	hypothetical protein	A0A0K2CPM6	Brevibacillus_phage	3.4e-08	26.9
WP_014124255.1\|864992_865385_+	hypothetical protein	NA	NA	NA	NA
WP_014124256.1\|865385_866492_+	hypothetical protein	NA	NA	NA	NA
WP_014124257.1\|866580_867018_+	DUF3199 family protein	NA	NA	NA	NA
WP_014124258.1\|867017_867374_+	hypothetical protein	NA	NA	NA	NA
WP_014124259.1\|867375_867810_+	HK97 gp10 family phage protein	NA	NA	NA	NA
867515:867531	attR	NA	NA	NA	NA
WP_014124260.1\|867816_868167_+	hypothetical protein	NA	NA	NA	NA
WP_014124261.1\|868178_868391_+	hypothetical protein	NA	NA	NA	NA
WP_014124262.1\|868393_869224_+	hypothetical protein	NA	NA	NA	NA
WP_014124263.1\|869287_869863_+	hypothetical protein	NA	NA	NA	NA
WP_014124264.1\|869913_870192_+	hypothetical protein	NA	NA	NA	NA
WP_014124265.1\|870225_876651_+	tape measure protein	A0A060ANI0	Enterococcus_phage	2.2e-37	46.4
WP_014124266.1\|876651_877368_+	hypothetical protein	A0A1B2APY0	Phage_Wrath	2.5e-51	44.7
WP_081497494.1\|877368_878877_+\|tail	phage tail protein	A0A1B2APX2	Phage_Wrath	2.9e-86	40.5
WP_014124268.1\|878869_879427_+	hypothetical protein	NA	NA	NA	NA
WP_014124269.1\|879416_880028_+	hypothetical protein	NA	NA	NA	NA
WP_014124270.1\|880049_880829_+	hypothetical protein	NA	NA	NA	NA
WP_014124271.1\|880828_881044_+	hypothetical protein	NA	NA	NA	NA
WP_014124272.1\|881043_881199_+	hypothetical protein	NA	NA	NA	NA
WP_014124273.1\|881232_882591_+\|plate	BppU family phage baseplate upper protein	A0A0U4JWX9	Bacillus_phage	7.1e-07	40.4
WP_014124274.1\|882687_884049_+\|transposase	transposase	NA	NA	NA	NA
WP_014124275.1\|884159_885404_+	DUF2817 domain-containing protein	A0A0A0RV50	Bacillus_phage	5.9e-08	30.2
WP_014124276.1\|885468_885873_+	hypothetical protein	NA	NA	NA	NA
WP_014123515.1\|886022_887345_+\|transposase	IS1380 family transposase	A0A1X9I6F6	Streptococcus_phage	1.1e-94	43.0

DBSCAN-SWA_7

1587027 : 1661516

Staphylococcus_phage(17.65%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014124941.1\|1587027_1588434_-\|protease	ATP-dependent protease ATPase subunit HslU	A0A173GFL6	Erwinia_phage	5.9e-41	28.6
WP_014124942.1\|1588438_1588984_-	HslU--HslV peptidase proteolytic subunit	NA	NA	NA	NA
WP_050989771.1\|1589015_1589954_-	tyrosine recombinase XerC	A0A0K2CP59	Brevibacillus_phage	4.7e-34	29.1
WP_014124944.1\|1590114_1592193_-	type I DNA topoisomerase	A0A2K9L1Q2	Tupanvirus	8.9e-102	38.5
WP_041591829.1\|1592326_1593205_-	DNA-protecting protein DprA	NA	NA	NA	NA
WP_014124946.1\|1593265_1594033_-	ribonuclease HII	D2TEQ2	Emiliania_huxleyi_virus	7.8e-27	41.0
WP_014124947.1\|1594033_1594882_-	ribosome biogenesis GTPase YlqF	NA	NA	NA	NA
WP_002335628.1\|1596602_1596833_-	hypothetical protein	A0A1X9IGE0	Lactococcus_phage	1.2e-10	43.2
WP_002335627.1\|1597222_1597465_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002335626.1\|1597451_1597880_-	hypothetical protein	NA	NA	NA	NA
WP_014124953.1\|1600523_1601561_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_014124954.1\|1601586_1602525_-	2-dehydropantoate 2-reductase	NA	NA	NA	NA
WP_014124955.1\|1603019_1603565_-	signal peptidase I	NA	NA	NA	NA
WP_014124956.1\|1603590_1605003_-	S41 family peptidase	A0A0R6PIZ1	Moraxella_phage	9.6e-23	29.0
WP_014124957.1\|1605030_1605252_-	YozE family protein	NA	NA	NA	NA
WP_014124958.1\|1605248_1605764_-	peptide-methionine (S)-S-oxide reductase MsrA	NA	NA	NA	NA
WP_014124959.1\|1605774_1606419_-	YpmS family protein	NA	NA	NA	NA
WP_014124960.1\|1606415_1607306_-	SGNH/GDSL hydrolase family protein	NA	NA	NA	NA
WP_014124961.1\|1607535_1608384_-	DegV family protein	A0A0N9SI50	Staphylococcus_phage	1.1e-18	38.3
WP_014124962.1\|1608503_1609571_-	iron-containing alcohol dehydrogenase family protein	NA	NA	NA	NA
WP_014124963.1\|1609803_1610457_+	hemolysin III family protein	NA	NA	NA	NA
WP_014124964.1\|1610538_1610994_+	ASCH domain-containing protein	NA	NA	NA	NA
WP_014124965.1\|1611063_1611552_-	dihydrofolate reductase	A0A1B2IBQ4	Erwinia_phage	6.9e-21	36.5
WP_014124966.1\|1611568_1612516_-	thymidylate synthase	A0A0N9SH48	Staphylococcus_phage	2.1e-119	63.4
WP_014124967.1\|1612535_1614416_-	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	2.2e-51	30.5
WP_014124968.1\|1614626_1616762_-	penicillin-binding protein 2	NA	NA	NA	NA
WP_014124969.1\|1617065_1618355_-	LCP family protein	NA	NA	NA	NA
WP_014124970.1\|1618468_1619278_-	ABC transporter permease	NA	NA	NA	NA
WP_014124971.1\|1619305_1620364_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.2e-14	28.0
WP_014124972.1\|1620765_1621161_-	glycerol-3-phosphate cytidylyltransferase	A0A1V0SGE7	Hokovirus	2.7e-15	37.0
WP_014124973.1\|1621256_1621739_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_014124974.1\|1621832_1622441_-	superoxide dismutase	Q56AR7	Bacillus_thuringiensis_phage	1.1e-68	58.6
WP_103083422.1\|1622982_1623336_-	GtrA family protein	NA	NA	NA	NA
WP_014124977.1\|1623659_1624457_+	DUF1189 domain-containing protein	NA	NA	NA	NA
WP_014124978.1\|1624535_1625489_+	phosphoglycerate dehydrogenase	NA	NA	NA	NA
WP_014124979.1\|1625519_1626461_-	glycosyltransferase family 2 protein	V5USA4	Oenococcus_phage	6.3e-79	50.7
WP_041591830.1\|1626545_1628399_-	sulfatase-like hydrolase/transferase	W6LM83	Streptococcus_phage	1.8e-05	24.3
WP_014124981.1\|1628461_1628755_-	iron-sulfur cluster biosynthesis protein	NA	NA	NA	NA
WP_014124982.1\|1628766_1629432_-	TrkA family potassium uptake protein	NA	NA	NA	NA
WP_014124983.1\|1629443_1630073_-	response regulator transcription factor	NA	NA	NA	NA
WP_014124984.1\|1630069_1631149_-	sensor histidine kinase	NA	NA	NA	NA
WP_014124985.1\|1631145_1631877_-	cell wall-active antibiotics response protein	NA	NA	NA	NA
WP_014124986.1\|1631996_1632479_-	transcription elongation factor GreA	NA	NA	NA	NA
WP_014124987.1\|1632617_1633796_-	endolytic transglycosylase MltG	NA	NA	NA	NA
WP_041591831.1\|1633926_1635420_-	hypothetical protein	NA	NA	NA	NA
WP_014124989.1\|1635501_1637307_-	hypothetical protein	NA	NA	NA	NA
WP_014124990.1\|1637382_1640676_-	CDP-glycerol glycerophosphotransferase family protein	NA	NA	NA	NA
WP_014124991.1\|1640816_1641629_-	acyltransferase	NA	NA	NA	NA
WP_014124992.1\|1642076_1644029_-	CDP-glycerol glycerophosphotransferase family protein	NA	NA	NA	NA
WP_014124993.1\|1644406_1644697_+\|transposase	transposase	NA	NA	NA	NA
WP_041591832.1\|1644693_1644948_+\|transposase	transposase	NA	NA	NA	NA
WP_014124995.1\|1645334_1646522_-	CDP-glycerol glycerophosphotransferase family protein	NA	NA	NA	NA
WP_041591975.1\|1646514_1647231_-	WecB/TagA/CpsF family glycosyltransferase	NA	NA	NA	NA
WP_014124997.1\|1647238_1648393_-	CDP-glycerol glycerophosphotransferase family protein	NA	NA	NA	NA
WP_014124998.1\|1648434_1649922_-	glycosyltransferase	NA	NA	NA	NA
WP_014125001.1\|1652425_1654159_-	hypothetical protein	NA	NA	NA	NA
WP_014125002.1\|1654330_1655437_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_159459087.1\|1655644_1656007_+\|transposase	transposase	A0A1P8CWQ3	Bacillus_phage	4.8e-27	50.8
WP_014125004.1\|1656472_1659844_-	CDP-glycerol glycerophosphotransferase family protein	NA	NA	NA	NA
WP_014125005.1\|1660193_1661516_+\|transposase	IS1380 family transposase	A0A1X9I6F6	Streptococcus_phage	4.4e-94	43.0

DBSCAN-SWA_8

1824070 : 1873199

uncultured_Caudovirales_phage(37.84%)

head,tail,capsid,transposase,holin,plate,protease,portal,integrase,terminase

attL 1820141:1820156|attR 1861258:1861273

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1820141:1820156	attL	NA	NA	NA	NA
WP_014125162.1\|1824070_1824328_-\|holin	phage holin family protein	NA	NA	NA	NA
WP_014125163.1\|1824343_1824682_-	hypothetical protein	NA	NA	NA	NA
WP_014125164.1\|1824742_1824967_-	hypothetical protein	NA	NA	NA	NA
WP_014125165.1\|1824967_1826398_-\|plate	BppU family phage baseplate upper protein	NA	NA	NA	NA
WP_014125166.1\|1826413_1827967_-	putative glycerophosphoryl diester phosphodiesterase	A0A0S2MYI4	Enterococcus_phage	2.2e-76	40.3
WP_014125167.1\|1827973_1829458_-\|tail	phage tail protein	A0A1B2APX2	Phage_Wrath	1.3e-86	43.6
WP_014125168.1\|1829460_1830180_-	hypothetical protein	A0A1B2APY0	Phage_Wrath	3.6e-50	46.0
WP_014125169.1\|1830180_1834578_-	tape measure protein	A0A2H4JBX9	uncultured_Caudovirales_phage	2.0e-215	57.0
WP_014125170.1\|1834790_1835150_-	hypothetical protein	A0A2H4J3M2	uncultured_Caudovirales_phage	4.4e-49	83.3
WP_014125171.1\|1835176_1835686_-	Ig domain-containing protein	A0A1D6Z291	Staphylococcus_phage	1.3e-38	53.8
WP_014125172.1\|1835769_1836363_-\|tail	phage tail protein	A0A2H4JH93	uncultured_Caudovirales_phage	5.5e-81	79.0
WP_014125173.1\|1836364_1836772_-	hypothetical protein	A0A2H4J9Z2	uncultured_Caudovirales_phage	3.4e-58	81.7
WP_014125174.1\|1836774_1837185_-	hypothetical protein	A0A2H4J3L8	uncultured_Caudovirales_phage	4.9e-36	57.4
WP_014125175.1\|1837181_1837511_-\|head,tail	head-tail adaptor protein	A0A2H4JEB0	uncultured_Caudovirales_phage	1.9e-46	80.7
WP_014125176.1\|1837500_1837842_-\|head,tail	phage gp6-like head-tail connector protein	A0A2H4J5J4	uncultured_Caudovirales_phage	1.0e-47	83.2
WP_014125177.1\|1837910_1839170_-\|capsid	phage major capsid protein	A0A0N9S8J3	Staphylococcus_phage	5.9e-133	77.0
WP_014125178.1\|1839202_1839763_-\|head,protease	HK97 family phage prohead protease	A0A2H4JA78	uncultured_Caudovirales_phage	5.2e-73	69.2
WP_014125179.1\|1839762_1840953_-\|portal	phage portal protein	A0A2H4JDG3	uncultured_Caudovirales_phage	4.7e-164	71.9
WP_014125180.1\|1840952_1841144_-	hypothetical protein	H9A112	Staphylococcus_phage	3.1e-09	48.4
WP_014125181.1\|1841156_1842848_-\|terminase	terminase large subunit	A0A2H4JC16	uncultured_Caudovirales_phage	3.2e-251	74.7
WP_014125182.1\|1842840_1843305_-\|terminase	phage terminase small subunit P27 family	A0A2H4J4D1	uncultured_Caudovirales_phage	4.6e-51	68.2
WP_014125183.1\|1843267_1844077_-	HNH endonuclease	A0A2H4PF54	Gordonia_phage	1.1e-12	27.2
WP_041591987.1\|1844224_1844578_-	HNH endonuclease	A0A2H4J4D3	uncultured_Caudovirales_phage	2.1e-48	78.6
WP_014125185.1\|1845249_1845663_-	autolysin	D2IZL7	Enterococcus_phage	7.8e-42	63.0
WP_155982961.1\|1845762_1845936_-	hypothetical protein	NA	NA	NA	NA
WP_041591988.1\|1846030_1846231_-	DUF3310 domain-containing protein	E5DV94	Deep-sea_thermophilic_phage	2.2e-18	68.3
WP_014125187.1\|1846509_1846740_-	hypothetical protein	NA	NA	NA	NA
WP_014125188.1\|1846736_1847051_-	hypothetical protein	NA	NA	NA	NA
WP_014125189.1\|1847047_1847314_-	hypothetical protein	NA	NA	NA	NA
WP_014125190.1\|1847310_1847670_-	hypothetical protein	NA	NA	NA	NA
WP_014125191.1\|1847666_1847825_-	hypothetical protein	NA	NA	NA	NA
WP_014125192.1\|1847821_1848046_-	DUF1774 domain-containing protein	NA	NA	NA	NA
WP_014125193.1\|1848047_1848389_-	hypothetical protein	NA	NA	NA	NA
WP_014125194.1\|1848385_1848661_-	hypothetical protein	NA	NA	NA	NA
WP_014125195.1\|1848662_1848965_-	hypothetical protein	NA	NA	NA	NA
WP_041591843.1\|1848961_1849153_-	hypothetical protein	NA	NA	NA	NA
WP_014125197.1\|1849157_1849697_-	DUF1642 domain-containing protein	NA	NA	NA	NA
WP_014125198.1\|1849689_1849866_-	hypothetical protein	NA	NA	NA	NA
WP_103083404.1\|1849865_1850195_-	hypothetical protein	NA	NA	NA	NA
WP_014125200.1\|1850414_1850951_-	HNH endonuclease	A0A1W6JNF8	Staphylococcus_phage	2.2e-44	53.2
WP_014125201.1\|1850967_1851438_-	single-stranded DNA-binding protein	A0A097PAQ3	Streptococcus_pyogenes_phage	7.3e-44	61.8
WP_014125202.1\|1851450_1851915_-	DUF1064 domain-containing protein	A0A1I9KKZ1	Lactobacillus_phage	1.9e-28	44.8
WP_014125203.1\|1851931_1852117_-	hypothetical protein	NA	NA	NA	NA
WP_014125204.1\|1852113_1853352_-	hypothetical protein	C8CGZ3	Staphylococcus_phage	3.6e-26	26.7
WP_014125205.1\|1853348_1853546_-	hypothetical protein	NA	NA	NA	NA
WP_014125206.1\|1853538_1854297_-	helix-turn-helix domain-containing protein	A0A2H4IYS0	uncultured_Caudovirales_phage	2.8e-21	44.5
WP_014125207.1\|1854300_1854981_-	hypothetical protein	C9E2N1	Enterococcus_phage	3.8e-78	61.3
WP_014125208.1\|1854986_1855670_-	ERF family protein	A0A2I7RVB8	Vibrio_phage	4.3e-37	57.3
WP_014125209.1\|1855683_1856166_-	siphovirus Gp157 family protein	A6M981	Geobacillus_virus	6.1e-30	49.0
WP_014125210.1\|1856165_1856432_-	hypothetical protein	NA	NA	NA	NA
WP_014125211.1\|1856424_1856679_-	hypothetical protein	NA	NA	NA	NA
WP_155982962.1\|1856845_1856995_-	hypothetical protein	NA	NA	NA	NA
WP_014125213.1\|1857039_1857339_-	hypothetical protein	NA	NA	NA	NA
WP_014125214.1\|1857402_1857573_+	hypothetical protein	NA	NA	NA	NA
WP_155982963.1\|1857569_1857713_-	hypothetical protein	NA	NA	NA	NA
WP_014125216.1\|1857730_1857976_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_014125217.1\|1858171_1858870_+	helix-turn-helix transcriptional regulator	A0A097BY95	Leuconostoc_phage	1.6e-50	47.6
WP_014125218.1\|1859011_1859317_+	DUF898 family protein	S5MNN8	Brevibacillus_phage	1.4e-11	64.6
WP_014125219.1\|1859351_1860017_+	Ltp family lipoprotein	A0A097BY93	Leuconostoc_phage	1.4e-08	60.9
WP_014125220.1\|1860120_1861257_+\|integrase	site-specific integrase	A0A1S5S7K9	Streptococcus_phage	5.5e-53	34.9
WP_014125221.1\|1861353_1861668_-	thioredoxin	A0A1J0GW78	Streptomyces_phage	1.2e-15	43.3
1861258:1861273	attR	NA	NA	NA	NA
WP_014125222.1\|1861749_1864128_-	endonuclease MutS2	Q94M10	Lactobacillus_phage	4.5e-25	52.2
WP_014125223.1\|1864212_1864755_-	CvpA family protein	NA	NA	NA	NA
WP_014125224.1\|1864771_1865212_-	cell division protein ZapA	NA	NA	NA	NA
WP_014125225.1\|1865398_1866313_+	ribonuclease HIII	NA	NA	NA	NA
WP_014125226.1\|1866379_1866958_-	chromate transporter	NA	NA	NA	NA
WP_014125227.1\|1866954_1867503_-	chromate transporter	NA	NA	NA	NA
WP_014125228.1\|1867891_1868152_-	YrhK family protein	A0A2H4IYD3	uncultured_Caudovirales_phage	2.2e-05	38.3
WP_050989777.1\|1868348_1869215_-	glycine betaine ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_014125230.1\|1869288_1870146_-	proline/glycine betaine ABC transporter permease	NA	NA	NA	NA
WP_014125231.1\|1870138_1871410_-	glycine betaine/L-proline ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	6.2e-29	36.9
WP_014125232.1\|1872092_1873199_-\|transposase	IS4 family transposase	NA	NA	NA	NA

DBSCAN-SWA_9

2319247 : 2358969

Streptococcus_phage(36.36%)

transposase,integrase

attL 2333654:2333713|attR 2361870:2362678

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014125678.1\|2319247_2320609_-\|transposase	transposase	NA	NA	NA	NA
WP_014125679.1\|2320956_2321265_-	MGMT family protein	NA	NA	NA	NA
WP_014125680.1\|2321440_2321656_-	helix-turn-helix transcriptional regulator	A0A0A7RUJ5	Clostridium_phage	1.3e-08	46.8
WP_014125681.1\|2321754_2322063_+	hypothetical protein	NA	NA	NA	NA
WP_014125682.1\|2322227_2323544_-	branched-chain amino acid transport system II carrier protein	NA	NA	NA	NA
WP_014125683.1\|2323618_2324500_-	serine hydrolase	NA	NA	NA	NA
WP_014123482.1\|2324887_2325244_-	reverse transcriptase	NA	NA	NA	NA
WP_014125684.1\|2325297_2326158_-	group II intron reverse transcriptase/maturase	D4HTV9	Vibrio_phage	1.3e-14	29.8
WP_014125689.1\|2327777_2327945_-	hypothetical protein	NA	NA	NA	NA
WP_050989782.1\|2327960_2328296_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_014125691.1\|2328682_2329696_+	phosphotransferase	NA	NA	NA	NA
WP_014125692.1\|2329768_2331061_+	acyl-CoA thioesterase/BAAT N-terminal domain-containing protein	NA	NA	NA	NA
WP_014125693.1\|2331175_2331841_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_014125694.1\|2332030_2333359_-\|transposase	IS4 family transposase	NA	NA	NA	NA
2333654:2333713	attL	NA	NA	NA	NA
WP_002331383.1\|2333727_2334408_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	5.8e-127	99.1
WP_014125697.1\|2334567_2335410_-	hypothetical protein	NA	NA	NA	NA
WP_014125699.1\|2336324_2336459_+	hypothetical protein	NA	NA	NA	NA
WP_014125700.1\|2336498_2338193_+	oleate hydratase	NA	NA	NA	NA
WP_014125701.1\|2338427_2339108_-\|transposase	IS6-like element ISTeha2 family transposase	A0A1X9I6C6	Streptococcus_phage	2.9e-110	82.7
WP_050989786.1\|2339241_2339943_+	hypothetical protein	NA	NA	NA	NA
WP_014125704.1\|2340386_2340764_-	pyridoxamine 5'-phosphate oxidase family protein	NA	NA	NA	NA
WP_014124169.1\|2342201_2343500_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	6.5e-34	29.0
WP_002307628.1\|2344266_2344818_-\|integrase	tyrosine-type recombinase/integrase	D2XR58	Bacillus_phage	2.9e-31	41.7
WP_014125706.1\|2345157_2347062_-	heavy metal translocating P-type ATPase	E4ZFI9	Streptococcus_phage	1.1e-98	35.0
WP_003125439.1\|2347381_2347615_-	heavy-metal-associated domain-containing protein	NA	NA	NA	NA
WP_041591854.1\|2348642_2348939_-	hypothetical protein	NA	NA	NA	NA
WP_041591855.1\|2349167_2349785_-	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_014125711.1\|2350059_2350632_-	DNA starvation/stationary phase protection protein	A0A0A7RTZ1	Clostridium_phage	2.8e-21	40.4
WP_002318453.1\|2353772_2353886_-	hypothetical protein	NA	NA	NA	NA
WP_014125715.1\|2353960_2354725_-	iron export ABC transporter permease subunit FetB	NA	NA	NA	NA
WP_002307505.1\|2354721_2355375_-	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	3.1e-24	36.4
WP_014125716.1\|2355459_2355882_-	cupin domain-containing protein	Q2I8C5	Bacillus_phage	6.3e-39	59.3
WP_002311028.1\|2356606_2356795_-	hypothetical protein	NA	NA	NA	NA
WP_041591856.1\|2358288_2358969_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	8.4e-126	98.7
2361870:2362678	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage