CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NC_016938	Melissococcus plutonius DAT561 chromosome 1, complete sequence	1 crisprs	cas3,cas5,cas8c,cas7,cas4,cas1,csa3	0	1	3	0
NC_018265	Melissococcus plutonius DAT561 plasmid 1, complete sequence	1 crisprs	NA	0	1	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_016938_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_016938_1

420406-421322

TypeI

Consensus_repeat	Method
GTCTCACTCTTCATAGAGTGAGTGGATTGAAAT	PILER-CR
GTCTCACTCTTCATAGAGTGAGTGGATTGAAAT	CRISPRCasFinder
GTCTCACTCTTCATAGAGTGAGTGGATTGAAAT	CRT

13 spacers

cas1,cas4,cas7,cas8c,cas5,cas3

The CRISPR arrays of NC_016938_1

>merge|NC_016938|1|420406-421322|PILER-CR,CRISPRCasFinder,CRT
GTCTCACTCTTCATAGAGTGAGTGGATTGAAATACTAGTCTATAAGGACGTTTGCTGAAACATGGTGTCTCACTCTTCATAGAGTGAGTGGATTGAAATATTTTCCTTAACTCCTGTGATTGTATCTTTATTAAGTCTCACTCTTCATAGAGTGAGTGGATTGAAATAGTGTTGGTGGTGCTAGAATAAATAAAGATGGAGGTCTCACTCTTCATAGAGTGAGTGGATTGAAATCCTCGTCTAAGGCAGTATCTACTTTAGAGCGTAAGTCTCACTCTTCATAGAGTGAGTGGATTGAAATGATAAATCCATACTCTGAGCGGAAAGCATAAGAAAAGTCTCACTCTTCATAGAGTGAGTGGATTGAAATATGTCATGTGTTAATGTAAAATCACCTGTTTTTGTCTCACTCTTCATAGAGTGAGTGGATTGAAATCGAAAATCAAGGGTCGTTGATTCTACTAACATGGAAGTCTCACTCTTCATAGAGTGAGTGGATTGAAATCCCTGTGTAACCGCATAGGTGTGTTCTACGAAATGGTCTCACTCTTCATAGAGTGAGTGGATTGAAATTGATCCTGTTTGTAAGTCATATTCGTAGACTTTATGGTCTCACTCTTCATAGAGTGAGTGGATTGAAATGTAGTGCTACTAAACTGCGTAAAAATTTTGAGCGTTTGGTCTCACTCTTCATAGAGTGAGTGGATTGAAATACCAAGTATTGAAACAATGTTTGTCACAGAAAGTGGAGTCTCACTCTTCATAGAGTGAGTGGATTGAAATTTGTGTGCGGTTCTGCTGTTTTCGGTTGTCAAAGCGTCTCACTCTTCATAGAGTGAGTGGATTGAAATGCCGCCTCAATAAAGAATGTTAGGCGCATAAACGTCTCACTCTTCATAGAGTGAGTGGATTTAAAA

>NC_016938|1|1|420406-421322|PILER-CR
GTCTCACTCTTCATAGAGTGAGTGGATTGAAAT	ACTAGTCTATAAGGACGTTTGCTGAAACATGGT
GTCTCACTCTTCATAGAGTGAGTGGATTGAAAT	ATTTTCCTTAACTCCTGTGATTGTATCTTTATTAA
GTCTCACTCTTCATAGAGTGAGTGGATTGAAAT	AGTGTTGGTGGTGCTAGAATAAATAAAGATGGAG
GTCTCACTCTTCATAGAGTGAGTGGATTGAAAT	CCTCGTCTAAGGCAGTATCTACTTTAGAGCGTAA
GTCTCACTCTTCATAGAGTGAGTGGATTGAAAT	GATAAATCCATACTCTGAGCGGAAAGCATAAGAAAA
GTCTCACTCTTCATAGAGTGAGTGGATTGAAAT	ATGTCATGTGTTAATGTAAAATCACCTGTTTTT
GTCTCACTCTTCATAGAGTGAGTGGATTGAAAT	CGAAAATCAAGGGTCGTTGATTCTACTAACATGGAA
GTCTCACTCTTCATAGAGTGAGTGGATTGAAAT	CCCTGTGTAACCGCATAGGTGTGTTCTACGAAATG
GTCTCACTCTTCATAGAGTGAGTGGATTGAAAT	TGATCCTGTTTGTAAGTCATATTCGTAGACTTTATG
GTCTCACTCTTCATAGAGTGAGTGGATTGAAAT	GTAGTGCTACTAAACTGCGTAAAAATTTTGAGCGTTTG
GTCTCACTCTTCATAGAGTGAGTGGATTGAAAT	ACCAAGTATTGAAACAATGTTTGTCACAGAAAGTGGA
GTCTCACTCTTCATAGAGTGAGTGGATTGAAAT	TTGTGTGCGGTTCTGCTGTTTTCGGTTGTCAAAGC
GTCTCACTCTTCATAGAGTGAGTGGATTGAAAT	GCCGCCTCAATAAAGAATGTTAGGCGCATAAAC
GTCTCACTCTTCATAGAGTGAGTGGATTTAAAA

>NC_016938|1|1|420406-421322|CRISPRCasFinder
GTCTCACTCTTCATAGAGTGAGTGGATTGAAAT	ACTAGTCTATAAGGACGTTTGCTGAAACATGGT
GTCTCACTCTTCATAGAGTGAGTGGATTGAAAT	ATTTTCCTTAACTCCTGTGATTGTATCTTTATTAA
GTCTCACTCTTCATAGAGTGAGTGGATTGAAAT	AGTGTTGGTGGTGCTAGAATAAATAAAGATGGAG
GTCTCACTCTTCATAGAGTGAGTGGATTGAAAT	CCTCGTCTAAGGCAGTATCTACTTTAGAGCGTAA
GTCTCACTCTTCATAGAGTGAGTGGATTGAAAT	GATAAATCCATACTCTGAGCGGAAAGCATAAGAAAA
GTCTCACTCTTCATAGAGTGAGTGGATTGAAAT	ATGTCATGTGTTAATGTAAAATCACCTGTTTTT
GTCTCACTCTTCATAGAGTGAGTGGATTGAAAT	CGAAAATCAAGGGTCGTTGATTCTACTAACATGGAA
GTCTCACTCTTCATAGAGTGAGTGGATTGAAAT	CCCTGTGTAACCGCATAGGTGTGTTCTACGAAATG
GTCTCACTCTTCATAGAGTGAGTGGATTGAAAT	TGATCCTGTTTGTAAGTCATATTCGTAGACTTTATG
GTCTCACTCTTCATAGAGTGAGTGGATTGAAAT	GTAGTGCTACTAAACTGCGTAAAAATTTTGAGCGTTTG
GTCTCACTCTTCATAGAGTGAGTGGATTGAAAT	ACCAAGTATTGAAACAATGTTTGTCACAGAAAGTGGA
GTCTCACTCTTCATAGAGTGAGTGGATTGAAAT	TTGTGTGCGGTTCTGCTGTTTTCGGTTGTCAAAGC
GTCTCACTCTTCATAGAGTGAGTGGATTGAAAT	GCCGCCTCAATAAAGAATGTTAGGCGCATAAAC
GTCTCACTCTTCATAGAGTGAGTGGATTTAAAA

>NC_016938|1|1|420406-421322|CRT
GTCTCACTCTTCATAGAGTGAGTGGATTGAAAT	ACTAGTCTATAAGGACGTTTGCTGAAACATGGT
GTCTCACTCTTCATAGAGTGAGTGGATTGAAAT	ATTTTCCTTAACTCCTGTGATTGTATCTTTATTAA
GTCTCACTCTTCATAGAGTGAGTGGATTGAAAT	AGTGTTGGTGGTGCTAGAATAAATAAAGATGGAG
GTCTCACTCTTCATAGAGTGAGTGGATTGAAAT	CCTCGTCTAAGGCAGTATCTACTTTAGAGCGTAA
GTCTCACTCTTCATAGAGTGAGTGGATTGAAAT	GATAAATCCATACTCTGAGCGGAAAGCATAAGAAAA
GTCTCACTCTTCATAGAGTGAGTGGATTGAAAT	ATGTCATGTGTTAATGTAAAATCACCTGTTTTT
GTCTCACTCTTCATAGAGTGAGTGGATTGAAAT	CGAAAATCAAGGGTCGTTGATTCTACTAACATGGAA
GTCTCACTCTTCATAGAGTGAGTGGATTGAAAT	CCCTGTGTAACCGCATAGGTGTGTTCTACGAAATG
GTCTCACTCTTCATAGAGTGAGTGGATTGAAAT	TGATCCTGTTTGTAAGTCATATTCGTAGACTTTATG
GTCTCACTCTTCATAGAGTGAGTGGATTGAAAT	GTAGTGCTACTAAACTGCGTAAAAATTTTGAGCGTTTG
GTCTCACTCTTCATAGAGTGAGTGGATTGAAAT	ACCAAGTATTGAAACAATGTTTGTCACAGAAAGTGGA
GTCTCACTCTTCATAGAGTGAGTGGATTGAAAT	TTGTGTGCGGTTCTGCTGTTTTCGGTTGTCAAAGC
GTCTCACTCTTCATAGAGTGAGTGGATTGAAAT	GCCGCCTCAATAAAGAATGTTAGGCGCATAAAC
GTCTCACTCTTCATAGAGTGAGTGGATTTAAAA

Protein	Signature genes	Signature genes Name	Protein_function
NC_016938.1\|WP_015694596.1\|435215_436208_-\|TIGR01212-family-radical-SAM-protein	unknown	unknown	gnl\|CDD\|224163
NC_016938.1\|WP_015694594.1\|428841_430014_+\|glucosaminidase-domain-containing-protein	unknown	unknown	gnl\|CDD\|236304
NC_016938.1\|WP_015694585.1\|418915_419947_+\|type-I-C-CRISPR-associated-endonuclease-Cas1	cas1	cd09721_cas1_CAS-I-C	gnl\|CDD\|188360
NC_016938.1\|WP_015694581.1\|412237_414700_+\|CRISPR-associated-helicase/endonuclease-Cas3	cas3	COG1203_cas3_CAS-I	gnl\|CDD\|224124
NC_016938.1\|WP_015694583.1\|415441_417397_+\|type-I-C-CRISPR-associated-protein-Cas8c/Csd1	cas8c	pfam09709_cas8c_CAS-I-C	gnl\|CDD\|378245
NC_016938.1\|WP_015694592.1\|425645_426860_+\|metallophosphoesterase	unknown	unknown	gnl\|CDD\|277355
NC_016938.1\|WP_013774531.1\|430285_430717_+\|hypothetical-protein	unknown	unknown	unknown
NC_016938.1\|WP_041363314.1\|422061_422976_+\|phosphate/phosphite/phosphonate-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270232
NC_016938.1\|WP_015694590.1\|424073_424853_+\|phosphonate-ABC-transporter,-permease-protein-PhnE	unknown	unknown	gnl\|CDD\|273441
NC_016938.1\|WP_013774554.1\|409659_410238_+\|LysM-peptidoglycan-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|197609
NC_016938.1\|WP_013774547.1\|417400_418264_+\|type-I-C-CRISPR-associated-protein-Cas7/Csd2	cas7	COG3649_cas7_CAS-I-C	gnl\|CDD\|187820
NC_016938.1\|WP_015694582.1\|414720_415440_+\|type-I-C-CRISPR-associated-protein-Cas5	cas5	cd09752_cas5_CAS-I-C	gnl\|CDD\|273847
NC_016938.1\|WP_015694591.1\|424852_425632_+\|phosphonate-ABC-transporter,-permease-protein-PhnE	unknown	unknown	gnl\|CDD\|273441
NC_016938.1\|WP_015694595.1\|434677_435241_-\|methyltransferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|377744
NC_016938.1\|WP_015694589.1\|423309_424077_+\|phosphonate-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|226164
NC_016938.1\|WP_015694578.1\|406553_407414_+\|rhamnulose-1-phosphate-aldolase	unknown	unknown	gnl\|CDD\|131673
NC_016938.1\|WP_015694584.1\|418265_418919_+\|CRISPR-associated-protein-Cas4	cas4	pfam01930_cas4_CAS-I	gnl\|CDD\|273040
NC_016938.1\|WP_015694579.1\|407502_408972_-\|peptide-MFS-transporter	unknown	unknown	gnl\|CDD\|225646
NC_016938.1\|WP_015694593.1\|426856_428389_+\|bifunctional-metallophosphatase/5'-nucleotidase	unknown	unknown	gnl\|CDD\|223808
NC_016938.1\|WP_015694580.1\|410672_411449_+\|pyrroline-5-carboxylate-reductase	unknown	unknown	gnl\|CDD\|223422

Protein	Function_ID	Function_description	E-value
NC_016938.1\|WP_015694594.1\|428841_430014_+\|glucosaminidase-domain-containing-protein	gnl\|CDD\|236304	PRK08581, PRK08581, amidase domain-containing protein.	9.50269e-66
NC_016938.1\|WP_015694585.1\|418915_419947_+\|type-I-C-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|188360	TIGR03640, cas1_DVULG, CRISPR-associated endonuclease Cas1, subtype I-C/DVULG. The CRISPR-associated protein Cas1 is virtually universal to CRISPR systems. CRISPR, an acronym for Clustered Regularly Interspaced Short Palindromic Repeats, is prokaryotic immunity system for foreign DNA, mostly from phage. CRISPR systems belong to different subtypes, distinguished by both nature of the repeats, the makeup of the cohort of associated Cas proteins, and by molecular phylogeny within the more universal Cas proteins such as this one. This model is of type EXCEPTION and provides more specific information than the EQUIVALOG model TIGR00287. It describes the Cas1 protein particular to the DVULG subtype of CRISPR/Cas system.	0
NC_016938.1\|WP_015694581.1\|412237_414700_+\|CRISPR-associated-helicase/endonuclease-Cas3	gnl\|CDD\|224124	COG1203, COG1203, CRISPR-associated helicase Cas3 [Defense mechanisms].	6.98461e-56
NC_016938.1\|WP_015694583.1\|415441_417397_+\|type-I-C-CRISPR-associated-protein-Cas8c/Csd1	gnl\|CDD\|378245	pfam09709, Cas_Csd1, CRISPR-associated protein (Cas_Csd1). CRISPR loci appear to be mobile elements with a wide host range. This entry represents proteins that tend to be found near CRISPR repeats. The species range, so far, is exclusively bacterial and mesophilic, although CRISPR loci are particularly common among the archaea and thermophilic bacteria. Clusters of short DNA repeats with nonhomologous spacers, which are found at regular intervals in the genomes of phylogenetically distinct prokaryotic species, comprise a family with recognisable features. This family is known as CRISPR (short for Clustered, Regularly Interspaced Short Palindromic Repeats). A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins.	6.79808e-151
NC_016938.1\|WP_015694592.1\|425645_426860_+\|metallophosphoesterase	gnl\|CDD\|277355	cd07410, MPP_CpdB_N, Escherichia coli CpdB and related proteins, N-terminal metallophosphatase domain. CpdB is a bacterial periplasmic protein with an N-terminal metallophosphatase domain and a C-terminal 3'-nucleotidase domain. This alignment model represents the N-terminal metallophosphatase domain, which has 2',3'-cyclic phosphodiesterase activity, hydrolyzing the 2',3'-cyclic phosphates of adenosine, guanosine, cytosine and uridine to yield nucleoside and phosphate. CpdB also hydrolyzes the chromogenic substrates p-nitrophenyl phosphate (PNPP), bis(PNPP) and p-nitrophenyl phosphorylcholine (NPPC). CpdB is thought to play a scavenging role during RNA hydrolysis by converting the non-transportable nucleotides produced by RNaseI to nucleosides which can easily enter a cell for use as a carbon source. This family also includes YfkN, a Bacillus subtilis nucleotide phosphoesterase with two copies of each of the metallophosphatase and 3'-nucleotidase domains. The N-terminal metallophosphatase domain belongs to a large superfamily of distantly related metallophosphatases (MPPs) that includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination.	6.21313e-56
NC_016938.1\|WP_015694595.1\|434677_435241_-\|methyltransferase-domain-containing-protein	gnl\|CDD\|377744	pfam06962, rRNA_methylase, Putative rRNA methylase. This family contains a number of putative rRNA methylases. Note that many family members are hypothetical proteins.	2.20612e-70
NC_016938.1\|WP_041363314.1\|422061_422976_+\|phosphate/phosphite/phosphonate-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270232	cd01071, PBP2_PhnD_like, Substrate binding domain of phosphonate uptake system-like, a member of the type 2 periplasmic-binding fold superfamily. This family includes alkylphosphonate binding domain PhnD. These domains are found in PhnD-like proteins that are predicted to function as initial receptors in hypophosphite, phosphonate, or phosphate ABC transport in archaea and eubacteria. PhnD is the periplasmic binding component of an ABC-type phosphonate uptake system (PhnCDE) that recognizes and binds phosphonate. PhnD belongs to the PBP2 superfamily of periplasmic binding proteins that differ in size and ligand specificity, but have similar tertiary structures consisting of two globular subdomains connected by a flexible hinge. The PBP2 have been shown to bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	1.22874e-68
NC_016938.1\|WP_015694590.1\|424073_424853_+\|phosphonate-ABC-transporter,-permease-protein-PhnE	gnl\|CDD\|273441	TIGR01097, PhnE, phosphonate ABC transporter, permease protein PhnE. Phosphonates are a class of compound analogous to organic phosphates, but in which the C-O-P linkage is replaced by a direct, stable C-P bond. Some bacteria can utilize phosphonates as a source of phosphorus. This family consists of permease proteins of known or predicted phosphonate ABC transporters. Often this protein is found as a duplicated pair, occasionally as a fused pair. Certain "second" copies score in between the trusted and noise cutoff and should be considered true hits (by context). [Transport and binding proteins, Anions].	1.49619e-79
NC_016938.1\|WP_013774554.1\|409659_410238_+\|LysM-peptidoglycan-binding-domain-containing-protein	gnl\|CDD\|197609	smart00257, LysM, Lysin motif.	8.40829e-11
NC_016938.1\|WP_013774547.1\|417400_418264_+\|type-I-C-CRISPR-associated-protein-Cas7/Csd2	gnl\|CDD\|187820	cd09689, Cas7_I-C, CRISPR/Cas system-associated RAMP superfamily protein Cas7. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas7 is a RAMP superfamily protein; Subunit of the Cascade complex; also known as Csd2 family.	2.15947e-122
NC_016938.1\|WP_015694582.1\|414720_415440_+\|type-I-C-CRISPR-associated-protein-Cas5	gnl\|CDD\|273847	TIGR01876, cas_Cas5d, CRISPR-associated protein Cas5, subtype I-C/DVULG. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This small Cas family is represented by CT1134 of Chlorobium tepidum. This family belongs to a set of several Cas protein families, one each for a number of different CRISPR/Cas subtypes, that share a region of N-terminal sequence similarity modeled by TIGR02593. This family represents the Dvulg subtype of CRISPR/Cas locus.	4.87552e-79
NC_016938.1\|WP_015694591.1\|424852_425632_+\|phosphonate-ABC-transporter,-permease-protein-PhnE	gnl\|CDD\|273441	TIGR01097, PhnE, phosphonate ABC transporter, permease protein PhnE. Phosphonates are a class of compound analogous to organic phosphates, but in which the C-O-P linkage is replaced by a direct, stable C-P bond. Some bacteria can utilize phosphonates as a source of phosphorus. This family consists of permease proteins of known or predicted phosphonate ABC transporters. Often this protein is found as a duplicated pair, occasionally as a fused pair. Certain "second" copies score in between the trusted and noise cutoff and should be considered true hits (by context). [Transport and binding proteins, Anions].	1.65118e-67
NC_016938.1\|WP_015694596.1\|435215_436208_-\|TIGR01212-family-radical-SAM-protein	gnl\|CDD\|224163	COG1242, COG1242, Predicted Fe-S oxidoreductase [General function prediction only].	6.95205e-180
NC_016938.1\|WP_015694589.1\|423309_424077_+\|phosphonate-ABC-transporter-ATP-binding-protein	gnl\|CDD\|226164	COG3638, COG3638, ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism].	3.105e-127
NC_016938.1\|WP_015694578.1\|406553_407414_+\|rhamnulose-1-phosphate-aldolase	gnl\|CDD\|131673	TIGR02624, Rhamnulose-1-phosphate_aldolase, rhamnulose-1-phosphate aldolase. Members of this family are the enzyme RhaD, rhamnulose-1-phosphate aldolase.	5.50524e-167
NC_016938.1\|WP_015694584.1\|418265_418919_+\|CRISPR-associated-protein-Cas4	gnl\|CDD\|273040	TIGR00372, conserved_hypothetical_protein, CRISPR-associated protein Cas4. This model represents a family of proteins associated with CRISPR repeats in a wide set of prokaryotic genomes. This scope of this model has been broadened since it was first built to describe an archaeal subset only. The function of the protein is undefined. Distantly related proteins, excluded from this model, include ORFs from Mycobacteriophage D29 and Sulfolobus islandicus filamentous virus and a region of the Schizosaccharomyces pombe DNA replication helicase Dna2p.	1.13897e-30
NC_016938.1\|WP_015694579.1\|407502_408972_-\|peptide-MFS-transporter	gnl\|CDD\|225646	COG3104, PTR2, Dipeptide/tripeptide permease [Amino acid transport and metabolism].	1.02665e-152
NC_016938.1\|WP_015694593.1\|426856_428389_+\|bifunctional-metallophosphatase/5'-nucleotidase	gnl\|CDD\|223808	COG0737, UshA, 5'-nucleotidase/2',3'-cyclic phosphodiesterase and related esterases [Nucleotide transport and metabolism].	3.75852e-78
NC_016938.1\|WP_015694580.1\|410672_411449_+\|pyrroline-5-carboxylate-reductase	gnl\|CDD\|223422	COG0345, ProC, Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism].	8.02595e-75

>NC_016938.1|WP_015694585.1|418915_419947_+|type-I-C-CRISPR-associated-endonuclease-Cas1
MRKLLNTIFITTPKSYLALDGQNLLIKMEDDQKHRMPLHNIEAIITTGYPGISPALMRMCADQNITITFLTSSGKFGCRVVGKTSGNVYLRKKQYQVSEDEMGSLTIARNFIIGKLYNQRWMLERMIREHTLQINVTYFKQISQELKSFIEDISFVQNLDTLRGIEGQAASRYFSLFDQMILQQKEDFRFYSRNRRPPLDNVNALLSFTYTLLSQDCTSALEMVGLDPYVGFMHQDRPGRTSLAQDLMEELRGIFADRFILTLINKKMMTKKDFIKKENGAVLLTDEARKRFFLAWQKKKNETIQHPFLGEKITWGIVPYAQALLLSRFLRGDLDGYPPFLWK
>NC_016938.1|WP_015694584.1|418265_418919_+|CRISPR-associated-protein-Cas4
MFEEQDYLMISGIQHFLFCKRQWALIHVEQQWQENSLTLEGKYLHEKADQPIIREKRKDKLIVRALPIHSKILGITGICDVVEFIKSPIGAPLYGEEGDFLPFPVEYKHGKPKKDLSDRLQLTAQAVCLEEMLHCSVSKGYLYYHQIRHREEVTIDSTLREALEKIIKEMQIYWQKKHTPKVKTGNFCKKCSLQAICLPKLMTSQTVKNYLERRLVE
>NC_016938.1|WP_013774547.1|417400_418264_+|type-I-C-CRISPR-associated-protein-Cas7/Csd2
MGVLQNKIDFKVVVSVANANPNGDPLNGNRPRQNFDGFGEISDVAIKRKIRNRLQDMQEKIFVQSDDRTDDGITSLKDRVESVEELKKIAADKKKADVDRFSEVACETWLDTRSFGQVFAFKGLELSVGVRGPVSIQMGISLDPIDINSLQITKSVNSVNGNGGKSSDTMGMKHFVDFGVYVFNGSINVQLAEKTKFSEEDAEKIKQALITLFENDASAARPDGSMVVEKIYWWKHPNKLGKYSSAKVHRSVKIEKNKGIDRPKSIEDYHFEVEQLEGIQLIELAGY
>NC_016938.1|WP_015694583.1|415441_417397_+|type-I-C-CRISPR-associated-protein-Cas8c/Csd1
MSWLADLYQTYENNLDQVGKPIRNNWGKEVILLPISHAYQNAQIEVIIKPTGEFYKAKVIPKEEAATMIPVTIESAGRTSKPMPHGLHDNLQYVAGDYIQYGGDAKKGESFQKYIANLERWCASDFSHPKVQAILTYLKRGTLITDLINYQDEESHQPILIEREGKLVAKWKKEFGEKPEIFSVLASDQFSSFVRFDIYDLNLDAVPVWKDLAISKAFIDYYTTQLSGGGLDYITGKQVPLTENHPSKIRYGGDMAKLISGNDTINFTFRGRFSEKNQVATIGYETSQKGHNALKWLISKQGKIIDGRVFLTWGEDSVDNLPAIDESSDAIFAEDKETDSITTIDKTSQDFSKSFIKALQGYQQDLRHDQNIHIMILDSATPGRMGILYYRSMEQESYLERLKNWHNQTGWWHAAGWQNAFYGAPSLRTIAEAVHGRKASETLIKNTMTQLFSCVVDNRKMPFNIMQSLLKNASNPLSMELWEWRKTVGIACSIIKHYFYDLGEEYTVALNKEEKDRSYLFGRLLAVADKAEDLALFIQYGEKNKKKQDNDNGKEKNKDKKERTTNALRYMNAFSNHPVTTWKILQENLIPYYEKLEDKGNYYQNLINQIMTQFDINDYTDRALTGKYLLGYSSQRIELNNKDKNKDKEEK
>NC_016938.1|WP_015694582.1|414720_415440_+|type-I-C-CRISPR-associated-protein-Cas5
MRNQISFLVEGEYALFTDPLTKMGGEKWTYPIPTYQALKGITESIYWKPTIIYYIDEVRIMNPIQMETKGIRLMKYNESNASDLAYYTYLKKPKYEVKVHFEFNKNRPDLKPDWNEDKHYQILKRSIKAGGRRDIFLGTRECQGYIEPIEFGREKGSYDEYEEEMNFNTMVHGLSYPDETGKEELLVRLWQPKMVRGIIKFPRPEACSLCRSLKSMNMKPFSIDTIESAELLAQSLEEE
>NC_016938.1|WP_015694581.1|412237_414700_+|CRISPR-associated-helicase/endonuclease-Cas3
MKFIAHYNQVTGEQQLLKDHLLETAALSKRFGEKLNLETVCYLAGLLHDLGKYSDKFQNYLKQAMSDPNSVTRGSVDHSTAGGKLLYEYLHQKNQCPYQKLVAELVGNAIISHHSSHGLQDFIKPEEDFSLDYLKRVRDKELPEYGTIKKRFFEDCLSESEFLAYLEMATEELKAFFISENKPTENQLFFIAKMIYSCLLDADRTNTMNFETRTTYEPIQQKPLFLKYSQRLEQKLKTFEEGNPTPINQLRNQMSKRCLDFAKEPTGIYGLAIPTGGGKTLASLRFALEHTRIHEKERIIYVTPFTTIIEQNAQVVRDILKEDRYILEHHSNILQEEIVDQKNKQNQGGLEERREREEVSMKDNWEAPIIFTTMVQFLDVIYSRGTRNPRRFHQLHHAVIIFDEVQGLPVHCTYLFNEAINYLKNFAQTTSILCTATQPALDNLDKKLQKDKDILEKSELQKIEAAFERVEIIDKTTQSAWNIKDTVSLIEEILQERNNLLVILNTKKAVLKLYQLLAEQSSEEIELYHLSTAMCPAHRKQILKEINVKLNAKNQQRKLVCITTQLIEAGIDISFEAVIRSSAGLDSIAQAAGRCNRNGEQPNKQPVYIIRLEKKLEDLKYLKEIKAGKEITLKMLENLRMDSNLYSGKLLSFEAQNTYFKQFYKHSDIEPNLKYPAAKNSLELFSLLGKNENTIYQYKNKYGKEQFPDLLLHNSTKTIGKYFNVIDTPTTAVLVPYEEGKDIIQRLNGDELALNELGPLLKKAQQYIVNLFSYEIEDLQKNGYIRPLYHGEIFALCERAYSNVFGIDKTGSVANQTIVL
>NC_016938.1|WP_015694580.1|410672_411449_+|pyrroline-5-carboxylate-reductase
MIGIIGAGQMGGALIKGFIHSSKFSAKDILVKGGKSNTAKKLQEELQFNLTDTLNDFEDCQMIILATNNASILSVLTDLGDRIKEKQIPILSVAAGVSLKDMQEIMGEMYPLAHCIPNTPVQVNEGILAITYAETIESEKKQTMQAILSVLGRIVEVPEIQLDIFGTIAGCGPAFVDVFIEALSDAAVLHGMPRAISYEIAAQMMKGASKLALKTNQHPGELKDSVTSPGGTTIKGVVALEKNGFRHAVIDGINEIMK
>NC_016938.1|WP_013774554.1|409659_410238_+|LysM-peptidoglycan-binding-domain-containing-protein
MRSLNTILLGTTLAAGIGLCLGTSNAHADSVYTVQSGDTLSSISQKFNGDSQLIQQIARDNSISNLNMIYKGQQLTIKTTNEIRETQTAPTNTVVELQPVITEEPVVQNQSTASTPVTTNTSSAKEWLAQRESGGSYSAMNGRYIGKYQLDASYLNGDYSPENQERVADNYITQRYGSWEGAQAFWQANGWY
>NC_016938.1|WP_015694579.1|407502_408972_-|peptide-MFS-transporter
MNDNQSDGSFLGQPKGLSTLFFTEMWERFSYYGMRAILLYYIYDTVANGGLGFPKETGLSIMSIYGSMVFMSSIIGGWISDRWLGSQKTVFFGGLFIMIGHIVLATPFGVSALFVSIFFIVIGTGMLKPNVSDMVGHLYSKTDLRRDSGFSIFYMGINIGALVAPLVVGTLGQEYNYHLGFSIAAIGMFFGLVQFYYKSKTTLAGIGLEPTNPMTNQEKKRFGMILLGVLVFAAIVFGGAAFMGKLTVDFFITIISILGILLPIYYFIKMLTAKNVTPDEKTKVMAYIPLFLAAIVFWSLEEQGSSILALFAADRTRHHLFGIPIAASWFQSLNPVFVVILTPVFVTLWTKLGKHQPSTVVKFALGLIFAGLAYVLLMFPGLLYGTNHKVSPLWLIISFFVIIVGEMCLSPVGLSVTTKLAPKAFEAQTVAIWLLADAASQAINAQIARFYTPHTESAYFGTIGIIAVVVGILLILVKKPIKRLMGSIN
>NC_016938.1|WP_015694578.1|406553_407414_+|rhamnulose-1-phosphate-aldolase
MKKIDVLQSFFVKEMIEVTANLYRLGWDERNGGNISYLLTEEEILPFVDPNHYLRKIPIEFDAIALEGKYFLVTGSGKYFKNIATTPAENIGLVRIVDRGASLAVLWGLENNTMPTSELPSHFMSHIARLEVDPENRIIMHNHANHLLAMTFTHELTEKAFTRTLWQMCTECLVVFPEGISIIPWMVPGTNEIGQATAEKMKRTRLVIWPHHGVYGAGKSMDEVFGLIETAEKAAQTYTYVCAQGPILQTISDENLQKLADSFGVVPRSGYLDQAISIANDNKVYN
>NC_016938.1|WP_041363314.1|422061_422976_+|phosphate/phosphite/phosphonate-ABC-transporter-substrate-binding-protein
MKFAVLLLIIGLNAALLVGCKSHKKTVNDPDKVLELQFVPTNNDGSMEAKTKPFARYLSKKLNRKVNVTLATDYSTIVEAMSSKKVDIGIMPPSAYVQARMQNVATAILSSKLGAYNRQTGKPEINQLSSTFKGEILVRSNSKIKKLKDLKGKKIAALSPNSASGYIYPIVDLKDAGINPEKNLTITTINDIPSEMTAVLNGQQDACFVFEGARNVFSKKFVNQDLFKELRVLHLTKGSIPNDAIAVHPKMNKKLREKIKKAFMDMSKDPQGQKAMAMWGHKGYVTANDKNYSDVEEYTQKAAE
>NC_016938.1|WP_015694589.1|423309_424077_+|phosphonate-ABC-transporter-ATP-binding-protein
MIQFEHVTKTYPNGVKGLKDINLTIEAGEFVSIIGLSGAGKSTLLRSINRLNEISEGNISINGLSITKAKKNELRKIRRNIGMIFQHFNLVRKSSVQKNVLSGRLGYYSTFKSILGIFSKEDYKLVNDALTRVGMLDKLHERSDALSGGQQQRISIARTLVQQASTILADEPVASLDPITTQMIMKDLKKINQELKCTVILNLHSVELARDFSSRIIGLRAGEIVFDGTPEEATDEVLTEIYGADILKSKEEEAI
>NC_016938.1|WP_015694590.1|424073_424853_+|phosphonate-ABC-transporter,-permease-protein-PhnE
MKLKDTIHRNLYKHLFIIFLILICICVSGQITEADPLEVFNNADQISEFLQRFFHPDWQYLPKIIEPILKTIKISVVGTILGVIFAVPFACLGTTTITRNPIITTILRFFMSIIRTIPNLLLAALFVAMIGIGEFTGVLTIAVFTFGMVSQLIYEAIETVEHGTIEAADSVGATKTQAAFWVILPQISHQIFGYALYAFEINVRASTVLGYVGAGGIGVILNSSLSLLRYDRVSIIILAILIVVTIIDWISEIIRKKLI
>NC_016938.1|WP_015694591.1|424852_425632_+|phosphonate-ABC-transporter,-permease-protein-PhnE
MRKANKVKNYSIIIFLIFIIVYSVFGIDYSGIDKISLVAIKSVLVGLFHPDWQFIYDGSGEDLISLLFLTICIAFLGTLIATFLALPLTLLGARTLWKTHPWIAKTGKFICNVLRAFPELVYAIIFVKVVGPGPFAGVLAIGIHQIGMLGKLYIEELEAMNEEVIESMDAVGAGFWQTTFFARVPELAPTCFSLALNHFEIAVRSAATLGLVGAGGIGAPMIFAIQARSWNKVGIILLGIIFTVFVIDTATGYLRKKLQ
>NC_016938.1|WP_015694592.1|425645_426860_+|metallophosphoesterase
MKKLSIISTTDIHGFLTCSNDEKQGLLSLPNLTKQIGEALLIDNGDYLVGSPLATFFNMTEKISPLIHLANQLGIDIMVPGNHDFDWGLAFLKRQVAAFNGVYLCANVVDTKDDLIFEPYKIIEKNGFKVGVIGVITGAMPQIAPYQKIKELKFIDVLETLAYWIPIVLSKADILLVSYHGGIERDMVTNQPTQYDTGEDQLYKIITSFPEIAGVIAGHQHRENVGCYKATDTLYVQPGYRGNVFGLFEFIEKNNQISKQAQLLSSKNYSASSFDYDQKRYQQWLEQPIDLTKFLTYIKSRIKVDHYLFQIQQSTIAGFLASFTIPYRISVYHLSKAEWQHFVSQFPLKDEQIIFEASSIEKEDYQIVTNCHHLPFYRLEANYVYDIFDEYLCYLKSIETGEEK
>NC_016938.1|WP_015694593.1|426856_428389_+|bifunctional-metallophosphatase/5'-nucleotidase
MSKTQQITIYYTSDIHGYLFPTDYVDKQDKRMGLLKCVPNFKKDENTLIIDGGDMLQGSAMATFCQKNRELGFPQAQVLNYAGYDFVTIGNHDVNFGTDYLYEYLDALKAKCICENIFQKQTNKQLFPSVIKTLKNGLKIGIVGIVTDYINIWEKKENIQDITITDPFEAAKQALKEIKPLVDITVCVYHGGFERDVKTGKQLTKTTENIGYKICEELEFDLLLTGHQHLLIEGNYINNTYVVQPSFSGLNYFKITIEKPLDTNKLIIESIIGKPGDSPENEITKKLLPIENKVQKWLDKPIGLLSKEMLTTDKKTMAIEGSSVIELIGAVQLAASQAQITCVSLANTSPGFHKKVTMRDIIATYPYTNQLITLQITGEQLKKILEKNSEYFSLDSNGYVIISPKYLYPKLEHYNYDYFIGISYVLDIRQPIGRRVTSLTYQEKEITNKDTFTLSLSNYRANGGGNFPIYTECSVLDEGSEEIVAMIVAFIQSKEMISIPRQLDYTILPK
>NC_016938.1|WP_015694594.1|428841_430014_+|glucosaminidase-domain-containing-protein
MKQKILPIVVSATLFSSALLLPTTSFAEKLTKPSVSVTSENSQSKNETVESSITTSETHQSTESGSSSTSTPSSSTTSSQETESSSSNGGISNHLPAKKPVTPSKEQQSKKESKTTNTVPVIEDKKEGKPVLEHTTIPNLDKIVVTKNQTTEEFIKKIGESARQVAHQYDLYASVMIAQAILESGSGNSGLASEPNYNLFGIKGEYDGASIVMKTQEDNGKGNLYTIDSAFRKYPSYKESLEDYAKLLKEGLTGNKDYYHGTWKSQTTSYKEATHFLMGRYATDTQYAEKLNQLIDVYNLTAYDEWHEENDAAAQAAHATPMAIKKAAEEKKAEQKKKEKHMDTVKAATKALNNRMEQIKKRKEERTKTFLTQPQQFLFQLLINKNDSVK
>NC_016938.1|WP_013774531.1|430285_430717_+|hypothetical-protein
MYSYTDMILTIMQRVEVYNEIFKAISKEIQEHNYNQELSKKGHDTYIFCRNNVNRFLMEDEGFRKNLKSVQEKEATKILLTGLDTYKEGIYFLLKSLNEQGEIIDPFKFELGLKEKNAAFKLINQACREACEGIRSAHSVHKM
>NC_016938.1|WP_015694595.1|434677_435241_-|methyltransferase-domain-containing-protein
MLETALQYSHFLLNEIICPGDHVVDATMGNGNDTLFLAKLVGDKGKVYAFDIQKQALERTRQRLIENQVIQCTELFQQGHETIEQVLPIETTLSAAIFNLGYLPKSDKEIVTLPETTIQAIEQLLIRLKSKGRLLLVIYYGHSGGQEELKAVSYYCQQLPQEQFNVLSYQFINQKNQPPILFCIEKK
>NC_016938.1|WP_015694596.1|435215_436208_-|TIGR01212-family-radical-SAM-protein
MKKFIYTDDPNKRYHSWNYALRKVFGKKIFKVPIDAGFDCPNRDGTVAKGGCTFCSVSGSGDMIVAPNEPLPIQFRKEIQLMEKKWPNVEQYIVYFQNFTNTHAPVEIIRHRFEQVINEKGVVGLSIGTRPDCLPEETIDYLAELNERFYLWVELGLQTTFEKTSNQINRAHDYQTYLTSVEKLRQHNIRVCTHLINGLPGESFEMMRDNVRRTLLDSDIQGIKLHLLHLMTNTKMIQDYHEGRLKLMTQEDYVAIICDQLEMIPPEIIIHRLTGDAPANSLIGPMWSLKKWEVLNAIDKELERRNSYQGKYDIRKTKEVIFNARNSTTV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_016938_1	1.3\|420573\|34\|NC_016938\|PILER-CR,CRISPRCasFinder,CRT	420573-420606	34	MH319754	Marine virus AG-345-L05 Ga0172272_11 genomic sequence	1043-1076	10	0.706

1. spacer 1.3|420573|34|NC_016938|PILER-CR,CRISPRCasFinder,CRT matches to MH319754 (Marine virus AG-345-L05 Ga0172272_11 genomic sequence) position: , mismatch: 10, identity: 0.706

agtgttggtggtgctagaataaataaagatggag	CRISPR spacer
agtgttgctggtgctagaataactattgcatact	Protospacer
******* ************** **  *   .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

604855 : 615133

Lactococcus_phage(40.0%)

plate,holin,tail

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015694703.1\|604855_605257_+	hypothetical protein	C9E2J9	Enterococcus_phage	1.4e-27	49.2
WP_015694704.1\|605257_605773_+\|tail	phage major tail protein, TP901-1 family	D7RWD5	Brochothrix_phage	8.0e-52	60.1
WP_013774346.1\|605813_606161_+\|tail	tail assembly chaperone	Q77RZ7	Lactococcus_phage	2.1e-24	51.0
WP_041363323.1\|606220_606502_+	hypothetical protein	A0A1P8BLR3	Lactococcus_phage	2.2e-19	52.7
WP_015694706.1\|606517_608401_+\|tail	tail protein	A0A1L2JXP6	Streptococcus_phage	5.4e-29	40.5
WP_015694707.1\|608415_609186_+\|tail	phage tail family protein	D7RWD9	Brochothrix_phage	4.8e-53	42.2
WP_015694708.1\|609182_611984_+\|tail	phage tail protein	A0A191KBX1	Streptococcus_virus	2.2e-196	47.6
WP_015694709.1\|612002_612977_+\|plate	phage baseplate upper protein	A0A1P8BLW0	Lactococcus_phage	7.5e-35	46.9
WP_015694710.1\|612969_613587_+	hypothetical protein	NA	NA	NA	NA
WP_015694711.1\|613589_613832_+	hypothetical protein	NA	NA	NA	NA
WP_015694712.1\|613831_614374_+	hypothetical protein	NA	NA	NA	NA
WP_015694713.1\|614717_614924_+	hypothetical protein	A0A0S2MYG0	Enterococcus_phage	1.8e-15	60.6
WP_013774334.1\|614938_615133_+\|holin	phage holin	A0A1P8BL51	Lactococcus_phage	1.2e-05	35.5

DBSCAN-SWA_2

666429 : 675419

Prochlorococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015694757.1\|666429_667722_+	adenylosuccinate lyase	A0A1B3B081	Gordonia_phage	6.5e-18	32.2
WP_015694758.1\|667773_668163_-	hypothetical protein	NA	NA	NA	NA
WP_041363241.1\|668434_669142_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	E3SPA9	Prochlorococcus_phage	4.5e-45	41.6
WP_013774222.1\|669156_669411_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_015694760.1\|669410_670097_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_193364593.1\|670121_672317_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	1.6e-138	39.9
WP_015694762.1\|672301_673735_+	amidophosphoribosyltransferase	A0A1B1ISH6	uncultured_Mediterranean_phage	7.1e-50	32.3
WP_015694763.1\|673767_674817_+	phosphoribosylformylglycinamidine cyclo-ligase	Q58MH8	Prochlorococcus_phage	1.6e-62	44.4
WP_015694764.1\|674813_675419_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	6.3e-24	34.1

DBSCAN-SWA_3

1458005 : 1466468

Streptococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013773528.1\|1458005_1460198_+	anaerobic ribonucleoside-triphosphate reductase	A0A0C5KKX3	Enterococcus_phage	4.3e-280	64.4
WP_015695237.1\|1460245_1460848_+	anaerobic ribonucleoside-triphosphate reductase activating protein	A0A288TZV3	Enterococcus_phage	3.9e-50	54.7
WP_013773526.1\|1461046_1462159_-	DNA polymerase IV	D0R0A3	Streptococcus_phage	1.6e-12	25.7
WP_015695238.1\|1462358_1463225_-	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	1.8e-80	55.4
WP_013773524.1\|1463328_1463676_-	DNA replication initiation control protein YabA	NA	NA	NA	NA
WP_015695239.1\|1464507_1465476_-	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	6.3e-34	32.0
WP_015695240.1\|1465475_1465805_-	cyclic-di-AMP receptor	NA	NA	NA	NA
WP_013773520.1\|1465823_1466468_-	dTMP kinase	M1PSC7	Streptococcus_phage	4.5e-52	50.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NC_018265

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_018265_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_018265_1

119602-119688

Orphan

Consensus_repeat	Method
ATAAAATTCTTTGTTATGTGTTTGGGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_018265_1

>merge|NC_018265|1|119602-119688|CRISPRCasFinder
ATAAAATTCTTTGTTATGTGTTTGGGCGGTTTTCTCTCCGCCCTTTTTTCCGTTTTCTTCATAAAATTCTTTGTTGTGTGTTTGGGC

>NC_018265|1|1|119602-119688|CRISPRCasFinder
ATAAAATTCTTTGTTATGTGTTTGGGC	GGTTTTCTCTCCGCCCTTTTTTCCGTTTTCTTC
ATAAAATTCTTTGTTGTGTGTTTGGGC

Protein	Signature genes	Signature genes Name	Protein_function
NC_018265.1\|WP_014868589.1\|107007_107691_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213222
NC_018265.1\|WP_166484928.1\|108230_108998_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|100078
NC_018265.1\|WP_014868586.1\|103356_104004_+\|pyroglutamyl-peptidase-I	unknown	unknown	gnl\|CDD\|237299
NC_018265.1\|WP_014868593.1\|109758_112065_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|226957
NC_018265.1\|WP_014868597.1\|121477_122830_+\|sugar-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224096
NC_018265.1\|WP_014868588.1\|105102_106998_+\|FtsX-like-permease-family-protein	unknown	unknown	unknown
NC_018265.1\|WP_014868602.1\|130170_130563_+\|hypothetical-protein	unknown	unknown	unknown
NC_018265.1\|WP_126347320.1\|120172_121375_+\|extracellular-solute-binding-protein	unknown	unknown	gnl\|CDD\|270373
NC_018265.1\|WP_013774765.1\|118115_118685_-\|LysM-peptidoglycan-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|212030
NC_018265.1\|WP_014868585.1\|102401_103322_+\|DUF979-domain-containing-protein	unknown	unknown	gnl\|CDD\|377620
NC_018265.1\|WP_014868604.1\|131089_131962_-\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha	unknown	unknown	gnl\|CDD\|129801
NC_018265.1\|WP_126347313.1\|126180_127152_+\|DUF916-and-DUF3324-domain-containing-protein	unknown	unknown	gnl\|CDD\|371730
NC_018265.1\|WP_014868592.1\|109106_109772_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224059
NC_018265.1\|WP_014868598.1\|122835_123675_+\|sugar-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|226354
NC_018265.1\|WP_014868595.1\|116201_117614_+\|glucuronate-isomerase	unknown	unknown	gnl\|CDD\|376859
NC_018265.1\|WP_014868599.1\|125438_126113_+\|WxL-domain-containing-protein	unknown	unknown	gnl\|CDD\|372694
NC_018265.1\|WP_013774769.1\|124307_124850_+\|phenolic-acid-decarboxylase	unknown	unknown	gnl\|CDD\|226010
NC_018265.1\|WP_014868594.1\|112758_115209_+\|DUF4982-domain-containing-protein	unknown	unknown	gnl\|CDD\|225789
NC_018265.1\|WP_014868603.1\|130580_130952_+\|hypothetical-protein	unknown	unknown	unknown
NC_018265.1\|WP_014868601.1\|127461_129570_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NC_018265.1\|WP_014868589.1\|107007_107691_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|213222	cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein. This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of lipoproteins from the cytoplasmic membrane (LolCDE). They are clustered together phylogenetically. MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all. An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport. The LolCDE complex catalyzes the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane.	5.81195e-74
NC_018265.1\|WP_166484928.1\|108230_108998_+\|hypothetical-protein	gnl\|CDD\|100078	cd05709, S2P-M50, Site-2 protease (S2P) class of zinc metalloproteases (MEROPS family M50) cleaves transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms. Members of this family use proteolytic activity within the membrane to transfer information across membranes to integrate gene expression with physiologic stresses occurring in another cellular compartment. The domain core structure appears to contain at least three transmembrane helices with a catalytic zinc atom coordinated by three conserved residues contained within the consensus sequence HExxH, together with a conserved aspartate residue. The S2P/M50 family of RIP proteases is widely distributed; in eukaryotic cells, they regulate such processes as sterol and lipid metabolism, and endoplasmic reticulum (ER) stress responses. In sterol-depleted mammalian cells, a two-step proteolytic process releases the N-terminal domains of sterol regulatory element-binding proteins (SREBPs) from membranes of the ER. These domains translocate into the nucleus, where they activate genes of cholesterol and fatty acid biosynthesis. It is the second proteolytic step that is carried out by the SREBP Site-2 protease (S2P) which is present in this CD superfamily. Prokaryotic S2P/M50 homologs have been shown to regulate stress responses, sporulation, cell division, and cell differentiation. In Escherichia coli, the S2P homolog RseP is involved in the sigmaE pathway of extracytoplasmic stress responses, and in Bacillus subtilis, the S2P homolog SpoIVFB is involved in the pro-sigmaK pathway of spore formation. Some of the subfamilies within this hierarchy contain one or two PDZ domain insertions, with putative regulatory roles, such as the inhibition of substrate cleavage as seen by the RseP PDZ domain.	0.00858618
NC_018265.1\|WP_014868586.1\|103356_104004_+\|pyroglutamyl-peptidase-I	gnl\|CDD\|237299	PRK13197, PRK13197, pyrrolidone-carboxylate peptidase; Provisional.	1.07708e-123
NC_018265.1\|WP_014868593.1\|109758_112065_+\|ABC-transporter-permease	gnl\|CDD\|226957	COG4591, LolE, ABC-type transport system, involved in lipoprotein release, permease component [Cell envelope biogenesis, outer membrane].	0.0037781
NC_018265.1\|WP_014868597.1\|121477_122830_+\|sugar-ABC-transporter-permease	gnl\|CDD\|224096	COG1175, UgpA, ABC-type sugar transport systems, permease components [Carbohydrate transport and metabolism].	6.9658e-58
NC_018265.1\|WP_126347320.1\|120172_121375_+\|extracellular-solute-binding-protein	gnl\|CDD\|270373	cd13655, PBP2_oligosaccharide_1, The periplasmic binding component of ABC tansport system specific for an unknown oligosaccharide; possess the type 2 periplasmic binidng fold. This group represents an uncharacterized periplasmic-binding protein of an ATP-binding cassette transporter predicted to be involved in uptake of an unknown oligosaccharide molecule. Members of this group belong to the type 2 periplasmic-binding fold superfamily. PBP2 is comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. The majority of PBP2 proteins function in the uptake of small soluble substrates in eubacteria and archaea. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.1704e-152
NC_018265.1\|WP_013774765.1\|118115_118685_-\|LysM-peptidoglycan-binding-domain-containing-protein	gnl\|CDD\|212030	cd00118, LysM, Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.	6.13602e-11
NC_018265.1\|WP_014868585.1\|102401_103322_+\|DUF979-domain-containing-protein	gnl\|CDD\|377620	pfam06166, DUF979, Protein of unknown function (DUF979). This family consists of several putative bacterial membrane proteins. The function of this family is unclear.	1.63272e-146
NC_018265.1\|WP_014868604.1\|131089_131962_-\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha	gnl\|CDD\|129801	TIGR00718, Probable_L-serine_dehydratase_alpha_chain, L-serine dehydratase, iron-sulfur-dependent, alpha subunit. This enzyme is also called serine deaminase. L-serine dehydratase converts serine into pyruvate in the gluconeogenesis pathway from serine. This model describes the alpha chain of an iron-sulfur-dependent L-serine dehydratase, found in Bacillus subtilis. A fairly deep split in a UPGMA tree separates members of this family of alpha chains from the homologous region of single chain forms such as found in Escherichia coli. This family of enzymes is not homologous to the pyridoxal phosphate-dependent threonine deaminases and eukaryotic serine deaminases. [Energy metabolism, Amino acids and amines, Energy metabolism, Glycolysis/gluconeogenesis].	5.53282e-101
NC_018265.1\|WP_126347313.1\|126180_127152_+\|DUF916-and-DUF3324-domain-containing-protein	gnl\|CDD\|371730	pfam11797, DUF3324, Protein of unknown function C-terminal (DUF3324). This family consists of several hypothetical bacterial proteins of unknown function.	2.46876e-33
NC_018265.1\|WP_014868592.1\|109106_109772_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224059	COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms].	1.27688e-89
NC_018265.1\|WP_014868598.1\|122835_123675_+\|sugar-ABC-transporter-permease	gnl\|CDD\|226354	COG3833, MalG, ABC-type maltose transport systems, permease component [Carbohydrate transport and metabolism].	1.27529e-95
NC_018265.1\|WP_014868595.1\|116201_117614_+\|glucuronate-isomerase	gnl\|CDD\|376859	pfam02614, UxaC, Glucuronate isomerase. This is a family of Glucuronate isomerases also known as D-glucuronate isomerase, uronic isomerase, uronate isomerase, or uronic acid isomerase, EC:5.3.1.12. This enzyme catalyzes the reactions: D-glucuronate <=> D-fructuronate and D-galacturonate <=> D-tagaturonate. It is not however clear where the experimental evidence for this functional assignment came from and thus this family has no literature reference.	0
NC_018265.1\|WP_014868599.1\|125438_126113_+\|WxL-domain-containing-protein	gnl\|CDD\|372694	pfam13731, WxL, WxL domain surface cell wall-binding. The WxL motif appears in two or three copies in these bacterial proteins and confers a cell surface localization function. It seems likely that this region is the cell wall-binding domain of gram-positive bacteria, and may interact with the peptidoglycan.	1.33861e-47
NC_018265.1\|WP_013774769.1\|124307_124850_+\|phenolic-acid-decarboxylase	gnl\|CDD\|226010	COG3479, COG3479, Phenolic acid decarboxylase [Secondary metabolites biosynthesis, transport, and catabolism].	1.96605e-100
NC_018265.1\|WP_014868594.1\|112758_115209_+\|DUF4982-domain-containing-protein	gnl\|CDD\|225789	COG3250, LacZ, Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].	1.56076e-58

>NC_018265.1|WP_013774765.1|118115_118685_-|LysM-peptidoglycan-binding-domain-containing-protein
MKSLKTILLGTTLAAGIGLSLGAGNVHADSLYKVQAGDTLSSIAAKNHTNIQEVANKNQISNINMIYEGQQLQIKTADSAVATPKTMQATPIAQPALSTTPMIQKQAPAQTSAPTSDSNSAKEWIAQRESSGSYNATNGKYIGRYQLDASYLKGDYSPANQEKVAENYVSERYGSWEQAKTFWMNNGWY
>NC_018265.1|WP_014868595.1|116201_117614_+|glucuronate-isomerase
MFLDEDFLLTTPMAKKLFHDYAAEMPIIDYHCHLDPKEIYEDKNFNNITEAWLTEGNNFGDHYKWRLMRANGVPEELITGNGDPYEKFLAFAGVLEKAYGNPIFEWCHLELRRFFGIEEVLTTETAPKIWEEANKKIVTETFSRRQLIRNMHVKALSTTDDPTDDLHYHELIKKEEATNGFKVIPGFRPDKILNIQVDTFTDYLEKLAKVSGVMIEQFSDIKKALEKRVEYFEEHGGNICDHGLDSVQYAEATEEELNEILAKRKARKQLTEIEIAKYRTGVLLALMKIYTDHDWTVQFHMHALRNLNKIAFEKMGADVGFDAINDEQVAVMTGKLLNACNENGALPKLVLYSLNQNDWMQLLTVMGCFQGGRKQKMQFGTAWWFDDTRSGMRKQLKMLMEQSLLGNFIGMLTDSRSFLSYPRHEYFRRVLCELLGEMVERGQIPADEKRLGKMVQDISYNNAEEYFQFK
>NC_018265.1|WP_014868594.1|112758_115209_+|DUF4982-domain-containing-protein
MQVKKFNQDWYYWKEQNSFALVWDIPEYAKIVQLPHDAMLEQAAYAESQNGGNTGYHDGAIYNYVKKLVVHENQKSEQFILKFEGIYMNAAVYVNGQLAGKNPFGYSTFYVTLNDYLKYGTENEIRVQARNGAMTNSRWYSGGGIYRDVYLLTSGSLFIEPTSIHIKTEQATKELASLSIKTKVINKENYYQDVQLITTVKTKSGEVVASTTDLFNLLSNDTRTFSQRLTVIHPELWSAETPTLYKCISQLYSNNQLIDEEVTTFGIRTLTLDSYHGLQVNHIPVKLRGACVHHDSGLLGAATYKETHLRQIAKLKAAGFNAIRMSHQPMAPAMLEACDELGMYVMDETFDMWNHCKSDYDYGLYFNEWWEKDVESMVLKDYNHPSVLLYSVGNEIPEIATNQGNKVCYELVEKIRSLDHTRYILASINGMFAVGDQLGEIIQDILPTQSADEETLDGNVNDFMTVMDTHLDEIVTHEIVGQALERVSGLLDITGYNYMTARYELDAKEHANRILVGSETYPPEIARNWEIIKKLPTVIGDFTWTGWDYLGEAGVGVPAYKWGEGGFGAAFPCQLAYVGDLDITGFRRPMSYYREIVFGLRTAPYLAIQNPYQPKEKLIKTPWIMSDTMSSWNWELPRGTLINVEVYAPGERIELWLNDTCVAQENMPEGSYRQIISIPYEPGKLCAYNYQGTKLLGQTELLTTGKATRIQLTPELMYSQELIYIEVCLVDEAGLIVMNDDCDIVATITGSADLLAFGSGNPKPLTNFNTNKTRTFNGRALLILAKNQQLSSIQIAVHSNNDSKKDEIVGQLTIEI
>NC_018265.1|WP_014868593.1|109758_112065_+|ABC-transporter-permease
MKNYKTWKIFLNGFILSFVVIFICIALFQVGTNINKDLDNHNKITLKAINKTPYRDIKSLTDKYPGNVVITADGFARLNKKGYEEYLLMKKSNNFSKYVLMEGRKPKSADELIISKRNADQNHIKLNKKINVDSRGKRVVGIFKNEGDINEDVVERIKLKEETVISNLEFTNLKKTDYTFIKKNKTANFEVEANDGNNKKETLLILLQLIVYIISIITIFFLLIMMEYEIKKILIRRKKNIFLLKSMGETNRNILYYELSYFLKPLIIGLIFGVLIGTAIIPLAYNALLGNFGGENFYQFTYNNYPVIQIILGVLICFIVETVLFYSNISKSLRSVSLKSFYMNKENNRYSFKHILLYLLVAILAVIAVSVMIQLSLISTTKIIISLILIMSILLLPQGVIKLINKIFPGKLLFAKSFLNSNQKKVSSIILVFTAILTLQFVVISATLSSLKSVNEGWKVILTGDGFGINPSGDKIDPQILDELKGIDHLYLSKRIYPTEKIRFKGQETNGFMVKGTDIDKYKDSVKGKTSDGKILIGRAISVKLGIKPGDQIVFKNKKIEVSGVTSSGENGGDIVYMYPALFRELFGEKGADIATLNIVNQRSFEKSIRGKENVFYFRTNAEYIKTGINSVYTTLSPVIALCVIVALLGIAIIILMLNDLIYDSRKAIVLLRSLGSGRLFLFKENLLVLCMLSFLAYLYALLFTQIISDTLNFFIASKLGSIVEINSFNLYTLLLSAAILFLMNLLIAVKNTFSMKKVSIAEEMRTL
>NC_018265.1|WP_014868592.1|109106_109772_+|ABC-transporter-ATP-binding-protein
MIEVKNLEKKYEKRTILNDVSLEITSGKITVILGESGSGKSTLLNLLAGFDLPNVGEIFIENTNISKLNEEQRTKFRKGKIGFIFQDFMLFEDLTVEENLRMGAKFNLKDLNKVETNALIDETLELLGLIEKKKSYPEQLSGGQKQRVAIGRTLCTSPDFIFADEPTGALDSVNEENILNIFNLINQKYETTLVLVTHSQRVAEAADEIIRIVDGKIYEEL
>NC_018265.1|WP_166484928.1|108230_108998_+|hypothetical-protein
MDKVYHVSFNVIKIDLLSEEIQKKYLSFLEKVESLDRNEKSKLPVYRLIEINLSTKYIFKYFYNWIVFIMLFQFLFLPLFQNNFFEIVRLSYKLDYVQIIFISLLSYILHEIGHAAWLKKKDIKQLKFGFALVLNILPTFYIKHKVYNFTKIEKITYYLSGCLMNIFIVFSALIYQLVFGVSNVSSCFILINFSIVFLNLIPFLITDGYHILTIITDEYNLRQKFTSVIKNPVNLKNYNKFVKVYTIFNIIFCFL
>NC_018265.1|WP_014868589.1|107007_107691_+|ABC-transporter-ATP-binding-protein
MSIKVENLTYSIQEGNQARKILNNISINIPKGKLTSITGESGSGKTTLLYGLSGILKIDEGNVFLNDKNLCNMKIKEREKFRLNHISFIYQQLNLFNFLNVEENIKINWLLRNKKISKDVDKQIDQYLELFNLGNSKKKEIQSLSGGEKQRIAIIRSFVSKSDFIFADEPTGNLDTKNSLLFMESLQKIMKNSTSTVIMVTHDSKLCNYADEKINLIDGKINNHTII
>NC_018265.1|WP_014868588.1|105102_106998_+|FtsX-like-permease-family-protein
MKEIAKKLIKDNPVQNILYGVGSTLNLIVIGVFLMLVKELIKIKKNTALISRNEQISFYFSTLITISIIVIIFSVLVLCMIQKSVFHSRRDFNIKMKLTGISSICLAKIYIKEIFTIQKITIPLGILLMQLTYTIISRIVEIPSKWISITIVVSSIILHIMILFFSSTIILCKLSQFDPLEKLRNPYMQEKVRILGKRDYILFFVGISLIGIPLIYSNTDNSFMAFIPIVGIFLIIDVLLVMIHNSFKKIGHTNSMSGLYLSESMILGYYKKMNSIVMTLIVGVMISVGLIGMFNTIRGISKDTVNQNLYYQTLVVYSKVKSFLSEKEYKKQFDKIDPHSKIAYGINLELTDKEGIKNTISAIDNDYFKYGEKLKIINHNNISKNILDENFNGIYLPDYFINEKDIGKKWPLKLGNKTLDLIIAGRFHANGDRGRFGFISKSFLQKFMSKPGFVNAFYVNTANQKLTNEIENNSNAIDIYKVSKKQIAAGSYKNAIKGTEIFELSSNAIILLAIIMVFHFYFSTSLSNYFDISRLRAQGISISKLINAYFLQVFCVITLSFLVGTVSSIFFIRGGVDMILPYIDVNVTYTLPIRDLLIKYIIVFAISFIGVYLSIKKSLKDDYLKYITISE
>NC_018265.1|WP_014868586.1|103356_104004_+|pyroglutamyl-peptidase-I
MKILVTGFDPFGGETTNPALDAVKGLPDKIREAEIIKLEIPTVFNKSAEVTKQAILTYQPDVVLNVGQAGGRFTVTPERVAINRDDARIPDNEGNQPINDSIHEDGAPAYFTQLPIKAMVKMIRDAGLPAAVSNTAGTFVCNHIMYQVQYMIDKEFPELKGGFIHVPFIASQVIDKPETPFMNLADIITSLEKAIEAILLFDEQKDLETIEGTIH
>NC_018265.1|WP_014868585.1|102401_103322_+|DUF979-domain-containing-protein
MDKFIPTILEFFYILIGLLSILTSFRVFFDKTNSARIGTSLFWLLLGIIFAAGNFMPYAISGILLTIIGILTLFKQVKIGKLAELSEKDGEKSAKRIGNWVFFPSILLAALAVGISYTSLGGQVGIGIASILSLIVAMFIMRAKPKTMLDDTDRMLQSVGTTGILPQLLAALGVIFNTAGVGDVISHAVSGVVPEGNRLAGVIAYCLGMIIFTMVMGNGFAAFTVITAGIGIPFVIAQGGDPVIAGTLAMSAGFSGTLLTPMAANFNALPVALLEMKDSNGVIKAQAPIALIMIVVHIALMYFLAF
>NC_018265.1|WP_126347320.1|120172_121375_+|extracellular-solute-binding-protein
MALSIIIVLLTACNNKKTEEIKPTGGKEKKGTIKLWVDAAVIDIYKPIVKQFENEHKGLKIIVKPSETGKAQENVKKDPSAAADVFMMPHDQLGQLVEAGTIYPNTKYANNVKKNNAKNLVDSATYNGKLYGYPYGMETLIAYYNKSKLTAEEMKTWETITKNGKLGTNFSEENANYVFVPLFMSNGDELYGKTGENIKGTNFNNEKGVQVLNWIYDQKDNKGVVQSNDDALSRLRNGEIDAFLSGPWSKNDAKKALGKNFAVTSYPTVNFGNGEVQQKAFLGVKLFCVNASTKNPLASMALADYLTKKENQLTVFEKNGIVPSNKEVLEQSNVQSDAVVHAVMTMSNEEHSVIMPKLPEMVSFWEPADALINDTYNHKISKNQFQSKLDKLVKDTSKSK
>NC_018265.1|WP_014868597.1|121477_122830_+|sugar-ABC-transporter-permease
MRKNNQTNQLSFWRVFKTGDLPIKASYLIMGSANFANKQKIKGLLFLLLQISFIAWFIFYGFQALKMLQTLGTKAQSWVMDDSLGIEVQEAGDNSMLLLLFGIVAIMICMAFVVLYIVNLRSTRKIFQLKKAGKKIPNLREDLSSLLNENFYITLISLPFLGVLLFTVLPLVYMTSIAFTSYDHNHLPPKNLFHWVGFSNFNEMIHGDIAGTFFPIFIWTIVWAILATITTFFFGILLALLINTKGIKGKKVWRTIFVITMAVPQFVSLLIMANLFNNSGPINTLLQKWQWITQPISFLTNGIMAKITIIIVNMWVGIPVTMLVTTSILTNLPKDQIEAAELDGATKVQIFKKITFPQILFVMFPSLIQQFITNINNFNVIFLLTGGQPANSNYYSAGETDLLVTWLYKLTVTVADYNLASVIGIIIFILSATFSLLAYTRSNSFKTEGV
>NC_018265.1|WP_014868598.1|122835_123675_+|sugar-ABC-transporter-permease
MKTTKKTGLIFCYGLLTLLAIVWLFPIVWIIVTSFREEGGTFVTYFIPKQWTIKNYQLLLTSSTYPFVQWFINTLIVASFSCLISTLSTIAIAYSLSRLRFKMRKSFLKIALVLNMFPGFMSMIAVYYILKAMNLTGSLFALILVYSSASALAFYIAKGFFDTIPKTLDESAMMDGANRYQIFISITLPLSKPMIVYTALTTFMIPWMDFIFAKIILGDNVNKYTVAIGLFTMQTKDNMNKYFMAFTAGCVLIAVPITLLFIFIQKYYVEGITSGSVKE
>NC_018265.1|WP_013774769.1|124307_124850_+|phenolic-acid-decarboxylase
MSKKIFKTLSDFLGTHFIYTYDNGWEYEWYAKNDHTVDYRIHGGMVAGRWVTDQQADIVMLTEGIYKVAWTEPTGTDVVLDFVPNENKLNGTIFFPKWVQDHPEITVTYQNEHIDLMEESREKYETYPKLMVPEFATITYIGNAGLNNDDVISEAPYKELPDDIRNGRYFDQEYKRINRC
>NC_018265.1|WP_014868599.1|125438_126113_+|WxL-domain-containing-protein
MKKKFLATCTVGIIIIPLTSLNTFAEENNQQPISSATSKTDLTLKSGSGENTKPIIPTDPVDPDPSTGNKGSLTIPYASNITFGENEIQAVDTDYLALNRAPYVQVNDVRGGASGWTLSASITSFKGTNGKELTGAQLSLSNGKIVAGSDGLVSPQQLANAYVLNSDKTAIMQAKPGQGAGAFALVFEGKEKENENVKLHVPRKNVEAQAYTAAITWDLSDAPM
>NC_018265.1|WP_126347313.1|126180_127152_+|DUF916-and-DUF3324-domain-containing-protein
MPVYANEQQNKINFEIKAVLPENQLSDKTYYDLKVAPGQEQNLTLKLKNTSGHAIKVRINTNNATTNVNGMIDYSKHQQKMLGNPTFEEMIGSSQAVSLLPFEEKIVSFHLKIPKNGFKGTVLGGFYCYEEEMKNQTKQHKTQKNLVIANRFSYTIGVQLTCTNDKVKPNIQLTKIKPGLSNGYLTIFSTIENRAPLLLSQLSMKATITKKNQQNILYREEKTISLAPRSLFELPINLNNSPLKKGIYLLTIKLIDENGKNWRLQKEFVINNLDEKLNDQAVEVKEEKKDNSLFYFYLLLALCLIIIFGLIIYIVLLKKTKKR
>NC_018265.1|WP_014868601.1|127461_129570_+|hypothetical-protein
MKNKLLIIFVTLTCFIFCFFMINIQESYADPITQLPNFQYSGTMLPESKDIFNFRYGKNTYFKKLSGEVLNGEKLYVNKTPSEAQAMIYHIGYYQGKNINVKITLTGRAGGLYINKKDFLNIDLDIGGWITIKFEFFDQANNPVSIPLTTNWNKINKQVSLKIGKDKIRYLIADPTNQFTYKEESNGELTLQNNVTSAVDTGINSSLQCILYPTTEVSFNFNHKQGYNSYIKYNHENLNASMLSNAYGLDERFDTFNSNDLTLTAVQDISNNIADESNASNGKLNALATNFRKEIDSLPFSQYKIDGFQVLDSDGNNLTDLFSLSVKDENDIILIARNPKDNRLYNTTLMYLVKLKWIGSEEKPVDPGRIDNNGYLKVPFEVQTTSIPNNTFISKGQSSIFYKGNININFVDIDNPEKILRDPLTIPSILTLSFDLSKEYPDIPNYQPVFTPSNDSENNDKGILLEKTKEITHQYLRKNNIHFEILDKDSLTINQGTQTEVTMNFSVSLELSDAYDLYGEYNGKRQLIHHYTTSNGKKDSLTFNIPKEWIGKKVIFYVVSNHYNTESNKEERQIIAREPELRVPPIFSFGETEIKNDKYGILLPDALKNEIKVIDDAQVKWKINVKEMLPFSAKNKEQLLERIHFTIKGKEYILNQEDQTILTGETSTQLDKNDSIFIIITPADKPGKYQGILEWTLLNGPS
>NC_018265.1|WP_014868602.1|130170_130563_+|hypothetical-protein
MEIEWGSLSEWVAGISKVISVAGAIIYPIIQAKKNREKAIQKIIRIEWRLASYIVKEQHEHPEIDIKELYSYQEFMKNYSRTMLIGEDDQLLDLTRKLKELLVKLADKNRSSDTKEISEMLDYLKEKYKL
>NC_018265.1|WP_014868603.1|130580_130952_+|hypothetical-protein
MEIGSLASWVEGISESLALIVALFLPIVTEKQNSKQTQQRLQRIGVRSAYQIVEEKQKHPDQLITETENYKEFNQYITTVSIINDDQQTVTVLMEMNELLQGLDRDAYTIEEAKSKIKELEKE
>NC_018265.1|WP_014868604.1|131089_131962_-|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha
MYLSIEEFITAAEKTGKSLSDLMIEQEMEQSQMSFDDVWNIMEQNLQTMENAVKRSQEGEGVFSSTGLTGGDAIKLKNYRENHQPLSGELMMKGIQAAIGTNEVNAAMGVICATPTAGAAGTLPGVLFTINETLDLSKEQMIRFLFAAGLFGIVVANNACIAGATGGCQAEVGSASAMAAAAAVEVAGGTPRQSAEAFSIAMQNLLGLVCDPVAGLVEIPCINRNAIGAGNALIAADMALADIKNKIPADQVVSAMGEIGATLPASLRETGLGGVAGTDAGKEMKKRIFG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP006684	Melissococcus plutonius S1 plasmid pMEPL_178, complete sequence	72811-72843	0	1.0
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_AP021886	Melissococcus plutonius strain DAT1033 plasmid pMP1, complete sequence	72809-72841	0	1.0
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_AP018525	Melissococcus plutonius strain DAT585 plasmid pMP1, complete sequence	72911-72943	0	1.0
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NC_018265	Melissococcus plutonius DAT561 plasmid 1, complete sequence	119629-119661	0	1.0
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP017620	Salmonella enterica subsp. enterica serovar Typhimurium strain 22792 plasmid unnamed1, complete sequence	69518-69550	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP041027	Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain SA20143792 plasmid pSA20143792.1, complete sequence	19402-19434	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP017618	Salmonella enterica subsp. enterica serovar Typhimurium strain 22495 plasmid unnamed1, complete sequence	61854-61886	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP014980	Salmonella enterica subsp. enterica serovar Typhimurium str. CDC H2662 plasmid pSTY1-H2662, complete sequence	63290-63322	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP014970	Salmonella enterica subsp. enterica serovar Typhimurium str. USDA-ARS-USMARC-1808 isolate ST1126-1 plasmid pSTY1-1808, complete sequence	63252-63284	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP014968	Salmonella enterica subsp. enterica serovar Typhimurium str. CDC 2011K-1702 plasmid pSTY1-2011K-1702, complete sequence	63254-63286	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP037873	Salmonella enterica subsp. enterica serovar 4,[5],12:i:- strain PNCS014854 plasmid pPNCS014854_S1, complete sequence	57557-57589	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP040669	Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain SA20082869 plasmid pSA20082869.1, complete sequence	102162-102194	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP014973	Salmonella enterica subsp. enterica serovar Typhimurium str. USDA-ARS-USMARC-1898 isolate ST073 plasmid pSTY2-1898, complete sequence	63189-63221	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	CP038435	Salmonella enterica subsp. enterica serovar Typhimurium strain E40V plasmid unnamed, complete sequence	57545-57577	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP014976	Salmonella enterica subsp. enterica serovar Typhimurium str. CDC 2009K-1640 plasmid pSTY1-2009K-1640, complete sequence	63266-63298	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NC_017054	Salmonella enterica subsp. enterica serovar Typhimurium str. 798 plasmid p798_93, complete sequence	63114-63146	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP047324	Salmonella enterica subsp. enterica serovar Typhimurium strain RM13672 plasmid pRM13672, complete sequence	63168-63200	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP014537	Salmonella enterica subsp. enterica serovar Typhimurium strain SO3 isolate SOHS 02-68 plasmid pSO3_STV, complete sequence	63180-63212	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NC_022570	Salmonella enterica subsp. enterica serovar Typhimurium str. DT104 unnamed plasmid, complete sequence	63271-63303	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP039560	Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014846 plasmid p08-4425.2, complete sequence	93134-93166	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP039586	Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014859 plasmid p11-0225.1, complete sequence	93223-93255	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_LN999012	Salmonella enterica subsp. enterica serovar Typhimurium str. DT2 plasmid pSLT, complete sequence	63180-63212	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	CP038433	Salmonella enterica subsp. enterica serovar Typhimurium strain E40 plasmid unnamed, complete sequence	57545-57577	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP016390	Salmonella enterica subsp. enterica serovar Typhimurium strain 13-931 plasmid pSLT931, complete sequence	63191-63223	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP025556	Salmonella enterica subsp. enterica serovar Typhimurium strain PIR00538 plasmid pPIR00538, complete sequence	10556-10588	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP039855	Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014864 plasmid p11-0972.1, complete sequence	93193-93225	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP034231	Salmonella enterica subsp. enterica serovar Typhimurium strain ATCC 14028 plasmid pATCC14028, complete sequence	12249-12281	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NC_014476	Salmonella enterica subsp. enterica serovar Typhimurium plasmid pYT1 DNA, complete sequence	79073-79105	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP017729	Salmonella enterica subsp. enterica serovar Typhimurium str. SARA13 plasmid pSARA13, complete sequence	48394-48426	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP008745	Salmonella enterica subsp. enterica serovar Typhimurium strain VNP20009 plasmid pSLT_VNP20009, complete sequence	63168-63200	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP007582	Salmonella enterica subsp. enterica serovar Typhimurium strain 138736 plasmid, complete sequence	61805-61837	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP039566	Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014849 plasmid p08-7727.1, complete sequence	93134-93166	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NC_013437	Salmonella enterica subsp. enterica serovar Typhimurium plasmid pSLT-BT, complete sequence	82979-83011	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NC_019001	Salmonella enterica subsp. enterica serovar Typhimurium plasmid pYT2, complete sequence	99245-99277	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	CP051281	Salmonella enterica subsp. enterica serovar Typhimurium strain OLF-FSR1_WB_Junco_ST-35 plasmid pST35-99574.1A, complete sequence	75716-75748	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_AP014566	Salmonella enterica subsp. enterica serovar Typhimurium str. L-3553 plasmid pST3553, complete sequence	99014-99046	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	LN794247	Salmonella enterica subsp. enterica serovar Typhimurium plasmid pSBLT, complete sequence	97834-97866	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP041974	Salmonella enterica subsp. enterica serovar Typhimurium strain NCCP 16207 plasmid unnamed1, complete sequence	25556-25588	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP039580	Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014857 plasmid p10-3881.1, complete sequence	110229-110261	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP039583	Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014858 plasmid p10-8609.1, complete sequence	93296-93328	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP044969	Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS007098 plasmid pPNCS007087.2, complete sequence	91520-91552	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP039596	Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014865 plasmid p12-4331.1, complete sequence	93134-93166	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP039592	Salmonella enterica subsp. enterica serovar Typhimurium strain PNCS014862 plasmid p11-0500.1, complete sequence	93294-93326	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP039568	Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014850 plasmid p08-8136.1, complete sequence	93133-93165	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	CP014577	Salmonella enterica subsp. enterica serovar Typhimurium strain RM9437 plasmid pRM9437, complete sequence	63187-63219	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	CP013721	Salmonella enterica subsp. enterica serovar Typhimurium strain RM10607 plasmid pRM10607, complete sequence	63182-63214	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NC_016864	Salmonella enterica subsp. enterica serovar Typhimurium str. UK-1 plasmid pSTUK-100, complete sequence	44979-45011	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP020113	Salmonella enterica subsp. enterica serovar Typhimurium str. USDA-ARS-USMARC-1810 plasmid pSTY1-1810, complete sequence	109078-109110	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP014962	Salmonella enterica subsp. enterica serovar Typhimurium str. USDA-ARS-USMARC-1899 plasmid pSTY1-1899, complete sequence	63187-63219	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	CP053407	Salmonella enterica strain 87-0091 plasmid unnamed, complete sequence	32718-32750	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NC_016861	Salmonella enterica subsp. enterica serovar Typhimurium str. T000240 plasmid pSTMDT12_L, complete sequence	75774-75806	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP021464	Salmonella enterica subsp. enterica serovar Typhimurium strain UGA14 plasmid pUGA14_2, complete sequence	95843-95875	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP014050	Salmonella enterica strain FDAARGOS_94 plasmid unnamed, complete sequence	5666-5698	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP038848	Salmonella enterica subsp. enterica serovar Typhimurium strain PNCS014851 plasmid p09-0499.1, complete sequence	93158-93190	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP050736	Salmonella enterica subsp. enterica serovar Typhimurium strain ST90 plasmid pST90-2, complete sequence	34401-34433	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP040565	Salmonella enterica subsp. enterica serovar Typhimurium strain SAP17-7699 plasmid pCFSAN059544, complete sequence	12096-12128	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NC_003277	Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 plasmid pSLT, complete sequence	63188-63220	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP051268	Salmonella enterica subsp. enterica serovar Typhimurium strain OLF-FSR1_WB_Hawk_ST-33 plasmid pST33-93798, complete sequence	42823-42855	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NC_016855	Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S plasmid unnamed, complete sequence	63168-63200	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_LT855377	Salmonella enterica subsp. enterica serovar Typhimurium isolate STMU2UK plasmid 2	63198-63230	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP014359	Salmonella enterica subsp. enterica serovar Typhimurium strain YU15 plasmid pYU15_94, complete sequence	63277-63309	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP015158	Salmonella enterica subsp. enterica serovar Typhimurium strain NC983 plasmid unnamed, complete sequence	63165-63197	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP014357	Salmonella enterica subsp. enterica serovar Typhimurium strain SO2 isolate SOHS 02-20 plasmid pSO2_STV, complete sequence	63173-63205	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP023469	Salmonella enterica subsp. enterica strain BAA-1586 plasmid pSalMiami, complete sequence	64066-64098	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP050741	Salmonella enterica subsp. enterica serovar Typhimurium strain ST56 plasmid pST56-2, complete sequence	19715-19747	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP040901	Salmonella enterica subsp. enterica serovar Typhimurium strain SAP18-6199 plasmid pCFSAN074387, complete sequence	57566-57598	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP040322	Salmonella enterica subsp. enterica serovar Typhimurium strain PNCS014879 plasmid p16-6397.1, complete sequence	93207-93239	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP015599	Salmonella enterica strain FORC_030 plasmid pFORC_030, complete sequence	58310-58342	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP026701	Salmonella enterica subsp. enterica serovar Typhimurium strain AR_0031 plasmid unitig_1_pilon, complete sequence	23282-23314	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	KX777254	Salmonella enterica subsp. enterica serovar Typhimurium plasmid pSTV-Mu1, complete sequence	61237-61269	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP046282	Salmonella enterica strain FDAARGOS_687 plasmid unnamed1, complete sequence	46916-46948	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP035302	Salmonella enterica subsp. enterica strain ST1539 plasmid pST1539, complete sequence	58730-58762	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP040569	Salmonella enterica subsp. enterica serovar Typhimurium strain SAP17-8290 plasmid pCFSAN059542, complete sequence	25030-25062	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP037876	Salmonella enterica subsp. enterica serovar 4,[5],12:i:- strain PNCS015054 plasmid pPNCS015054_S3, complete sequence	31858-31890	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP020923	Salmonella enterica subsp. enterica strain 16A242 plasmid unnamed1, complete sequence	50562-50594	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP039577	Salmonella enterica subsp. enterica serovar Typhimurium strain PNCS014856 plasmid p10-3857.1, complete sequence	44063-44095	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP034480	Salmonella enterica subsp. enterica serovar Typhimurium strain 14028 plasmid unnamed, complete sequence	48245-48277	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP050746	Salmonella enterica subsp. enterica serovar Typhimurium strain ST53 plasmid pST53-1, complete sequence	60166-60198	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP053871	Salmonella enterica subsp. enterica serovar Typhimurium strain SS2017 plasmid pSS2017-1, complete sequence	31970-32002	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP053866	Salmonella enterica subsp. enterica serovar Typhimurium strain SL7207 plasmid pSL7202-1, complete sequence	30632-30664	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP041006	Salmonella enterica strain FDAARGOS_768 plasmid unnamed1, complete sequence	43731-43763	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP022137	Salmonella enterica subsp. diarizonae serovar 65:c:z str. SA20044251 plasmid unnamed2, complete sequence	54466-54498	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP029594	Salmonella enterica strain DA34827 plasmid pDA34827-94, complete sequence	12503-12535	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	CP051287	Salmonella enterica subsp. enterica serovar Typhimurium strain OLF-FSR1_WB_Gull_ST-29 plasmid pST29-94038, complete sequence	41572-41604	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP034720	Salmonella enterica subsp. enterica serovar Typhimurium strain RSE04 plasmid pRSE04, complete sequence	48317-48349	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP029596	Salmonella enterica strain DA34833 plasmid pDA34833-94, complete sequence	39378-39410	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	CP051277	Salmonella enterica subsp. enterica serovar Typhimurium strain OLF-FSR1_WB_Sparrow_ST-87 plasmid pST87-92921, complete sequence	64932-64964	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_LS997974	Salmonella enterica subsp. enterica serovar Typhimurium strain D23580 isolate D23580_liv plasmid D23580_liv_pSLT-BT	48221-48253	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP044959	Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS007087 plasmid pPNCS007087.2, complete sequence	48245-48277	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP029838	Salmonella enterica subsp. enterica serovar Typhimurium strain 10ST07093 plasmid p10ST07093B, complete sequence	8635-8667	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NC_019108	Salmonella enterica subsp. enterica serovar Typhimurium plasmid pSal6919a, complete sequence	33421-33453	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NC_019109	Salmonella enterica subsp. enterica serovar Typhimurium plasmid pSal8934b, complete sequence	33421-33453	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP018634	Salmonella enterica subsp. enterica serovar Enteritidis strain 49-2444 plasmid pSE49-2444, complete sequence	1896-1928	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP022071	Salmonella enterica subsp. enterica serovar Typhimurium strain FDAARGOS_321 plasmid unnamed1, complete sequence	12443-12475	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP029841	Salmonella enterica subsp. enterica serovar Typhimurium strain 01ST04081 plasmid p01ST04081A, complete sequence	48245-48277	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP027413	Salmonella enterica subsp. enterica serovar Typhimurium strain FDAARGOS_320 plasmid unnamed2, complete sequence	44014-44046	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP027409	Salmonella enterica subsp. enterica serovar Typhimurium strain FDAARGOS_317 plasmid unnamed, complete sequence	42055-42087	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP018658	Salmonella enterica subsp. enterica serovar Enteritidis strain 92-0392 plasmid pSE92-0392, complete sequence	57287-57319	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP028200	Salmonella enterica subsp. enterica serovar Typhimurium strain CFSAN018746 plasmid pGMI14-001, complete sequence	339-371	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NC_021155	Salmonella enterica subsp. enterica serovar Typhimurium str. U288 plasmid pSTU288-1, complete sequence	73920-73952	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP028319	Salmonella enterica subsp. enterica serovar Typhimurium var. 5- strain CFSAN067216 plasmid pSC-09-1, complete sequence	59214-59246	9	0.727
NC_018265_1	1.1\|119629\|33\|NC_018265\|CRISPRCasFinder	119629-119661	33	NZ_CP045950	Salmonella enterica subsp. enterica serovar Typhimurium strain AUSMDU00010529 plasmid pAUSMDU00010529_01, complete sequence	48257-48289	9	0.727

1. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP006684 (Melissococcus plutonius S1 plasmid pMEPL_178, complete sequence) position: , mismatch: 0, identity: 1.0

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
ggttttctctccgcccttttttccgttttcttc	Protospacer
*********************************

2. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_AP021886 (Melissococcus plutonius strain DAT1033 plasmid pMP1, complete sequence) position: , mismatch: 0, identity: 1.0

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
ggttttctctccgcccttttttccgttttcttc	Protospacer
*********************************

3. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_AP018525 (Melissococcus plutonius strain DAT585 plasmid pMP1, complete sequence) position: , mismatch: 0, identity: 1.0

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
ggttttctctccgcccttttttccgttttcttc	Protospacer
*********************************

4. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NC_018265 (Melissococcus plutonius DAT561 plasmid 1, complete sequence) position: , mismatch: 0, identity: 1.0

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
ggttttctctccgcccttttttccgttttcttc	Protospacer
*********************************

5. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP017620 (Salmonella enterica subsp. enterica serovar Typhimurium strain 22792 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

6. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP041027 (Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain SA20143792 plasmid pSA20143792.1, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

7. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP017618 (Salmonella enterica subsp. enterica serovar Typhimurium strain 22495 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

8. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP014980 (Salmonella enterica subsp. enterica serovar Typhimurium str. CDC H2662 plasmid pSTY1-H2662, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

9. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP014970 (Salmonella enterica subsp. enterica serovar Typhimurium str. USDA-ARS-USMARC-1808 isolate ST1126-1 plasmid pSTY1-1808, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

10. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP014968 (Salmonella enterica subsp. enterica serovar Typhimurium str. CDC 2011K-1702 plasmid pSTY1-2011K-1702, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

11. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP037873 (Salmonella enterica subsp. enterica serovar 4,[5],12:i:- strain PNCS014854 plasmid pPNCS014854_S1, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

12. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP040669 (Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain SA20082869 plasmid pSA20082869.1, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

13. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP014973 (Salmonella enterica subsp. enterica serovar Typhimurium str. USDA-ARS-USMARC-1898 isolate ST073 plasmid pSTY2-1898, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

14. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to CP038435 (Salmonella enterica subsp. enterica serovar Typhimurium strain E40V plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

15. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP014976 (Salmonella enterica subsp. enterica serovar Typhimurium str. CDC 2009K-1640 plasmid pSTY1-2009K-1640, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

16. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NC_017054 (Salmonella enterica subsp. enterica serovar Typhimurium str. 798 plasmid p798_93, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

17. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP047324 (Salmonella enterica subsp. enterica serovar Typhimurium strain RM13672 plasmid pRM13672, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

18. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP014537 (Salmonella enterica subsp. enterica serovar Typhimurium strain SO3 isolate SOHS 02-68 plasmid pSO3_STV, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

19. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NC_022570 (Salmonella enterica subsp. enterica serovar Typhimurium str. DT104 unnamed plasmid, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

20. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP039560 (Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014846 plasmid p08-4425.2, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

21. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP039586 (Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014859 plasmid p11-0225.1, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

22. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_LN999012 (Salmonella enterica subsp. enterica serovar Typhimurium str. DT2 plasmid pSLT, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

23. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to CP038433 (Salmonella enterica subsp. enterica serovar Typhimurium strain E40 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

24. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP016390 (Salmonella enterica subsp. enterica serovar Typhimurium strain 13-931 plasmid pSLT931, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

25. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP025556 (Salmonella enterica subsp. enterica serovar Typhimurium strain PIR00538 plasmid pPIR00538, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

26. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP039855 (Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014864 plasmid p11-0972.1, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

27. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP034231 (Salmonella enterica subsp. enterica serovar Typhimurium strain ATCC 14028 plasmid pATCC14028, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

28. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NC_014476 (Salmonella enterica subsp. enterica serovar Typhimurium plasmid pYT1 DNA, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

29. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP017729 (Salmonella enterica subsp. enterica serovar Typhimurium str. SARA13 plasmid pSARA13, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

30. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP008745 (Salmonella enterica subsp. enterica serovar Typhimurium strain VNP20009 plasmid pSLT_VNP20009, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

31. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP007582 (Salmonella enterica subsp. enterica serovar Typhimurium strain 138736 plasmid, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

32. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP039566 (Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014849 plasmid p08-7727.1, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

33. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NC_013437 (Salmonella enterica subsp. enterica serovar Typhimurium plasmid pSLT-BT, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

34. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NC_019001 (Salmonella enterica subsp. enterica serovar Typhimurium plasmid pYT2, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

35. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to CP051281 (Salmonella enterica subsp. enterica serovar Typhimurium strain OLF-FSR1_WB_Junco_ST-35 plasmid pST35-99574.1A, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

36. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_AP014566 (Salmonella enterica subsp. enterica serovar Typhimurium str. L-3553 plasmid pST3553, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

37. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to LN794247 (Salmonella enterica subsp. enterica serovar Typhimurium plasmid pSBLT, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

38. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP041974 (Salmonella enterica subsp. enterica serovar Typhimurium strain NCCP 16207 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

39. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP039580 (Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014857 plasmid p10-3881.1, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

40. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP039583 (Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014858 plasmid p10-8609.1, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

41. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP044969 (Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS007098 plasmid pPNCS007087.2, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

42. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP039596 (Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014865 plasmid p12-4331.1, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

43. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP039592 (Salmonella enterica subsp. enterica serovar Typhimurium strain PNCS014862 plasmid p11-0500.1, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

44. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP039568 (Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014850 plasmid p08-8136.1, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

45. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to CP014577 (Salmonella enterica subsp. enterica serovar Typhimurium strain RM9437 plasmid pRM9437, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

46. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to CP013721 (Salmonella enterica subsp. enterica serovar Typhimurium strain RM10607 plasmid pRM10607, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

47. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NC_016864 (Salmonella enterica subsp. enterica serovar Typhimurium str. UK-1 plasmid pSTUK-100, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

48. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP020113 (Salmonella enterica subsp. enterica serovar Typhimurium str. USDA-ARS-USMARC-1810 plasmid pSTY1-1810, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

49. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP014962 (Salmonella enterica subsp. enterica serovar Typhimurium str. USDA-ARS-USMARC-1899 plasmid pSTY1-1899, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

50. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to CP053407 (Salmonella enterica strain 87-0091 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

51. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NC_016861 (Salmonella enterica subsp. enterica serovar Typhimurium str. T000240 plasmid pSTMDT12_L, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

52. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP021464 (Salmonella enterica subsp. enterica serovar Typhimurium strain UGA14 plasmid pUGA14_2, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

53. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP014050 (Salmonella enterica strain FDAARGOS_94 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

54. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP038848 (Salmonella enterica subsp. enterica serovar Typhimurium strain PNCS014851 plasmid p09-0499.1, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

55. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP050736 (Salmonella enterica subsp. enterica serovar Typhimurium strain ST90 plasmid pST90-2, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

56. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP040565 (Salmonella enterica subsp. enterica serovar Typhimurium strain SAP17-7699 plasmid pCFSAN059544, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

57. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NC_003277 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 plasmid pSLT, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

58. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP051268 (Salmonella enterica subsp. enterica serovar Typhimurium strain OLF-FSR1_WB_Hawk_ST-33 plasmid pST33-93798, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

59. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NC_016855 (Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

60. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_LT855377 (Salmonella enterica subsp. enterica serovar Typhimurium isolate STMU2UK plasmid 2) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

61. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP014359 (Salmonella enterica subsp. enterica serovar Typhimurium strain YU15 plasmid pYU15_94, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

62. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP015158 (Salmonella enterica subsp. enterica serovar Typhimurium strain NC983 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

63. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP014357 (Salmonella enterica subsp. enterica serovar Typhimurium strain SO2 isolate SOHS 02-20 plasmid pSO2_STV, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

64. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP023469 (Salmonella enterica subsp. enterica strain BAA-1586 plasmid pSalMiami, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

65. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP050741 (Salmonella enterica subsp. enterica serovar Typhimurium strain ST56 plasmid pST56-2, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

66. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP040901 (Salmonella enterica subsp. enterica serovar Typhimurium strain SAP18-6199 plasmid pCFSAN074387, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

67. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP040322 (Salmonella enterica subsp. enterica serovar Typhimurium strain PNCS014879 plasmid p16-6397.1, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

68. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP015599 (Salmonella enterica strain FORC_030 plasmid pFORC_030, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

69. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP026701 (Salmonella enterica subsp. enterica serovar Typhimurium strain AR_0031 plasmid unitig_1_pilon, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

70. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to KX777254 (Salmonella enterica subsp. enterica serovar Typhimurium plasmid pSTV-Mu1, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

71. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP046282 (Salmonella enterica strain FDAARGOS_687 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

72. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP035302 (Salmonella enterica subsp. enterica strain ST1539 plasmid pST1539, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

73. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP040569 (Salmonella enterica subsp. enterica serovar Typhimurium strain SAP17-8290 plasmid pCFSAN059542, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

74. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP037876 (Salmonella enterica subsp. enterica serovar 4,[5],12:i:- strain PNCS015054 plasmid pPNCS015054_S3, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

75. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP020923 (Salmonella enterica subsp. enterica strain 16A242 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

76. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP039577 (Salmonella enterica subsp. enterica serovar Typhimurium strain PNCS014856 plasmid p10-3857.1, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

77. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP034480 (Salmonella enterica subsp. enterica serovar Typhimurium strain 14028 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

78. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP050746 (Salmonella enterica subsp. enterica serovar Typhimurium strain ST53 plasmid pST53-1, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

79. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP053871 (Salmonella enterica subsp. enterica serovar Typhimurium strain SS2017 plasmid pSS2017-1, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

80. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP053866 (Salmonella enterica subsp. enterica serovar Typhimurium strain SL7207 plasmid pSL7202-1, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

81. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP041006 (Salmonella enterica strain FDAARGOS_768 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

82. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP022137 (Salmonella enterica subsp. diarizonae serovar 65:c:z str. SA20044251 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

83. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP029594 (Salmonella enterica strain DA34827 plasmid pDA34827-94, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

84. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to CP051287 (Salmonella enterica subsp. enterica serovar Typhimurium strain OLF-FSR1_WB_Gull_ST-29 plasmid pST29-94038, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

85. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP034720 (Salmonella enterica subsp. enterica serovar Typhimurium strain RSE04 plasmid pRSE04, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

86. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP029596 (Salmonella enterica strain DA34833 plasmid pDA34833-94, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

87. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to CP051277 (Salmonella enterica subsp. enterica serovar Typhimurium strain OLF-FSR1_WB_Sparrow_ST-87 plasmid pST87-92921, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

88. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_LS997974 (Salmonella enterica subsp. enterica serovar Typhimurium strain D23580 isolate D23580_liv plasmid D23580_liv_pSLT-BT) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

89. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP044959 (Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS007087 plasmid pPNCS007087.2, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

90. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP029838 (Salmonella enterica subsp. enterica serovar Typhimurium strain 10ST07093 plasmid p10ST07093B, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

91. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NC_019108 (Salmonella enterica subsp. enterica serovar Typhimurium plasmid pSal6919a, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

92. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NC_019109 (Salmonella enterica subsp. enterica serovar Typhimurium plasmid pSal8934b, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

93. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP018634 (Salmonella enterica subsp. enterica serovar Enteritidis strain 49-2444 plasmid pSE49-2444, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

94. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP022071 (Salmonella enterica subsp. enterica serovar Typhimurium strain FDAARGOS_321 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

95. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP029841 (Salmonella enterica subsp. enterica serovar Typhimurium strain 01ST04081 plasmid p01ST04081A, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

96. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP027413 (Salmonella enterica subsp. enterica serovar Typhimurium strain FDAARGOS_320 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

97. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP027409 (Salmonella enterica subsp. enterica serovar Typhimurium strain FDAARGOS_317 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

98. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP018658 (Salmonella enterica subsp. enterica serovar Enteritidis strain 92-0392 plasmid pSE92-0392, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

99. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP028200 (Salmonella enterica subsp. enterica serovar Typhimurium strain CFSAN018746 plasmid pGMI14-001, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

100. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NC_021155 (Salmonella enterica subsp. enterica serovar Typhimurium str. U288 plasmid pSTU288-1, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

101. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP028319 (Salmonella enterica subsp. enterica serovar Typhimurium var. 5- strain CFSAN067216 plasmid pSC-09-1, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

102. spacer 1.1|119629|33|NC_018265|CRISPRCasFinder matches to NZ_CP045950 (Salmonella enterica subsp. enterica serovar Typhimurium strain AUSMDU00010529 plasmid pAUSMDU00010529_01, complete sequence) position: , mismatch: 9, identity: 0.727

ggttttctctccgcccttttttccgttttcttc	CRISPR spacer
aggagcttccccgcccttttttcagttttctta	Protospacer
.*   ..**.************* ********

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_016938

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NC_018265

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection