CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NC_017668	Halobacillus halophilus DSM 2266, complete genome	2 crisprs	csa3,RT,cas14j,cas3,DEDDh,DinG	0	4
NC_017670	Halobacillus halophilus DSM 2266 plasmid PL3, complete sequence	0 crisprs	NA	0	0
NC_017669	Halobacillus halophilus DSM 2266 plasmid PL16, complete sequence	1 crisprs	NA	1	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_017668_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_017668_1

1271191-1271285

TypeV

Consensus_repeat	Method
AAAGTGGAAACGTTTCCACTTTT	CRISPRCasFinder

1 spacers

cas14j

The CRISPR arrays of NC_017668_1

>merge|NC_017668|1|1271191-1271285|CRISPRCasFinder
AAAGTGGAAACGTTTCCACTTTTTGCTCAGTCGTTTTGAATAGGCCGCAAACGTTGCTTTATTTTTTACCCTAAAGTGGAAACGTTTCCACTTTG

>NC_017668|1|1|1271191-1271285|CRISPRCasFinder
AAAGTGGAAACGTTTCCACTTTT	TGCTCAGTCGTTTTGAATAGGCCGCAAACGTTGCTTTATTTTTTACCCT
AAAGTGGAAACGTTTCCACTTTG

Protein	Signature genes	Signature genes Name	Protein_function
NC_017668.1\|WP_014642503.1\|1265941_1266580_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225239
NC_017668.1\|WP_014642499.1\|1257679_1258216_+\|signal-peptidase-I	unknown	unknown	gnl\|CDD\|274044
NC_017668.1\|WP_014642501.1\|1261869_1265571_+\|helicase-exonuclease-AddAB-subunit-AddA	unknown	unknown	gnl\|CDD\|274299
NC_017668.1\|WP_014642509.1\|1275083_1275947_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|224747
NC_017668.1\|WP_014642515.1\|1278116_1279307_+\|DUF418-domain-containing-protein	unknown	unknown	gnl\|CDD\|225193
NC_017668.1\|WP_014642510.1\|1276118_1276337_-\|spore-germination-protein	unknown	unknown	gnl\|CDD\|371190
NC_017668.1\|WP_014642502.1\|1265571_1265859_+\|HNH-endonuclease	unknown	unknown	unknown
NC_017668.1\|WP_014642505.1\|1268799_1269930_-\|IS200/IS605-family-element-transposase-accessory-protein-TnpB	cas14j	-	gnl\|CDD\|223747
NC_017668.1\|WP_041601229.1\|1270147_1271116_+\|LacI-family-DNA-binding-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380514
NC_017668.1\|WP_014642500.1\|1258369_1261876_+\|helicase-exonuclease-AddAB-subunit-AddB	unknown	unknown	gnl\|CDD\|213736
NC_017668.1\|WP_014642507.1\|1271318_1272737_+\|PTS-transporter-subunit-EIIC	unknown	unknown	gnl\|CDD\|131051
NC_017668.1\|WP_145956006.1\|1276406_1276775_-\|spore-germination-protein-GerPE	unknown	unknown	gnl\|CDD\|287884
NC_017668.1\|WP_014642513.1\|1277570_1277798_-\|germination-protein-KA	unknown	unknown	gnl\|CDD\|313906
NC_017668.1\|WP_014642504.1\|1267831_1268596_-\|DUF4397-domain-containing-protein	unknown	unknown	gnl\|CDD\|379570
NC_017668.1\|WP_014642498.1\|1256976_1257624_+\|TVP38/TMEM64-family-protein	unknown	unknown	gnl\|CDD\|223475
NC_017668.1\|WP_145956096.1\|1276976_1277483_-\|spore-gernimation-protein-GerPC	unknown	unknown	gnl\|CDD\|371215
NC_017668.1\|WP_014642514.1\|1277809_1278031_-\|spore-germination-protein	unknown	unknown	gnl\|CDD\|371190
NC_017668.1\|WP_014642497.1\|1256346_1256763_-\|hypothetical-protein	unknown	unknown	unknown
NC_017668.1\|WP_041601581.1\|1272927_1274370_+\|sucrose-6-phosphate-hydrolase	unknown	unknown	gnl\|CDD\|273554
NC_017668.1\|WP_041601230.1\|1276767_1276980_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NC_017668.1\|WP_014642503.1\|1265941_1266580_-\|hypothetical-protein	gnl\|CDD\|225239	COG2364, COG2364, Predicted membrane protein [Function unknown].	1.05163e-25
NC_017668.1\|WP_014642499.1\|1257679_1258216_+\|signal-peptidase-I	gnl\|CDD\|274044	TIGR02227, Inactive_signal_peptidase_IA., signal peptidase I, bacterial type. This model represents signal peptidase I from most bacteria. Eukaryotic sequences are likely organellar. Several bacteria have multiple paralogs, but these represent isozymes of signal peptidase I. Virtually all known bacteria may be presumed to A related model finds a simlar protein in many archaea and a few bacteria, as well as a microsomal (endoplasmic reticulum) protein in eukaryotes. [Protein fate, Protein and peptide secretion and trafficking].	2.58233e-54
NC_017668.1\|WP_014642501.1\|1261869_1265571_+\|helicase-exonuclease-AddAB-subunit-AddA	gnl\|CDD\|274299	TIGR02785, ATP-dependent_helicase/nuclease_subunit_A, helicase-exonuclease AddAB, AddA subunit, Firmicutes type. AddAB, also called RexAB, substitutes for RecBCD in several bacterial lineages. These DNA recombination proteins act before synapse and are particularly important for DNA repair of double-stranded breaks by homologous recombination. The term AddAB is used broadly, with AddA homologous between the Firmicutes (as modeled here) and the alphaproteobacteria, while the partner AddB proteins show no strong homology across the two groups of species. [DNA metabolism, DNA replication, recombination, and repair].	0
NC_017668.1\|WP_014642515.1\|1278116_1279307_+\|DUF418-domain-containing-protein	gnl\|CDD\|225193	COG2311, COG2311, Predicted membrane protein [Function unknown].	2.39529e-82
NC_017668.1\|WP_014642510.1\|1276118_1276337_-\|spore-germination-protein	gnl\|CDD\|371190	pfam10676, gerPA, Spore germination protein gerPA/gerPF. This is a bacterial family of proteins that are required for the formation of functionally normal spores. Proteins in this family may be involved in establishing normal coat structure and/or permeability which could control the access of germinants to their receptor.	4.53194e-20
NC_017668.1\|WP_014642505.1\|1268799_1269930_-\|IS200/IS605-family-element-transposase-accessory-protein-TnpB	gnl\|CDD\|223747	COG0675, COG0675, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	1.7784e-57
NC_017668.1\|WP_041601229.1\|1270147_1271116_+\|LacI-family-DNA-binding-transcriptional-regulator	gnl\|CDD\|380514	cd06291, PBP1_Qymf-like, ligand binding domain of the lacI-like transcription regulator from a novel metal-reducing bacterium Alkaliphilus Metalliredigens (strain Qymf) and its close homologs. This group includes the ligand binding domain of the lacI-like transcription regulator from a novel metal-reducing bacterium Alkaliphilus metalliredigens (strain Qymf) and its close homologs. Qymf is a strict anaerobe that could be grown in the presence of borax and its cells are straight rods that produce endospores. This group is a member of the LacI-GalR family repressors that are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type 1 periplasmic binding protein-like fold. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA binding affinity of the repressor.	5.25476e-101
NC_017668.1\|WP_014642507.1\|1271318_1272737_+\|PTS-transporter-subunit-EIIC	gnl\|CDD\|131051	TIGR01996, Includes:_Phosphotransferase_enzyme_IIB_component, PTS system, sucrose-specific IIBC component. This model represents the fused enzyme II B and C components of the sucrose-specific PTS sugar transporter system. Sucrose is converted to sucrose-6-phosphate in the process of translocation into the cell. Some of these transporters lack their own IIA domains and instead use the glucose IIA protein (IIAglc or Crr). The exceptions to this rule are Staphylococci, Streptococci, Lactococci, Lactobacilli, etc. which contain their own A domain as a C-terminal fusion. This family is closely related to the trehalose transporting PTS IIBC enzymes and the B and C domains of each are described by subfamily-domain level TIGRFAMs models (TIGR00826 and TIGR00852, respectively).	7.19131e-148
NC_017668.1\|WP_014642500.1\|1258369_1261876_+\|helicase-exonuclease-AddAB-subunit-AddB	gnl\|CDD\|213736	TIGR02773, ATP-dependent_helicase/deoxyribonuclease_subunit_B, helicase-exonuclease AddAB, AddB subunit. DNA repair is accomplished by several different systems in prokaryotes. Recombinational repair of double-stranded DNA breaks involves the RecBCD pathway in some lineages, and AddAB (also called RexAB) in other. The AddA protein is conserved between the firmicutes and the alphaproteobacteria, while the partner protein is not. Nevertheless, the partner is designated AddB in both systems. This model describes the AddB protein as found Bacillus subtilis and related species. Although the RexB protein of Streptococcus and Lactococcus is considered to be orthologous, functionally equivalent, and merely named differently, all members of this protein family have a P-loop nucleotide binding motif GxxGxGK[ST] at the N-terminus, unlike RexB proteins, and a CxxCxxxxxC motif at the C-terminus, both of which may be relevant to function. [DNA metabolism, DNA replication, recombination, and repair].	0
NC_017668.1\|WP_041601581.1\|1272927_1274370_+\|sucrose-6-phosphate-hydrolase	gnl\|CDD\|273554	TIGR01322, Sucrose-6-phosphate_hydrolase, sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	2.55328e-160
NC_017668.1\|WP_145956006.1\|1276406_1276775_-\|spore-germination-protein-GerPE	gnl\|CDD\|287884	pfam10970, GerPE, Spore germination protein GerPE. GerPE is required for the formation of functionally normal spores. It could be involved in the establishment of a normal spore coat structure and (or) permeability, which allows the access of germinants to their receptor.	9.24972e-20
NC_017668.1\|WP_014642513.1\|1277570_1277798_-\|germination-protein-KA	gnl\|CDD\|313906	pfam10803, GerPB, Spore germination GerPB. Members of this family are required for formation of functionally normal spores. They may be involved in the establishment of spore coat structure or permeability.	4.90428e-23
NC_017668.1\|WP_014642504.1\|1267831_1268596_-\|DUF4397-domain-containing-protein	gnl\|CDD\|379570	pfam14344, DUF4397, Domain of unknown function (DUF4397). This presumed domain is functionally uncharacterized. This domain family is found in bacteria, archaea and eukaryotes, and is approximately 120 amino acids in length.	5.30909e-45
NC_017668.1\|WP_014642498.1\|1256976_1257624_+\|TVP38/TMEM64-family-protein	gnl\|CDD\|223475	COG0398, COG0398, Uncharacterized conserved protein [Function unknown].	1.2175e-37
NC_017668.1\|WP_145956096.1\|1276976_1277483_-\|spore-gernimation-protein-GerPC	gnl\|CDD\|371215	pfam10737, GerPC, Spore germination protein GerPC. GerPC is required for the formation of functionally normal spores. The gerP locus encodes a number of proteins which are thought to be involved in the establishment of normal spore coat structure and/or permeability, which allows the access of germinants to their receptor.	5.92641e-26
NC_017668.1\|WP_014642514.1\|1277809_1278031_-\|spore-germination-protein	gnl\|CDD\|371190	pfam10676, gerPA, Spore germination protein gerPA/gerPF. This is a bacterial family of proteins that are required for the formation of functionally normal spores. Proteins in this family may be involved in establishing normal coat structure and/or permeability which could control the access of germinants to their receptor.	7.65138e-17
NC_017668.1\|WP_014642509.1\|1275083_1275947_-\|hypothetical-protein	gnl\|CDD\|224747	COG1834, COG1834, N-Dimethylarginine dimethylaminohydrolase [Amino acid transport and metabolism].	1.31793e-77

>NC_017668.1|WP_041601229.1|1270147_1271116_+|LacI-family-DNA-binding-transcriptional-regulator
MKDVAREAGVGLGTVSRVLNKNGPVKEATRLKVERAIETLKYKPNEVARNFKMQQSQSVALIVPTIWHPFFSNFAYHLEKKLSENGYKMILCNSQSDVDKEINYISMLEKNKIDGLVAITYSYDLDQYISSDLPIVSIDRHFTEDVVYVTSDNESGGRIAADELMKRGCKEIAFLGSLSSIKNESMRRRQGFENEVKKHNFPHRILELEEPVHDIAGSVRQFFEEYPEVDGVFAMNDKWARIIIEELKAKGKKVPEDVQVIGYDGVTPSKEEELTFSTIKQPVPLMAEKATQALMQIIQDEPGEEKIILPVEFFAGNSTKKY
>NC_017668.1|WP_014642505.1|1268799_1269930_-|IS200/IS605-family-element-transposase-accessory-protein-TnpB
MERLKHKAYNFRIYPNKTQESLIAKTIGCARFVFNHFLSEWSSAYKETGKGLSYSTCSKQLPKLKREFLWLKEVDSTAIQTSVKHLSDAYERFFKKQNQAPRFKSKKNRVQSYTTKCTNGNIAIQDRKIKLPKLGLVRFAKSREVKGRILSATVRRNPTGKYSVSILVKTDIQELPKSNTYVGIDLGLKDFAALSNGTTYQNPRYLRKTEKKLAKAQRILSRREKGSSNWHKQRIKVARLHEKIANSRKDYLHKISTEIIKNHDVIGVENLQISNMLKNRKRSKSISDVSWSMFTSMLEYKAKWYGKQLVTVSKVFASSQLCSKCGYQNSEVKNLAVRTWDCPDCGCHHDRDLNASFNILKEIQRILTTVGATGLA
>NC_017668.1|WP_014642504.1|1267831_1268596_-|DUF4397-domain-containing-protein
MYNYDPCDQLAWNAAKYDMLSNYYKYSDPQKHIYYYQRHLECMQRWIMMQERGENSGMMGMNSEAKVRVLHASPDAPAVDIYVNGQKVLEGVTYKQQSEYLSVPAGQYRIDIYPAGETNQPVLSQNVSVEAGNMYTVAAAGRLNNLRLIAVADNDSISSGNAKVRFWHLSPNAPNVDIAVQGGDVLFRNVPFGKATRYLTLPPTTANLEVRVAGTNQTALTIPNVTLSPNQAYTAVAVGLAGGDPPLEAIFLQP
>NC_017668.1|WP_014642503.1|1265941_1266580_-|hypothetical-protein
MLYRSMVYLFGMLVNFFGVALLINATLGAGFWTSFFIGVSDHLGFTVGFWYGAFQLLIIFINAKLMKNLPEVRAVVPVFMESLILDFWLEIVFANVDLSTAPFILQIAALFTGVAIIGLGVAIYILPQFPRAPVDQLFLAVSARFNLSLQTGQTLVAVTMTSLALLIGGPVGLGTLAPMLFLGPVIQYCYTRAYPLYYKIHPDGERVYQQAV
>NC_017668.1|WP_014642502.1|1265571_1265859_+|HNH-endonuclease
MEGTCELCFRTPVKTTEHHLIPRQHGGAMGVTVWLCGACHRQIHALFTNEELANFYHTLERLREHPDMEKYLSWIKKQDPQKEVTTRKSNRRRRR
>NC_017668.1|WP_014642501.1|1261869_1265571_+|helicase-exonuclease-AddAB-subunit-AddA
MVSWTEEQERAIYTHGSNILVAAAAGSGKTAVLVERIIQKLLHEEDPADIDSLLVVTFTNAAAQEMRNRVGQALSKALEANPGSHHLKKQLSLLQNASISTLHSFCMEVVRRYAYRLDLDPGFRIADTVEADLIQQEVLEDLFEDWYGKEGEEQERFFDIVDRFSSDRSDLDVEKVILELYTFATQNPWPEVWLDQMVQMYNVQEVDGEKQLPWLHLLKDEVSSHLKAMEAEAHKFLDLTKEPDGPYTYGETADSDLEMIQQAKGAMAHSWEELQSYISEQSFATLSKKKMECNEEKKEQAKKIRDRYKKRWNEMRDEWFSRSLNSYLQDMQELYPVMEQLAVVVKDFKQRYEQLKKEKAIVDFSDLEHYCLQILLDESSTPEQPVASSVAAGFHQQFSEVLIDEYQDTNLVQETLLRLLTDAPEAGNLFMVGDVKQSIYRFRHAEPSLFLQKYKAYGYQENYGERIDLARNFRSRKQVLDATNYIFRQVLDEEVGEMEYEKEAELIYSNQTYDEWAPSSPEAELFVIDRESKDDEQEENEEYKDLEKAQLEARAYGQMIRKWLGHDDEPPLEVMDKETGAKRPIQYRDIVLLMRSMTWAPMIVDELKQQGIPVYAELSTGYFEAIEIKIMLSLLKVIDNPMQDIPLASVLKSPIVGLNEDELARLRLARKRVSYYEAMKEYAGNDELGRKVESFFDLLESFRERARQGALSELIWDIFRETGYYDFVGGMPGGRQRQANLRALYDRARSYESTSFRGLFRFLRFIERMEERGDDLGAARALGEQEDVVRIMTIHKSKGLEFPVVILGAMDKQFNMMDLKDRYLLHKDYGFGSRYINPHKRLMYPTLAYHALKQAKRRELLAEEMRVLYVAMTRAKEKLVMVGNVASFDKKQEKWQTFLDSPEWVLPPHDRLDAKSYLDWVGPALIRHQHAEELRGSIEVTTSEDIYADASEWKVNIAHGSQFAVLDESQEKRDEELRTAIEDWQPAEDYAQGKDMVEKRLSFVYLHHKAAYSRAKQTVTEIKRQRETKDEYSSDQLLVPYQAPIQKRPRFMQADQRLSAAEKGSAMHTVMQHIPLSHKHSAEEVEEFVEHLVLKDVLRREEADVIDPAAVAAFFETSVGQFVLEAEHVEREVPFSLTLPAHEVYPDWESPENEQVFIQGVIDAMIPYEDGWMILDYKSDQIDPEKKSVEETMKDRYRTQIEMYRCALEKIWKEPVRKSCLYLFEGSVLVEVD
>NC_017668.1|WP_014642500.1|1258369_1261876_+|helicase-exonuclease-AddAB-subunit-AddB
MGMRLLLGRSGAGKSTRCLEEIEGRLKEDPKGPPIIYIVPEQMTFQQEYALLKREGIEGSIRAQVFSFSRLAWRVLQETGGGTKKFLTSTGVQMMLRKIVEERTSDWKVFQKAIEKQGFIEQLEGMITEFKRYRITPEDLQSQMAGLDRFQHTTTHEEGLRDKLDDLNYIYDRLVDALREQYIDSEDQLQLLASKIPEAGFLEGAEVYIDGFHSFTPQECGVLEELLKKVDKVHVTLTTERPEGDANPELDLFHETKETYLNLKEITRTAGSQVDEVVILDHTKGRMKDQPAFQHLEKYFDQRPAPAFEGQAPIHIAEAVHPRAEVEGAAQEILRLVREEGYRYKDMAILMREPEVYHSLIETLFNDYGIPVFIDEKRTMLNHPMIELIRSGLDVVEGNFRYDALFRLLKTGFIPATDRMHPLNENAIDELENYVLEYGIRSRTKWFSNQDWIYQRFRGFEQASQTDEEKQKQQRINAYRKQVREALEEFDERLRAVDTIEEKAVVIYEWLEHLQVPRQLEEWRNRYDASGEIERGREQEQVYDAFLQLLDEMVEMAGDEKMSLQVFRNTMDSGLESLNFAHVPPSMDHVIVGSVDRSRITGIKASFLLGVTDGLWPMKPPSDGMISEQERSLLAEHGLQLADGSNRQLLDDRFYVYLALTMPKNHLWVSYPLSNEEGKSKVPASIIQRLEELFPSCKDHILLQDPDDLHEAERFITTPVKTRSALTSQLARYLKGYAMQPVWWSVLNWYIEREDPNGLTHRVLESLFYNNQPVDLGEETTGQLFDKQVKTSVSRLETYHSCSYQYFARHSLNLEERRTYKLDAPDIGQLFHEALKQITEWIQGEGRDFAQLNKDETNSYAAKATEQLAPILQNQILHSSNRYQYIQKKLQQVIARAAFVLSEQARSSDFSPVGLELGFGTGNDAKLPPLSLDLPNGYELMLRGRIDRVDKALTEEDLYLRIIDYKSSAKGLSLMDVYYGLSLQMLAYLDVVLTNAEHWLGTAASPAGVLYFHVHNPMITGSRMLQDAAIEEEIFKKFKMQGLLLENERIIQMMDTGLEKGHSQIVPAGLKAKGGFYKNSKTADAERFQQLSHYIRELMSRAGTNITDGKVDLNPYQQKQQSACNFCPYRSVCQFDPTLEENNFRKLKELKDEDVLERMMNREEGSAW
>NC_017668.1|WP_014642499.1|1257679_1258216_+|signal-peptidase-I
MKKYRNLIRTVLLALLLAFVFRSFFFASYIVDGESMEPTLYDGNLLMVNKVVYDLQDIGRQDVIVFHANEKEDYVKRVIGVGGDEIAVREDELYVNGKRVKETYLEALRPHDGKAFTSDFTLEGVIGQMQVPEGHLFVLGDNRRDSLDSRYFGFVPIEKVVGKVDVRYWPFSQLALQF
>NC_017668.1|WP_014642498.1|1256976_1257624_+|TVP38/TMEM64-family-protein
MYLFTFSLERYKRMAENDQLFDYVIQQLEQLESFGPLPGILLPLLEAFLPILPLVAFVLANSVVYGLFKGFLYSWIGSVAGALCVFLIIRRLGRKRFLRFITRHEQVKKVMTWVEEHGFGPLFLLMCFPFSPSSIINVVSGLSNVSRQQFMLAAILGKSVMIFTIAYVGSSIASFAQNPMKSVIVGICILLFWTAGKYIEKRIQRRAERTGRVSD
>NC_017668.1|WP_014642497.1|1256346_1256763_-|hypothetical-protein
MRYLKQKELDLASRYLFLSMAIAVIKQDRKHFELGKFKIKEPYLELLGKMELEAREERRKLRQKMDHHKLQVVETGRNDSFTSFLFLAHGYEEKRNYFNPAIRKKVEVILSELMKRSQTSNREKHPAGVEKREDDPQE
>NC_017668.1|WP_014642507.1|1271318_1272737_+|PTS-transporter-subunit-EIIC
MARNPKAVAVAVLEAFGGRENIYKVSHCATRLRVELHDDKKMNKQAFDSIEGVNGYFFQSGQHQVILGTGFVNKVFAEFEKMGIAESQGEKEEEESTSNKGKMQQLTKTFADIFIPVIPVLIATGLLMGLRGLLINGFGMEMSGTILKLSQVLTDTAFTFIPVLVTWSAMKKFGGSPVIGVALGLMLVAPQLPDKWAVSFGEAEPLLLPFLGFDIPITGMQSSILPAVFMGWLAAKIEKSARKYIPEVLDLILTPFVTLLFSLILGLVMVGPLILGIENLITSGIMYFFELPFGLGGFIYGGAIQFLAITGMHHTIVPITVKMVAETGYDLINPIGTAAIAGQAGAALAVVLQQKNRIKRSNMFGSVIPAFLGITEPVMFAINLPKVKPFLFGCLGGAVGGGLASILGIAAAGTGSTMLPGLLLYIGGGFFQYILVILVALAVSFLVTFFVYREKQEEEVEHPEMNYDVKHG
>NC_017668.1|WP_041601581.1|1272927_1274370_+|sucrose-6-phosphate-hydrolase
MDFSNRQNRFLSLTDVSSQYLQMIEGKTKQDPYYPTYHVAPHHGLLNDPNGLSFFNGKHHIFYQWFPLGPVHGLKHWYHVSTEDFIHFEDHGIALYPDCEFDSHGCFSGAAFAEGGMLHLFYTGNHVTEEGIPNPSQVYASMDKHLNITKGRPIAHAPAPGFTHNFRDPVVFKRENIYYMLVGGENKDGEGALALYQGESMQQLSFQGKVTTDLPDAGYMWECPNYFEQDGRGVFIFSPQGELETDKYNFNNVFSVAYVLSDPLDVRKLHYEGKQYIELDKGFDFYAPQTYEDERGRRILIGWLGNSKSDYPTDENMWAHMLTIPRQVTLQRNRLVQQPLEELKKLRLGAETLEQEHNLSSRAFELELSVDPDFTLTFSNRKGESVTFSSNGEEYCLDRSDMTHTFAETYGTKRYALRKYKENHRIRLFMDSSSLEIFCDYGETVFTSRIFIEDLEYLKSDGASGTLYNLGSITLEAQNG
>NC_017668.1|WP_014642509.1|1275083_1275947_-|hypothetical-protein
MKECTLSNRIHCRTEYSALKKVLVAKPSFMKISTVINETQKHYEDVNIDIPRALDQHETFVHVLKEHGVEVVELSAHPELHEQVFTRDIAFVIHDQLFVASMNEEVRLEETSLLKEWLYENSIPFQEPFLSSIEGGDVLIDGKTIWIGKSGRTSSESIETLREQLPSYTIEPLDLEDDILHLDCVFNIISDHTALVYPPSFTDSGLDKLQSRFNLIPVTREEQFHMGPNVLSIDEGKLITLPQNQRLNDELHSKGFQIIPIDFSEIIKSGGSFRCCTLPLLRSSDHK
>NC_017668.1|WP_014642510.1|1276118_1276337_-|spore-germination-protein
MPAIVGPISINSVGGGVVNFGDSFYLSPKSTSKTNAGSGALNTGNWIVCNNGISSTNPFDPDVNDQNVTANA
>NC_017668.1|WP_145956006.1|1276406_1276775_-|spore-germination-protein-GerPE
MYNRMVYVDGIDITSALIASHISIGDVHRASPWSKVLAVQKEGAEFISNSLNFEDFPIFSLHPTRPLPPITVPSFHYQNQAIYVNDIHVTGVSTAGIVQVGGIEHIDSLSRTKHFRVLRDEQ
>NC_017668.1|WP_041601230.1|1276767_1276980_-|hypothetical-protein
MNHIVHNYGLHVGRIRVTAVSSSSVFLIGDNKTIRLQSYFDTPPESLIIGPYVPMETEGEAAVMDDGENV
>NC_017668.1|WP_145956096.1|1276976_1277483_-|spore-gernimation-protein-GerPC
MKHMENQQQLINQLTQKIEQLQMNESPKTVIEKIEYHFDQLKIDTLEGTLQIGLTPNGSDAADIGDFYANQGQMTSQQDPVLHQLQKYMNTDIPQWMNQYTRDHDIPVTDHHKEQIIADVRKQLPQRVEHYKNQNPDLDEAGLVNQVQNEIRHSIAQYFDSFQGDGTS
>NC_017668.1|WP_014642513.1|1277570_1277798_-|germination-protein-KA
MNITVHQSICIHVLRIGTVANSSIVQIGSSGVIQAKADLYNTGAFQSAAPAATPAEGTVDIPEAEGPSLVPLSIS
>NC_017668.1|WP_014642514.1|1277809_1278031_-|spore-germination-protein
MPAKVGAVNVTSLSSSSIFNIGDVYNMAPQAWVKTFAGGGSFNTGSGINIDINNSNTYVNDQEMIDQSLINDS
>NC_017668.1|WP_014642515.1|1278116_1279307_+|DUF418-domain-containing-protein
MNSKASPLGESERLNWIDAARGLAILGIFMVNVPAFNAPYFLYGGAAQAWDSSLSHTVQAIIDIFFQASFYTLFSFMFGFGMQMMKDRLDEKNLDYRPIIFKRLVVLIGFGLVHSFLIWHGDILLSYGILGLTLFAFFHLSTTGLLVVAYSMLAFLVLPMTLALYSIRGRLQGIVEQESINEAIANYGTGSLTEIWQQNASDWLYANHVANLPFLALSLLPMFLFGLYVCRKRWLHEPAAHLGSIKKVWAMTGVLFLIFKAGPHLYGNPEWVGIMQDSVGGTASAIFYVLSVTLLFRTKSGARFLHPLTWIGRMSLSNYILQSLVCFVLFYSVGFGLYGQVPPIMSVMIVVVVYTLQIFASRAWLKRYRYGPLEWLWRTLTYGKRQPLKRKQTAAS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_017668_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_017668_2

1657361-1657450

TypeV,TypeI-A

Consensus_repeat	Method
ATTCAAACAATTATTTGAATGAA	CRISPRCasFinder

1 spacers

cas14j

The CRISPR arrays of NC_017668_2

>merge|NC_017668|2|1657361-1657450|CRISPRCasFinder
ATTCAAACAATTATTTGAATGAAAAGGTTGACTCTTTTGATGTATGGAGCATACACTATAAACAAACATTCAAACAATTATTAGAATGAA

>NC_017668|2|2|1657361-1657450|CRISPRCasFinder
ATTCAAACAATTATTTGAATGAA	AAGGTTGACTCTTTTGATGTATGGAGCATACACTATAAACAAAC
ATTCAAACAATTATTAGAATGAA

Protein	Signature genes	Signature genes Name	Protein_function
NC_017668.1\|WP_014642896.1\|1655452_1656595_+\|alanine-dehydrogenase	unknown	unknown	gnl\|CDD\|240630
NC_017668.1\|WP_014642890.1\|1646868_1648284_+\|dihydropyrimidinase	unknown	unknown	gnl\|CDD\|236240
NC_017668.1\|WP_014642903.1\|1663428_1664547_+\|IS200/IS605-family-element-transposase-accessory-protein-TnpB	cas14j	-	gnl\|CDD\|223747
NC_017668.1\|WP_014642901.1\|1662290_1662509_+\|hypothetical-protein	unknown	unknown	unknown
NC_017668.1\|WP_014642899.1\|1660647_1661871_+\|ISL3-like-element-ISHaha2-family-transposase	unknown	unknown	gnl\|CDD\|225995
NC_017668.1\|WP_014642888.1\|1644156_1645530_+\|NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|236967
NC_017668.1\|WP_014642895.1\|1654090_1655431_+\|aspartate-aminotransferase-family-protein	unknown	unknown	gnl\|CDD\|181078
NC_017668.1\|WP_041601289.1\|1665837_1666029_-\|H-type-small-acid-soluble-spore-protein	unknown	unknown	gnl\|CDD\|377962
NC_017668.1\|WP_014642889.1\|1645557_1646844_+\|NAD-dependent-dihydropyrimidine-dehydrogenase-subunit-PreA	unknown	unknown	gnl\|CDD\|236237
NC_017668.1\|WP_014642898.1\|1657868_1660514_+\|cadmium-translocating-P-type-ATPase	unknown	unknown	gnl\|CDD\|225127
NC_017668.1\|WP_014642894.1\|1652240_1653824_+\|PucR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|377939
NC_017668.1\|WP_014642887.1\|1643128_1644019_+\|apolipoprotein-acyltransferase	unknown	unknown	gnl\|CDD\|143592
NC_017668.1\|WP_014642892.1\|1650384_1651878_+\|cytosine-permease	unknown	unknown	gnl\|CDD\|271358
NC_017668.1\|WP_014642908.1\|1667156_1667813_-\|MtnX-like-HAD-IB-family-phosphatase	unknown	unknown	gnl\|CDD\|226802
NC_017668.1\|WP_087946061.1\|1648772_1650115_-\|IS3-like-element-ISHaha3-family-transposase	unknown	unknown	gnl\|CDD\|222853
NC_017668.1\|WP_014642902.1\|1662580_1663165_-\|DUF45-domain-containing-protein	unknown	unknown	gnl\|CDD\|307807
NC_017668.1\|WP_041601286.1\|1651892_1652129_+\|hypothetical-protein	unknown	unknown	unknown
NC_017668.1\|WP_014642909.1\|1668045_1668843_+\|LysM-peptidoglycan-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|371178
NC_017668.1\|WP_014642905.1\|1665005_1665770_+\|TIGR02206-family-membrane-protein	unknown	unknown	gnl\|CDD\|378199
NC_017668.1\|WP_014642907.1\|1666111_1667164_-\|iron-containing-alcohol-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|341453

Protein	Function_ID	Function_description	E-value
NC_017668.1\|WP_014642896.1\|1655452_1656595_+\|alanine-dehydrogenase	gnl\|CDD\|240630	cd05305, L-AlaDH, Alanine dehydrogenase NAD-binding and catalytic domains. Alanine dehydrogenase (L-AlaDH) catalyzes the NAD-dependent conversion of pyruvate to L-alanine via reductive amination. Like formate dehydrogenase and related enzymes, L-AlaDH is comprised of 2 domains connected by a long alpha helical stretch, each resembling a Rossmann fold NAD-binding domain. The NAD-binding domain is inserted within the linear sequence of the more divergent catalytic domain. Ligand binding and active site residues are found in the cleft between the subdomains. L-AlaDH is typically hexameric and is critical in carbon and nitrogen metabolism in micro-organisms.	0
NC_017668.1\|WP_014642890.1\|1646868_1648284_+\|dihydropyrimidinase	gnl\|CDD\|236240	PRK08323, PRK08323, phenylhydantoinase; Validated.	0
NC_017668.1\|WP_014642903.1\|1663428_1664547_+\|IS200/IS605-family-element-transposase-accessory-protein-TnpB	gnl\|CDD\|223747	COG0675, COG0675, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	7.93231e-51
NC_017668.1\|WP_014642899.1\|1660647_1661871_+\|ISL3-like-element-ISHaha2-family-transposase	gnl\|CDD\|225995	COG3464, COG3464, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	1.02739e-100
NC_017668.1\|WP_014642888.1\|1644156_1645530_+\|NAD(P)-dependent-oxidoreductase	gnl\|CDD\|236967	PRK11749, PRK11749, dihydropyrimidine dehydrogenase subunit A; Provisional.	0
NC_017668.1\|WP_014642895.1\|1654090_1655431_+\|aspartate-aminotransferase-family-protein	gnl\|CDD\|181078	PRK07678, PRK07678, aminotransferase; Validated.	0
NC_017668.1\|WP_041601289.1\|1665837_1666029_-\|H-type-small-acid-soluble-spore-protein	gnl\|CDD\|377962	pfam08141, SspH, Small acid-soluble spore protein H family. This family consists of the small acid-soluble spore proteins (SASP) of the H type (sspH). SspH are unique to spores of Bacillus subtilis and are expressed only in the forespore compartment during sporulation of this organism. The sspH genes are monocistronic and are recognized by the forespore-specific sigma factor for RNA polymerase - sigma-G. The specific role of this protein is unclear but is thought to play a role in sporulation under conditions different from that of the common laboratory tests of spore properties.	3.77289e-22
NC_017668.1\|WP_014642889.1\|1645557_1646844_+\|NAD-dependent-dihydropyrimidine-dehydrogenase-subunit-PreA	gnl\|CDD\|236237	PRK08318, PRK08318, NAD-dependent dihydropyrimidine dehydrogenase subunit PreA.	0
NC_017668.1\|WP_014642898.1\|1657868_1660514_+\|cadmium-translocating-P-type-ATPase	gnl\|CDD\|225127	COG2217, ZntA, Cation transport ATPase [Inorganic ion transport and metabolism].	0
NC_017668.1\|WP_014642894.1\|1652240_1653824_+\|PucR-family-transcriptional-regulator	gnl\|CDD\|377939	pfam07905, PucR, Purine catabolism regulatory protein-like family. The bacterial proteins found in this family are similar to the purine catabolism regulatory protein expressed by Bacillus subtilis (PucR). PucR is thought to be a transcriptional activator involved in the induction of the purine degradation pathway, and may contain a LysR-like DNA-binding domain. It is similar to LysR-type regulators in that it represses its own expression. The other members of this family are also annotated as being putative regulatory proteins.	2.16955e-44
NC_017668.1\|WP_014642887.1\|1643128_1644019_+\|apolipoprotein-acyltransferase	gnl\|CDD\|143592	cd07568, ML_beta-AS_like, mammalian-like beta-alanine synthase (beta-AS) and similar proteins (class 5 nitrilases). This family includes mammalian-like beta-AS (EC 3.5.1.6, also known as beta-ureidopropionase or N-carbamoyl-beta-alanine amidohydrolase). This enzyme catalyzes the third and final step in the catabolic pyrimidine catabolic pathway responsible for the degradation of uracil and thymine, the hydrolysis of N-carbamyl-beta-alanine and N-carbamyl-beta-aminoisobutyrate to the beta-amino acids, beta-alanine and beta-aminoisobutyrate respectively. This family belongs to a larger nitrilase superfamily comprised of nitrile- or amide-hydrolyzing enzymes and amide-condensing enzymes, which depend on a Glu-Lys-Cys catalytic triad. This superfamily has been classified in the literature based on global and structure based sequence analysis into thirteen different enzyme classes (referred to as 1-13), this subgroup corresponds to class 5. Members of this superfamily generally form homomeric complexes, the basic building block of which is a homodimer. Beta-ASs from this subgroup are found in various oligomeric states, dimer (human), hexamer (calf liver), decamer (Arabidopsis and Zea mays), and in the case of Drosophila melanogaster beta-AS, as a homooctamer assembled as a left-handed helical turn, with the possibility of higher order oligomers formed by adding dimers at either end. Rat beta-AS changes its oligomeric state (hexamer, trimer, dodecamer) in response to allosteric effectors. Eukaryotic Saccharomyces kluyveri beta-AS belongs to a different superfamily.	0
NC_017668.1\|WP_014642892.1\|1650384_1651878_+\|cytosine-permease	gnl\|CDD\|271358	cd10323, SLC-NCS1sbd, nucleobase-cation-symport-1 (NCS1) transporters; solute-binding domain. NCS1s are essential components of salvage pathways for nucleobases and related metabolites; their known substrates include allantoin, uracil, thiamine, and nicotinamide riboside. This family includes Microbacterium liquefaciens Mhp1, a transporter that mediates the uptake of indolyl methyl- and benzyl-hydantoins as part of a metabolic salvage pathway for their conversion to amino acids. It also includes various Saccharomyces cerevisiae transporters: Fcy21p (Purine-cytosine permease), vitamin B6 transporter Tpn1, nicotinamide riboside transporter 1 (Nrt1p, also called Thi71p), Dal4p (allantoin permease), Fui1p (uridine permease), and Fur4p (uracil permease). Mhp1 has 12 transmembrane (TM) helices (an inverted topology repeat: TMs1-5 and TMs6-10, and TMs11-12; TMs numbered to conform to the solute carrier 6 family Aquifex aeolicus LeuT). NCS1s belong to a superfamily which also contains the solute carrier 5 family sodium/glucose transporters (SLC5s), and SLC6 neurotransmitter transporters.	9.16339e-126
NC_017668.1\|WP_014642908.1\|1667156_1667813_-\|MtnX-like-HAD-IB-family-phosphatase	gnl\|CDD\|226802	COG4359, COG4359, Uncharacterized conserved protein [Function unknown].	7.07282e-43
NC_017668.1\|WP_087946061.1\|1648772_1650115_-\|IS3-like-element-ISHaha3-family-transposase	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	3.78684e-56
NC_017668.1\|WP_014642902.1\|1662580_1663165_-\|DUF45-domain-containing-protein	gnl\|CDD\|307807	pfam01863, DUF45, Protein of unknown function DUF45. This protein has no known function. Members are found in some archaebacteria, as well as Helicobacter pylori. The proteins are 190-240 amino acids long, with the C-terminus being the most conserved region, containing three conserved histidines. This motif is similar to that found in Zinc proteases, suggesting that this family may also be proteases.	1.52546e-11
NC_017668.1\|WP_014642909.1\|1668045_1668843_+\|LysM-peptidoglycan-binding-domain-containing-protein	gnl\|CDD\|371178	pfam10648, Gmad2, Immunoglobulin-like domain of bacterial spore germination. This domain is found linked to the GerMN domain pfam10646 in some bacterial proteins. It is predicted to contain an immunoglobulin-like all-beta fold.	9.70696e-27
NC_017668.1\|WP_014642905.1\|1665005_1665770_+\|TIGR02206-family-membrane-protein	gnl\|CDD\|378199	pfam09529, Intg_mem_TP0381, Integral membrane protein (intg_mem_TP0381). This entry represents a family of hydrophobic proteins with seven predicted transmembrane alpha helices. Members are found in Bacillus subtilis (ywaF), TP0381 from Treponema pallidum (TP0381), Streptococcus pyogenes, Rhodococcus erythropolis, etc.	1.90541e-39
NC_017668.1\|WP_014642907.1\|1666111_1667164_-\|iron-containing-alcohol-dehydrogenase-family-protein	gnl\|CDD\|341453	cd08174, G1PDH-like, Glycerol-1-phosphate dehydrogenase-like. These glycerol-1-phosphate dehydrogenase-like proteins have not been characterized. The protein sequences have high similarity with that of glycerol-1-phosphate dehydrogenase (G1PDH) which plays a role in the synthesis of phosphoglycerolipids in Gram-positive bacterial species. It catalyzes the reversibly reduction of dihydroxyacetone phosphate (DHAP) to glycerol-1-phosphate (G1P) in a NADH-dependent manner. Its activity requires Ni++ ion.	1.07177e-148

>NC_017668.1|WP_014642896.1|1655452_1656595_+|alanine-dehydrogenase
MKIGIPREIKNHENRVAITPAGAANLIKEGHEVVLEKGAGEGSGFTDHDYAQVGVTIVDTAAEAWETQMVMKVKEPIAEEYHYFYKGLILFTFLHLAADEKLTRALSEKKVVAIAYETVQLTDGTLPLLTPMSEVAGRMAAQKGAQYLEKPSSGKGILLGGVPGVKRGKVTIIGGGVVGTNAAKIAVGFGADVTMIDLNPERIRQLDDLFGSSINTLMSNPLNIGEAVREADLVIGAVLLPGAKAPRLVTEEMVQAMRQGSVIIDVAVDQGGIVETVDHVTTHDDPIYIKYGVVHYAVGNMPGAVPRTSTMALTNVTIPYAIQIANKGHERACLENEALLKGLNVVNGYVTYKEVAEVHELSFMDGANALRTKRYAEKFV
>NC_017668.1|WP_014642895.1|1654090_1655431_+|aspartate-aminotransferase-family-protein
MTKADVKNDLLTKDEKYVWHSMKPYKPEDTMVAKSAKGSWITDVEGNRYLDAMSGLWCVNIGYGREELAQAAFEQMKELSYMPMTQSHVSAIQLGEKINQLLGDDYVIFFSNSGSEANEAAFKMVRQYHQQKGDYYRTKFISRYRAYHGNSTSSLAATGQAQRKYKYEPLGPGFLHVAPPDEYRNDHSEKDQWGAQDIDRVMTWEHSESIAGVIMEPIITGGGVIVPPEQYMKEVKAVCERHGALMIVDEVICGFGRTGKPFGFMNYDVKPDIITMAKGITSAYLPLSATAVKREVYEAFCGSEPYDFFRHINTFGGHPAACAVALKNIEIMEKENLFDRSRALGEAARNELRHRLGAHKYVGDIRGKGLLMGIELVEDKETKEPLEVSKVNQVIGYCKDQGILIGKNGMTVAGYNNVLTLSPPLTIEEEDMQLLLNTLVDALHQL
>NC_017668.1|WP_014642894.1|1652240_1653824_+|PucR-family-transcriptional-regulator
MKYRISLENILDRKLFASAKVVAGQKGMDRQVKWVHVFETIEVRGNLKGGELVLATGFGWKDDESLFLNLLEQMIQRNVAGICIELGSFIDHISEEAIQLADKHDFPIIIFEEEVSFVDITQDIHAHLINQQYELITNLEDYSQRLNKRLLKIDNYFEILKNLQQYVNCQLIYIAKDHRIVTIPAMREKERESMLASIQNSSSKQLVKQTVQVFEREFATIYLISSCREFTEFESLLLDRTATALAQYLLRELYTEEKRKARETEWLLEWLQGEHSPEEIKDHLSFYKIHQPVSGAVVLTVKLKMAEGRDNNLDLAYLNMLIHNIFDQNGYFVFAVEKRHLLTFILLNKKGEEDWKIRIKRGIERLKKISLLNDSSIDSFQIAGGKFVRELNLLHESFQTAQETLSIQNKMPAGHFKYFYEDMHMYRLISLVHKHSNLNGLVEEYLEPIIQYDQKHNANLLETLRVYLSCNGSKKETADRVFVVRQTLYHRLEKLEKLLGSDFMESEKRQVLEFALLANEYQKTIYS
>NC_017668.1|WP_041601286.1|1651892_1652129_+|hypothetical-protein
MSTYQEFEIEREKIDFLLEKGYTIKGVTENLSGAFVEFEYKGNDPEKSKKERLHILHPDSRKYFSTILVQQQRQKQVQ
>NC_017668.1|WP_014642892.1|1650384_1651878_+|cytosine-permease
MDKKDNHLKSPDLMPIPHHEKKIGTLGFTFMWIGMAVVLAAFAIGGAGVQSISLIWVVLGTLLGTLLIGFAITLTADIGIEHGISFPVYMRAPFGTLGTHFPSVVRGLAASMWFGINTFFGSTAINGILNILTGFDNWFVCYVLFALFQLFNTALGIKAVEKFADLAAPIIILIGIWMYFNLAGEASAQNKDIWGWVESPVTGGAAFTAFVIVVVSNMGYWATLAADISSISRFIKAPKHERNWVKRNKGALVGSLVGLPLTQTFIVVLGAVSYIAVSNFDPVVALQESASGLVLGILLLMIVLAQWSTNVSANIVPAATIFSNVGGPKLPFWAGVFIAGLIGTVIQPWSIFNLLIPVLLIAAAILSVIVGIIFADYYLLRKRRMNVHDLYKSGGQYRYDGGINWAGVISWAIGSVAAYTFSTYSFFVGFGVGALLYYLLAKHWYFKKHPQAEIENPSDEEYLGITVGRDWNIGEGFAEEKIGRKTGTESAPAKVDV
>NC_017668.1|WP_087946061.1|1648772_1650115_-|IS3-like-element-ISHaha3-family-transposase
MSKLTSQEKYLIVQRYLTENVSFRDLEKEFGVDSSSIRYWVKLSEYHGSEAFDFPYTNYSAAFKLKVIQRIEEEEYSIREASAMFHIPDFSMVRRWRKKWLEGGKEALESTRKGPTQMTSHKKKEDSMDSYEALKKENERLRMENEYFKKVRDLSSKKESISKEEQAQVIDELRFHFPVKQLTEIADIPRSTYYHWKEKQLEPKTDRPLKELITSIFKEHKGRYGYRRIENELRNLGHEVNHKKVYRLMKELGLQSTVKMKKYRSYKGKVGQTAPNILNRNFKADQPNQKWVTDITEFKLFGEKLYLSPVLDLFNGEIITYTIGSRPTYSLVNNMLDQAFERLHPSDELVMHSDQGWHYQMAPYRKKLKDHQVTQSMSRKGNCHDNAVMENFFGIMKSEFLYLREFESVAHFKQELEEYIHYYNHKRIKSKLRISPISYRARFQESA
>NC_017668.1|WP_014642890.1|1646868_1648284_+|dihydropyrimidinase
MKKIIKNGIIVTAADTYKADIMVENEKIVLIGQDLSDSSAEIIDAKGNYVFPGGVDPHTHLEMPFGGTVSKDDFETGTIAAAHGGTTTVIDFCLTNKGKPLQDSIDQWHAKSRDKSVIDYSFHLMISEMNDSVLEQLPSVIEDEGITSFKVFMAYKNVFQADDETLFRTLEEAKRLGALVMVHAENGDVIDHLVKKALEKGQTDPIYHALTRPPEAEGEATGRAAQLTGLANSQLYVVHVSCENAVEEISKARKKGYQVIGETCPQYLVLDQSYLEKPNFEGAKYVWSPPLREKKHQDVLWNALKTGELQTLGSDQCSFDFKGQKDLGKGDFTKIPNGGPIIEDRVSLLFSEGVKKGRISLNQFVDITSTRIAKTFGIFPQKGTISVGADADLVIFDPNVERTISVETSHMAADYNPFEGIKVTGQPVSVLSRGEFVIRDKEFVGKIGSGNYLKRARFGELKQSQEELYQN
>NC_017668.1|WP_014642889.1|1645557_1646844_+|NAD-dependent-dihydropyrimidine-dehydrogenase-subunit-PreA
MADLSLNLAGIKSPNPFWLASAPPTNSGYQVQRAFEAGWGGAVWKTLGEPILNVTSRFAAVGFNGQKVAGFNNIELITDRPLEVNLREIYETKKRFPNHAIIASLMVEPTQEKWHEIVKRVEEVGVDGLELNFGCPHGMAERGMGAASGQVPELVEKQTMWAKEVAETPVIVKLTPNITDITFTAQAAVNGGADAVSMINTINSLAGVDIDTWDTIPNVAGKGAHGGYCGPAVKPIALNMVAECARHPKINVPISGMGGVSSWREAVEFMLMGATGVQVCTAAMHHGFSIVEDMNDGLNNYLDEKGIDSVMDLVGKSVEKYSDWGNLDLNHQIVAKINNDVCINCNKCHIACEDTSHQCIDMLKDEDGNDILRVREEDCVGCNLCSIVCPVDGAIDMVDYANGKPPMTWNERQAAIGAASSCEVDLIK
>NC_017668.1|WP_014642888.1|1644156_1645530_+|NAD(P)-dependent-oxidoreductase
MTQLKSKGISLENLKLNFEEVHEGLNNQEAIEEANRCLYCYDAPCIKACPTSIDIPKFIKKIASGNLKGSATTIMSSNPVGATCARVCPTEELCEGACVLNHSTQPILIGDLQRFATDWAIKNEQLLFKPGEKNGMKVAVVGGGPAGLSAARELARFGYEVTIFEAEAEAGGLDTYGIVSFRLPQDISRWEVDQVRQMDVEIRTNTRVGTDITFQELSEQYDSIVLTIGMGNVPMLGIEGEELQGVHDAIEFVKSTKSGPLTKELLGKNVVVIGAGNTAIDAATCAARKGAADVKIVYRRTVKEMTAYDFEYDFAKQDNVEFNWLTQPIEIIGDETNQVTHLKCVKMALGEPDADGRRRPAPVEGSEFVIETDAVIKAIGQTRYSDLIEAFGLDHEGGVVKVDPESLQTSNSKVFAAGDVIFAKGQGEAMVVTAAQQGKEVAMAIHKQLAPAPTAAM
>NC_017668.1|WP_014642887.1|1643128_1644019_+|apolipoprotein-acyltransferase
MSDKVQIGLIQASHDVDGNEPVEVHKQTSIEKHIKLVREAAEKGAQIICLQEIFYGPYFCSEQNSKWYDAAEEIPNGPTTVQFQELAKELGVVIVLPIYEREGIATYYNTAAVIDADGSYLGKYRKHHIPQVGVGDKGYGFWEKYYFKPGNLGYPVFDTAFAKVGVYICYDRHFPEGARVLGLNGAEVVFNPSATVAGLSEYLWKLEQPAHAVANGYYLGAINRVGYEGPWNMGEFYGQSYLVNPRGEFVATGSRDQDEVIIGEMNKKFIREVRDTWQFYRDRRPETYEKMGQLLP
>NC_017668.1|WP_014642898.1|1657868_1660514_+|cadmium-translocating-P-type-ATPase
MSQIEKQQESSCCSNESTSPVNGESGTVVKETEPTSCCSRESDKSVQSTESATCCSKEGDEAVQLKEPTSCCSKENGAAIEEAASETSSCCSNSTSNDESQETHTGKSSLSRSSGITVFNVSGMDCPSCAATIEKSLGQQDGFQTVEVHYGTGKLKVEARDEEALQEVPILVRKLGFEAERVQDKKNTQTYLIEGMDCGSCAKTIEKHLGSQSRVNEVSVNFSTGKMQIDHNTSSEEIIQEVGKSGFTASLETSRKTEDNETKKKPKDIRTTVSGVLLALGFISSFTNLPALLITLLYAGSIVIGGYKPARSAFYSIKSRSLDMNVLMASAAIGAALIGEWFEGAMVVWLFALGNTLQNRSIERTRDSIRSLINLAPSEATVKVGNEWVRKPVESISIQDRILVKPGEKLPLDGEVVAGSSSINQAPITGESLPVDKHEGDTVFAGTINEHGSLEIRVTKLVEDTTIAGIIHLVEEAQEKKAPTQAFVDRFARVYTPIVFSLALLVMVLPPLAGFGSFGEWVYKGLALLVVACPCALVISTPVAIVSAIGNAAKNGVLIKGGTFLEKAGAVQAIAFDKTGTLTEGKPRVSQVFALNDQTDELLRMAHTIETHSTHPIAKAITAYAEEREISVKDGLNYQAIAGKGAKATIDGVDYFAGNPKLFEEMEIPLDKIRDHIHSIQHEGGSIVIVGTRTEIIGVIGVADTIREITLDSIQKLKSTGLKEMVMLTGDNEGTAKKVADSAGVDRYFSDLMPEEKVTAVKKLQAEGKSVAMVGDGINDAPALATADLGIAMGGAGTDTAMETADIVLMADNLEKLPYTIKLSRRSLKIIKQNVWFSLITKFAALLLIFPGFLTLWMAVLSDTGAALVVILNSMRLLRQK
>NC_017668.1|WP_014642899.1|1660647_1661871_+|ISL3-like-element-ISHaha2-family-transposase
MYVYSNMPIPGLQKAIIKKSEEVEGGFHLHVELPRKNHRCKDCGEWTDRIHDYRIQKIQHLKIFERTTSLFYRKRRYRCRCGKRFFEDNDLVERYQRHSKEWNQALGLRVIQGKNFKDTADLFRTSPTTVMRRFDELAMPMLEKVETLPPVIAIDEYKGDTSAGKYQVVIADGDTGQLLDILPDRSVDTVRDYLREKGSEVEMVIMDMSHAFKSAVQKALGSPIIVADRFHFCRYIYWALERVRRRVQKEFHHYDRKQCKRKKHVFYKREENLTERQRWHLERYLSMSEDMRTSYELKESFREWFERAKNIGVEQPSQVKKELHNFYKQVEKAGVWEFMQGINTLKNWQKEILNSFTFNYSNGFVEGLNNQTKVIKRNAFGFRRYDRLRLKVLLHHQYKHIRNFQVG
>NC_017668.1|WP_014642901.1|1662290_1662509_+|hypothetical-protein
MKVNVDAWTTVSNEGSAKESYEFEKKPDVQTIRVPNPNEYEEGQKVEVKVIKNYEKDVWDIDRLKFEVEKIN
>NC_017668.1|WP_014642902.1|1662580_1663165_-|DUF45-domain-containing-protein
MPELTIEDRKIHYDLHTKPTIYYVKIYMDELNGAQVTAPEKRKPELIEAFLQKKAAWMKETWESHHTDLYHVDHLSLEDGQKINYLGRAYQLILEEGNEFAFSFNKGKFLFTYPEDEKEDEVSKQLIGLAKEWLREKSEKKFSDLHSRTISSEEDAARLGKKGEDAIVLNWRLIQQPKESIKEKIQKLIDEETC
>NC_017668.1|WP_014642903.1|1663428_1664547_+|IS200/IS605-family-element-transposase-accessory-protein-TnpB
MVKKNKAFKFKTEPNFEQLNLIKRTFGSARFIFNKMLDDRILAYEDYKNDQSELKKMKFPTPAKYKKEYPFLKEVDSLALANTQMNLDKAYKAFFTGQNKFPKHKSRKARKSYTTNVVNGNIMVQDGYIKLPKLKWVKLKQHRQIPEGSKLKSVTVSMSATGKIYVSILTEYEVEPKEVQPENIIGLDYSMKELFVANEGTRAKYPRFYRQSEDRLAKEQRVLSRRKKGSNRWFKQKNKVAKLHEKVANQRKDFCHKWSRNLADNFDAIAIEDLNMKDMSKALKFGKSVHDNGWGMFASFLSYKLEELGKKLVKVGKWFPSSKTCSKCGGIDKQLTMSIRTYKCACGHVQDRDVNAAINIKVEGKRLLSEHQ
>NC_017668.1|WP_014642905.1|1665005_1665770_+|TIGR02206-family-membrane-protein
MPEWFNIQIQDRFEFLSTSHMIMLAILFSGIALLLIFHQTLQKNDRLQQIIRWTLFVLLLGGEIGQTIWGLANHNWNMEDHAPLHLCGIASILGMVALLFYRHKVIQILYFIGIIPPIVTLLTPEVFYSFPHFRFLKFFLHHMALAWTGIFLILVSSARVTFRSLLMMFGYLNLYAVFIFFLNRQIGTNYLFLAGTPDVSTPLDALGEGVWYYVNLELFCFGLFLGMYGLYRFISLGRNWKKRSGLKEEKYHYL
>NC_017668.1|WP_041601289.1|1665837_1666029_-|H-type-small-acid-soluble-spore-protein
MNKERAKEIFHSPEMIAVTHEDRPIYIEEVIERSETARIHPVDQPNVFQEVPLYELKETEVQH
>NC_017668.1|WP_014642907.1|1666111_1667164_-|iron-containing-alcohol-dehydrogenase-family-protein
MTNPITNIPIPAILEIKSGIIYNLQDIFDRHGFENILMLFDSFTMDQWEANIKDSLSTTKVDTVLMQPHAEVHDLIKQAFSIKMYDAIVAVGGGAVIDCGKYMAFSRQTPFISIPTSASNDGFASSNCSLMIEGKKTTVPAKVPYGIIADLDIIQNAPSPFILAGVGDLMSNITALYDWEFEDRQGVSRVNAFASMLSKKAVNSFVRTPMHDIQDPTFLKELVSSLTMGGVATIISGNSAPISGSEHLISHALDKYAEHPHMHGIQVGIATYIMANVQEHRADRMQKVFTRTGFFDHIKTLEVKKADFKMAIENSPEIKPHRYTYLHEKKYQRKALDFLDQDPILQEILR
>NC_017668.1|WP_014642908.1|1667156_1667813_-|MtnX-like-HAD-IB-family-phosphatase
MKKWAFVSDFDGTISNKDFYWVIIEKYYPEGRDLFKKWKAGQMKDIEFLRSIFTSINQHEEQIIEDILNIPIDEYVPAFIQHVQNNGGDFYILSAGTDYYIHHILKEYNIQNVTVFSNEGYYEDQNVHLNMDPSHRHHSERYGIDKSKVIQELKQEYETVHFAGDSEPDSHPAVYADATFAKDALQEILSEKNIAFTPVATFQDIQADLEKKGYLSHD
>NC_017668.1|WP_014642909.1|1668045_1668843_+|LysM-peptidoglycan-binding-domain-containing-protein
MPVISTKGLIYTVKPGDTLFSIASRFGSTVAAIENANHLYPPVTDRGFIYPDDVLVIPTSTSTPILSHIVTNGDTLSAIAQTFDAHVDLLTGVNNVSNPNVINVGQNLLVPAFTYRIVSGDSLYSIARRFGVSMADIEEANADRPGFQGDVIWPDYHLIIPIPTSRNIFVIRPLPGSTFNSGDKVEGYARVFEAVVTYQLRDSNGVVVSNERFTMTDQGGPAYGFFSSTVSFDRQPTSASGELWVYSRSAKDGSIQDLVKIKVNF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

603431 : 613207

Synechococcus_phage(28.57%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014641866.1\|603431_604724_+	adenylosuccinate lyase	A0A1B3B081	Gordonia_phage	6.1e-16	29.9
WP_173380427.1\|604822_605548_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	G8EYA2	Synechococcus_phage	5.8e-40	40.0
WP_014641868.1\|605535_605781_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_014641869.1\|605781_606465_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_014641870.1\|606448_608677_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	1.3e-162	42.4
WP_014641871.1\|608652_610065_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.9e-50	33.2
WP_014641872.1\|610083_611106_+	phosphoribosylformylglycinamidine cyclo-ligase	Q58MH8	Prochlorococcus_phage	2.1e-67	44.3
WP_014641873.1\|611102_611681_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	4.2e-25	36.3
WP_014641874.1\|611677_613207_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	2.8e-76	50.8

DBSCAN-SWA_2

2207641 : 2216380

Bacillus_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014643450.1\|2207641_2210758_-	SMC family ATPase	G3MAB6	Bacillus_virus	1.5e-15	29.1
WP_014643451.1\|2210761_2211916_-	exonuclease SbcCD subunit D	A0A217ER54	Bacillus_phage	8.4e-09	23.8
WP_014643452.1\|2211952_2212174_-	YozE family protein	NA	NA	NA	NA
WP_051005638.1\|2212288_2213014_-	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	3.9e-12	28.3
WP_014643454.1\|2213127_2213322_-	twin-arginine translocase TatA/TatE family subunit	NA	NA	NA	NA
WP_041601335.1\|2213372_2213558_-	twin-arginine translocase TatA/TatE family subunit	NA	NA	NA	NA
WP_014643456.1\|2213686_2214283_-	molybdenum cofactor guanylyltransferase	NA	NA	NA	NA
WP_014643457.1\|2214279_2214774_-	dihydrofolate reductase	G3MBI7	Bacillus_virus	3.0e-40	50.0
WP_014643458.1\|2214794_2215754_-	thymidylate synthase	A0A0N9SH48	Staphylococcus_phage	7.7e-125	64.8
WP_014643459.1\|2215780_2216380_-	HD domain-containing protein	A0A1D6Y7U0	Golden_Marseillevirus	2.4e-07	27.8

DBSCAN-SWA_3

2958777 : 2966051

Streptococcus_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014644240.1\|2958777_2959908_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	S6AND0	Bacillus_phage	2.1e-153	72.7
WP_014644241.1\|2960502_2961084_+	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	1.1e-54	55.3
WP_014644242.1\|2961173_2961428_-	HPr family phosphocarrier protein	NA	NA	NA	NA
WP_014644243.1\|2961561_2962518_-	DNA-binding protein WhiA	Q7AWZ3	Streptococcus_phage	9.0e-49	37.8
WP_014644244.1\|2962553_2963507_-	YvcK family protein	A1IMD5	Streptococcus_phage	2.3e-60	45.4
WP_014644245.1\|2963510_2964395_-	RNase adapter RapZ	A0A0R8VB27	Thermobifida_phage	1.5e-05	27.1
WP_014644246.1\|2964412_2964880_-	8-oxo-dGTP diphosphatase	NA	NA	NA	NA
WP_014644247.1\|2965100_2966051_-	thioredoxin-disulfide reductase	G3MA85	Bacillus_virus	4.8e-87	52.1

DBSCAN-SWA_4

3616102 : 3621565

Staphylococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014644901.1\|3616102_3616573_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	1.8e-42	58.4
WP_014644902.1\|3616589_3617783_-	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	4.0e-115	51.9
WP_014644903.1\|3617799_3618450_-	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	1.3e-38	42.3
WP_014644904.1\|3618430_3619546_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	3.0e-64	39.7
WP_014644905.1\|3621005_3621347_-	YolD-like family protein	O64030	Bacillus_phage	2.3e-07	39.2
WP_014644906.1\|3621343_3621565_-	hypothetical protein	A0A1L2JZ89	Aeribacillus_phage	1.1e-05	37.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NC_017669

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_017669_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_017669_1

14004-14109

Orphan

Consensus_repeat	Method
AACTATCGACAACTCGAAACGATCTC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_017669_1

>merge|NC_017669|1|14004-14109|CRISPRCasFinder
AACTATCGACAACTCGAAACGATCTCCTTTTCTTTCGTTCAACTATCGACAACTCGAAACGATCTCCTTTTCTTTCGTTCAACTATCAACAACTCGAAACGATCTC

>NC_017669|1|1|14004-14109|CRISPRCasFinder
AACTATCGACAACTCGAAACGATCTC	CTTTTCTTTCGTTCAACTATCGACAACTCGAAACGATCTCCTTTTCTTTCGTTC
AACTATCAACAACTCGAAACGATCTC

Protein	Signature genes	Signature genes Name	Protein_function
NC_017669.1\|WP_014645398.1\|11514_11700_+\|hypothetical-protein	unknown	unknown	unknown
NC_017669.1\|WP_148273133.1\|5307_5985_+\|DUF4352-domain-containing-protein	unknown	unknown	gnl\|CDD\|378684
NC_017669.1\|WP_014645397.1\|10713_11499_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|236545
NC_017669.1\|WP_014645393.1\|3733_3925_+\|hypothetical-protein	unknown	unknown	unknown
NC_017669.1\|WP_014645399.1\|12046_12901_+\|DeoR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197669
NC_017669.1\|WP_041601806.1\|8857_9103_+\|hypothetical-protein	unknown	unknown	unknown
NC_017669.1\|WP_051005656.1\|3927_4254_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|259851
NC_017669.1\|WP_051005657.1\|4372_4636_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|379188
NC_017669.1\|WP_014645400.1\|15073_15979_+\|hypothetical-protein	unknown	unknown	unknown
NC_017669.1\|WP_158512398.1\|7562_7727_+\|hypothetical-protein	unknown	unknown	unknown
NC_017669.1\|WP_041601805.1\|6095_7148_-\|CHAT-domain-containing-protein	unknown	unknown	gnl\|CDD\|378942

Protein	Function_ID	Function_description	E-value
NC_017669.1\|WP_051005657.1\|4372_4636_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|379188	pfam13443, HTH_26, Cro/C1-type HTH DNA-binding domain. This is a helix-turn-helix domain that probably binds to DNA.	4.54291e-10
NC_017669.1\|WP_148273133.1\|5307_5985_+\|DUF4352-domain-containing-protein	gnl\|CDD\|378684	pfam11611, DUF4352, Domain of unknown function (DUF4352). Members of these family are putative lipoproteins that fall into the Antigen MPT63/MPB63 (immunoprotective extracellular protein) superfamily.	2.4608e-19
NC_017669.1\|WP_014645397.1\|10713_11499_+\|hypothetical-protein	gnl\|CDD\|236545	PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional.	0.00043433
NC_017669.1\|WP_014645399.1\|12046_12901_+\|DeoR-family-transcriptional-regulator	gnl\|CDD\|197669	smart00345, HTH_GNTR, helix_turn_helix gluconate operon transcriptional repressor.	0.000280248
NC_017669.1\|WP_051005656.1\|3927_4254_+\|hypothetical-protein	gnl\|CDD\|259851	cd00569, HTH_Hin_like, Helix-turn-helix domain of Hin and related proteins. This domain model summarizes a family of DNA-binding domains unique to bacteria and represented by the Hin protein of Salmonella. The basic HTH domain is a simple fold comprised of three core helices that form a right-handed helical bundle. The principal DNA-protein interface is formed by the third helix, the recognition helix, inserting itself into the major groove of the DNA. A diverse array of HTH domains participate in a variety of functions that depend on their DNA-binding properties. HTH_Hin represents one of the simplest versions of the HTH domains; the characterization of homologous relationships between various sequence-diverse HTH domain families remains difficult. The Hin recombinase induces the site-specific inversion of a chromosomal DNA segment containing a promoter, which controls the alternate expression of two genes by reversibly switching orientation. The Hin recombinase consists of a single polypeptide chain containing a C-terminal DNA-binding domain (HTH_Hin) and a catalytic domain.	0.000245754
NC_017669.1\|WP_041601805.1\|6095_7148_-\|CHAT-domain-containing-protein	gnl\|CDD\|378942	pfam12770, CHAT, CHAT domain. These proteins appear to be related to peptidases in peptidase clan CD that includes the caspases. This domain has been termed the CHAT domain for Caspase HetF Associated with Tprs. This family has been identified as a sister group to the separins.	8.54156e-06

>NC_017669.1|WP_014645399.1|12046_12901_+|DeoR-family-transcriptional-regulator
MAGIDLFYLRNKETIKQKAERFRSLDDFNKRLREIFYKYADDLTNKKLKEFVKFLSQYSVKATGVSWMKPETMAKLFGVSIATVRRYLSKLKELGIIERIRPEKGTHYITVFTPTGKAEKASDRENDRPELIDQTNAGNACNSKDEGDFNRKETMTFKAGYKSIELKEQRKGTTVPSIIPTYVDSSFIEFLKPFVKPEEITTLWRKAAQAARGLELCEKNEGPHEYIDAVLDAARSTVYQYKRGKVGGSIVGYFYGTVRKTLEKVTEKAIIRKMLLEYDYLGSE
>NC_017669.1|WP_014645398.1|11514_11700_+|hypothetical-protein
MEESSKDGREHNEKEQQEKERMDKAAQLFADVQDRAWKRIDEREKEREKERGSQQEDNGRE
>NC_017669.1|WP_014645397.1|10713_11499_+|hypothetical-protein
MNNDERRNDSQNGNHARRTYSLTEIAKHLDRPPTTVRTWRQQYAEYLESSAVGNGRNKRFKQQAFHLFELIAEMKDRNEPHELIQEALTENVDSIIHDVGEYEEENRPALMNEILNGYASVLGVMKEQDKKLDDQSELIRQQGEKIEEQAEKIEKLLKYAETQEQRQDEQQRQQDKKIEKLLDYAEQEEEEREQQRRDEEQRKAAAEVAASEENAASTEGADNNAEDDKTAGSNDERQQRPDEQQVQPEKPGFFARLFGIK
>NC_017669.1|WP_041601806.1|8857_9103_+|hypothetical-protein
MTLARLVILRKEIARKLQAKKRSLLSYSKAAKYFRAGDILGDGKLILGVSETTEHMIFKTVDAAERIHVIKSMKTKELTFK
>NC_017669.1|WP_158512398.1|7562_7727_+|hypothetical-protein
MSHFYYKSKHRTIIVSYDKNDRKESSSTETYNRTKHVAIALTIIYNLFKFSIGL
>NC_017669.1|WP_041601805.1|6095_7148_-|CHAT-domain-containing-protein
MTISSHQNAIKRYGKEVADLQKKISSEKEKEAKIYKDISNLTSQINRSKTGTTLKTKMSRLVTLNKNLSSAQNKVAEYQKKLSGKQHSLQSEQVKLDKALKQNEKKNETDRKKVRQLETKHQNFVTSSLRTQVLLHNEMKESPLMIDLAKLPEKITVLFFAANPKDQHQLKLDEEIRDVMQKIRASEHRDAIELKARWAVRSHDLLQSLNEENPHIVHFSGHGSMEDEIIFMDDKGNAKPVTKNAIVQLINATSENIRLVLFNTCYSSNQAAQLTNYVDFAIGMNTSIGDEAARVFAANFYSALGFSASVQKAFDQAKVALMIEGIPEESTPELFSREGINAGEIILVKP
>NC_017669.1|WP_148273133.1|5307_5985_+|DUF4352-domain-containing-protein
MAKEKKKKVKKPFYKKIWVWVLAIIVIGAVATSGGDETASDNSGNDAEATEANADASSSSNESSSNEGSSSEESNEENAEESDEVKTAKIGEPSEVDNVTFTVTDVEETSEIDSGNDFIDNAKTSGKFVLVDVTVKNGKSEALTIDSSYFKLNAGGSEYEPTTSGEVTMALSSEDDFFLTQVNPDLEKTGTIAFEVGGDVEVSEATLKASPGFWGTKATEIQLSE
>NC_017669.1|WP_051005657.1|4372_4636_-|helix-turn-helix-transcriptional-regulator
MAIRITLKDTLEERGVSQRGLARELGLRPAAINNLVNNNRNFVYLYHLDLIARYFDIDVCDLIEYDPTEPHENPDTSNNHTNDATPS
>NC_017669.1|WP_051005656.1|3927_4254_+|hypothetical-protein
MRLNQARRRSKLTENDVKEIRKRYAKGGITQKELGEIYGVSTFPISTVVNRKGWKHVGEDDNDEQQTSTETPPTTIGGIKDFLANNAKVKSVTVEIDGVETKLTESSF
>NC_017669.1|WP_014645393.1|3733_3925_+|hypothetical-protein
MAINNNEVQKELREKDPETFTREDMDKALKLAKSTQRIDEKVLYTSVKHHVKQNEQQQQGEES
>NC_017669.1|WP_014645400.1|15073_15979_+|hypothetical-protein
MSENHKLYVISDGETGEKIGVTDTVITGEQLEEMNRKRKEGYTTYLARKEYYDKDRRKFVTNFMDSIEELSSQLSLVDAGYLMKLLPYTQEDGKLRDNGVNLNQMKIGKIVKRSERPVRSALKRLEESGVLLSTNEKPKTYAINPKYHLVGKLGGRKKERFIKLFKSKAKELLDRLTLSEAGCVYKILPYFHYETFILCGNPNEENPELYEELSQRDLVRKLNHNENELVKIISKLRSKGILLKTESSYITSHYVHPDLMYRKSYESNHTQEVRNMFERNEIRRQARAKKRAAGKKTEGSR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_017669_1	1.1\|14030\|54\|NC_017669\|CRISPRCasFinder	14030-14083	54	NZ_CP022107	Halobacillus halophilus strain HL2HP6 plasmid pHL2HP62 sequence	15334-15387	0	1.0
NC_017669_1	1.1\|14030\|54\|NC_017669\|CRISPRCasFinder	14030-14083	54	NC_017669	Halobacillus halophilus DSM 2266 plasmid PL16, complete sequence	14030-14083	0	1.0
NC_017669_1	1.1\|14030\|54\|NC_017669\|CRISPRCasFinder	14030-14083	54	NZ_CP022107	Halobacillus halophilus strain HL2HP6 plasmid pHL2HP62 sequence	15374-15427	7	0.87
NC_017669_1	1.1\|14030\|54\|NC_017669\|CRISPRCasFinder	14030-14083	54	NC_017669	Halobacillus halophilus DSM 2266 plasmid PL16, complete sequence	14070-14123	7	0.87

1. spacer 1.1|14030|54|NC_017669|CRISPRCasFinder matches to NZ_CP022107 (Halobacillus halophilus strain HL2HP6 plasmid pHL2HP62 sequence) position: , mismatch: 0, identity: 1.0

cttttctttcgttcaactatcgacaactcgaaacgatctccttttctttcgttc	CRISPR spacer
cttttctttcgttcaactatcgacaactcgaaacgatctccttttctttcgttc	Protospacer
******************************************************

2. spacer 1.1|14030|54|NC_017669|CRISPRCasFinder matches to NC_017669 (Halobacillus halophilus DSM 2266 plasmid PL16, complete sequence) position: , mismatch: 0, identity: 1.0

cttttctttcgttcaactatcgacaactcgaaacgatctccttttctttcgttc	CRISPR spacer
cttttctttcgttcaactatcgacaactcgaaacgatctccttttctttcgttc	Protospacer
******************************************************

3. spacer 1.1|14030|54|NC_017669|CRISPRCasFinder matches to NZ_CP022107 (Halobacillus halophilus strain HL2HP6 plasmid pHL2HP62 sequence) position: , mismatch: 7, identity: 0.87

cttttctttcgttcaactatcgacaactcgaaacgatctcctt---ttctttcgttc	CRISPR spacer
cttttctttcgttcaactatcaacaactcgaaacgatctcattaagttattgcg---	Protospacer
*********************.****************** **   ** ** **

4. spacer 1.1|14030|54|NC_017669|CRISPRCasFinder matches to NC_017669 (Halobacillus halophilus DSM 2266 plasmid PL16, complete sequence) position: , mismatch: 7, identity: 0.87

cttttctttcgttcaactatcgacaactcgaaacgatctcctt---ttctttcgttc	CRISPR spacer
cttttctttcgttcaactatcaacaactcgaaacgatctcattaagttattgcg---	Protospacer
*********************.****************** **   ** ** **

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_017668

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NC_017669

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection