CRISPRimmunity

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NC_017761	Helicobacter cinaedi PAGU611, complete genome	4 crisprs	DEDDh,cas3,WYL,cas2,cas1,cas9,csx23,cas10,csm3gr7,csx19	8	26	0	0
NC_017762	Helicobacter cinaedi PAGU611 plasmid pHci1, complete sequence	0 crisprs	NA	0	0	0	0

1. NC_017761

CRISPR-Cas detection and classification

Crispr_ID: NC_017761_1

• CRISPR_ID: NC_017761_1
• CRISPR_location: 155005-155128
• CRISPR_type: Orphan
• Repeat_type: NA
• Spacer_info: 2 spacers

Consensus repeat of NC_017761_1

Consensus_repeat	Method
ATTCTTATGGAGAGTTTG	PILER-CR

spacers of NC_017761_1

>1.1|155023|32|NC_017761|PILER-CR
GCCATTGATTGATTCTTTGGCTCAAATTCCCC
>1.2|155073|38|NC_017761|PILER-CR
CTACTATTAATTATTTTTGATAGATACAAACTCCCATA

CRISPR arrays and Neighbor proteins around NC_017761_1

CRISPR arrays

The CRISPR arrays of NC_017761_1

>merge|NC_017761|1|155005-155128|PILER-CR
ATTCTTATGGAGAGTTTAGCCATTGATTGATTCTTTGGCTCAAATTCCCCATTCTTATGGAGAGTTTGCTACTATTAATTATTTTTGATAGATACAAACTCCCATAATTCTTATGGAGAGTTTG

>NC_017761|1|1|155005-155128|PILER-CR
ATTCTTATGGAGAGTTTA	GCCATTGATTGATTCTTTGGCTCAAATTCCCC
ATTCTTATGGAGAGTTTG	CTACTATTAATTATTTTTGATAGATACAAACTCCCATA
ATTCTTATGGAGAGTTTG

Neighbor Proteins Overview

Protein	Signature genes	Signature genes Name	Protein_function
NC_017761.1|WP_014666252.1|164932_166024_+|glycosyltransferase	unknown	unknown	gnl|CDD|182223
NC_017761.1|WP_002956211.1|150926_152399_+|Ppx/GppA-family-phosphatase	unknown	unknown	gnl|CDD|223326
NC_017761.1|WP_014666253.1|166112_166823_+|LPP20-family-lipoprotein	unknown	unknown	gnl|CDD|225563
NC_017761.1|WP_014666250.1|162102_163521_+|O-antigen-ligase-family-protein	unknown	unknown	unknown
NC_017761.1|WP_014666251.1|163495_164929_+|glycosyltransferase	unknown	unknown	gnl|CDD|340847
NC_017761.1|WP_133246282.1|146780_147032_-|ion-transporter	unknown	unknown	gnl|CDD|366146
NC_017761.1|WP_014666245.1|147669_147984_-|hypothetical-protein	unknown	unknown	unknown
NC_017761.1|WP_014666255.1|169050_170424_+|oxygen-independent-coproporphyrinogen-III-oxidase	unknown	unknown	gnl|CDD|236430
NC_017761.1|WP_002957383.1|166840_167458_+|hypothetical-protein	unknown	unknown	unknown
NC_017761.1|WP_002957381.1|168574_169018_+|DUF2603-domain-containing-protein	unknown	unknown	gnl|CDD|337854
NC_017761.1|WP_015453216.1|160793_161021_+|hypothetical-protein	unknown	unknown	unknown
NC_017761.1|WP_081495219.1|153464_154379_+|lipid-A-biosynthesis-lauroyl-acyltransferase	unknown	unknown	gnl|CDD|181420
NC_017761.1|WP_014666248.1|149336_149693_-|TM2-domain-containing-protein	unknown	unknown	gnl|CDD|377473
NC_017761.1|WP_002957379.1|170432_171746_+|(Fe-S)-binding-protein	unknown	unknown	gnl|CDD|223325
NC_017761.1|WP_002956203.1|146995_147535_-|ion-transporter	unknown	unknown	gnl|CDD|366146
NC_017761.1|WP_014666249.1|149821_150616_+|indole-3-glycerol-phosphate-synthase	unknown	unknown	gnl|CDD|238203
NC_017761.1|WP_014666254.1|167587_168574_+|ornithine-carbamoyltransferase	unknown	unknown	gnl|CDD|234835
NC_017761.1|WP_002956210.1|150675_150927_+|YfhL-family-4Fe-4S-dicluster-ferredoxin	unknown	unknown	gnl|CDD|224066
NC_017761.1|WP_014666247.1|148368_148617_-|hypothetical-protein	unknown	unknown	unknown
NC_017761.1|WP_173363056.1|152400_153468_+|lipopolysaccharide-heptosyltransferase-I	unknown	unknown	gnl|CDD|274025

rpsblast for functional proteins

Protein	Function_ID	Function_description	E-value
NC_017761.1|WP_002956211.1|150926_152399_+|Ppx/GppA-family-phosphatase	gnl|CDD|223326	COG0248, GppA, Exopolyphosphatase [Nucleotide transport and metabolism / Inorganic ion transport and metabolism].	3.3773e-118
NC_017761.1|WP_002957379.1|170432_171746_+|(Fe-S)-binding-protein	gnl|CDD|223325	COG0247, GlpC, Fe-S oxidoreductase [Energy production and conversion].	1.54206e-68
NC_017761.1|WP_002956210.1|150675_150927_+|YfhL-family-4Fe-4S-dicluster-ferredoxin	gnl|CDD|224066	COG1143, NuoI, Formate hydrogenlyase subunit 6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I) [Energy production and conversion].	4.29894e-06
NC_017761.1|WP_014666251.1|163495_164929_+|glycosyltransferase	gnl|CDD|340847	cd03820, GT4_AmsD-like, amylovoran biosynthesis glycosyltransferase AmsD and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. AmSD in Erwinia amylovora has been shown to be involved in the biosynthesis of amylovoran, the acidic exopolysaccharide acting as a virulence factor. This enzyme may be responsible for the formation of galactose alpha-1,6 linkages in amylovoran.	5.15643e-49
NC_017761.1|WP_133246282.1|146780_147032_-|ion-transporter	gnl|CDD|366146	pfam00520, Ion_trans, Ion transport protein. This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.	4.99377e-11
NC_017761.1|WP_014666254.1|167587_168574_+|ornithine-carbamoyltransferase	gnl|CDD|234835	PRK00779, PRK00779, ornithine carbamoyltransferase; Provisional.	0
NC_017761.1|WP_014666255.1|169050_170424_+|oxygen-independent-coproporphyrinogen-III-oxidase	gnl|CDD|236430	PRK09249, PRK09249, coproporphyrinogen dehydrogenase.	0
NC_017761.1|WP_002957381.1|168574_169018_+|DUF2603-domain-containing-protein	gnl|CDD|337854	pfam10788, DUF2603, Protein of unknown function (DUF2603). This family is conserved in Epsilon-proteobacteria. The function is not known.	1.22436e-35
NC_017761.1|WP_014666252.1|164932_166024_+|glycosyltransferase	gnl|CDD|182223	PRK10073, PRK10073, putative glycosyl transferase; Provisional.	4.99926e-39
NC_017761.1|WP_081495219.1|153464_154379_+|lipid-A-biosynthesis-lauroyl-acyltransferase	gnl|CDD|181420	PRK08419, PRK08419, lipid A biosynthesis lauroyl acyltransferase; Reviewed.	3.3757e-135
NC_017761.1|WP_014666248.1|149336_149693_-|TM2-domain-containing-protein	gnl|CDD|377473	pfam05154, TM2, TM2 domain. This family is composed of a pair of transmembrane alpha helices connected by a short linker. The function of this domain is unknown, however it occurs in a wide range or protein contexts.	4.01666e-07
NC_017761.1|WP_002956203.1|146995_147535_-|ion-transporter	gnl|CDD|366146	pfam00520, Ion_trans, Ion transport protein. This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.	2.44594e-16
NC_017761.1|WP_014666249.1|149821_150616_+|indole-3-glycerol-phosphate-synthase	gnl|CDD|238203	cd00331, IGPS, Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water. IGPS is active as a separate monomer in most organisms, but is also found fused to other enzymes as part of a bifunctional or multifunctional enzyme involved in tryptophan biosynthesis.	5.40697e-17
NC_017761.1|WP_014666253.1|166112_166823_+|LPP20-family-lipoprotein	gnl|CDD|225563	COG3018, COG3018, Uncharacterized protein conserved in bacteria [Function unknown].	2.65813e-38
NC_017761.1|WP_173363056.1|152400_153468_+|lipopolysaccharide-heptosyltransferase-I	gnl|CDD|274025	TIGR02193, LIPOPOLYSACCHARIDE_HEPTOSYLTRANSFERASE-1, lipopolysaccharide heptosyltransferase I. This family consists of examples of ADP-heptose:LPS heptosyltransferase I, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides].	1.9278e-89

Protein sequences

>NC_017761.1|WP_081495219.1|153464_154379_+|lipid-A-biosynthesis-lauroyl-acyltransferase
MKFFTKILKAIVSCLGFYLSKIPHWFFVWHIVALAFIMRAVDRRRYKDARANLDFVYGEQMSEVDKKALIQTCYKNFAFVLLETIRVPFIPLDKHTKRFRFVDEEYILQTLEKDKGAVLISAHYGYWEAMASVLPPRYHWCNMASLGRLTQFSAINELIIQRREMQNVKFINKKGAFKHLLKLYGAENALAGILVDQNISASEGVWVEFFGKKATHTTIASVLSRRFNVGIVPVMIEIKENYKSFEARFYPPIYCKKSEDSTQNILEATQAQADAIEKAIRAKPQDWFWFHKRFKSAYQEIYTH
>NC_017761.1|WP_173363056.1|152400_153468_+|lipopolysaccharide-heptosyltransferase-I
MGLRVAIIRLSSLGDVIVGACVLPFVREKLQEKLGQEVEITWIVDNVFAEVLQDSPCVDRLVRIDLKKGGIGAIPKIINRLKALPYYDKVVDMQGLIKSAVCGRFLKYDEFWGFDKDSIKERAASLFYKKKVRIPYENHILERNFVLVREALGLDDVNLERVYTRRKEAFSLNNKAKEQVATIMQECGIDSKKHLVLLVLESSLESKSYPVDLFIEMTAILLSQSQIQVLLLWYSTDKAREIKACFESKDVVPLPRLSMSEIKALIQKVSVVVGGDTGITHLAWAMQKPSVTLYGNTPASRFALVGEQNVFLSGSENPRYQKNDFSIAKIAPRAIVGEIDTILQRQHSVACERDI
>NC_017761.1|WP_002956211.1|150926_152399_+|Ppx/GppA-family-phosphatase
MAKITSVIDIGSNSVRMAIFRKTSRFAFHLIYEIKSKVRISEGCYESRGVLGEVPMNRAVLALKEFAQISKAHKARKVFCVATSALRDAPNSKIFVDRVKKECGLSVKVIDGKKEALYGGIACANLLHYKDGITMDIGGGSTECAFIRNGKIIDLISLDIGTIRLKELFFDKKNNIEGARRFIQEQLKSVPSHFKHNRIFGVGGTIRALSKMIMKYKKYPIAELHGYEVDVAQNLKFFEKISQASEDKLESMGVPQDRIDNIRSGCLILQMFLAHFGAKQIVTSGVGVREGVYLSDLLRGHKNTFPKAFNPSISAIEDRFMLDKTYAEMTRRESLKIFDALFPLHKLDEQCKKLLNIASYLSSVGRILNFYNAELHGSYMLLNALEYGFSHTERLSICLLVEYSGKKIPQDGSIEHISDFMPKLLSLQWLSFMLALAETLCRSEGNLQIRYEYVKSKILRIYTSADLYLARENIAKLHKPEPLQIEFIKV
>NC_017761.1|WP_002956210.1|150675_150927_+|YfhL-family-4Fe-4S-dicluster-ferredoxin
MALMINNECIACDACAEECPNGAIEEGDPIYSIDPDVCTECVGSYDEPSCLSVCPVDAIVPDPDNMETMEELRYKFETLQKGE
>NC_017761.1|WP_014666249.1|149821_150616_+|indole-3-glycerol-phosphate-synthase
MKSIESNFLQSSVIFTEKCKRNLQAHLAKRKSVIDFETLGRTLAYSPFLPRFEREFFARARANPPKNAIRFEIQGDFDEVGFLEMASGAEQNGVRNGKHKSGGDMFLLDLRMQYMPCVSGDCVDSKVDSSTLGMVLESISLLRRHSTLPIIHADLFVDSYQILESALFGADSLLIPCGLHSAKTLSELLQFARRLNLEPFVEVCDKDELKRAIFSGASMLFIHKDSFEALLSLVPNSQIIATNHHNDYGVDVQILDSGADFSSF
>NC_017761.1|WP_014666248.1|149336_149693_-|TM2-domain-containing-protein
MNDSALIMLTSAWSNKIPSEAAFMLQGRLEKIPEDKIQALSFIPLKDPIIGLILGLFFGALGVDRFYKGDIGLGILKFLSIFIFIGFFWALADLYFVWQGIKEDNLNKINQQLMILGV
>NC_017761.1|WP_014666247.1|148368_148617_-|hypothetical-protein
MLGFFGIAWLMLKNMPLFIAKLSVWALWILLWIIAAATDSAVVAGFSLVPQIIVYVWFVVDLFIVGKRAREFNYQKIMQSLI
>NC_017761.1|WP_014666245.1|147669_147984_-|hypothetical-protein
MKKLGAFVMSVVVAGMLNGCFDSTPSCDDKVITQHLNDVLTELYKNIATFSLSEYKTERVDDNAKKVTCQAKISITAFGQTNTDILRYTAQNTGKDIEVEILDN
>NC_017761.1|WP_002956203.1|146995_147535_-|ion-transporter
MFSAFIRKLQGFLESTSWSVFITSVILINSACLGLETIKFIHKHFGEILSIIDYICLGIFVMELGLRILAFRLKFFIGKDWGWNWFDFIIIAVSLFAVGGLAVLRAFRVIRIFRLLSVIPTMRLVSAAMLHTIPSMISIMVLLIIFYCIYGCCVSISLERRSRSGLEIWAIAFIRSFKL
>NC_017761.1|WP_133246282.1|146780_147032_-|ion-transporter
MGDSFYTLFQIMTLESWSMGIVRPIMEVYPWAWAVFVSFICIASFIVLNLIVGVVVESIAEMKQMREENTKDSKSNAESTSKG
>NC_017761.1|WP_015453216.1|160793_161021_+|hypothetical-protein
MRLYVLYRFLVVALAYVFMLMQFVRKCGSVSSAKSLVWLLTPLPYKENGNKDKRKFSLRVLSYVENAFKCLVVES
>NC_017761.1|WP_014666250.1|162102_163521_+|O-antigen-ligase-family-protein
MGFIKKYNQEITLGLFCVGMLCYALGLSSFGKSLKTQIFFHIGGLLFIFYNHRLFSRALWKILSVPICCFVIVCLLGILTIFDDVWVRQISVVLKSVNQHIVGYFVLFVSMFLFGMYGKAKNVFFFLAAFVLLCVLEVCSTICLSLKNGLLNTDNIPFFFQVVFTYNIWLIAPASMSLAGVFTFKKWTYKILSFIGLILSLFAMLANGERSFLVAFVGMLFIPFFVWQYKHKLKVLLFVLCIGITFVIGFYHASKSFSDRYNFAHMIDNFVVVWNTNPIEMGQYDKLCFSKYIDCLPESLALGQNEMTWEHSSLSRINMTKSTLLAVADSPFKPHIVGVFQIGEYLWRYYSLKNHQNRSYINFENNSNNMNMNGYNHPHNFAVSLLFSYGVIGFVCIVIFQFFLLYSGYRCMQKQEYRWKSFWGLSLIIFVCGICIQSLFDALYPQILQCIFIWCGVVVGLGWRDENLTNNQ
>NC_017761.1|WP_014666251.1|163495_164929_+|glycosyltransferase
MKILLTINDISITGGAERVCVNLANALSELGHQVSVLSFYRANAILPYRLNESVNLHIWHNISEVEYAKKQCGNILSKMYYKNLYKFILSLQVSQRFSHFDVIISNCATYTPFFKYSKTHYCRIIHLNFSKYHSRNNYFDVLIILSSAELSTWQYYHNNIKVIPNFLPNISQKNTDSNQRRIISVGRMDRGDQKGFLRLIDIWEKVQERMGGLRGLGCKNDENLDSNLCYAKPTSCHTERSEVSKNLESKKDISPFSKANTIRKDFVHTCKYDKIDSHETILDSKQTSAEVVCDDFKSCEALSARSLSINDEARKANSLKRVETATHKKSLESWQLIIVGSGVLQEQIESKIKEKNLQDSIILKPFTKDVEKEYLSASIYAMTSYVEGFPMVLLESCSYALCPIAFDVATGPSDIIESHISGYLIEDNDLQGYADKLFTLMSDKDKRESMGLKAKRRVKEKFSKEVIMPLWEEVFRG
>NC_017761.1|WP_014666252.1|164932_166024_+|glycosyltransferase
MKKKGMENIKFFIIVPIYNVESYLKECLDSIIYQTYTEFEAILVDDGSTDSSWAIAEKYVKKDSRLMLIHQENQGVSMARNKGLDVARQKSLIPPPQQESHNTTNKSYIVFVDSDDYLELNALEHISKVLIKENVDILIESHIIVRDEKGGKKSPCDFRVFAPHIKGRYTPKELVENMRGQTLITSDWAFTIRTDFLFKNGIRFIPHIIYEDVPFCTEVAMKAQSLYVDDTCVYNYRLSPNSIMRGRQTRDKKIKIAFSRFKILQYFKILQQEARDKGSIEITSFYESIICSNVNGLIRFLGVVGYVSELGFTKADLKPFLPCIKGKYRFCYHFPRIYAFPKRLRLTFQALWERLASKVMGKV
>NC_017761.1|WP_014666253.1|166112_166823_+|LPP20-family-lipoprotein
MKNGLLKSSIVASFAVFALSGCGDLLNVGDAGGANNGLIPPSASNQPMYAPIQAPTYPPMPGYNTNPNLISKPTSGNQKINTLVVEKVEVPGLNKDNLEPKFDRDRDEYIGRNDTNNIPNSPMLTPENEITLSAVGIGVSPENSLSPSQAFAMAKRAAIVDAYRQIGEKMYGIRVNAQDTVRDMMLQSSTVKTKVQALIRNAEVLETVYKDGLCQVNMELKLDGRIWHKILSNARA
>NC_017761.1|WP_002957383.1|166840_167458_+|hypothetical-protein
MNAIVGVFKRTFLGSIVFLLPFLHFFLLALFLAFFLASCAWLESFEDPDINPNQPPVLEPTKFKILLIDTPRVKFYDFASFKYNKTSKKLNVELYKLGKPVSEIVVTPKEVCMAKQCTSKWIAVKSFFGEVSYPNLFSDILAARDIFDGEGKRVSNDGTLFVQWFVRGGQEFYYERSKNKVLFKNLTANITIGIEDYIPPSSSTN
>NC_017761.1|WP_014666254.1|167587_168574_+|ornithine-carbamoyltransferase
MRHFLTLNDFSKDEILAVTNLALKLKQELRNSNHTPYLKGKILAMIFEKSSTRTRVSFEGGIYQLGGHGMFLSHKDIQLGRGEPIKDTSRVISSMVDMVMMRTDRHEKLQEFAEYSSVPIINGLSDDFHPVQLMADYLTMLECGIALPDGIHKNGLKKPIVAYIGDGNNMAHSWINLAAILGFELRVASPLGYFPRADIIESALKTCKQSGGAIHIMQEPQKAVSGVNVVVTDTWASMGQEEQKKEREKAFVGFCVDDSLMNLAQEDAIFLHCLPAYRGQEVSESVLEGKQSRVFQEANNRLHAQKAIMLALVKLNNLPLAYPLEMEL
>NC_017761.1|WP_002957381.1|168574_169018_+|DUF2603-domain-containing-protein
MKDIKQDKWLESKEKIIQENLGILRQLEDDTMLLAMQRGEFSKDELWFLQDEQGEEYVVFPQKLFVRLLSRIKNMQEEKLVMKLEKDIISQMPIDLDDAMAVATNILESLRLKDGNLPEINTAILAKDIKKKHPNLFFDIDYLRKPR
>NC_017761.1|WP_014666255.1|169050_170424_+|oxygen-independent-coproporphyrinogen-III-oxidase
MSQNIDFNAFVKYSKSAPRYTSYPTAVEFRESWNDTSYKEALKEADFTSLPLSLYTHLPFCRSACYFCGCNVVYTSKEEKKERYIHYLKKELALLKDSMDTSREVVQFHFGGGTPTFFNAKELESVIGLIRGVFTNFAKNAEVSCEVDPRFFSREQMAVLKENGFNRLSFGVQDFDERVQEAIHRIQSVEIVSNAIALAREFGTESVNFDLIYGLPYQSEQSFADTLQKVVGLKPDRLAIFNYAHLPWMKKTMRKIDETTLPNPAQKLEILKNTIAFLQEQGYMMIGMDHFAKKSDELYLAKAKNELRRNFQGYTTRGFSQTIGIGLTSIGEGLRYYSQNYKDMQEYEKALDEGRLPVERGVELSEKDILRKEVIMGLMNNLRLDFKGIEKRFGIEFRAYFANELESLREYEELGLIQITPSNIETSPTGGMLIRNIAMVFDTYLQNDTTKRFSKTI
>NC_017761.1|WP_002957379.1|170432_171746_+|(Fe-S)-binding-protein
MLDLQSVASACVKCGKCIPNCTIYMANRDEVTSPRGFLDLLGAYKRGDLELNSQSREIFESCFLCTTCVTHCPSSLPVDVAIESVRVDIAEKYGIAWYKRAYFYLLRHRKAADFVFRFVHFIMPCAFKEENGRLVSRLKLFKGVDSKRAKRSVFPVWRKSFLQKYQGEILPTAKTAPKNALQHNRVAIFIGCLSNYNYVSVGESLLEILNHLGIRAFVPHLQECCGAPAFFTGDVKSVVHLAKKNIDYFESFWDSIDAMIIPEATCAAMIKKDWLHALDSDSTLKDYAQRLEKLLPKIYMASEWLYHHTPLSEIIPQNLAGESITYHDPCHARKVLGVYKEPRVLLSKGFRLKEMSDSSRCCGFGGISMQSSRYDLTLKAGVPKAEMIERSGAEIVSAECGACRMQIDNVLTQIDSKVRFAHPLELIAQALKGESVK

Crispr_ID: NC_017761_2

• CRISPR_ID: NC_017761_2
• CRISPR_location: 538864-538987
• CRISPR_type: Orphan
• Repeat_type: NA
• Spacer_info: 2 spacers

Consensus repeat of NC_017761_2

Consensus_repeat	Method
ATTCTTATGGAGAGTTTG	PILER-CR

spacers of NC_017761_2

>2.1|538882|32|NC_017761|PILER-CR
GCCATTGATTGATTCTTTGGCTCAAATTCCCC
>2.2|538932|38|NC_017761|PILER-CR
CTACTATTAATTATTTTTGATAGATACAAACTCCCATA

CRISPR arrays and Neighbor proteins around NC_017761_2

CRISPR arrays

The CRISPR arrays of NC_017761_2

>merge|NC_017761|2|538864-538987|PILER-CR
ATTCTTATGGAGAGTTTAGCCATTGATTGATTCTTTGGCTCAAATTCCCCATTCTTATGGAGAGTTTGCTACTATTAATTATTTTTGATAGATACAAACTCCCATAATTCTTATGGAGAGTTTG

>NC_017761|2|2|538864-538987|PILER-CR
ATTCTTATGGAGAGTTTA	GCCATTGATTGATTCTTTGGCTCAAATTCCCC
ATTCTTATGGAGAGTTTG	CTACTATTAATTATTTTTGATAGATACAAACTCCCATA
ATTCTTATGGAGAGTTTG

Neighbor Proteins Overview

Protein	Signature genes	Signature genes Name	Protein_function
NC_017761.1|WP_002956966.1|537310_537634_-|YbaB/EbfC-family-nucleoid-associated-protein	unknown	unknown	gnl|CDD|179646
NC_017761.1|WP_050754590.1|536259_537318_-|PDZ-domain-containing-protein	unknown	unknown	gnl|CDD|379052
NC_017761.1|WP_014666476.1|553709_553994_-|hypothetical-protein	unknown	unknown	unknown
NC_017761.1|WP_081445323.1|552715_553552_-|hypothetical-protein	unknown	unknown	gnl|CDD|133030
NC_017761.1|WP_014666466.1|533903_534587_-|ThiF-family-adenylyltransferase	unknown	unknown	gnl|CDD|238384
NC_017761.1|WP_014666467.1|534583_535372_-|5'/3'-nucleotidase-SurE	unknown	unknown	gnl|CDD|234732
NC_017761.1|WP_014666472.1|548130_549339_-|phosphoglycerate-kinase	unknown	unknown	gnl|CDD|234613
NC_017761.1|WP_014666464.1|530336_532760_+|AAA-family-ATPase	unknown	unknown	gnl|CDD|379114
NC_017761.1|WP_015453311.1|533746_533911_-|hypothetical-protein	unknown	unknown	gnl|CDD|367156
NC_017761.1|WP_002956965.1|537635_537998_-|aspartate-1-decarboxylase	unknown	unknown	gnl|CDD|376751
NC_017761.1|WP_014666468.1|535381_536251_-|polyprenyl-synthetase-family-protein	unknown	unknown	gnl|CDD|223220
NC_017761.1|WP_014666473.1|549386_550868_-|FAD-dependent-oxidoreductase	unknown	unknown	gnl|CDD|223652
NC_017761.1|WP_014666465.1|532852_533740_-|carbon-nitrogen-hydrolase	unknown	unknown	gnl|CDD|143597
NC_017761.1|WP_014666474.1|551949_552714_-|glycosyltransferase	unknown	unknown	gnl|CDD|133031
NC_017761.1|WP_014666471.1|546965_548114_-|MFS-transporter	unknown	unknown	gnl|CDD|340882
NC_017761.1|WP_002956215.1|545545_546058_+|ClbS/DfsB-family-four-helix-bundle-protein	unknown	unknown	gnl|CDD|377957
NC_017761.1|WP_014666470.1|546081_546966_-|ferritin-like-domain-containing-protein	unknown	unknown	gnl|CDD|377292
NC_017761.1|WP_014666463.1|529794_530340_+|hypothetical-protein	unknown	unknown	unknown
NC_017761.1|WP_002956220.1|550870_551935_-|Gfo/Idh/MocA-family-oxidoreductase	unknown	unknown	gnl|CDD|223745
NC_017761.1|WP_015453216.1|544651_544879_+|hypothetical-protein	unknown	unknown	unknown

rpsblast for functional proteins

Protein	Function_ID	Function_description	E-value
NC_017761.1|WP_002956966.1|537310_537634_-|YbaB/EbfC-family-nucleoid-associated-protein	gnl|CDD|179646	PRK03762, PRK03762, YbaB/EbfC family nucleoid-associated protein.	2.79649e-43
NC_017761.1|WP_050754590.1|536259_537318_-|PDZ-domain-containing-protein	gnl|CDD|379052	pfam13180, PDZ_2, PDZ domain.	4.57402e-10
NC_017761.1|WP_081445323.1|552715_553552_-|hypothetical-protein	gnl|CDD|133030	cd04187, DPM1_like_bac, Bacterial DPM1_like enzymes are related to eukaryotic DPM1. A family of bacterial enzymes related to eukaryotic DPM1; Although the mechanism of eukaryotic enzyme is well studied, the mechanism of the bacterial enzymes is not well understood. The eukaryotic DPM1 is the catalytic subunit of eukaryotic Dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. The enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. This protein family belongs to Glycosyltransferase 2 superfamily.	3.19454e-12
NC_017761.1|WP_014666466.1|533903_534587_-|ThiF-family-adenylyltransferase	gnl|CDD|238384	cd00755, YgdL_like, Family of activating enzymes (E1) of ubiquitin-like proteins related to the E.coli hypothetical protein ygdL. The common reaction mechanism catalyzed by E1-like enzymes begins with a nucleophilic attack of the C-terminal carboxylate of the ubiquitin-like substrate, on the alpha-phosphate of an ATP molecule bound at the active site of the activating enzymes, leading to the formation of a high-energy acyladenylate intermediate and subsequently to the formation of a thiocarboxylate at the C termini of the substrate. The exact function of this family is unknown.	1.62144e-69
NC_017761.1|WP_014666467.1|534583_535372_-|5'/3'-nucleotidase-SurE	gnl|CDD|234732	PRK00346, surE, 5'(3')-nucleotidase/polyphosphatase; Provisional.	2.34182e-131
NC_017761.1|WP_014666472.1|548130_549339_-|phosphoglycerate-kinase	gnl|CDD|234613	PRK00073, pgk, phosphoglycerate kinase; Provisional.	0
NC_017761.1|WP_014666464.1|530336_532760_+|AAA-family-ATPase	gnl|CDD|379114	pfam13304, AAA_21, AAA domain, putative AbiEii toxin, Type IV TA system. Several members are annotated as being of the abortive phage resistance system, in which case the family would be acting as the toxin for a type IV toxin-antitoxin resistance system.	1.20773e-07
NC_017761.1|WP_015453311.1|533746_533911_-|hypothetical-protein	gnl|CDD|367156	pfam02724, CDC45, CDC45-like protein. CDC45 is an essential gene required for initiation of DNA replication in S. cerevisiae, forming a complex with MCM5/CDC46. homologs of CDC45 have been identified in human, mouse and smut fungus, among others.	0.00545043
NC_017761.1|WP_002956965.1|537635_537998_-|aspartate-1-decarboxylase	gnl|CDD|376751	pfam02261, Asp_decarbox, Aspartate decarboxylase. Decarboxylation of aspartate is the major route of beta-alanine production in bacteria, and is catalyzed by the enzyme aspartate decarboxylase EC:4.1.1.11 which requires a pyruvoyl group for its activity. It is synthesized initially as a proenzyme which is then proteolytically cleaved to an alpha (C-terminal) and beta (N-terminal) subunit and a pyruvoyl group. This family contains both chains of aspartate decarboxylase.	6.06043e-60
NC_017761.1|WP_014666473.1|549386_550868_-|FAD-dependent-oxidoreductase	gnl|CDD|223652	COG0579, COG0579, Predicted dehydrogenase [General function prediction only].	1.28154e-08
NC_017761.1|WP_014666465.1|532852_533740_-|carbon-nitrogen-hydrolase	gnl|CDD|143597	cd07573, CPA, N-carbamoylputrescine amidohydrolase (CPA) (class 11 nitrilases). CPA (EC 3.5.1.53, also known as N-carbamoylputrescine amidase and carbamoylputrescine hydrolase) converts N-carbamoylputrescine to putrescine, a step in polyamine biosynthesis in plants and bacteria. This subgroup includes Arabidopsis thaliana CPA, also known as nitrilase-like 1 (NLP1), and Pseudomonas aeruginosa AguB. This subgroup belongs to a larger nitrilase superfamily comprised of nitrile- or amide-hydrolyzing enzymes and amide-condensing enzymes, which depend on a Glu-Lys-Cys catalytic triad. This superfamily has been classified in the literature based on global and structure based sequence analysis into thirteen different enzyme classes (referred to as 1-13), this subgroup corresponds to class 11. Members of this superfamily generally form homomeric complexes, the basic building block of which is a homodimer; P. aeruginosa AugB is a homohexamer, Arabidopsis thaliana NLP1 is a homooctomer.	5.95412e-155
NC_017761.1|WP_014666474.1|551949_552714_-|glycosyltransferase	gnl|CDD|133031	cd04188, DPG_synthase, DPG_synthase is involved in protein N-linked glycosylation. UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate.	8.63991e-50
NC_017761.1|WP_014666471.1|546965_548114_-|MFS-transporter	gnl|CDD|340882	cd17324, MFS_NepI_like, Purine ribonucleoside efflux pump NepI and similar transporters of the Major Facilitator Superfamily. This family is composed of purine efflux pumps such as Escherichia coli NepI and Bacillus subtilis PbuE, sugar efflux transporters such as Corynebacterium glutamicum arabinose efflux permease, multidrug resistance (MDR) transporters such as Streptomyces lividans chloramphenicol resistance protein (CmlR), and similar proteins. NepI and PbuE are involved in the efflux of purine ribonucleosides such as guanosine, adenosine and inosine, as well as purine bases like guanine, adenine, and hypoxanthine, and purine base analogs. They play a role in the maintenance of cellular purine base pools, as well as in protecting the cells and conferring resistance against toxic purine base analogs such as 6-mercaptopurine. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The NepI-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	7.25492e-36
NC_017761.1|WP_002956215.1|545545_546058_+|ClbS/DfsB-family-four-helix-bundle-protein	gnl|CDD|377957	pfam08020, DUF1706, Protein of unknown function (DUF1706). This family contains many hypothetical proteins from bacteria and yeast.	8.76466e-63
NC_017761.1|WP_014666470.1|546081_546966_-|ferritin-like-domain-containing-protein	gnl|CDD|377292	pfam04305, DUF455, Protein of unknown function (DUF455).	1.03578e-80
NC_017761.1|WP_002956220.1|550870_551935_-|Gfo/Idh/MocA-family-oxidoreductase	gnl|CDD|223745	COG0673, MviM, Predicted dehydrogenases and related proteins [General function prediction only].	1.33529e-18
NC_017761.1|WP_014666468.1|535381_536251_-|polyprenyl-synthetase-family-protein	gnl|CDD|223220	COG0142, IspA, Geranylgeranyl pyrophosphate synthase [Coenzyme metabolism].	6.26633e-74

Protein sequences

>NC_017761.1|WP_002956965.1|537635_537998_-|aspartate-1-decarboxylase
MQFEMLYSKIHRAQVSDANLNYVGSITIEKNLAKSAKLLAGMKVEILNINNGERFSTYVIYGDKKGEICLNGAAARKAQVGDIIIIVAYATYSQEELQSYQPTIVQVGANNEILSITSEV
>NC_017761.1|WP_002956966.1|537310_537634_-|YbaB/EbfC-family-nucleoid-associated-protein
MFDPSQFGAMLGSMQDSIKELEERNQQTTLTAKSGGGLVSISANGNGEIIDISIDDSLLEDKESLQILLMSAFNDLRKSVEENRQSSAMNLLGNLGGLNIFGGKNNA
>NC_017761.1|WP_050754590.1|536259_537318_-|PDZ-domain-containing-protein
MLKHIMLLATLILSLCSHAFAYDYSHCVKYFKAASTPVDSSYAISLKVGTTQHHILYAKTPPKNVKILKADPFVGLYLLALPKTKQSYELLPLDTRTLNDKKLAIISLSHTPSIGHITKRQNGFIDYAGFSNKTSQNGVLGNICYQIYGLGVGNNGFIEKKYIDRFLNQKSAYYGDLGIRFYSQKPIVSFIDPFFPNNPFQPQDEIVSINGTKVSNSGQIEWIMSNLKKDSQAKVLIKRSDKTMTLLVKVNQRYGGFLLRETFLERFGITLNDEMIIQSTNLAIAGRFSQLRVNDKILFINKNPIITQATDTTHKRFERLKMLLSQASFNEEFDGKIQLLILRDGLEIFIKI
>NC_017761.1|WP_014666468.1|535381_536251_-|polyprenyl-synthetase-family-protein
MQHITEILHDFESFLLAQAPQIPSFHQHYEKAVWEMVQNGGKRFRPALIFSVLNALAPQLIKNAFLPALSIECIHTYSLIHDDLPCMDNASLRRGHPTLHTKYGETLALLVGDGLNTYAFALLAQARLDSQLKLALIESLAINAGIGGMVLGQMLDCEFENQTLTLEQLQTIHTNKTAKLIATSLEFGAIIANADSKLRKALYDFGLKLGVYFQLRDDIIDICQDSSQAGKTTQNDSHKNSYVNLLGLDGARAEFHRQRQNLQQELKSFESSIAQSLNTLLENYFQDIV
>NC_017761.1|WP_014666467.1|534583_535372_-|5'/3'-nucleotidase-SurE
MKKILLTNDDGFDSSGLLTLKEALQNLAHITIVAPASEKSACGHGLTLTRPLSFVRIDDDFYKLEDGTPSDCVYLALHSLYQQKPDLVISGINLGSNMGEDITYSGTAAGAMEACIQGVPSIAISQLMPDKNRSKHFDFSLAKQCIAEVVEMIFSRGYPLGERKFLNINIPHIPPKDCKGYKITQMGHRIYADDAQVHRNPRGQEYYWLGLHPLQWEERADTPFANGSDFNATHNKYISITPIKLDMTSYEDSKNLESWIQK
>NC_017761.1|WP_014666466.1|533903_534587_-|ThiF-family-adenylyltransferase
MSEIIDRYTRSRILFGESFKSIQQKSVIIFGVGGVGSFVVDCLYRSGLVNITIVDKDSFDVTNQNRQIGSEHINEPKVLVLAKLYPGITPLQKCVDKAFLSEFDIMRFDYIVDAIDDIDAKVQIAKIASNKPLGHYIVSTGSAKKLSPLHICVASVWKSYGDKFARKFRDNLKKAGIKKNFKVVFSPEVPKCKALGSFSAVTAGFGLTIASEIIQDILKHTQGDQNA
>NC_017761.1|WP_015453311.1|533746_533911_-|hypothetical-protein
MREYDDYNDEYDDLEQDSDFDGDFYDDEEEDFRHSGYDDDDYANPDDEYDDEGE
>NC_017761.1|WP_014666465.1|532852_533740_-|carbon-nitrogen-hydrolase
MKSTKLQVALLQQNYKGEKKAMLDSTTSLIQQAAESGAKLVALQELHTREYFCQSEDPKFFDYANDFEADIAYFSNIAKKHKIVLLTSLFERRTAGIYHNTAVVFDTDGSIAGKYRKMHIPDDPQFYEKFYFTPGDLGFEPIQTSLGKLGVLICWDQWYPEAARIMALKGAGILIYPTAIGWFDEDSLEEKKRQKEAWIAVQRGHSVANGLPTLAINRVGFEKDNSGNAQGIRFWGSSFAFDAQGALLAQGSEDKEEIISVEIDLSRSEEVRRMWPFLRDRRIESYKPMLKRFCN
>NC_017761.1|WP_014666464.1|530336_532760_+|AAA-family-ATPase
MNTRSIIFENFRNLGIKDSKQENLSNKLQLGSIDGEHIGGLLILLGGNNDGKSNVLDGISLAVSKLKDSDKPDYRRHKEEPKLTLEYKITDAKILEEIAESTKDTQEQDIDSNFSGKTFGIFFTEGSLEKGVELNESDTQEEYCEFIQNMFESSQVHGIYGYDEAGDRKEIRLILPEHNRMLLCSVDRGGKALKCFSAVQKKYNEIKDKDRAIKLACKFVIGDTKAPKNCDDAKELREFLKGEFEKAESNQTESQSSISAPQVESYIFRAILTPNGLETNLPKELETYRDYDTERAREHMKNVLAMKQHAYSSNTRKEMENIESAIKGDITFKELQNHYNTLQNMVEEDYYLNRNSSLQTLLQTPLESFQKDMQRQKDRDIIKEHFDITFLPNIVLYKENAIAKKDLKVEPSKINKSSFFQALFTILDEDIAMIQEDYKENDSDYLTTTQNEINKLFTSTIDKRFNDLYCLEQPVYSFHIKLDSAFVELSIRKNGDTINLERQSTGFRKFFNLFFNFLYKGEIGRGDIVLIDEPENSLSIPAQKDLRKFLKDYGRKSGILFIIATHSPSMLDITHLDEVRIVKALNSLESSEIENPNPKGSLIINDFSMLGYGASDTLDSIREALGTDIEFDKTKLIFVEGIMDYNILNAYSQFYDYKDSNKLVFLPLSGLGRNDTESRDENDNKALQFSPEQKQKAENLITFAKRLRIHPILLVDNDGAGKAMKQGVEDEEKFKNKISVITLKDAFTIIKDNKECFKDDFKDLEKLEKIKIESLFSKGDEKNLALILAKKTSDQVLSQACLKTQRI
>NC_017761.1|WP_014666463.1|529794_530340_+|hypothetical-protein
MVKPTNKTNTDQTSQAPPKLLRERLKEIEIRLVDLADFLGISRPTAYKFIQMYETGYKDNIEGKLLKFFDFVMNEKGLTKSKAMSYIVENLVQPKAKSTQDRTQTIANLLKKENSVKIEFIDMVAQTQVLDPILEYLLECQKILAKSKRALNEEEVAKITPLNELYNKLGLRLDIKIKEQK
>NC_017761.1|WP_015453216.1|544651_544879_+|hypothetical-protein
MRLYVLYRFLVVALAYVFMLMQFVRKCGSVSSAKSLVWLLTPLPYKENGNKDKRKFSLRVLSYVENAFKCLVVES
>NC_017761.1|WP_002956215.1|545545_546058_+|ClbS/DfsB-family-four-helix-bundle-protein
MSRPTTKLQLQEASQTNFEKLFAIIESIPLDAQNTHFAYNERDETLKDVLIHLYEWQNLLLTFVRTNLNKTSDFIPFLPPPYNFKTYPKMNWAIKEKHHATSLEHAKSLLYQSHTEVMELIATLPLKTLFVKKHYKWCGNTSLGSYCVSSTSSHYDWAIKCIKKYVRALK
>NC_017761.1|WP_014666470.1|546081_546966_-|ferritin-like-domain-containing-protein
MDFTLIFEAMIAQSPEAKLKLIANIEQMAQELLESENLPSNTLDSYYLESSFQTQEIQHFFTDFHSPIRPLQNPSYQRFCTITHPTKIRRPKHIKSVQSLAKVLHSIVHIEYSAIDLALDAMYRFRHLPLQYYRDWLIVALQEANHFRLLLDSLHSLGYEYGDFAVHSQLFDAQSATQDFRDRMALLHRGLEANGLDANPFVVAKIERFEHESIPQILQTLEIILHDEIEHVRKGDFWWRYANTKTSPEDFLAILQNFKQFHSVPKILNHKARLQAGFSAEELECLTHLYSTNS
>NC_017761.1|WP_014666471.1|546965_548114_-|MFS-transporter
MDIKTKVSVIYIAIITLSSIYIPQPILPLLALEFGTTAQNTSAITSITLLPMAFAPLFYGYFLENHQPKLILSLSLFVAGIFQILLAWCESLETFLLLRFIQSLFFPAILTTLLTILTRSQSGSLQFNVSIYIASTIAGGLIGRMGGAYLTELFSWQICFILLGVSLTLGGIFSLSWIANQASKLTQFTFSQILPLLGNKTSLVVLSSVFVMFFSFQAVLNTLPFYAKEMFPHISQNELGRLYLGYSIGIVVSLLANPIIKLCGGREKTIFLSLNLFALGLCVFLLHSLMWIYVGMFVMCFGSFIAHSVLNALNNSLNPKYKAASSGLYLSFYYTGGTLGSYLSSFVFELFGWQMLIISLAITLSLTSFVFYHHMTHIKKEA
>NC_017761.1|WP_014666472.1|548130_549339_-|phosphoglycerate-kinase
MREAGIELMKNTKSVRDIDVNSKRVLIRVDFNVPMDEDFDICDDTRIREALPTINYCIDNHAKNIVLVSHLGRPKGRSAEFSLKHVIKRVERLLGRDVGFAESIEEAVLLQEQSPSGSVILLENIRFCVGEEKNDKDLSQKLAGLCDIYVNDAFGTSHRAHSSTCGIAEFAKERVAGLLLKKEIDSFAKAMANPLKPVLLIVGGSKVSSKLALLYNILDVVDKIIIGGAMSNTFLKACGYDMQKSLVEEYLVAEAKKILEHAREKKVKIYLPVDVVSTDDVKSHTQIKITPAQDVPEGFMAVDMGPATSKLFSEVVRDSQTIIWNGPLGIYEIQAFSRGTFNLAHAVSDTYAFSLIGGGDTADAIDRAGERDNMSFISTGGGASLELLEGKILPAFKVLERK
>NC_017761.1|WP_014666473.1|549386_550868_-|FAD-dependent-oxidoreductase
MPKLDKYDCIIIGGGFFGAYIALQLKEKYNSILVLEQESDLLLHASLNNQARVHNGYHYPRSLSTAVSSSRHFKTFCNEFKSAIKNDFAKYYAIANIGSKTSNTQFYRLFKQFDIFIESVPNHIKAMFNKKLVSDVFLTREYAFDAAILREILKERLESKKIEIATNTQAVCVKEDKVGLCVEIQKIGHSACNAISADSAIAKVAKHNFATIKINGGDSQSETPTLKALSGWGIFKGEGATSCAVAKLQTHTCKFKPLPLKEKENKILRNIDRSDFSPQAELQKETMRETQKLHAPLILNCTYAGINHLLQNSHLPPLPLKFEMTEMALVNVPKSLQNISVTIMDGAFFSLMPYPSKDCYTLSHVRYTPHFAWRDFSLESKLKAYNLQDSNNPPTQTTSPYTILQAFMQNATSNFPLMKADARRYMPILESLEYLDSLYEIKTLQIQNEIDDGRPIIFAKDYGLKGFCTIMGGKIDNIYEIAELLTMEFNLSI
>NC_017761.1|WP_002956220.1|550870_551935_-|Gfo/Idh/MocA-family-oxidoreductase
MQKAILIGRGYWGKILQHYIQKHYKISHIFGRDVEDEVLIEALDKADSAFIATPLSSHFKLAKLALEHNCNVFVEKPSTATKEEFETLLNLARKNNKILFTDYIYTFSQSILYALQILQEKHIESIQAEITQYGNFYENESVLEVIGVHYISVFAFMQELGLLDNLCVKSCKFLDSKKQSATLEFSALQEKGSKKEIVLLLHCSLLSNDKKRLLRISTTDSIISVDMLSPTPLSTIDSSESLPIFDEKNNLSFAVESFKNMCARVKQDSTSLESCTNASAEVSWSDFKCFTKESRAFQSKGKGSGSKANDRALSAESLKSTQETTQNLHLRFSHTTLALLSQAHNLAQDSTPKP
>NC_017761.1|WP_014666474.1|551949_552714_-|glycosyltransferase
MESNKILNIIIPVLNEEKRLENGIRGAMAFLREAKIPHIISIVDNGSSDSTQEIAKSLCEELNANTLEFISQVEYLRLEERGVGLALREAIAHNTKRSEPCGFIGYMDIDLSTDIGHLQEVYENLKNGVEIIVGSRLLKDSVVIGRSLKREILSRTLNLILKIALKAKFSDAMCGFKFYQSQVALNLKNLCNDDKSWFYCTQMLVIAQYHNIPIKEIAVKWEDESTDSKVRIFSLSRIYLSEIWRLFKLLRLKK
>NC_017761.1|WP_081445323.1|552715_553552_-|hypothetical-protein
MSAESAKSTKKTTQNLASIPNVRILEISSPLCSYENLGSLKYEIFLQNCIGDYLLFMDLKTDSIADCLSMLSLAQQYDMVIGTRKNKKQNILQKLGSKLFYKTLALFANKAREDYSEFCVISRKVIHTLLSHKHDIKLLRLLHFDTTLNICEYPYTPKSYPKRKFLDSLFLGLDVIFGESYKLLRLGTCMCLLLACGNAFYALYILSTYFLLPHIASGWTSTSLYMVAMNIGLFLMLSIIGEYVRIALIKLKGATPYEIVNETSSVNLNFENKNIQRH
>NC_017761.1|WP_014666476.1|553709_553994_-|hypothetical-protein
MQNSVDSHSSTSQKPLQDKHRVISIALLDNHINMDLLRELSKHLQESFAYFEILILNPLFDMFDKNHKDTIKQQNTHITPPPPRYKSTFHTNRI

Crispr_ID: NC_017761_3

• CRISPR_ID: NC_017761_3
• CRISPR_location: 1346374-1347400
• CRISPR_type: TypeII
• Repeat_type: NA
• Spacer_info: 15 spacers
• Cas_protein_info: cas2,cas1,cas9

Consensus repeat of NC_017761_3

Consensus_repeat	Method
GTTTTAGTCCCTTCTTAAACTTCTATATGCTAGAAT	CRISPRCasFinder
GTTTTAGTCCCTTCTTAAACTTCTATATGCTAGAAT	CRT
GTTTTAGTCCCTTCTTAAACTTCTATATGCTAGAAT	PILER-CR

spacers of NC_017761_3

>3.1|1346410|30|NC_017761|CRISPRCasFinder,CRT
ATGACAAGTCTATACCCGTTTTTATACTCG
>3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT
ATAGAGATGAAAAAGCAAAAAACTGCCACA
>3.3|1346542|31|NC_017761|CRISPRCasFinder,CRT
TGGTATAATATAAAGGGTGTAGCGAAATACT
>3.4|1346609|30|NC_017761|CRISPRCasFinder,CRT
TTTACGCAGTTACGATGATAATGGGTATCT
>3.5|1346675|30|NC_017761|CRISPRCasFinder,CRT
TGGAATACTCGCTATAGAGATGAGGATCTT
>3.6|1346741|30|NC_017761|CRISPRCasFinder,CRT
ATGACAAGTCTATACCCGTTTTTATACTCG
>3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT
ATAGAGATGAAAAAGCAAAAAACTGCCACA
>3.8|1346873|30|NC_017761|CRISPRCasFinder,CRT
TCTAGCACAATTTAACAAGTTTAACCGCAA
>3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT
TAAAGGCTTTGCCAATGAAATGCTAAAGAA
>3.10|1347005|30|NC_017761|CRISPRCasFinder,CRT
ACACTTGATTTAGAAACTTTAAAAGATGAC
>3.11|1347071|30|NC_017761|CRISPRCasFinder,CRT
AGCGTCCATTCCGTCTTCCAATCTTTGCTT
>3.12|1347137|30|NC_017761|CRISPRCasFinder,CRT
AAGAGCATTTTACAAGCAATATTATGTAGA
>3.13|1347203|30|NC_017761|CRISPRCasFinder,CRT
CTAAATCACTTCTTGCCTACGAGATTCTTC
>3.14|1347269|30|NC_017761|CRISPRCasFinder,CRT
CTAAATCACTTCTTGCCTACGAGATTCTTC
>3.15|1347335|30|NC_017761|CRISPRCasFinder,CRT
CAAACACGCTAGGTATCTAAATAGTGCTAA
>3.16|1346411|30|NC_017761|PILER-CR
ATGACAAGTCTATACCCGTTTTTATACTCG
>3.17|1346477|30|NC_017761|PILER-CR
ATAGAGATGAAAAAGCAAAAAACTGCCACA
>3.18|1346543|31|NC_017761|PILER-CR
TGGTATAATATAAAGGGTGTAGCGAAATACT
>3.19|1346610|30|NC_017761|PILER-CR
TTTACGCAGTTACGATGATAATGGGTATCT
>3.20|1346676|30|NC_017761|PILER-CR
TGGAATACTCGCTATAGAGATGAGGATCTT
>3.21|1346742|30|NC_017761|PILER-CR
ATGACAAGTCTATACCCGTTTTTATACTCG
>3.22|1346808|30|NC_017761|PILER-CR
ATAGAGATGAAAAAGCAAAAAACTGCCACA
>3.23|1346874|30|NC_017761|PILER-CR
TCTAGCACAATTTAACAAGTTTAACCGCAA
>3.24|1346940|30|NC_017761|PILER-CR
TAAAGGCTTTGCCAATGAAATGCTAAAGAA
>3.25|1347006|30|NC_017761|PILER-CR
ACACTTGATTTAGAAACTTTAAAAGATGAC
>3.26|1347072|30|NC_017761|PILER-CR
AGCGTCCATTCCGTCTTCCAATCTTTGCTT

CRISPR arrays and Neighbor proteins around NC_017761_3

CRISPR arrays

The CRISPR arrays of NC_017761_3

>merge|NC_017761|3|1346374-1347400|CRISPRCasFinder,CRT,PILER-CR
ATTTTAGTCCCTTCTTAAACTTCTATATGCTAGAATATGACAAGTCTATACCCGTTTTTATACTCGGTTTTAGTCCCTTCTTAAACTTCTATATGCTAGAATATAGAGATGAAAAAGCAAAAAACTGCCACAGTTTTAGTCCCTTCTTAAACTTCTATATGCTAGAATTGGTATAATATAAAGGGTGTAGCGAAATACTGTTTTAGTCCCTTCTTAAACTTCTATATGCTAGAATTTTACGCAGTTACGATGATAATGGGTATCTGTTTTAGTCCCTTCTTAAACTTCTATATGCTAGAATTGGAATACTCGCTATAGAGATGAGGATCTTGTTTTAGTCCCTTCTTAAACTTCTATATGCTAGAATATGACAAGTCTATACCCGTTTTTATACTCGGTTTTAGTCCCTTCTTAAACTTCTATATGCTAGAATATAGAGATGAAAAAGCAAAAAACTGCCACAGTTTTAGTCCCTTCTTAAACTTCTATATGCTAGAATTCTAGCACAATTTAACAAGTTTAACCGCAAGTTTTAGTCCCTTCTTAAACTTCTATATGCTAGAATTAAAGGCTTTGCCAATGAAATGCTAAAGAAGTTTTAGTCCCTTCTTAAACTTCTATATGCTAGAATACACTTGATTTAGAAACTTTAAAAGATGACGTTTTAGTCCCTTCTTAAACTTCTATATGCTAGAATAGCGTCCATTCCGTCTTCCAATCTTTGCTTGTTTTAGTCCCTTCTTAAACTTCTATATGCTAGAATAAGAGCATTTTACAAGCAATATTATGTAGAGTTTTAGTCCCTTCTTAAACTTCTATATGCTAGAATCTAAATCACTTCTTGCCTACGAGATTCTTCGTTTTAGTCCCTTCTTAAACTTCTATATGCTAGAATCTAAATCACTTCTTGCCTACGAGATTCTTCGTTTTAGTCCCTTCTTAAACTTCTATATGCTAGAATCAAACACGCTAGGTATCTAAATAGTGCTAAGTTTTAGTCCCTTCTTAAACTTCTATATGCTAGAAT

>NC_017761|3|1|1346374-1347400|CRISPRCasFinder
ATTTTAGTCCCTTCTTAAACTTCTATATGCTAGAAT	ATGACAAGTCTATACCCGTTTTTATACTCG
GTTTTAGTCCCTTCTTAAACTTCTATATGCTAGAAT	ATAGAGATGAAAAAGCAAAAAACTGCCACA
GTTTTAGTCCCTTCTTAAACTTCTATATGCTAGAAT	TGGTATAATATAAAGGGTGTAGCGAAATACT
GTTTTAGTCCCTTCTTAAACTTCTATATGCTAGAAT	TTTACGCAGTTACGATGATAATGGGTATCT
GTTTTAGTCCCTTCTTAAACTTCTATATGCTAGAAT	TGGAATACTCGCTATAGAGATGAGGATCTT
GTTTTAGTCCCTTCTTAAACTTCTATATGCTAGAAT	ATGACAAGTCTATACCCGTTTTTATACTCG
GTTTTAGTCCCTTCTTAAACTTCTATATGCTAGAAT	ATAGAGATGAAAAAGCAAAAAACTGCCACA
GTTTTAGTCCCTTCTTAAACTTCTATATGCTAGAAT	TCTAGCACAATTTAACAAGTTTAACCGCAA
GTTTTAGTCCCTTCTTAAACTTCTATATGCTAGAAT	TAAAGGCTTTGCCAATGAAATGCTAAAGAA
GTTTTAGTCCCTTCTTAAACTTCTATATGCTAGAAT	ACACTTGATTTAGAAACTTTAAAAGATGAC
GTTTTAGTCCCTTCTTAAACTTCTATATGCTAGAAT	AGCGTCCATTCCGTCTTCCAATCTTTGCTT
GTTTTAGTCCCTTCTTAAACTTCTATATGCTAGAAT	AAGAGCATTTTACAAGCAATATTATGTAGA
GTTTTAGTCCCTTCTTAAACTTCTATATGCTAGAAT	CTAAATCACTTCTTGCCTACGAGATTCTTC
GTTTTAGTCCCTTCTTAAACTTCTATATGCTAGAAT	CTAAATCACTTCTTGCCTACGAGATTCTTC
GTTTTAGTCCCTTCTTAAACTTCTATATGCTAGAAT	CAAACACGCTAGGTATCTAAATAGTGCTAA
GTTTTAGTCCCTTCTTAAACTTCTATATGCTAGAAT

>NC_017761|3|1|1346374-1347400|CRT
ATTTTAGTCCCTTCTTAAACTTCTATATGCTAGAAT	ATGACAAGTCTATACCCGTTTTTATACTCG
GTTTTAGTCCCTTCTTAAACTTCTATATGCTAGAAT	ATAGAGATGAAAAAGCAAAAAACTGCCACA
GTTTTAGTCCCTTCTTAAACTTCTATATGCTAGAAT	TGGTATAATATAAAGGGTGTAGCGAAATACT
GTTTTAGTCCCTTCTTAAACTTCTATATGCTAGAAT	TTTACGCAGTTACGATGATAATGGGTATCT
GTTTTAGTCCCTTCTTAAACTTCTATATGCTAGAAT	TGGAATACTCGCTATAGAGATGAGGATCTT
GTTTTAGTCCCTTCTTAAACTTCTATATGCTAGAAT	ATGACAAGTCTATACCCGTTTTTATACTCG
GTTTTAGTCCCTTCTTAAACTTCTATATGCTAGAAT	ATAGAGATGAAAAAGCAAAAAACTGCCACA
GTTTTAGTCCCTTCTTAAACTTCTATATGCTAGAAT	TCTAGCACAATTTAACAAGTTTAACCGCAA
GTTTTAGTCCCTTCTTAAACTTCTATATGCTAGAAT	TAAAGGCTTTGCCAATGAAATGCTAAAGAA
GTTTTAGTCCCTTCTTAAACTTCTATATGCTAGAAT	ACACTTGATTTAGAAACTTTAAAAGATGAC
GTTTTAGTCCCTTCTTAAACTTCTATATGCTAGAAT	AGCGTCCATTCCGTCTTCCAATCTTTGCTT
GTTTTAGTCCCTTCTTAAACTTCTATATGCTAGAAT	AAGAGCATTTTACAAGCAATATTATGTAGA
GTTTTAGTCCCTTCTTAAACTTCTATATGCTAGAAT	CTAAATCACTTCTTGCCTACGAGATTCTTC
GTTTTAGTCCCTTCTTAAACTTCTATATGCTAGAAT	CTAAATCACTTCTTGCCTACGAGATTCTTC
GTTTTAGTCCCTTCTTAAACTTCTATATGCTAGAAT	CAAACACGCTAGGTATCTAAATAGTGCTAA
GTTTTAGTCCCTTCTTAAACTTCTATATGCTAGAAT

>NC_017761|3|3|1346375-1347136|PILER-CR
TTTTAGTCCCTTCTTAAACTTCTATATGCTAGAATA	TGACAAGTCTATACCCGTTTTTATACTCGG
TTTTAGTCCCTTCTTAAACTTCTATATGCTAGAATA	TAGAGATGAAAAAGCAAAAAACTGCCACAG
TTTTAGTCCCTTCTTAAACTTCTATATGCTAGAATT	GGTATAATATAAAGGGTGTAGCGAAATACTG
TTTTAGTCCCTTCTTAAACTTCTATATGCTAGAATT	TTACGCAGTTACGATGATAATGGGTATCTG
TTTTAGTCCCTTCTTAAACTTCTATATGCTAGAATT	GGAATACTCGCTATAGAGATGAGGATCTTG
TTTTAGTCCCTTCTTAAACTTCTATATGCTAGAATA	TGACAAGTCTATACCCGTTTTTATACTCGG
TTTTAGTCCCTTCTTAAACTTCTATATGCTAGAATA	TAGAGATGAAAAAGCAAAAAACTGCCACAG
TTTTAGTCCCTTCTTAAACTTCTATATGCTAGAATT	CTAGCACAATTTAACAAGTTTAACCGCAAG
TTTTAGTCCCTTCTTAAACTTCTATATGCTAGAATT	AAAGGCTTTGCCAATGAAATGCTAAAGAAG
TTTTAGTCCCTTCTTAAACTTCTATATGCTAGAATA	CACTTGATTTAGAAACTTTAAAAGATGACG
TTTTAGTCCCTTCTTAAACTTCTATATGCTAGAATA	GCGTCCATTCCGTCTTCCAATCTTTGCTTG
TTTTAGTCCCTTCTTAAACTTCTATATGCTAGAAT

Neighbor Proteins Overview

Protein	Signature genes	Signature genes Name	Protein_function
NC_017761.1|WP_014667009.1|1355081_1355894_-|metallophosphoesterase-family-protein	unknown	unknown	unknown
NC_017761.1|WP_002957400.1|1347557_1347992_-|CRISPR-associated-endonuclease-Cas2	cas2	COG3512_cas2_CAS-II-A:CAS-II-B:CAS-II-C	gnl|CDD|226043
NC_017761.1|WP_014667003.1|1345716_1346034_-|hypothetical-protein	unknown	unknown	unknown
NC_017761.1|WP_014666995.1|1341784_1341922_-|hypothetical-protein	unknown	unknown	unknown
NC_017761.1|WP_014667007.1|1348900_1351972_-|type-II-CRISPR-RNA-guided-endonuclease-Cas9	cas9	COG3513_cas9_CAS-II-A:CAS-II-B:CAS-II-C	gnl|CDD|226044
NC_017761.1|WP_014666991.1|1340003_1340375_-|virulence-associated-protein-D	unknown	unknown	gnl|CDD|225846
NC_017761.1|WP_041309631.1|1361792_1362362_-|hypothetical-protein	unknown	unknown	unknown
NC_017761.1|WP_014667008.1|1354738_1355077_-|hypothetical-protein	unknown	unknown	unknown
NC_017761.1|WP_014667006.1|1348002_1348899_-|type-II-CRISPR-associated-endonuclease-Cas1	cas1	cd09720_cas1_CAS-II-A:CAS-II-B:CAS-II-C	gnl|CDD|274694
NC_017761.1|WP_002957390.1|1361229_1361622_+|hypothetical-protein	unknown	unknown	gnl|CDD|198383
NC_017761.1|WP_154645880.1|1355906_1356044_-|hypothetical-protein	unknown	unknown	unknown
NC_017761.1|WP_014667584.1|1356115_1359094_-|type-III-restriction-modification-system-endonuclease	unknown	unknown	gnl|CDD|237972
NC_017761.1|WP_014667004.1|1346123_1346342_-|hypothetical-protein	unknown	unknown	unknown
NC_017761.1|WP_014666988.1|1338738_1339038_-|hypothetical-protein	unknown	unknown	unknown
NC_017761.1|WP_014666996.1|1341931_1342399_-|hypothetical-protein	unknown	unknown	unknown
NC_017761.1|WP_014666992.1|1340371_1340710_-|hypothetical-protein	unknown	unknown	unknown
NC_017761.1|WP_014666993.1|1340823_1341300_-|hypothetical-protein	unknown	unknown	unknown
NC_017761.1|WP_014666987.1|1338601_1338829_-|hypothetical-protein	unknown	unknown	unknown
NC_017761.1|WP_014667585.1|1359093_1360989_-|site-specific-DNA-methyltransferase	unknown	unknown	gnl|CDD|225100
NC_017761.1|WP_014666998.1|1342547_1343456_-|hypothetical-protein	unknown	unknown	unknown

HMMScan for Signature genes

Protein	Cas_name	Cas_description	E-value	Identity	Coverage
NC_017761.1|WP_014667007.1|1348900_1351972_-|type-II-CRISPR-RNA-guided-endonuclease-Cas9	cas9	COG3513_cas9_CAS-II-A:CAS-II-B:CAS-II-C	4.2e-198	655.4	21.4
NC_017761.1|WP_002957400.1|1347557_1347992_-|CRISPR-associated-endonuclease-Cas2	cas2	COG3512_cas2_CAS-II-A:CAS-II-B:CAS-II-C	7.1e-44	143.5	0.6
NC_017761.1|WP_014667006.1|1348002_1348899_-|type-II-CRISPR-associated-endonuclease-Cas1	cas1	cd09720_cas1_CAS-II-A:CAS-II-B:CAS-II-C	1.9e-96	317.1	6.6

rpsblast for functional proteins

Protein	Function_ID	Function_description	E-value
NC_017761.1|WP_002957400.1|1347557_1347992_-|CRISPR-associated-endonuclease-Cas2	gnl|CDD|226043	COG3512, COG3512, CRISPR-associated protein, Cas2 homolog [Defense mechanisms].	3.92759e-41
NC_017761.1|WP_014667584.1|1356115_1359094_-|type-III-restriction-modification-system-endonuclease	gnl|CDD|237972	PRK15483, PRK15483, type III restriction-modification system endonuclease.	0
NC_017761.1|WP_002957390.1|1361229_1361622_+|hypothetical-protein	gnl|CDD|198383	cd10436, GIY-YIG_EndoII_Hpy188I_like, Catalytic GIY-YIG domain of coliphage T4 non-specific endonuclease II, type II restriction endonuclease R.Hpy188I, and similar proteins. This family includes two different GIY-YIG enzymes, coliphage T4 non-specific endonuclease II (EndoII), and type II restriction endonuclease R.Hpy188I. They display high sequence similarity to each other, and both of them contain an extra N-terminal hairpin that lacks counterparts in other GIY-YIG enzymes. EndoII encoded by gene denA catalyzes the initial step in degradation of host DNA, which permits scavenging of host-derived nucleotides for phage DNA synthesis. R.Hpy188I recognizes the unique sequence, 5'-TCNGA-3', and cleaves the DNA between nucleotides N and G in its recognition sequence to generate a single nucleotide 3'-overhang. EndoII binds to two DNA substrates as an X-shaped tetrameric structure composed as a dimer of dimers. In contrast, two subunits of R.Hpy188I form a dimer to embrace one bound DNA. Divalent metal-ion cofactors are required for their catalytic events, but not for the substrates binding.	3.24731e-11
NC_017761.1|WP_014667007.1|1348900_1351972_-|type-II-CRISPR-RNA-guided-endonuclease-Cas9	gnl|CDD|226044	COG3513, COG3513, Predicted CRISPR-associated nuclease, contains McrA/HNH-nuclease and RuvC-like nuclease domain [Defense mechanisms].	0
NC_017761.1|WP_014666991.1|1340003_1340375_-|virulence-associated-protein-D	gnl|CDD|225846	COG3309, VapD, Uncharacterized virulence-associated protein D [Function unknown].	5.26605e-11
NC_017761.1|WP_014667006.1|1348002_1348899_-|type-II-CRISPR-associated-endonuclease-Cas1	gnl|CDD|274694	TIGR03639, cas1_NMENI, CRISPR-associated endonuclease Cas1, subtype II/NMENI. The CRISPR-associated protein Cas1 is virtually universal to CRISPR systems. CRISPR, an acronym for Clustered Regularly Interspaced Short Palindromic Repeats, is a prokaryotic immunity system for foreign DNA, mostly from phage. CRISPR systems belong to different subtypes, distinguished by both nature of the repeats, the makeup of the cohort of associated Cas proteins, and by molecular phylogeny within the more universal Cas proteins such as this one. This model is of type EXCEPTION and provides more specific information than the EQUIVALOG model TIGR00287. It describes the Cas1 variant of the NMENI subtype of CRISPR/Cas system.	2.40692e-113
NC_017761.1|WP_014667585.1|1359093_1360989_-|site-specific-DNA-methyltransferase	gnl|CDD|225100	COG2189, COG2189, Adenine specific DNA methylase Mod [DNA replication, recombination, and repair].	4.19091e-40

Protein sequences

>NC_017761.1|WP_014667004.1|1346123_1346342_-|hypothetical-protein
MAELETQDGDSNTSQSVVESKQNFNALNDFKSYADENQKQTTNGFSFGSAFSKLKEKGIEAKEAIEKKQNAR
>NC_017761.1|WP_014667003.1|1345716_1346034_-|hypothetical-protein
MSEIKNKTFEDKCNLLGNTLLKVNDILSSDFRRELESLSPSSMSMDKKLLLFSLYHLMNDDYLFYNFKMLLKEKVAQIAECYYFNFGLTDFGLCDLPPQDLPRDL
>NC_017761.1|WP_014666998.1|1342547_1343456_-|hypothetical-protein
MNEIENKEIATISPQEETIQNEAITNKNNVEEKSKDKNKKQNEKLKKNAVEKDPHKESLNFHCEQFFGKNWKYIASFLGIAILIFAYELNHISTKMNDLEQVVLENNSKVVLTTSDGRAIKVTKEPLKAEYLKQFAISTYVNNLIVSRSQLTNNFQAPQFKDYGEVMDNVPQIRNILTNFMDYKEDEEKGIKINQVAVGDLRAYVQWLISVTAQDKLPEYIAIKDYSVEKYEYTGNKFSTEIIIKVVAQSYILSENNYKQQNGNFKIISEGSFDLNKSSDINPYGLRIERIKIEPVVKSKTS
>NC_017761.1|WP_014666996.1|1341931_1342399_-|hypothetical-protein
MEQEYKDKIEKLNSDLTKLTLDLQKEVKELKEDTLVNAQHIKILKTKNTNNLNTMNENLKRHIDNTANMSFALAEISEEQESSNYEKFLKTLLESDFKALQQEMIEETKRELLTKKVSKNQQGGFKIGMIFNLFGLLSFLLTLWICAKYKLLFFA
>NC_017761.1|WP_014666995.1|1341784_1341922_-|hypothetical-protein
MKSFKKEYKNINYGAYNILIAIVDDEIYFKTEDIKKTLNLDTYKE
>NC_017761.1|WP_014666993.1|1340823_1341300_-|hypothetical-protein
MQDLEGLAKHFETKYGFQCYQIAIHRDEGHIDDNGEKVINHHAHLEFITLDKESGKSLFRAELQKPKALRQIQTEVAEILQMEWGQDKRISKRERIEPRKYGAMKEKEREALRKLLDFYDEILGIDTKGLSITEAQQAHKNLVKKTQEKNILKGIDNI
>NC_017761.1|WP_014666992.1|1340371_1340710_-|hypothetical-protein
MTAVSTQHTQRRSLLGTRIVLDEEKILKENKYDLDRMYEIIDELAKESGLIKIDKHTYHCKGNDKDLACLGIFVYNNLIDCKWFTLNVKEWDWISEKEGNETLIGDDMGVWQ
>NC_017761.1|WP_014666991.1|1340003_1340375_-|virulence-associated-protein-D
MKNRKALNFDLSTNELKKHFNSTAEAYSQIKIFMIENGFEHRQYSGYISKEPMNEREITKLVRKLNKQLSWLSTCVLNFDVTDIGEQHDLTHLLTGKKSKIAEFEISNEFNEAKKTELIRKHR
>NC_017761.1|WP_014666988.1|1338738_1339038_-|hypothetical-protein
MKKSVVSLAVAALFAGNPLHLGEVFSNIVQTYEYRNHKESYEAICNRLIESSTLLFLSIAKHLNTMEKEAWGDIRNEIDHVIKQPRAVETSMLNTLCMR
>NC_017761.1|WP_014666987.1|1338601_1338829_-|hypothetical-protein
MGRYKKRDRPCNKTAQSRGDFNVKYAMYALKSLLDTLEHNKTFVADGLSLIKHDNFDIVEFGKDVAKAQEDMAWA
>NC_017761.1|WP_002957400.1|1347557_1347992_-|CRISPR-associated-endonuclease-Cas2
MRILLMFDVPTKTKKEQKQATRFRNELIKLGFFMMQFSVYMKICKGLSSAKSSLNVVKKVLPPYGNVRALIITERQFDNIEILLGNPSFNENVNEDKNLVLFDFDENAGDYRYGMEYQKQEELNTTTTQPKQKIKNRQPSLFEF
>NC_017761.1|WP_014667006.1|1348002_1348899_-|type-II-CRISPR-associated-endonuclease-Cas1
MSFDEAFRSVLVSSEAKLSLQANHLVLKQTNKEAKLFLKDIHFVILESPQILITSALLSAFAKHNIVLLTCDESHHINGIMHSYLGHFQHAKIAKEQMMVSTHKKAIVWQKIVKNKITNQARILKLHHKSKESDELLSFAKNVSLGDSRNLEAVAAAIYFKALFGKEFHRDEINFINSALNYGYAILRACIVRNVCISGLITWLGIKHDNMYNSFNLCDDLIEVFRPWVDLCVLKLNTLDKEATLRPNDKRELINILQQAALIDGQKHPLSRAIGRYIQSFRSALLGDQTLMVVSFES
>NC_017761.1|WP_014667007.1|1348900_1351972_-|type-II-CRISPR-RNA-guided-endonuclease-Cas9
MKIYSFDIGVASIGWAFIENEVLQDCGIRIFTKAENPKNGASLALPRREARGVRKRLARRRGRLNTIKQLLCKEFGLQLEDYLSNDGELPKAYTASKANPLKSPYELRTLALSQKLDSKDLVRVILHIAKHRGYGNKHAKDSKDTESGKVKKAIEFNRKTLAEKGYRSVGEYLYREFFQQSRISQNNGATEFINVRNKAGNYEHCVAQDMLKEELESILNAQRQFGFSLKQDFENKLLTKIFEQRPLKSFADKVGNCCFIAGEKRTPKDSLSAIEFIALSRTINTLINLSKESGEIYNRAIILQIVESTLKKGEISYKELREIIRLDERLRFKDPRLDYSREIKEAEKVKFLEFKQLKGFKKALGESFTTLARSQLDEIAEHIALIKDRVKLNEKLESYALTKEQREALSNLSFSAHINLSLQALKQILPFMRGDNGEQCLDYDESVEKAGLKALSKDTLKGQMLPPLNEFEPYLSNPVVARALAEYRKVLNALLKQYGSPHKIHIEYAREAKLSSTERQKYEKEQKDNYAANQAAHKKCQELGLEPSSTNLLKLKLWQEQGGLCLYSGAKITISYLQDPTALQVDHIYPYSRSFDDSYMNKCLVLTKANQEKGNRTPFEAFGTDSAKWGVITTLAQKLPHKKRRRILNTAFNDKEAGFKLRNLNDTSYIARLVADYTETYLEFLPLVESENTTLGKGQKGSKKHIAIVNGALTSTMRYYLGFASKDRDNHLHHALDAVIIGFMNDSVIKAFSDFKKTQETSKAAYYAHTLSKQEYKKQRAFIQLPSGENFRASVLEKVESVFVSKPPRKRVRGALHEATFYSPNDPKLLKNYGGTKGVERALALGKMRKVGAKIVSNGAMVRVDIFRHKSSGKFYGVPVYTMDFALGILPNKAVVVGKDKNGVIKDWLEMDSSYEFIFSLYKDDLLLVQKKEMAEPELCYFMSFNSSIAQISVAKHDNNFSTLTKNQKLLFSNATQEDVSGKSIGIQNLQVFEKWQVSVLGEVKRTQSYPRENISLASKAKK
>NC_017761.1|WP_014667008.1|1354738_1355077_-|hypothetical-protein
MIKIKLSTILFIIAIIASNANAVFCVDFATLNVYEQMTNSKYTQGDNEIGNEIRNITNTIKSEIKQIENNNKTLLKNLKRAKEAESILALKKSFLLKQNNELQSINNNIKAN
>NC_017761.1|WP_014667009.1|1355081_1355894_-|metallophosphoesterase-family-protein
MSNIYFFGDTHGSLDIDKIFMPSYQADDYIIVCGDFGVLWSDETGVFKQDDMLEKEAKLKERIQTLPCTLLFIDGNHENFNRLNTLKQVERFESIVGEYIKDKCYHLKRGNIYNIIGHTIFTMGGALSIDKAWRAERLSWWRQEAITQMELENALHNIQNYKGKIELVVTHTCPQSFLSPLSELINIDHKIHDENPYKLEKIKNALIDNHQKPQFWIFGHWHRDVNFTSDEIEANTLYLHCLKLDKHKNFERFDFRKEIFYAKTRNRHKE
>NC_017761.1|WP_154645880.1|1355906_1356044_-|hypothetical-protein
MRVEAFSRFVQISIEEYNPALTQILNYAKKHFQQISHLNFKKICI
>NC_017761.1|WP_014667584.1|1356115_1359094_-|type-III-restriction-modification-system-endonuclease
MGFSYERNLPHQSKAIDCVLLALKGASVEASLNKSFNPKISINDLNLSANLRELQKRENINSLHTLTRVFDICMETGTGKTYTYTKMALELCKEFGLRKFIIIVPSLAIKANTLNFLQAVATREHFKSEFELEIIANAIEAKKQAGKKGRKLMPNGLRDFIENDNPKEVHFLIINAQMLTATSMNEDYEQNLCDEFSNPYDALNAVNAVCIVDEPHRFDETNKAWAKIVNKTEKAINPQMIFRYGATFKEDGRGNKYHNLIYQLNAISAFNDNLVKGVEISVCEAQGSEKHKWVEFSGIENNQAKFELKEQGKSGALRQVSLNAGESLGVIDENLAHLCVEIKTKKTNAITKFKLNNQDDNNELKKGDRINLNAYLPQMQTQMLQTALKKHFELEKRLMQSQTKIKPLTLFFIEDIESYRSDDATREFLRIEFEKIAENLMRENLKEASGFYKEYLEKSLRDLRGISGGYFSKDNSNKEEYVVSEINEILHDKEKLLSCENIRRFIFSKWTLREGWDNPNVFVICKLRSSGSEISKLQEVGRGLRLPVNEYMSRVGNDGDFGAHYLHYIVNDSERDFAQSLISDINAQSGVIFSENAKTLDEKMRQKICEVYEIAEFDLLSELVSSGIVDKKFDFLENGMLRLKELYPNAFDKESLQKDKVRQSGKTQTKAHIRRDNYKILRELWETINQKVILEYKIKSEGEFSALLESFLREFMQKNQAVQSNITTTTKRLEMRDNSASLQEILRQENALDSKSMQYQAMGKSEFLQQSANALLVNVGTLREVLESVGFESQFFNARNIALLKSEFNRFLFENAISGFEVGFAKISSATQPNLHPTAFTDTNGKPYEAIESSNLGIESSDEITPKNYLFDELFYDSAIERENILQNVDRVLVFTKIPKNALKIPVAGGISYTPDFAYVLKCENGEQIYCIIESKGKDLRDLSKVENLKISRAEQFLEKSGIFGAKIQFRAQFESEAITKILQEFLNKNDI
>NC_017761.1|WP_014667585.1|1359093_1360989_-|site-specific-DNA-methyltransferase
MLDRFHKLKEHFPQCFDKNGDLMPHKLQKAILDLAQEINAQANTATQDLENEAAFSLSKESYSLNWLGKSYAKLLRHLPTHTLIAQDSAHNAQPQNANSKNVLIKGDNLEVLKHLKNAYYRKVKMIYIDPPYNTGNGDFIYNDERSFTPQSLAQMANIELEEASSILNLTLKNSSTHSAWLSFMYPRLYIARQLLHDDGVIFISIDDNEQANLKLLCDEIFGEENFVGQIIWQKKKGGGQDSQDFAKEHEYILCYSKYEWKINDKKEQLSENKFNKIINGKKAIISKLEKWGIGALMEDAPSLYYPIKDPNGNDFYPIAPNGEKGRWRKKPENLDSEYIYWQENSKGRLTPYEVIYFDEVKDKEKIIKTRTIFTGYGTTTDATKEILNLFNNQKIFDTPKPTNLIKTLLQLSTTPNSNDIILDFFAGSGTTAQAVMELNAEDNGNREFILVQLDEVIDKSKSKTAYEFCKNELGSENPTIFDITKERIKRASAKIAQNSNLDLGFKIYELRENDFDSQNGALFKEVDKNALLESFRLQDSTPLSVENQTIDLGGYKAIRAGEKLYLLNSGFEMKHLQKLISLIDAQKDFVIKEISYLNDAFESARIREIEEGIKSYSNKKELKILVRARFA
>NC_017761.1|WP_002957390.1|1361229_1361622_+|hypothetical-protein
MDKERLDIEVLDKSKCDEEGFVYVFVVNEKIFKIGQSTTNIIKRIQSYNCGKAQYRKNGTCGTTNYFVLQSLLNLNLEVFVYAFFPQKPRYEIFGQVFEDSYPPSKKVENIIITDFIKKHGKKPIGCTQA
>NC_017761.1|WP_041309631.1|1361792_1362362_-|hypothetical-protein
MKYKNEYNINDIKTFIDLMRQNIDDKNKEQLKRAISSISLAEECIQNGFVDYEKFYQNFKEYKLEDSFVQEESNLQSNKEFLETNTNKEDIVSKELLTSLQDLTLLSEDSQNKKQEVQRLQNLKEEEDFYKPEIAEKKQTYPPSINVMLGFIKDKDLLSIGISGTFTHSLPFGFRIRAHSFHTPKSALM

Crispr_ID: NC_017761_4

• CRISPR_ID: NC_017761_4
• CRISPR_location: 1748910-1749409
• CRISPR_type: TypeIII
• Repeat_type: NA
• Spacer_info: 7 spacers
• Cas_protein_info: csm3gr7,csx19,cas10,csx23

Consensus repeat of NC_017761_4

Consensus_repeat	Method
GTTTTAGTGGGACCCGATTTGTGAGGGGATTGCAAC	CRISPRCasFinder
GTTTTAGTGGGACCCGATTTGTGAGGGGATTGCAACTA	PILER-CR

spacers of NC_017761_4

>4.1|1748946|30|NC_017761|CRISPRCasFinder
ATCCAGCTATATCTTCAGCACTACAAGATG
>4.2|1749012|30|NC_017761|CRISPRCasFinder
ATCCAGCTATATCTTCAGCACTACAAGATG
>4.3|1749078|30|NC_017761|CRISPRCasFinder
ATCCAGCTATATCTTCAGCACTACAAGATG
>4.4|1749144|30|NC_017761|CRISPRCasFinder
AGAGAAGAAACAGCAAGCTAATTAATCAAA
>4.5|1749210|30|NC_017761|CRISPRCasFinder
TGATTTTGGCAAGTAATGATTATTTGGTAG
>4.6|1749276|30|NC_017761|CRISPRCasFinder
TAACCTTTGCTTCTGTCCTTGCTATACTTG
>4.7|1749342|30|NC_017761|CRISPRCasFinder
TAACCTTTGCTTCTGTCCTTGCTATACTTG
>4.8|1749212|28|NC_017761|PILER-CR
ATTTTGGCAAGTAATGATTATTTGGTAG
>4.9|1749278|28|NC_017761|PILER-CR
ACCTTTGCTTCTGTCCTTGCTATACTTG
>4.10|1749344|28|NC_017761|PILER-CR
ACCTTTGCTTCTGTCCTTGCTATACTTG

CRISPR arrays and Neighbor proteins around NC_017761_4

CRISPR arrays

The CRISPR arrays of NC_017761_4

>merge|NC_017761|4|1748910-1749409|CRISPRCasFinder,PILER-CR
GTTTTAGTGGGACCCGATTTGTGAGGGGATTGCAACATCCAGCTATATCTTCAGCACTACAAGATGGTTTTAGTGGGACCCGATTTGTGAGGGGATTGCAACATCCAGCTATATCTTCAGCACTACAAGATGGTTTTAGTGGGACCCGATTTGTGAGGGGATTGCAACATCCAGCTATATCTTCAGCACTACAAGATGGTTTTAGTGGGACCCGATTTGTGAGGGGATTGCAACAGAGAAGAAACAGCAAGCTAATTAATCAAAGTTTTAGTGGGACCCGATTTGTGAGGGGATTGCAACTGATTTTGGCAAGTAATGATTATTTGGTAGGTTTTAGTGGGACCCGATTTGTGAGGGGATTGCAACTAACCTTTGCTTCTGTCCTTGCTATACTTGGTTTTAGTGGGACCCGATTTGTGAGGGGATTGCAACTAACCTTTGCTTCTGTCCTTGCTATACTTGGTTTTAGTGGGACCCGATTTGTGAGGGGATTGCAACTA

>NC_017761|4|2|1748910-1749407|CRISPRCasFinder
GTTTTAGTGGGACCCGATTTGTGAGGGGATTGCAAC	ATCCAGCTATATCTTCAGCACTACAAGATG
GTTTTAGTGGGACCCGATTTGTGAGGGGATTGCAAC	ATCCAGCTATATCTTCAGCACTACAAGATG
GTTTTAGTGGGACCCGATTTGTGAGGGGATTGCAAC	ATCCAGCTATATCTTCAGCACTACAAGATG
GTTTTAGTGGGACCCGATTTGTGAGGGGATTGCAAC	AGAGAAGAAACAGCAAGCTAATTAATCAAA
GTTTTAGTGGGACCCGATTTGTGAGGGGATTGCAAC	TGATTTTGGCAAGTAATGATTATTTGGTAG
GTTTTAGTGGGACCCGATTTGTGAGGGGATTGCAAC	TAACCTTTGCTTCTGTCCTTGCTATACTTG
GTTTTAGTGGGACCCGATTTGTGAGGGGATTGCAAC	TAACCTTTGCTTCTGTCCTTGCTATACTTG
GTTTTAGTGGGACCCGATTTGTGAGGGGATTGCAAC

>NC_017761|4|4|1749174-1749409|PILER-CR
GTTTTAGTGGGACCCGATTTGTGAGGGGATTGCAACTG	ATTTTGGCAAGTAATGATTATTTGGTAG
GTTTTAGTGGGACCCGATTTGTGAGGGGATTGCAACTA	ACCTTTGCTTCTGTCCTTGCTATACTTG
GTTTTAGTGGGACCCGATTTGTGAGGGGATTGCAACTA	ACCTTTGCTTCTGTCCTTGCTATACTTG
GTTTTAGTGGGACCCGATTTGTGAGGGGATTGCAACTA

Neighbor Proteins Overview

Protein	Signature genes	Signature genes Name	Protein_function
NC_017761.1|WP_014667278.1|1737777_1738602_-|hypothetical-protein	unknown	unknown	gnl|CDD|368834
NC_017761.1|WP_014667286.1|1743663_1744098_+|TIGR04423-family-type-III-CRISPR-associated-protein	csx19	mkCas0122_csx19_CAS-III-D	gnl|CDD|275216
NC_017761.1|WP_014667289.1|1749650_1751060_+|sodium-dependent-transporter	unknown	unknown	gnl|CDD|271367
NC_017761.1|WP_014667291.1|1757186_1757864_-|hypothetical-protein	unknown	unknown	unknown
NC_017761.1|WP_014667288.1|1747149_1747752_-|recombinase-family-protein	unknown	unknown	gnl|CDD|184041
NC_017761.1|WP_014667293.1|1760433_1761354_-|DMT-family-transporter	unknown	unknown	gnl|CDD|307170
NC_017761.1|WP_002955696.1|1754871_1756254_-|CZB-domain-containing-protein	unknown	unknown	gnl|CDD|206779
NC_017761.1|WP_002955693.1|1751068_1752214_-|glutamine-hydrolyzing-carbamoyl-phosphate-synthase-small-subunit	unknown	unknown	gnl|CDD|237139
NC_017761.1|WP_014667283.1|1741490_1741769_+|hypothetical-protein	cas10	mkCas0133_cas10_CAS-III	unknown
NC_017761.1|WP_014667284.1|1741781_1742885_+|hypothetical-protein	cas10	mkCas0133_cas10_CAS-III	gnl|CDD|274208
NC_017761.1|WP_014667285.1|1742900_1743683_+|hypothetical-protein	csm3gr7	cd09726_csm3gr7_CAS-III-D	gnl|CDD|377130
NC_017761.1|WP_119361907.1|1746378_1747155_+|undecaprenyl/decaprenyl-phosphate-alpha-N-acetylglucosaminyl-1-phosphate-transferase	unknown	unknown	gnl|CDD|133463
NC_017761.1|WP_041309552.1|1752825_1754838_-|PBP1A-family-penicillin-binding-protein	unknown	unknown	gnl|CDD|273955
NC_017761.1|WP_014667608.1|1747779_1748406_-|undecaprenyl/decaprenyl-phosphate-alpha-N-acetylglucosaminyl-1-phosphate-transferase	unknown	unknown	gnl|CDD|133463
NC_017761.1|WP_002955680.1|1740352_1740676_+|hypothetical-protein	csx23	mkCas0160_csx23_CAS-III-D	unknown
NC_017761.1|WP_014667287.1|1744090_1745872_+|TIGR03986-family-CRISPR-associated-RAMP-protein	csm3gr7	cls000253_csm3gr7_CAS-III-A:CAS-III-D	gnl|CDD|274902
NC_017761.1|WP_014667292.1|1759184_1760423_-|threonine-ammonia-lyase	unknown	unknown	gnl|CDD|181457
NC_017761.1|WP_002955694.1|1752210_1752762_-|DUF507-family-protein	unknown	unknown	gnl|CDD|367914
NC_017761.1|WP_002955698.1|1756530_1756986_+|transcriptional-repressor	unknown	unknown	gnl|CDD|366663
NC_017761.1|WP_002955742.1|1757870_1759166_-|hypothetical-protein	unknown	unknown	gnl|CDD|379080

HMMScan for Signature genes

Protein	Cas_name	Cas_description	E-value	Identity	Coverage
NC_017761.1|WP_014667285.1|1742900_1743683_+|hypothetical-protein	csm3gr7	cd09726_csm3gr7_CAS-III-D	9.2e-18	60.0	0.0
NC_017761.1|WP_014667286.1|1743663_1744098_+|TIGR04423-family-type-III-CRISPR-associated-protein	csx19	mkCas0122_csx19_CAS-III-D	7.7e-73	238.4	2.5
NC_017761.1|WP_002955680.1|1740352_1740676_+|hypothetical-protein	csx23	mkCas0160_csx23_CAS-III-D	8.5e-38	123.7	0.6
NC_017761.1|WP_014667287.1|1744090_1745872_+|TIGR03986-family-CRISPR-associated-RAMP-protein	csm3gr7	cls000253_csm3gr7_CAS-III-A:CAS-III-D	2e-86	286.0	25.8
NC_017761.1|WP_014667283.1|1741490_1741769_+|hypothetical-protein	cas10	mkCas0133_cas10_CAS-III	2.3e-18	61.1	0.0
NC_017761.1|WP_014667284.1|1741781_1742885_+|hypothetical-protein	cas10	mkCas0133_cas10_CAS-III	3.7e-60	198.7	0.5

rpsblast for functional proteins

Protein	Function_ID	Function_description	E-value
NC_017761.1|WP_014667278.1|1737777_1738602_-|hypothetical-protein	gnl|CDD|368834	pfam06300, Tsp45I, Tsp45I type II restriction enzyme. This family consists of several type II restriction enzymes.	5.28711e-72
NC_017761.1|WP_014667286.1|1743663_1744098_+|TIGR04423-family-type-III-CRISPR-associated-protein	gnl|CDD|275216	TIGR04423, predicted_protein, CRISPR type III-associated protein, TIGR04423 family. Members of this protein family occur only in species with CRISPR systems, in the context of type III systems that resemble type III-A (MTUBE) and III-B (the RAMP module). It occurs in several species of Prevotella, Helicobacter, Campylobacter, and Bacteroides.	3.11612e-48
NC_017761.1|WP_014667289.1|1749650_1751060_+|sodium-dependent-transporter	gnl|CDD|271367	cd10336, SLC6sbd_Tyt1-Like, solute carrier 6 subfamily, Fusobacterium nucleatum Tyt1-like; solute-binding domain. SLC6 proteins (also called the sodium- and chloride-dependent neurotransmitter transporter family or Na+/Cl--dependent transporter family) include neurotransmitter transporters (NTTs): these are sodium- and chloride-dependent plasma membrane transporters for the monoamine neurotransmitters serotonin (5-hydroxytryptamine), dopamine, and norepinephrine, and the amino acid neurotransmitters GABA and glycine. These NTTs are widely expressed in the mammalian brain, involved in regulating neurotransmitter signaling and homeostasis, and the target of a range of therapeutic drugs for the treatment of psychiatric diseases. Bacterial members of the SLC6 family include the LeuT amino acid transporter. An arrangement of 12 transmembrane (TM) helices appears to be as a common topological motif for eukaryotic and some prokaryotic and archaeal NTTs. However, this subfamily which contains the majority of bacterial members and some archaeal members, appears to contain only 11 TMs; for example the functional Fusobacterium nucleatum tyrosine transporter Tyt1.	4.52884e-130
NC_017761.1|WP_014667292.1|1759184_1760423_-|threonine-ammonia-lyase	gnl|CDD|181457	PRK08526, PRK08526, threonine dehydratase; Provisional.	0
NC_017761.1|WP_014667288.1|1747149_1747752_-|recombinase-family-protein	gnl|CDD|184041	PRK13413, mpi, master DNA invertase Mpi family serine-type recombinase.	2.00803e-82
NC_017761.1|WP_014667293.1|1760433_1761354_-|DMT-family-transporter	gnl|CDD|307170	pfam00892, EamA, EamA-like transporter family. This family includes many hypothetical membrane proteins of unknown function. Many of the proteins contain two copies of the aligned region. The family used to be known as DUF6. Members of this family usually carry 5+5 transmembrane domains, and this domain attempts to model five of these.	1.24272e-10
NC_017761.1|WP_002955696.1|1754871_1756254_-|CZB-domain-containing-protein	gnl|CDD|206779	cd11386, MCP_signal, Methyl-accepting chemotaxis protein (MCP), signaling domain. Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.	9.84292e-42
NC_017761.1|WP_041309552.1|1752825_1754838_-|PBP1A-family-penicillin-binding-protein	gnl|CDD|273955	TIGR02074, Includes:_Penicillin-insensitive_transglycosylase, penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan].	0
NC_017761.1|WP_014667284.1|1741781_1742885_+|hypothetical-protein	gnl|CDD|274208	TIGR02577, thermophile-specific_DNA_repair_system, CRISPR-associated protein Cas10/Cmr2, subtype III-B. This model represent a Crm2 family of the CRISPR-associated RAMP module, a set of six genes recurring found together in prokaryotic genomes. This gene cluster is found only in species with CRISPR repeats, usually near the repeats themselves. Because most of the six (but not this family) contain RAMP domains, and because its appearance in a genome appears to depend on other CRISPR-associated Cas genes, the set is designated the CRISPR RAMP module. This protein, typified by TM1794 from Thermotoga maritima, is designated Crm2, for CRISPR RAMP Module protein 2.	1.34057e-08
NC_017761.1|WP_014667285.1|1742900_1743683_+|hypothetical-protein	gnl|CDD|377130	pfam03787, RAMPs, RAMP superfamily. The molecular function of these proteins is not yet known. However, they have been identified and called the RAMP (Repair Associated Mysterious Proteins) superfamily. The members of this family have no known function they are around 300 amino acids in length and have several conserved motifs.	2.2756e-07
NC_017761.1|WP_119361907.1|1746378_1747155_+|undecaprenyl/decaprenyl-phosphate-alpha-N-acetylglucosaminyl-1-phosphate-transferase	gnl|CDD|133463	cd06853, GT_WecA_like, This subfamily contains Escherichia coli WecA, Bacillus subtilis TagO and related proteins. WecA is an UDP-N-acetylglucosamine (GlcNAc):undecaprenyl-phosphate (Und-P) GlcNAc-1-phosphate transferase that catalyzes the formation of a phosphodiester bond between a membrane-associated undecaprenyl-phosphate molecule and N-acetylglucosamine 1-phosphate, which is usually donated by a soluble UDP-N-acetylglucosamine precursor. WecA participates in the biosynthesis of O antigen LPS in many enteric bacteria and is also involved in the biosynthesis of enterobacterial common antigen. A conserved short sequence motif and a conserved arginine at a cytosolic loop of this integral membrane protein were shown to be critical in recognition of substrate UDP-N-acetylglucosamine.	1.64453e-42
NC_017761.1|WP_002955742.1|1757870_1759166_-|hypothetical-protein	gnl|CDD|379080	pfam13231, PMT_2, Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.	0.0037061
NC_017761.1|WP_014667608.1|1747779_1748406_-|undecaprenyl/decaprenyl-phosphate-alpha-N-acetylglucosaminyl-1-phosphate-transferase	gnl|CDD|133463	cd06853, GT_WecA_like, This subfamily contains Escherichia coli WecA, Bacillus subtilis TagO and related proteins. WecA is an UDP-N-acetylglucosamine (GlcNAc):undecaprenyl-phosphate (Und-P) GlcNAc-1-phosphate transferase that catalyzes the formation of a phosphodiester bond between a membrane-associated undecaprenyl-phosphate molecule and N-acetylglucosamine 1-phosphate, which is usually donated by a soluble UDP-N-acetylglucosamine precursor. WecA participates in the biosynthesis of O antigen LPS in many enteric bacteria and is also involved in the biosynthesis of enterobacterial common antigen. A conserved short sequence motif and a conserved arginine at a cytosolic loop of this integral membrane protein were shown to be critical in recognition of substrate UDP-N-acetylglucosamine.	1.93922e-32
NC_017761.1|WP_002955693.1|1751068_1752214_-|glutamine-hydrolyzing-carbamoyl-phosphate-synthase-small-subunit	gnl|CDD|237139	PRK12564, PRK12564, carbamoyl-phosphate synthase small subunit.	0
NC_017761.1|WP_014667287.1|1744090_1745872_+|TIGR03986-family-CRISPR-associated-RAMP-protein	gnl|CDD|274902	TIGR03986, CRISPR-associated_protein, CRISPR-associated protein. Members of this protein family, part of the larger RAMP family, are found exclusively in species with CRISPR systems, in local contexts containing other RAMP (Repeat-Associated Mystery Proteins).	1.16902e-72
NC_017761.1|WP_002955694.1|1752210_1752762_-|DUF507-family-protein	gnl|CDD|367914	pfam04368, DUF507, Protein of unknown function (DUF507). Bacterial protein of unknown function.	2.53779e-72
NC_017761.1|WP_002955698.1|1756530_1756986_+|transcriptional-repressor	gnl|CDD|366663	pfam01475, FUR, Ferric uptake regulator family. This family includes metal ion uptake regulator proteins, that bind to the operator DNA and controls transcription of metal ion-responsive genes. This family is also known as the FUR family.	8.79712e-44

Protein sequences

>NC_017761.1|WP_014667608.1|1747779_1748406_-|undecaprenyl/decaprenyl-phosphate-alpha-N-acetylglucosaminyl-1-phosphate-transferase
MIFLGLFFTTFALVGVSNAINIIDGFNGLASGVCLLILAGIMYVAYDVKDVEIFYCALVLFFGILGFFVCNFPLGKIFLGDGGAYFLGFILGMLLVLLTQRHTESVSAFFGLSIMIYPVWEVVFSIWRKRFKRKMSATKPDKVHLHMLVFKRITHSNKNTSLILLAYNVPFVMLSVCFYQHTWLLLAFCGIFALLYGYFYARLIRFGM
>NC_017761.1|WP_014667288.1|1747149_1747752_-|recombinase-family-protein
MHYIYLRVSSHKQSVKNQYFEIQKWCEQRNIHTYRVIAETMSGAISPDYRQLGILLKKAQKGDCLIIAEISRLGRSILQIMSVLHQCMERGITIYSIKENYELGDNLNSKVLAFAFSLSAEIERHLISQRTKEALSRIKSEGGKLGRPRGIAPLQSLKLYENKDSIIKMYQNRIPMVRIAKRFNVNRKTLACFLKRLGLL
>NC_017761.1|WP_119361907.1|1746378_1747155_+|undecaprenyl/decaprenyl-phosphate-alpha-N-acetylglucosaminyl-1-phosphate-transferase
MLGSGIIFASGLIEDFSGNLSPKMRLIMQCVAAFGVCAWIDVYLKDLSLGFTLPYLIGLFFTTFALVGVSNAINIIDGFNGLASGVCLLILAGIMYVAYDVKDVEIFYCALVLFFGILGFFVCNFPLGKIFLGDGGAYFLGFILGMLLVLLTQRHTESVSAFFGLSIMIYPVWEVVFSIWRRKRLRRNATSPDDLHLHTLIFKISRHNVGTSSVILALHIPIVIFSIYFHAHTLVLICGIMGFVGLYMLCYFVLSKRL
>NC_017761.1|WP_014667287.1|1744090_1745872_+|TIGR03986-family-CRISPR-associated-RAMP-protein
MIDITAPYRFVRTYNKIFYPSWGQKQGKDISFDMPYIDSQSGQINITITAKSPIFVGNGTGKQQDDTGKNKSDKTDKPQEFFNHNGTYYIPGSSIRGMIRTIATILSFSKMSLDDKTLSCRDINNPAYKKKAIKQNQTFIGWLYVKSKKWYIDEIGTLTKEHKISYEKLEQLFGKSLIANLKNKQAHAKYELLQHKNLHLKEGTIILTGFFGKKKNEFIFPHTITQTHNLTNEQVKTFQEAYYIGTPNESKDWTKRWKQEIKQGKKVPIFFQKTQNNQIRHFGLSMLYKLPYDNSTQALYTRSLAEYNKSYLDCVDRIFGFVRDDTQSHENKALKGRISFSHFKAQGSPKSFAKQSLILSTPRLTFYPYYIDQTPDTLFKTYDDQDSKLSGFKFYVPRHNIMDHKGNGNSNILSHIIPLDKGTTFTGTLRYFNLKKEELGLLLLALTFLQDKYYYKIGGAKPYGFGDCHIKLHTSLNTQEYINAYIDFVKREFGDDPINSQSAKDLLEVSQQMPSDEYLDYMELQEFTKLKSENQSKFGKRHSHNGGNNPHRNHHHNSPNPKAPKPYNESREHKNKDDAFKNTIRISQKGQKH
>NC_017761.1|WP_014667286.1|1743663_1744098_+|TIGR04423-family-type-III-CRISPR-associated-protein
MTQADFKAFYANLTESFEGYIQLSDSKDFIILDNEPLPQWEALHNGKNFIHQMCLYSPTTQRSINATQINNGFNVLDKNLADFEKSAKSEVEFLVNAQAHKRNISQIKITQIWQEVADELCCDFNVLMPTFTLFSGFTKGENND
>NC_017761.1|WP_014667285.1|1742900_1743683_+|hypothetical-protein
MSHNITFLDYWHLGSGQSGGAKYDSSVIKDRQGFPYVPGKTLKGLLREYAEGEFAKVCFGEQGETRGMCYFSNAYIESSTRAELLKHNHQFLLVDSISATKINDKGVAESGSLREIEAVIPLSLYGSIENVPNEFVSLMSATLKKIKRMGLNRTRGKILLVDMYYNKAKGKTFPHIKIDNFTGGGIDGALFQEKVDTLESFKLKIWLEKGIDKTALEAFEHALCDIANGLLALGGASSKGHGYFQGSITKNGENYDTSRF
>NC_017761.1|WP_014667284.1|1741781_1742885_+|hypothetical-protein
MNEYKSASAKLEKNLKIARNKIALPLDTHLSICAINPRTGLSAIPSKLATNKKEMFDTSVNQKLQAFNEAVNKNKALAQDINAIKNKKNKIAVIHIDGNGLGGIVRGLEKDEMKTFSQKLDSATKEAYKQTLESIIDSNPTYQNALRDIILGGDDVTLICNANIALDLSEKFLENFESNTQNIHKQSSLTACAGIAYCNEKFPFFYAVKLAEDLCAYAKKDAKEINPKLPPSCLMFHNIQGSYVEGFSQFLDEELSINSVRCDFGPYYLRDIENKPSIKAFKSLIQDFKKDNSPKGRLRDWLSSLQFNKEYAKAESIRIAEIFKDKWKGENLATLHRELSLANLILVIDNVEKTPIYDILQILSVQD
>NC_017761.1|WP_014667283.1|1741490_1741769_+|hypothetical-protein
MGQYLYGASLQGLQEFIFKTNKLREIVGASEIIKTFDEIDLKAEFHLSTEPDVILKAAGNLRVIFDNESDVKKVVKYLPKKILQSAYGVNLS
>NC_017761.1|WP_002955680.1|1740352_1740676_+|hypothetical-protein
MNIISTFISLGTFGIVAYRFGRDNHKISIIIHRDNLEQEIPIKILRKQVTRSEILGILGTLDRESNFSIAYTGEKAFFDNMVAVQSGWRARKIHIYIQEGDKFNYAL
>NC_017761.1|WP_014667278.1|1737777_1738602_-|hypothetical-protein
MTSWTRESINLANNYDYLDRLYTIYPVISNVRQNLSPEVMNNLASMLLPTPNFARGELLNLLLEQEVFPIKDSYVAYLRRDRTAIERNPNTVNRIETTIANMGYQNVLREITRPIEANRQMGQHFKNWVNSQYFRYEKTNDINHFLTTDTLLVFIGSDKVMAEVAQDYFGYQKGKGIDFIAKKGQSVAIGEAKFLTDFGGHQNAQFNDANNIISINAFAPSNYQIFPIAILDGVLYIQNTANGNATNNKMANFLNNSDKLIMSALLLIDFIATL
>NC_017761.1|WP_014667289.1|1749650_1751060_+|sodium-dependent-transporter
MNNFSKIGFVLATLGSSIGLGHIWRFPYMAGENGGGAFVIFYLILAILIGASMLMAEMLLGNKARSNPLDNFTILNNLNKLPPNTPTQEHNTTDSKSSSSLMWLGFSTIAAPLILSFYAVVMGWIMYYLFYVSFHLPTNINEADVIFNEITSRSLLWQSVCFFGVIAITGIIVGFGVKRGIESLNLILMPLLFIIFVGLLVYAMNLPEFSKAWAFMFHFEPSNITTKTIIESLGQVFFSLSLGVGTIAVYAASAKQNENLFQSSVWVVVSGIVVSLVAGLMIFTFIYHFKGVPSDGVGLLFKSLPLAFNALGGSGAVISMFFFIAVLFAGITSTVSMLEPGVSILRDKCHFSQIKATFILSLAILVLGFLVILWANAEMELPLIFGQPLFGVLDSITSSFLMPVGMLIILTFVGWKIRANHLRTWTPYLPQWLFVGWLWILRIIAPAIILIVLASKYFDIVGFINSLLA
>NC_017761.1|WP_002955693.1|1751068_1752214_-|glutamine-hydrolyzing-carbamoyl-phosphate-synthase-small-subunit
MSELKDVSLYFANGLSLKAKSFGAEGTFVGEVVFNTSMTGYQEIITDPSYAGQFVIFSMPEIGIVGVNEYDNESKSASCVGMIVSSYNDYVSNFRAQGSLADFLKSRNIMGICNVDTRGLIKLLTKQGAMNMIASTQMSQIDELREALESVPNISQINFIEQVSTKTPYTHTDSVFDFASFAYVKPKEPKAKVIAIDFGAKANILNELTSVGLEVEVMPHTFKADEIVARFQKDEIQGVFLSNGPGDPLVLCNEVEQIKLLIEANIPIFGICLGHQLLSIAHGYPTHKLKFGHHGGNHPIKNLQSGAVEITAQNHNYCVPESISEIATITHRNLFDNTIEGVRYKNKPIFSVQHHPEASPGPKEARILFQDFATLCLKPQS
>NC_017761.1|WP_002955694.1|1752210_1752762_-|DUF507-family-protein
MRLKLQHAPYIANKISIDLGNSPHIKPLAPIANIAQVALECLQENIQKELAIDEKVREILEERSDEIEDFHMDERELFRMCKRQVAKERNFYLSWEDRCSDVSHKILSTLESKGLIAFSVSETIIKNIIFKAINDYSRIYDKAEDAVFERLKKYKRKLTYGTEEYEIVFSKLYEEELRKKGLL
>NC_017761.1|WP_041309552.1|1752825_1754838_-|PBP1A-family-penicillin-binding-protein
MWRRVRVGVFVVSIVLGVGIGVYLIKLFYEVETEVSKIKEYRFALASQIVDRKDRLIANIFTDENFRFYATFDEIPPRVIESLLAVEDTLFFEHIGINPDAISRAMLKNIKSMRYVEGGSTLTQQLIKNIALSPEKTLKRKLTEAMLAIHIERHLSKEKILELYLNRISFGHGYHGIKTAALGYFHKTLHELSLKEICMLVGLPKAPSFYDPTKNKDYSMSRANDIIDRLYDIGWISKEEHDNAINEVPDVYNETLTQNVAPYVVDEVLRELGHIEDLKTGGYYIKLKVDLDYQLAAQEAVAYGYEEINKRLRERYPKIYNDETMDENDTLNGAMVVTDTHTGDILAMVGGVNYAKQKFNRATQAKRQIGSSVKPFIYQAAFDKGDSPATFIPDVPRKFATKGAAEAAAEGTKETESEEWRPSNYSSKFNGFMTLKDALRTSSNLATINLVDQNLGFGKLYQALKRDGFDDLPENMSIVLGSFELSLVEVAEQYSMFSNYGTILKPTLIESVINKSGESIYSSPTQSRHITTAQQAFLTIDILRDVVNRGTGFRARIKGIEVAGKTGTSNRNIDGWFCGFTPDVQAIVWYGRDDNTPIGPTESGGIVSPPAFAYFFSKVLTFDPGISRKFKVPEGVKLKTLDYGDFYYTENSPLPSKKPMAVDIEEELLF
>NC_017761.1|WP_002955696.1|1754871_1756254_-|CZB-domain-containing-protein
MFGSSKALQRQIMEKDAHIAHLTKKLEVYETLVGFSQVEAIIGLKGGEIIYQNDVAKKLERMECLIPQLNESVSSVSCVRHDYSVVSTRVEDVVYYSIVPLDHLTNNTTGTNLFEVYTKSLKTGVTETQTSLQNVLTESNGVAEYSIKAVESAEDGLGMSTQALDQIEILYEKMQVASGLVDSLTQRSNEITSVISLIDDIAEQTNLLALNAAIEAARAGEYGRGFAVVADEVRKLAEKTQKATKEIAVVVKSMQQEANDIQTSTEETNEATSNVREGIMKLHGIVNNLKLDSLITKHSTFNLSNRIFCVLAKLDHIVFKNNLYSYIFGLADSFNCVDHHNCRLGKWYFEGEGKAVFANTQGYKALDAFHMGVHTEAITLAQTFADEKQSCPKKLIDTKILAMEQSSDGVMKAIVDMYNEKREEVLGDIKRLESEMIQAERHRAALSGTESSVEPQAQEA
>NC_017761.1|WP_002955698.1|1756530_1756986_+|transcriptional-repressor
MNANHRVETLDSILERLRSSIKKNGLKNSKQREEIISVLYKSGTHLSPEEITNIIKTTDKNASISSVYRILSFLEKENFITALEADKSGRRYEIAAKEHHDHIICLTCGDIVEFVDDEIERLQLDIAKQFGAKLISHDMRLFVKCSKCQGL
>NC_017761.1|WP_014667291.1|1757186_1757864_-|hypothetical-protein
MKLFEFLIALSLMLVLFSFPSIKANHSLESAYKSLATHIRATQLAALSDDVVLIQLESARDLLRFYPSSNALALMQQYHNAMWQIQFHLGRIYTTFSYSIYADTPRHATNTNFDSRPMAGDMILKNMDRKCLSAYNNTNTAQECKNNAQAEVRLGEYFGIEQMFLESDRFCRENGGGRIYFDRLGVPYCGKIPTPLQQPFKITLQKGKYTKSLCVMPKSGIVKEC
>NC_017761.1|WP_002955742.1|1757870_1759166_-|hypothetical-protein
MLKDMWDIYRTSNLRTNVLFCLILGINVGMLLFACGDLSIHHREAAGVFYSQDLLFVVVRFFLDTFGWNDYVLRLPLILLHIGNMFLMYRISRLYLKKPRDSLIVVLVYALLPGVMLSALLVLKSGFIIFVSLLCCYYQMRFKRMPYVMMFVAVFLDGSFAVLFFALFFYTLRNKNTLGMFITLVFFALNMYIFGFDVSGSPRNYFLQNLGKMALYFSPLLLVYYFYTIVNALKKQNNILVDIGATSMFFVMLLSLRQDVDLESLFPMSVVALPVAIRHFFADMRVRLPNFRAVYVRRFVVIFALLCMQSLVLYGNKVLYLFGVQNHFASSYYISKDVANVLQSRGIESIKVSDSRLELALRFYGIKSEKNPYLLPITDLNESYVDEIDIVYLGKKVASFVVVPTSSGKPLSTTQAHKNKQIDKAKNPKTP
>NC_017761.1|WP_014667292.1|1759184_1760423_-|threonine-ammonia-lyase
MRHIYDKVLEARQRLQGVIAHTPLSYAPVLSQLSVGEIYLKKENLQLTGAFKIRGAFNKIASLVESSKAESYKAGQIQGVIAASAGNHAQGVAYSARHFGIQSVIVMPEATPLLKVSATKALGAEVVLCGDNYDEAFERALQIAKERDLVFIHPFADELVIAGQGSIGLEIIEEKNDIDVVVVPIGGGGLLGGIGSVIKTLKPSVRVIGVVASGADAMKRSFVSGKIEKVESVRSIADGIAVRDVNADNFALLQQCVDEIVSVDDEEIANAILFLLEKQKLVVEGAGAASVASVLHKKFSFSQSDKIALLLSGGNIDITMLNVIIEKGLLKSNRKMKLEVVLVDKPGSLQGLTDILSKVGANIVQIEYDRTSVILKYGDALVTMALETKGQEHKEQIRQSLKNYGYFFNEIN
>NC_017761.1|WP_014667293.1|1760433_1761354_-|DMT-family-transporter
MSANLTQGILAMLFSSLLFALMGAEAKILSLTLPSMEVAFFRSFLMVLFLLPLCFSKPMKKPSHKKGGYVFLLSRSIAGGLSFVALFYNIATISLGNATAFSQSMPLYVVVLSFLFLKERFHLGVVLSTIIGFCGILLICNPNFNAMGLENVIFGISSALFMAVAFLNLRALKDYFSSWVPVFATGVAMSVITLIVSVAQIPLFAESWAMPQGIDWLHIILLGLFGTLGQHYLTKAYMSAPAGIVAPIDYMRLVFSVILGVLLGDNLPNLATSFGIMLIILSGIGVGLPPLLADMKKLLHAKNTKK

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NC_017761_3	3.13|1347203|30|NC_017761|CRISPRCasFinder,CRT	1347203-1347232	30	NC_017761.1	1657414-1657443	0	1.0
NC_017761_3	3.14|1347269|30|NC_017761|CRISPRCasFinder,CRT	1347269-1347298	30	NC_017761.1	1657414-1657443	0	1.0
NC_017761_4	4.1|1748946|30|NC_017761|CRISPRCasFinder	1748946-1748975	30	NC_017761.1	1851447-1851476	0	1.0
NC_017761_4	4.2|1749012|30|NC_017761|CRISPRCasFinder	1749012-1749041	30	NC_017761.1	1851447-1851476	0	1.0
NC_017761_4	4.3|1749078|30|NC_017761|CRISPRCasFinder	1749078-1749107	30	NC_017761.1	1851447-1851476	0	1.0
NC_017761_4	4.4|1749144|30|NC_017761|CRISPRCasFinder	1749144-1749173	30	NC_017761.1	1923220-1923249	0	1.0
NC_017761_4	4.5|1749210|30|NC_017761|CRISPRCasFinder	1749210-1749239	30	NC_017761.1	47260-47289	0	1.0
NC_017761_4	4.8|1749212|28|NC_017761|PILER-CR	1749212-1749239	28	NC_017761.1	47262-47289	0	1.0

1. spacer 3.13|1347203|30|NC_017761|CRISPRCasFinder,CRT matches to position: 1657414-1657443, mismatch: 0, identity: 1.0

ctaaatcacttcttgcctacgagattcttc	CRISPR spacer
ctaaatcacttcttgcctacgagattcttc	Protospacer
******************************

2. spacer 3.14|1347269|30|NC_017761|CRISPRCasFinder,CRT matches to position: 1657414-1657443, mismatch: 0, identity: 1.0

ctaaatcacttcttgcctacgagattcttc	CRISPR spacer
ctaaatcacttcttgcctacgagattcttc	Protospacer
******************************

3. spacer 4.1|1748946|30|NC_017761|CRISPRCasFinder matches to position: 1851447-1851476, mismatch: 0, identity: 1.0

atccagctatatcttcagcactacaagatg	CRISPR spacer
atccagctatatcttcagcactacaagatg	Protospacer
******************************

4. spacer 4.2|1749012|30|NC_017761|CRISPRCasFinder matches to position: 1851447-1851476, mismatch: 0, identity: 1.0

atccagctatatcttcagcactacaagatg	CRISPR spacer
atccagctatatcttcagcactacaagatg	Protospacer
******************************

5. spacer 4.3|1749078|30|NC_017761|CRISPRCasFinder matches to position: 1851447-1851476, mismatch: 0, identity: 1.0

atccagctatatcttcagcactacaagatg	CRISPR spacer
atccagctatatcttcagcactacaagatg	Protospacer
******************************

6. spacer 4.4|1749144|30|NC_017761|CRISPRCasFinder matches to position: 1923220-1923249, mismatch: 0, identity: 1.0

agagaagaaacagcaagctaattaatcaaa	CRISPR spacer
agagaagaaacagcaagctaattaatcaaa	Protospacer
******************************

7. spacer 4.5|1749210|30|NC_017761|CRISPRCasFinder matches to position: 47260-47289, mismatch: 0, identity: 1.0

tgattttggcaagtaatgattatttggtag	CRISPR spacer
tgattttggcaagtaatgattatttggtag	Protospacer
******************************

8. spacer 4.8|1749212|28|NC_017761|PILER-CR matches to position: 47262-47289, mismatch: 0, identity: 1.0

attttggcaagtaatgattatttggtag	CRISPR spacer
attttggcaagtaatgattatttggtag	Protospacer
****************************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_017761_4	4.8|1749212|28|NC_017761|PILER-CR	1749212-1749239	28	AP014353	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S39-C37, *** SEQUENCING IN PROGRESS ***	10081-10108	5	0.821
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	NC_015512	Haliscomenobacter hydrossis DSM 1100 plasmid pHALHY02, complete sequence	81819-81848	6	0.8
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	MN592896	Alteromonas phage XX1924, complete genome	31994-32023	6	0.8
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	NC_015512	Haliscomenobacter hydrossis DSM 1100 plasmid pHALHY02, complete sequence	81819-81848	6	0.8
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	MN592896	Alteromonas phage XX1924, complete genome	31994-32023	6	0.8
NC_017761_3	3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT	1346939-1346968	30	NZ_CP039061	Piscirickettsia salmonis strain Psal-099 plasmid unnamed1, complete sequence	89105-89134	6	0.8
NC_017761_3	3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT	1346939-1346968	30	NZ_CP013797	Piscirickettsia salmonis strain AY6532B plasmid p1PS9, complete sequence	105626-105655	6	0.8
NC_017761_3	3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT	1346939-1346968	30	NZ_CP013787	Piscirickettsia salmonis strain PM58386B plasmid p1PS7, complete sequence	178638-178667	6	0.8
NC_017761_3	3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT	1346939-1346968	30	NZ_CP039228	Piscirickettsia salmonis strain SR1 plasmid unnamed1, complete sequence	187646-187675	6	0.8
NC_017761_3	3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT	1346939-1346968	30	NZ_CP013820	Piscirickettsia salmonis strain AY3800B plasmid p4PS10, complete sequence	105627-105656	6	0.8
NC_017761_3	3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT	1346939-1346968	30	NZ_CP013792	Piscirickettsia salmonis strain AY6297B plasmid p1PS8, complete sequence	105595-105624	6	0.8
NC_017761_3	3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT	1346939-1346968	30	NZ_CP013815	Piscirickettsia salmonis strain AY3864B plasmid p4PS11, complete sequence	105626-105655	6	0.8
NC_017761_3	3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT	1346939-1346968	30	NZ_CP011850	Piscirickettsia salmonis LF-89 = ATCC VR-1361 plasmid pPSLF89-1, complete sequence	48302-48331	6	0.8
NC_017761_3	3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT	1346939-1346968	30	NZ_CP039235	Piscirickettsia salmonis strain BI1 plasmid unnamed1, complete sequence	105908-105937	6	0.8
NC_017761_3	3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT	1346939-1346968	30	NZ_CP039241	Piscirickettsia salmonis strain MR5 plasmid unnamed1, complete sequence	169428-169457	6	0.8
NC_017761_3	3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT	1346939-1346968	30	NZ_CP039098	Piscirickettsia salmonis strain Psal-117 plasmid unnamed1, complete sequence	82136-82165	6	0.8
NC_017761_3	3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT	1346939-1346968	30	NZ_CP039056	Piscirickettsia salmonis strain Psal-098 plasmid unnamed1, complete sequence	140605-140634	6	0.8
NC_017761_3	3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT	1346939-1346968	30	NZ_CP039047	Piscirickettsia salmonis strain Psal-073 plasmid unnamed1, complete sequence	96418-96447	6	0.8
NC_017761_3	3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT	1346939-1346968	30	NZ_CP013807	Piscirickettsia salmonis strain PM31429B plasmid p1PS12, complete sequence	178540-178569	6	0.8
NC_017761_3	3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT	1346939-1346968	30	NZ_CP013782	Piscirickettsia salmonis strain PM49811B plasmid p1PS6, complete sequence	178532-178561	6	0.8
NC_017761_3	3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT	1346939-1346968	30	NZ_CP039088	Piscirickettsia salmonis strain Psal-111 plasmid unnamed1, complete sequence	84266-84295	6	0.8
NC_017761_3	3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT	1346939-1346968	30	NZ_CP039113	Piscirickettsia salmonis strain Psal-135 plasmid unnamed1, complete sequence	73154-73183	6	0.8
NC_017761_3	3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT	1346939-1346968	30	NZ_CP038905	Piscirickettsia salmonis strain Psal-008 plasmid unnamed1, complete sequence	78326-78355	6	0.8
NC_017761_3	3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT	1346939-1346968	30	NZ_CP038928	Piscirickettsia salmonis strain Psal-013 plasmid unnamed1, complete sequence	79790-79819	6	0.8
NC_017761_3	3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT	1346939-1346968	30	NZ_CP039093	Piscirickettsia salmonis strain Psal-114 plasmid unnamed1, complete sequence	85372-85401	6	0.8
NC_017761_3	3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT	1346939-1346968	30	NZ_CP039172	Piscirickettsia salmonis strain Psal-138 plasmid unnamed1, complete sequence	84266-84295	6	0.8
NC_017761_3	3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT	1346939-1346968	30	NZ_CP012511	Piscirickettsia salmonis strain PM32597B1 plasmid pPSB1-3, complete sequence	20958-20987	6	0.8
NC_017761_3	3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT	1346939-1346968	30	NZ_CP013824	Piscirickettsia salmonis strain PM25344B plasmid p3PS14, complete sequence	20971-21000	6	0.8
NC_017761_3	3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT	1346939-1346968	30	NZ_CP013804	Piscirickettsia salmonis strain PM22180B plasmid p3PS13, complete sequence	20958-20987	6	0.8
NC_017761_3	3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT	1346939-1346968	30	NZ_CP039869	Piscirickettsia salmonis strain Psal-113 plasmid unnamed1, complete sequence	81381-81410	6	0.8
NC_017761_3	3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT	1346939-1346968	30	NZ_CP039071	Piscirickettsia salmonis strain Psal-108 plasmid unnamed1, complete sequence	73154-73183	6	0.8
NC_017761_3	3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT	1346939-1346968	30	NZ_CP039103	Piscirickettsia salmonis strain Psal-118 plasmid unnamed1, complete sequence	84265-84294	6	0.8
NC_017761_3	3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT	1346939-1346968	30	NZ_CP039177	Piscirickettsia salmonis strain Psal-139 plasmid unnamed1, complete sequence	84265-84294	6	0.8
NC_017761_3	3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT	1346939-1346968	30	NZ_CP039108	Piscirickettsia salmonis strain Psal-134 plasmid unnamed1, complete sequence	73154-73183	6	0.8
NC_017761_3	3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT	1346939-1346968	30	NZ_CP039051	Piscirickettsia salmonis strain Psal-081 plasmid unnamed1, complete sequence	96780-96809	6	0.8
NC_017761_3	3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT	1346939-1346968	30	NZ_CP013946	Piscirickettsia salmonis strain PSCGR01 plasmid pPsCRG01-1, complete sequence	18143-18172	6	0.8
NC_017761_3	3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT	1346939-1346968	30	NZ_CP039078	Piscirickettsia salmonis strain Psal-109 plasmid unnamed2, complete sequence	85371-85400	6	0.8
NC_017761_3	3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT	1346939-1346968	30	NZ_CP039082	Piscirickettsia salmonis strain Psal-110 plasmid unnamed1, complete sequence	85887-85916	6	0.8
NC_017761_3	3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT	1346939-1346968	30	NZ_CP038919	Piscirickettsia salmonis strain Psal-010b plasmid unnamed1, complete sequence	85388-85417	6	0.8
NC_017761_3	3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT	1346939-1346968	30	NZ_CP038899	Piscirickettsia salmonis strain Psal-006b plasmid unnamed1, complete sequence	81670-81699	6	0.8
NC_017761_3	3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT	1346939-1346968	30	NZ_CP048060	Piscirickettsia salmonis strain Ps-8942B plasmid Ps8942B-p4, complete sequence	163307-163336	6	0.8
NC_017761_3	3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT	1346939-1346968	30	NZ_CP048053	Piscirickettsia salmonis strain Ps-11091B plasmid Ps11091B-p1, complete sequence	46484-46513	6	0.8
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	NC_015512	Haliscomenobacter hydrossis DSM 1100 plasmid pHALHY02, complete sequence	81819-81848	6	0.8
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	MN592896	Alteromonas phage XX1924, complete genome	31994-32023	6	0.8
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	NC_015512	Haliscomenobacter hydrossis DSM 1100 plasmid pHALHY02, complete sequence	81819-81848	6	0.8
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	MN592896	Alteromonas phage XX1924, complete genome	31994-32023	6	0.8
NC_017761_3	3.24|1346940|30|NC_017761|PILER-CR	1346940-1346969	30	NZ_CP039061	Piscirickettsia salmonis strain Psal-099 plasmid unnamed1, complete sequence	89105-89134	6	0.8
NC_017761_3	3.24|1346940|30|NC_017761|PILER-CR	1346940-1346969	30	NZ_CP013797	Piscirickettsia salmonis strain AY6532B plasmid p1PS9, complete sequence	105626-105655	6	0.8
NC_017761_3	3.24|1346940|30|NC_017761|PILER-CR	1346940-1346969	30	NZ_CP013787	Piscirickettsia salmonis strain PM58386B plasmid p1PS7, complete sequence	178638-178667	6	0.8
NC_017761_3	3.24|1346940|30|NC_017761|PILER-CR	1346940-1346969	30	NZ_CP039228	Piscirickettsia salmonis strain SR1 plasmid unnamed1, complete sequence	187646-187675	6	0.8
NC_017761_3	3.24|1346940|30|NC_017761|PILER-CR	1346940-1346969	30	NZ_CP013820	Piscirickettsia salmonis strain AY3800B plasmid p4PS10, complete sequence	105627-105656	6	0.8
NC_017761_3	3.24|1346940|30|NC_017761|PILER-CR	1346940-1346969	30	NZ_CP013792	Piscirickettsia salmonis strain AY6297B plasmid p1PS8, complete sequence	105595-105624	6	0.8
NC_017761_3	3.24|1346940|30|NC_017761|PILER-CR	1346940-1346969	30	NZ_CP013815	Piscirickettsia salmonis strain AY3864B plasmid p4PS11, complete sequence	105626-105655	6	0.8
NC_017761_3	3.24|1346940|30|NC_017761|PILER-CR	1346940-1346969	30	NZ_CP011850	Piscirickettsia salmonis LF-89 = ATCC VR-1361 plasmid pPSLF89-1, complete sequence	48302-48331	6	0.8
NC_017761_3	3.24|1346940|30|NC_017761|PILER-CR	1346940-1346969	30	NZ_CP039235	Piscirickettsia salmonis strain BI1 plasmid unnamed1, complete sequence	105908-105937	6	0.8
NC_017761_3	3.24|1346940|30|NC_017761|PILER-CR	1346940-1346969	30	NZ_CP039241	Piscirickettsia salmonis strain MR5 plasmid unnamed1, complete sequence	169428-169457	6	0.8
NC_017761_3	3.24|1346940|30|NC_017761|PILER-CR	1346940-1346969	30	NZ_CP039098	Piscirickettsia salmonis strain Psal-117 plasmid unnamed1, complete sequence	82136-82165	6	0.8
NC_017761_3	3.24|1346940|30|NC_017761|PILER-CR	1346940-1346969	30	NZ_CP039056	Piscirickettsia salmonis strain Psal-098 plasmid unnamed1, complete sequence	140605-140634	6	0.8
NC_017761_3	3.24|1346940|30|NC_017761|PILER-CR	1346940-1346969	30	NZ_CP039047	Piscirickettsia salmonis strain Psal-073 plasmid unnamed1, complete sequence	96418-96447	6	0.8
NC_017761_3	3.24|1346940|30|NC_017761|PILER-CR	1346940-1346969	30	NZ_CP013807	Piscirickettsia salmonis strain PM31429B plasmid p1PS12, complete sequence	178540-178569	6	0.8
NC_017761_3	3.24|1346940|30|NC_017761|PILER-CR	1346940-1346969	30	NZ_CP013782	Piscirickettsia salmonis strain PM49811B plasmid p1PS6, complete sequence	178532-178561	6	0.8
NC_017761_3	3.24|1346940|30|NC_017761|PILER-CR	1346940-1346969	30	NZ_CP039088	Piscirickettsia salmonis strain Psal-111 plasmid unnamed1, complete sequence	84266-84295	6	0.8
NC_017761_3	3.24|1346940|30|NC_017761|PILER-CR	1346940-1346969	30	NZ_CP039113	Piscirickettsia salmonis strain Psal-135 plasmid unnamed1, complete sequence	73154-73183	6	0.8
NC_017761_3	3.24|1346940|30|NC_017761|PILER-CR	1346940-1346969	30	NZ_CP038905	Piscirickettsia salmonis strain Psal-008 plasmid unnamed1, complete sequence	78326-78355	6	0.8
NC_017761_3	3.24|1346940|30|NC_017761|PILER-CR	1346940-1346969	30	NZ_CP038928	Piscirickettsia salmonis strain Psal-013 plasmid unnamed1, complete sequence	79790-79819	6	0.8
NC_017761_3	3.24|1346940|30|NC_017761|PILER-CR	1346940-1346969	30	NZ_CP039093	Piscirickettsia salmonis strain Psal-114 plasmid unnamed1, complete sequence	85372-85401	6	0.8
NC_017761_3	3.24|1346940|30|NC_017761|PILER-CR	1346940-1346969	30	NZ_CP039172	Piscirickettsia salmonis strain Psal-138 plasmid unnamed1, complete sequence	84266-84295	6	0.8
NC_017761_3	3.24|1346940|30|NC_017761|PILER-CR	1346940-1346969	30	NZ_CP012511	Piscirickettsia salmonis strain PM32597B1 plasmid pPSB1-3, complete sequence	20958-20987	6	0.8
NC_017761_3	3.24|1346940|30|NC_017761|PILER-CR	1346940-1346969	30	NZ_CP013824	Piscirickettsia salmonis strain PM25344B plasmid p3PS14, complete sequence	20971-21000	6	0.8
NC_017761_3	3.24|1346940|30|NC_017761|PILER-CR	1346940-1346969	30	NZ_CP013804	Piscirickettsia salmonis strain PM22180B plasmid p3PS13, complete sequence	20958-20987	6	0.8
NC_017761_3	3.24|1346940|30|NC_017761|PILER-CR	1346940-1346969	30	NZ_CP039869	Piscirickettsia salmonis strain Psal-113 plasmid unnamed1, complete sequence	81381-81410	6	0.8
NC_017761_3	3.24|1346940|30|NC_017761|PILER-CR	1346940-1346969	30	NZ_CP039071	Piscirickettsia salmonis strain Psal-108 plasmid unnamed1, complete sequence	73154-73183	6	0.8
NC_017761_3	3.24|1346940|30|NC_017761|PILER-CR	1346940-1346969	30	NZ_CP039103	Piscirickettsia salmonis strain Psal-118 plasmid unnamed1, complete sequence	84265-84294	6	0.8
NC_017761_3	3.24|1346940|30|NC_017761|PILER-CR	1346940-1346969	30	NZ_CP039177	Piscirickettsia salmonis strain Psal-139 plasmid unnamed1, complete sequence	84265-84294	6	0.8
NC_017761_3	3.24|1346940|30|NC_017761|PILER-CR	1346940-1346969	30	NZ_CP039108	Piscirickettsia salmonis strain Psal-134 plasmid unnamed1, complete sequence	73154-73183	6	0.8
NC_017761_3	3.24|1346940|30|NC_017761|PILER-CR	1346940-1346969	30	NZ_CP039051	Piscirickettsia salmonis strain Psal-081 plasmid unnamed1, complete sequence	96780-96809	6	0.8
NC_017761_3	3.24|1346940|30|NC_017761|PILER-CR	1346940-1346969	30	NZ_CP013946	Piscirickettsia salmonis strain PSCGR01 plasmid pPsCRG01-1, complete sequence	18143-18172	6	0.8
NC_017761_3	3.24|1346940|30|NC_017761|PILER-CR	1346940-1346969	30	NZ_CP039078	Piscirickettsia salmonis strain Psal-109 plasmid unnamed2, complete sequence	85371-85400	6	0.8
NC_017761_3	3.24|1346940|30|NC_017761|PILER-CR	1346940-1346969	30	NZ_CP039082	Piscirickettsia salmonis strain Psal-110 plasmid unnamed1, complete sequence	85887-85916	6	0.8
NC_017761_3	3.24|1346940|30|NC_017761|PILER-CR	1346940-1346969	30	NZ_CP038919	Piscirickettsia salmonis strain Psal-010b plasmid unnamed1, complete sequence	85388-85417	6	0.8
NC_017761_3	3.24|1346940|30|NC_017761|PILER-CR	1346940-1346969	30	NZ_CP038899	Piscirickettsia salmonis strain Psal-006b plasmid unnamed1, complete sequence	81670-81699	6	0.8
NC_017761_3	3.24|1346940|30|NC_017761|PILER-CR	1346940-1346969	30	NZ_CP048060	Piscirickettsia salmonis strain Ps-8942B plasmid Ps8942B-p4, complete sequence	163307-163336	6	0.8
NC_017761_3	3.24|1346940|30|NC_017761|PILER-CR	1346940-1346969	30	NZ_CP048053	Piscirickettsia salmonis strain Ps-11091B plasmid Ps11091B-p1, complete sequence	46484-46513	6	0.8
NC_017761_4	4.5|1749210|30|NC_017761|CRISPRCasFinder	1749210-1749239	30	AP014353	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S39-C37, *** SEQUENCING IN PROGRESS ***	10079-10108	6	0.8
NC_017761_3	3.1|1346410|30|NC_017761|CRISPRCasFinder,CRT	1346410-1346439	30	NZ_CP007453	Peptoclostridium acidaminophilum DSM 3953 strain al-2 plasmid EAL2_808p, complete sequence	509034-509063	7	0.767
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	NC_009998	Shewanella baltica OS195 plasmid pS19501, complete sequence	32148-32177	7	0.767
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	NZ_CP025427	Enterococcus faecium strain SC4 plasmid p2, complete sequence	64591-64620	7	0.767
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	NZ_CP041263	Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R2	36352-36381	7	0.767
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	NZ_CP027511	Enterococcus faecium strain AUSMDU00004055 plasmid unnamed5, complete sequence	58028-58057	7	0.767
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	NZ_LR135245	Enterococcus faecium isolate E6988 plasmid 3	38464-38493	7	0.767
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	NZ_LR135256	Enterococcus faecium isolate E7098 plasmid 3	42060-42089	7	0.767
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	NZ_CP038997	Enterococcus faecium strain SRR24 plasmid pSRR24	38599-38628	7	0.767
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	NZ_CP019989	Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence	43134-43163	7	0.767
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	NZ_LR135490	Enterococcus faecium isolate E8414 plasmid 3	36524-36553	7	0.767
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	NZ_CP044266	Enterococcus faecium strain V1836 plasmid pHVH-V1836-2, complete sequence	98110-98139	7	0.767
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	NZ_LR134109	Enterococcus faecium isolate E6043 plasmid 5	33642-33671	7	0.767
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	NZ_CP045014	Enterococcus faecium strain LAC7.2 plasmid pII, complete sequence	26091-26120	7	0.767
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	NZ_CP040742	Enterococcus faecium strain VRE1 plasmid pVRE1-VanA, complete sequence	55253-55282	7	0.767
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	MN831413	Enterococcus faecium strain M17/0314 plasmid pM17/0314, complete sequence	40338-40367	7	0.767
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	NZ_AP022343	Enterococcus faecium strain KUHS13 plasmid pELF2	68868-68897	7	0.767
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	NZ_CP041272	Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S2	53421-53450	7	0.767
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	NZ_CP019994	Enterococcus faecium isolate 2014-VREF-268 plasmid p268-2	63259-63288	7	0.767
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	NZ_CP035656	Enterococcus faecium strain UAMSEF_09 plasmid unnamed2	26226-26255	7	0.767
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	NZ_CP035662	Enterococcus faecium strain UAMSEF_20 plasmid unnamed2	55021-55050	7	0.767
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	NZ_CP039730	Enterococcus faecium strain ZY2 plasmid pZY2	27274-27303	7	0.767
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	NZ_CP019971	Enterococcus faecium isolate 2014-VREF-114 plasmid p114-1 sequence	54796-54825	7	0.767
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	NZ_CP012462	Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p2	23082-23111	7	0.767
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	NZ_MG640601	Enterococcus faecium strain SRR6 plasmid pEMSRR6, complete sequence	33234-33263	7	0.767
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	KX982260	Alteromonas phage PB15, complete genome	27444-27473	7	0.767
NC_017761_3	3.6|1346741|30|NC_017761|CRISPRCasFinder,CRT	1346741-1346770	30	NZ_CP007453	Peptoclostridium acidaminophilum DSM 3953 strain al-2 plasmid EAL2_808p, complete sequence	509034-509063	7	0.767
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	NC_009998	Shewanella baltica OS195 plasmid pS19501, complete sequence	32148-32177	7	0.767
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	NZ_CP025427	Enterococcus faecium strain SC4 plasmid p2, complete sequence	64591-64620	7	0.767
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	NZ_CP041263	Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R2	36352-36381	7	0.767
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	NZ_CP027511	Enterococcus faecium strain AUSMDU00004055 plasmid unnamed5, complete sequence	58028-58057	7	0.767
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	NZ_LR135245	Enterococcus faecium isolate E6988 plasmid 3	38464-38493	7	0.767
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	NZ_LR135256	Enterococcus faecium isolate E7098 plasmid 3	42060-42089	7	0.767
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	NZ_CP038997	Enterococcus faecium strain SRR24 plasmid pSRR24	38599-38628	7	0.767
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	NZ_CP019989	Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence	43134-43163	7	0.767
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	NZ_LR135490	Enterococcus faecium isolate E8414 plasmid 3	36524-36553	7	0.767
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	NZ_CP044266	Enterococcus faecium strain V1836 plasmid pHVH-V1836-2, complete sequence	98110-98139	7	0.767
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	NZ_LR134109	Enterococcus faecium isolate E6043 plasmid 5	33642-33671	7	0.767
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	NZ_CP045014	Enterococcus faecium strain LAC7.2 plasmid pII, complete sequence	26091-26120	7	0.767
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	NZ_CP040742	Enterococcus faecium strain VRE1 plasmid pVRE1-VanA, complete sequence	55253-55282	7	0.767
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	MN831413	Enterococcus faecium strain M17/0314 plasmid pM17/0314, complete sequence	40338-40367	7	0.767
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	NZ_AP022343	Enterococcus faecium strain KUHS13 plasmid pELF2	68868-68897	7	0.767
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	NZ_CP041272	Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S2	53421-53450	7	0.767
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	NZ_CP019994	Enterococcus faecium isolate 2014-VREF-268 plasmid p268-2	63259-63288	7	0.767
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	NZ_CP035656	Enterococcus faecium strain UAMSEF_09 plasmid unnamed2	26226-26255	7	0.767
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	NZ_CP035662	Enterococcus faecium strain UAMSEF_20 plasmid unnamed2	55021-55050	7	0.767
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	NZ_CP039730	Enterococcus faecium strain ZY2 plasmid pZY2	27274-27303	7	0.767
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	NZ_CP019971	Enterococcus faecium isolate 2014-VREF-114 plasmid p114-1 sequence	54796-54825	7	0.767
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	NZ_CP012462	Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p2	23082-23111	7	0.767
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	NZ_MG640601	Enterococcus faecium strain SRR6 plasmid pEMSRR6, complete sequence	33234-33263	7	0.767
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	KX982260	Alteromonas phage PB15, complete genome	27444-27473	7	0.767
NC_017761_3	3.10|1347005|30|NC_017761|CRISPRCasFinder,CRT	1347005-1347034	30	NZ_CP013040	Clostridium perfringens strain JP838 plasmid pJFP838C, complete sequence	38662-38691	7	0.767
NC_017761_3	3.10|1347005|30|NC_017761|CRISPRCasFinder,CRT	1347005-1347034	30	NZ_CP013041	Clostridium perfringens strain JP55 plasmid pJFP55F, complete sequence	38561-38590	7	0.767
NC_017761_3	3.10|1347005|30|NC_017761|CRISPRCasFinder,CRT	1347005-1347034	30	MK416009	Klebsiella phage ST11-OXA245phi3.1, complete genome	18944-18973	7	0.767
NC_017761_3	3.10|1347005|30|NC_017761|CRISPRCasFinder,CRT	1347005-1347034	30	MK422449	Klebsiella phage ST512-KPC3phi13.2, complete genome	17920-17949	7	0.767
NC_017761_3	3.10|1347005|30|NC_017761|CRISPRCasFinder,CRT	1347005-1347034	30	MK422454	Klebsiella phage ST340-VIM1phi10.2, complete genome	18944-18973	7	0.767
NC_017761_3	3.10|1347005|30|NC_017761|CRISPRCasFinder,CRT	1347005-1347034	30	NZ_CP016898	Acinetobacter soli strain GFJ2 plasmid pGFJ2, complete sequence	20707-20736	7	0.767
NC_017761_3	3.10|1347005|30|NC_017761|CRISPRCasFinder,CRT	1347005-1347034	30	MK416020	Klebsiella phage ST11-VIM1phi8.4, complete genome	14044-14073	7	0.767
NC_017761_3	3.10|1347005|30|NC_017761|CRISPRCasFinder,CRT	1347005-1347034	30	MK433580	Klebsiella phage ST11-OXA48phi15.3, complete genome	14354-14383	7	0.767
NC_017761_3	3.10|1347005|30|NC_017761|CRISPRCasFinder,CRT	1347005-1347034	30	MK433582	Klebsiella phage ST258-KPC3phi16.2, complete genome	14354-14383	7	0.767
NC_017761_3	3.10|1347005|30|NC_017761|CRISPRCasFinder,CRT	1347005-1347034	30	NZ_CP053657	Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence	132978-133007	7	0.767
NC_017761_3	3.10|1347005|30|NC_017761|CRISPRCasFinder,CRT	1347005-1347034	30	MH460460	Dickeya phage vB_DsoM_JA13, complete genome	176526-176555	7	0.767
NC_017761_3	3.16|1346411|30|NC_017761|PILER-CR	1346411-1346440	30	NZ_CP007453	Peptoclostridium acidaminophilum DSM 3953 strain al-2 plasmid EAL2_808p, complete sequence	509034-509063	7	0.767
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	NC_009998	Shewanella baltica OS195 plasmid pS19501, complete sequence	32148-32177	7	0.767
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	NZ_CP025427	Enterococcus faecium strain SC4 plasmid p2, complete sequence	64591-64620	7	0.767
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	NZ_CP041263	Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R2	36352-36381	7	0.767
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	NZ_CP027511	Enterococcus faecium strain AUSMDU00004055 plasmid unnamed5, complete sequence	58028-58057	7	0.767
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	NZ_LR135245	Enterococcus faecium isolate E6988 plasmid 3	38464-38493	7	0.767
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	NZ_LR135256	Enterococcus faecium isolate E7098 plasmid 3	42060-42089	7	0.767
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	NZ_CP038997	Enterococcus faecium strain SRR24 plasmid pSRR24	38599-38628	7	0.767
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	NZ_CP019989	Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence	43134-43163	7	0.767
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	NZ_LR135490	Enterococcus faecium isolate E8414 plasmid 3	36524-36553	7	0.767
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	NZ_CP044266	Enterococcus faecium strain V1836 plasmid pHVH-V1836-2, complete sequence	98110-98139	7	0.767
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	NZ_LR134109	Enterococcus faecium isolate E6043 plasmid 5	33642-33671	7	0.767
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	NZ_CP045014	Enterococcus faecium strain LAC7.2 plasmid pII, complete sequence	26091-26120	7	0.767
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	NZ_CP040742	Enterococcus faecium strain VRE1 plasmid pVRE1-VanA, complete sequence	55253-55282	7	0.767
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	MN831413	Enterococcus faecium strain M17/0314 plasmid pM17/0314, complete sequence	40338-40367	7	0.767
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	NZ_AP022343	Enterococcus faecium strain KUHS13 plasmid pELF2	68868-68897	7	0.767
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	NZ_CP041272	Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S2	53421-53450	7	0.767
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	NZ_CP019994	Enterococcus faecium isolate 2014-VREF-268 plasmid p268-2	63259-63288	7	0.767
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	NZ_CP035656	Enterococcus faecium strain UAMSEF_09 plasmid unnamed2	26226-26255	7	0.767
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	NZ_CP035662	Enterococcus faecium strain UAMSEF_20 plasmid unnamed2	55021-55050	7	0.767
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	NZ_CP039730	Enterococcus faecium strain ZY2 plasmid pZY2	27274-27303	7	0.767
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	NZ_CP019971	Enterococcus faecium isolate 2014-VREF-114 plasmid p114-1 sequence	54796-54825	7	0.767
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	NZ_CP012462	Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p2	23082-23111	7	0.767
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	NZ_MG640601	Enterococcus faecium strain SRR6 plasmid pEMSRR6, complete sequence	33234-33263	7	0.767
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	KX982260	Alteromonas phage PB15, complete genome	27444-27473	7	0.767
NC_017761_3	3.21|1346742|30|NC_017761|PILER-CR	1346742-1346771	30	NZ_CP007453	Peptoclostridium acidaminophilum DSM 3953 strain al-2 plasmid EAL2_808p, complete sequence	509034-509063	7	0.767
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	NC_009998	Shewanella baltica OS195 plasmid pS19501, complete sequence	32148-32177	7	0.767
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	NZ_CP025427	Enterococcus faecium strain SC4 plasmid p2, complete sequence	64591-64620	7	0.767
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	NZ_CP041263	Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R2	36352-36381	7	0.767
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	NZ_CP027511	Enterococcus faecium strain AUSMDU00004055 plasmid unnamed5, complete sequence	58028-58057	7	0.767
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	NZ_LR135245	Enterococcus faecium isolate E6988 plasmid 3	38464-38493	7	0.767
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	NZ_LR135256	Enterococcus faecium isolate E7098 plasmid 3	42060-42089	7	0.767
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	NZ_CP038997	Enterococcus faecium strain SRR24 plasmid pSRR24	38599-38628	7	0.767
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	NZ_CP019989	Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence	43134-43163	7	0.767
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	NZ_LR135490	Enterococcus faecium isolate E8414 plasmid 3	36524-36553	7	0.767
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	NZ_CP044266	Enterococcus faecium strain V1836 plasmid pHVH-V1836-2, complete sequence	98110-98139	7	0.767
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	NZ_LR134109	Enterococcus faecium isolate E6043 plasmid 5	33642-33671	7	0.767
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	NZ_CP045014	Enterococcus faecium strain LAC7.2 plasmid pII, complete sequence	26091-26120	7	0.767
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	NZ_CP040742	Enterococcus faecium strain VRE1 plasmid pVRE1-VanA, complete sequence	55253-55282	7	0.767
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	MN831413	Enterococcus faecium strain M17/0314 plasmid pM17/0314, complete sequence	40338-40367	7	0.767
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	NZ_AP022343	Enterococcus faecium strain KUHS13 plasmid pELF2	68868-68897	7	0.767
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	NZ_CP041272	Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S2	53421-53450	7	0.767
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	NZ_CP019994	Enterococcus faecium isolate 2014-VREF-268 plasmid p268-2	63259-63288	7	0.767
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	NZ_CP035656	Enterococcus faecium strain UAMSEF_09 plasmid unnamed2	26226-26255	7	0.767
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	NZ_CP035662	Enterococcus faecium strain UAMSEF_20 plasmid unnamed2	55021-55050	7	0.767
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	NZ_CP039730	Enterococcus faecium strain ZY2 plasmid pZY2	27274-27303	7	0.767
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	NZ_CP019971	Enterococcus faecium isolate 2014-VREF-114 plasmid p114-1 sequence	54796-54825	7	0.767
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	NZ_CP012462	Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p2	23082-23111	7	0.767
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	NZ_MG640601	Enterococcus faecium strain SRR6 plasmid pEMSRR6, complete sequence	33234-33263	7	0.767
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	KX982260	Alteromonas phage PB15, complete genome	27444-27473	7	0.767
NC_017761_3	3.25|1347006|30|NC_017761|PILER-CR	1347006-1347035	30	NZ_CP013040	Clostridium perfringens strain JP838 plasmid pJFP838C, complete sequence	38662-38691	7	0.767
NC_017761_3	3.25|1347006|30|NC_017761|PILER-CR	1347006-1347035	30	NZ_CP013041	Clostridium perfringens strain JP55 plasmid pJFP55F, complete sequence	38561-38590	7	0.767
NC_017761_3	3.25|1347006|30|NC_017761|PILER-CR	1347006-1347035	30	MK416009	Klebsiella phage ST11-OXA245phi3.1, complete genome	18944-18973	7	0.767
NC_017761_3	3.25|1347006|30|NC_017761|PILER-CR	1347006-1347035	30	MK422449	Klebsiella phage ST512-KPC3phi13.2, complete genome	17920-17949	7	0.767
NC_017761_3	3.25|1347006|30|NC_017761|PILER-CR	1347006-1347035	30	MK422454	Klebsiella phage ST340-VIM1phi10.2, complete genome	18944-18973	7	0.767
NC_017761_3	3.25|1347006|30|NC_017761|PILER-CR	1347006-1347035	30	NZ_CP016898	Acinetobacter soli strain GFJ2 plasmid pGFJ2, complete sequence	20707-20736	7	0.767
NC_017761_3	3.25|1347006|30|NC_017761|PILER-CR	1347006-1347035	30	MK416020	Klebsiella phage ST11-VIM1phi8.4, complete genome	14044-14073	7	0.767
NC_017761_3	3.25|1347006|30|NC_017761|PILER-CR	1347006-1347035	30	MK433580	Klebsiella phage ST11-OXA48phi15.3, complete genome	14354-14383	7	0.767
NC_017761_3	3.25|1347006|30|NC_017761|PILER-CR	1347006-1347035	30	MK433582	Klebsiella phage ST258-KPC3phi16.2, complete genome	14354-14383	7	0.767
NC_017761_3	3.25|1347006|30|NC_017761|PILER-CR	1347006-1347035	30	NZ_CP053657	Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence	132978-133007	7	0.767
NC_017761_3	3.25|1347006|30|NC_017761|PILER-CR	1347006-1347035	30	MH460460	Dickeya phage vB_DsoM_JA13, complete genome	176526-176555	7	0.767
NC_017761_4	4.6|1749276|30|NC_017761|CRISPRCasFinder	1749276-1749305	30	MK250024	Prevotella phage Lak-B5, complete genome	337979-338008	7	0.767
NC_017761_4	4.6|1749276|30|NC_017761|CRISPRCasFinder	1749276-1749305	30	MK250028	Prevotella phage Lak-B9, complete genome	342869-342898	7	0.767
NC_017761_4	4.6|1749276|30|NC_017761|CRISPRCasFinder	1749276-1749305	30	MK250023	Prevotella phage Lak-B4, complete genome	344119-344148	7	0.767
NC_017761_4	4.6|1749276|30|NC_017761|CRISPRCasFinder	1749276-1749305	30	MK250025	Prevotella phage Lak-B6, complete genome	341171-341200	7	0.767
NC_017761_4	4.6|1749276|30|NC_017761|CRISPRCasFinder	1749276-1749305	30	MK250022	Prevotella phage Lak-B3, complete genome	341262-341291	7	0.767
NC_017761_4	4.6|1749276|30|NC_017761|CRISPRCasFinder	1749276-1749305	30	MK250027	Prevotella phage Lak-B8, complete genome	344385-344414	7	0.767
NC_017761_4	4.6|1749276|30|NC_017761|CRISPRCasFinder	1749276-1749305	30	MK250026	Prevotella phage Lak-B7, complete genome	343432-343461	7	0.767
NC_017761_4	4.6|1749276|30|NC_017761|CRISPRCasFinder	1749276-1749305	30	MK250020	Prevotella phage Lak-B1, complete genome	342852-342881	7	0.767
NC_017761_4	4.7|1749342|30|NC_017761|CRISPRCasFinder	1749342-1749371	30	MK250024	Prevotella phage Lak-B5, complete genome	337979-338008	7	0.767
NC_017761_4	4.7|1749342|30|NC_017761|CRISPRCasFinder	1749342-1749371	30	MK250028	Prevotella phage Lak-B9, complete genome	342869-342898	7	0.767
NC_017761_4	4.7|1749342|30|NC_017761|CRISPRCasFinder	1749342-1749371	30	MK250023	Prevotella phage Lak-B4, complete genome	344119-344148	7	0.767
NC_017761_4	4.7|1749342|30|NC_017761|CRISPRCasFinder	1749342-1749371	30	MK250025	Prevotella phage Lak-B6, complete genome	341171-341200	7	0.767
NC_017761_4	4.7|1749342|30|NC_017761|CRISPRCasFinder	1749342-1749371	30	MK250022	Prevotella phage Lak-B3, complete genome	341262-341291	7	0.767
NC_017761_4	4.7|1749342|30|NC_017761|CRISPRCasFinder	1749342-1749371	30	MK250027	Prevotella phage Lak-B8, complete genome	344385-344414	7	0.767
NC_017761_4	4.7|1749342|30|NC_017761|CRISPRCasFinder	1749342-1749371	30	MK250026	Prevotella phage Lak-B7, complete genome	343432-343461	7	0.767
NC_017761_4	4.7|1749342|30|NC_017761|CRISPRCasFinder	1749342-1749371	30	MK250020	Prevotella phage Lak-B1, complete genome	342852-342881	7	0.767
NC_017761_4	4.9|1749278|28|NC_017761|PILER-CR	1749278-1749305	28	MK250024	Prevotella phage Lak-B5, complete genome	337979-338006	7	0.75
NC_017761_4	4.9|1749278|28|NC_017761|PILER-CR	1749278-1749305	28	MK250028	Prevotella phage Lak-B9, complete genome	342869-342896	7	0.75
NC_017761_4	4.9|1749278|28|NC_017761|PILER-CR	1749278-1749305	28	MK250023	Prevotella phage Lak-B4, complete genome	344119-344146	7	0.75
NC_017761_4	4.9|1749278|28|NC_017761|PILER-CR	1749278-1749305	28	MK250025	Prevotella phage Lak-B6, complete genome	341171-341198	7	0.75
NC_017761_4	4.9|1749278|28|NC_017761|PILER-CR	1749278-1749305	28	MK250022	Prevotella phage Lak-B3, complete genome	341262-341289	7	0.75
NC_017761_4	4.9|1749278|28|NC_017761|PILER-CR	1749278-1749305	28	MK250027	Prevotella phage Lak-B8, complete genome	344385-344412	7	0.75
NC_017761_4	4.9|1749278|28|NC_017761|PILER-CR	1749278-1749305	28	MK250026	Prevotella phage Lak-B7, complete genome	343432-343459	7	0.75
NC_017761_4	4.9|1749278|28|NC_017761|PILER-CR	1749278-1749305	28	MK250020	Prevotella phage Lak-B1, complete genome	342852-342879	7	0.75
NC_017761_4	4.10|1749344|28|NC_017761|PILER-CR	1749344-1749371	28	MK250024	Prevotella phage Lak-B5, complete genome	337979-338006	7	0.75
NC_017761_4	4.10|1749344|28|NC_017761|PILER-CR	1749344-1749371	28	MK250028	Prevotella phage Lak-B9, complete genome	342869-342896	7	0.75
NC_017761_4	4.10|1749344|28|NC_017761|PILER-CR	1749344-1749371	28	MK250023	Prevotella phage Lak-B4, complete genome	344119-344146	7	0.75
NC_017761_4	4.10|1749344|28|NC_017761|PILER-CR	1749344-1749371	28	MK250025	Prevotella phage Lak-B6, complete genome	341171-341198	7	0.75
NC_017761_4	4.10|1749344|28|NC_017761|PILER-CR	1749344-1749371	28	MK250022	Prevotella phage Lak-B3, complete genome	341262-341289	7	0.75
NC_017761_4	4.10|1749344|28|NC_017761|PILER-CR	1749344-1749371	28	MK250027	Prevotella phage Lak-B8, complete genome	344385-344412	7	0.75
NC_017761_4	4.10|1749344|28|NC_017761|PILER-CR	1749344-1749371	28	MK250026	Prevotella phage Lak-B7, complete genome	343432-343459	7	0.75
NC_017761_4	4.10|1749344|28|NC_017761|PILER-CR	1749344-1749371	28	MK250020	Prevotella phage Lak-B1, complete genome	342852-342879	7	0.75
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	KY421186	Flavobacterium phage FL-1, complete genome	17524-17553	8	0.733
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	MN693415	Marine virus AFVG_25M102, complete genome	25582-25611	8	0.733
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	MK448348	Streptococcus satellite phage Javan175, complete genome	4595-4624	8	0.733
NC_017761_3	3.5|1346675|30|NC_017761|CRISPRCasFinder,CRT	1346675-1346704	30	MG592671	Vibrio phage 2.275.O._10N.286.54.E11, partial genome	129907-129936	8	0.733
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	KY421186	Flavobacterium phage FL-1, complete genome	17524-17553	8	0.733
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	MN693415	Marine virus AFVG_25M102, complete genome	25582-25611	8	0.733
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	MK448348	Streptococcus satellite phage Javan175, complete genome	4595-4624	8	0.733
NC_017761_3	3.10|1347005|30|NC_017761|CRISPRCasFinder,CRT	1347005-1347034	30	CP016714	Lactococcus lactis subsp. lactis strain UC77 plasmid pUC77B, complete sequence	14514-14543	8	0.733
NC_017761_3	3.10|1347005|30|NC_017761|CRISPRCasFinder,CRT	1347005-1347034	30	NZ_CP016694	Lactococcus lactis subsp. lactis strain 229 plasmid p229A, complete sequence	14516-14545	8	0.733
NC_017761_3	3.10|1347005|30|NC_017761|CRISPRCasFinder,CRT	1347005-1347034	30	NZ_CP016701	Lactococcus lactis subsp. lactis strain 275 plasmid p275C, complete sequence	2940-2969	8	0.733
NC_017761_3	3.10|1347005|30|NC_017761|CRISPRCasFinder,CRT	1347005-1347034	30	AP014341	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S37-C76, *** SEQUENCING IN PROGRESS ***	9584-9613	8	0.733
NC_017761_3	3.10|1347005|30|NC_017761|CRISPRCasFinder,CRT	1347005-1347034	30	MF417947	Uncultured Caudovirales phage clone 3F_8, partial genome	6302-6331	8	0.733
NC_017761_3	3.10|1347005|30|NC_017761|CRISPRCasFinder,CRT	1347005-1347034	30	NC_010901	Lactococcus lactis plasmid pNP40, complete sequence	59532-59561	8	0.733
NC_017761_3	3.10|1347005|30|NC_017761|CRISPRCasFinder,CRT	1347005-1347034	30	NC_010183	Bacillus mycoides KBAB4 plasmid pBWB404, complete sequence	31386-31415	8	0.733
NC_017761_3	3.10|1347005|30|NC_017761|CRISPRCasFinder,CRT	1347005-1347034	30	NC_015862	Lactococcus lactis subsp. lactis plasmid pIL4, complete sequence	45976-46005	8	0.733
NC_017761_3	3.10|1347005|30|NC_017761|CRISPRCasFinder,CRT	1347005-1347034	30	NZ_CP010090	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB426, complete sequence	220417-220446	8	0.733
NC_017761_3	3.12|1347137|30|NC_017761|CRISPRCasFinder,CRT	1347137-1347166	30	NZ_CP010112	Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-6, complete sequence	141526-141555	8	0.733
NC_017761_3	3.12|1347137|30|NC_017761|CRISPRCasFinder,CRT	1347137-1347166	30	NZ_CP016589	Bacillus thuringiensis strain KNU-07 plasmid pBTKNU07-01, complete sequence	491705-491734	8	0.733
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	KY421186	Flavobacterium phage FL-1, complete genome	17524-17553	8	0.733
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	MN693415	Marine virus AFVG_25M102, complete genome	25582-25611	8	0.733
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	MK448348	Streptococcus satellite phage Javan175, complete genome	4595-4624	8	0.733
NC_017761_3	3.20|1346676|30|NC_017761|PILER-CR	1346676-1346705	30	MG592671	Vibrio phage 2.275.O._10N.286.54.E11, partial genome	129907-129936	8	0.733
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	KY421186	Flavobacterium phage FL-1, complete genome	17524-17553	8	0.733
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	MN693415	Marine virus AFVG_25M102, complete genome	25582-25611	8	0.733
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	MK448348	Streptococcus satellite phage Javan175, complete genome	4595-4624	8	0.733
NC_017761_3	3.25|1347006|30|NC_017761|PILER-CR	1347006-1347035	30	CP016714	Lactococcus lactis subsp. lactis strain UC77 plasmid pUC77B, complete sequence	14514-14543	8	0.733
NC_017761_3	3.25|1347006|30|NC_017761|PILER-CR	1347006-1347035	30	NZ_CP016694	Lactococcus lactis subsp. lactis strain 229 plasmid p229A, complete sequence	14516-14545	8	0.733
NC_017761_3	3.25|1347006|30|NC_017761|PILER-CR	1347006-1347035	30	NZ_CP016701	Lactococcus lactis subsp. lactis strain 275 plasmid p275C, complete sequence	2940-2969	8	0.733
NC_017761_3	3.25|1347006|30|NC_017761|PILER-CR	1347006-1347035	30	AP014341	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S37-C76, *** SEQUENCING IN PROGRESS ***	9584-9613	8	0.733
NC_017761_3	3.25|1347006|30|NC_017761|PILER-CR	1347006-1347035	30	MF417947	Uncultured Caudovirales phage clone 3F_8, partial genome	6302-6331	8	0.733
NC_017761_3	3.25|1347006|30|NC_017761|PILER-CR	1347006-1347035	30	NC_010901	Lactococcus lactis plasmid pNP40, complete sequence	59532-59561	8	0.733
NC_017761_3	3.25|1347006|30|NC_017761|PILER-CR	1347006-1347035	30	NC_010183	Bacillus mycoides KBAB4 plasmid pBWB404, complete sequence	31386-31415	8	0.733
NC_017761_3	3.25|1347006|30|NC_017761|PILER-CR	1347006-1347035	30	NC_015862	Lactococcus lactis subsp. lactis plasmid pIL4, complete sequence	45976-46005	8	0.733
NC_017761_3	3.25|1347006|30|NC_017761|PILER-CR	1347006-1347035	30	NZ_CP010090	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB426, complete sequence	220417-220446	8	0.733
NC_017761_4	4.4|1749144|30|NC_017761|CRISPRCasFinder	1749144-1749173	30	MH617026	Microviridae sp. isolate ctcj618, complete genome	33-62	8	0.733
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	NC_007336	Cupriavidus pinatubonensis JMP134 megaplasmid, complete sequence	452389-452418	9	0.7
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	KJ019062	Synechococcus phage ACG-2014d isolate Syn7803C93, complete genome	117188-117217	9	0.7
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	KJ019121	Synechococcus phage ACG-2014d isolate Syn7803US78, complete genome	117185-117214	9	0.7
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	KJ019126	Synechococcus phage ACG-2014d isolate Syn7803US83, complete genome	117280-117309	9	0.7
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	KJ019047	Synechococcus phage ACG-2014d isolate Syn7803C73, complete genome	117188-117217	9	0.7
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	KJ019072	Synechococcus phage ACG-2014d isolate Syn7803US108, complete genome	117189-117218	9	0.7
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	KJ019032	Synechococcus phage ACG-2014d isolate Syn7803C49, complete genome	117195-117224	9	0.7
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	KJ019078	Synechococcus phage ACG-2014d isolate Syn7803US114, complete genome	117185-117214	9	0.7
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	KJ019165	Synechococcus phage ACG-2014d isolate Syn7803C40, complete genome	117190-117219	9	0.7
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	KJ019124	Synechococcus phage ACG-2014d isolate Syn7803US80, complete genome	117337-117366	9	0.7
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	KJ019074	Synechococcus phage ACG-2014d isolate Syn7803US110, complete genome	117188-117217	9	0.7
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	KJ019034	Synechococcus phage ACG-2014d isolate Syn7803C54, complete genome	117283-117312	9	0.7
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	KJ019127	Synechococcus phage ACG-2014d isolate Syn7803US85, complete genome	117194-117223	9	0.7
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	KJ019118	Synechococcus phage ACG-2014d isolate Syn7803US64, complete genome	117188-117217	9	0.7
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	KJ019075	Synechococcus phage ACG-2014d isolate Syn7803US111, complete genome	117188-117217	9	0.7
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	KJ019131	Synechococcus phage ACG-2014d isolate Syn7803US95, complete genome	117189-117218	9	0.7
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	KJ019057	Synechococcus phage ACG-2014d isolate Syn7803C89, complete genome	117188-117217	9	0.7
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	KJ019056	Synechococcus phage ACG-2014d isolate Syn7803C88, partial genome	117219-117248	9	0.7
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	KJ019160	Synechococcus phage ACG-2014d isolate Syn7803C35, complete genome	117287-117316	9	0.7
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	KJ019112	Synechococcus phage ACG-2014d isolate Syn7803US59, complete genome	117188-117217	9	0.7
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	KJ019073	Synechococcus phage ACG-2014d isolate Syn7803US109, complete genome	117191-117220	9	0.7
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	KJ019077	Synechococcus phage ACG-2014d isolate Syn7803US113, complete genome	117191-117220	9	0.7
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	KJ019129	Synechococcus phage ACG-2014d isolate Syn7803US89, complete genome	117219-117248	9	0.7
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	KJ019031	Synechococcus phage ACG-2014d isolate Syn7803C48, complete genome	117188-117217	9	0.7
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	KJ019079	Synechococcus phage ACG-2014d isolate Syn7803US115, complete genome	117188-117217	9	0.7
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	KJ019035	Synechococcus phage ACG-2014d isolate Syn7803C55, complete genome	115526-115555	9	0.7
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	KJ019120	Synechococcus phage ACG-2014d isolate Syn7803US71, complete genome	117191-117220	9	0.7
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	KJ019036	Synechococcus phage ACG-2014d isolate Syn7803C57, complete genome	117182-117211	9	0.7
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	KJ019048	Synechococcus phage ACG-2014d isolate Syn7803C75, complete genome	117188-117217	9	0.7
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	KJ019113	Synechococcus phage ACG-2014d isolate Syn7803US5, complete genome	117239-117268	9	0.7
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	KJ019140	Synechococcus phage ACG-2014d isolate Syn7803C109, complete genome	117192-117221	9	0.7
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	KJ019119	Synechococcus phage ACG-2014d isolate Syn7803US65, complete genome	117243-117272	9	0.7
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	KJ019162	Synechococcus phage ACG-2014d isolate Syn7803C37, complete genome	117236-117265	9	0.7
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	KJ019130	Synechococcus phage ACG-2014d isolate Syn7803US94, complete genome	117287-117316	9	0.7
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	KJ019115	Synechococcus phage ACG-2014d isolate Syn7803US61, complete genome	117118-117147	9	0.7
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	KJ019139	Synechococcus phage ACG-2014d isolate Syn7803C108, complete genome	117283-117312	9	0.7
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	KJ019125	Synechococcus phage ACG-2014d isolate Syn7803US82, complete genome	117191-117220	9	0.7
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	KJ019070	Synechococcus phage ACG-2014d isolate Syn7803US104, complete genome	117334-117363	9	0.7
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	KJ019028	Synechococcus phage ACG-2014d isolate Syn7803C45, complete genome	117194-117223	9	0.7
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	KJ019083	Synechococcus phage ACG-2014d isolate Syn7803US122, complete genome	117188-117217	9	0.7
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	KJ019164	Synechococcus phage ACG-2014d isolate Syn7803C39, complete genome	117254-117283	9	0.7
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	KJ019117	Synechococcus phage ACG-2014d isolate Syn7803US63, complete genome	117235-117264	9	0.7
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	KJ019046	Synechococcus phage ACG-2014d isolate Syn7803C72, complete genome	117189-117218	9	0.7
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	KJ019050	Synechococcus phage ACG-2014d isolate Syn7803C77, complete genome	117284-117313	9	0.7
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	KJ019029	Synechococcus phage ACG-2014d isolate Syn7803C46, complete genome	117185-117214	9	0.7
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	KJ019080	Synechococcus phage ACG-2014d isolate Syn7803US116, complete genome	117187-117216	9	0.7
NC_017761_3	3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT	1346476-1346505	30	NC_026923	Synechococcus phage ACG-2014d isolate Syn7803C102, complete genome	117194-117223	9	0.7
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	NC_007336	Cupriavidus pinatubonensis JMP134 megaplasmid, complete sequence	452389-452418	9	0.7
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	KJ019062	Synechococcus phage ACG-2014d isolate Syn7803C93, complete genome	117188-117217	9	0.7
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	KJ019121	Synechococcus phage ACG-2014d isolate Syn7803US78, complete genome	117185-117214	9	0.7
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	KJ019126	Synechococcus phage ACG-2014d isolate Syn7803US83, complete genome	117280-117309	9	0.7
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	KJ019047	Synechococcus phage ACG-2014d isolate Syn7803C73, complete genome	117188-117217	9	0.7
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	KJ019072	Synechococcus phage ACG-2014d isolate Syn7803US108, complete genome	117189-117218	9	0.7
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	KJ019032	Synechococcus phage ACG-2014d isolate Syn7803C49, complete genome	117195-117224	9	0.7
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	KJ019078	Synechococcus phage ACG-2014d isolate Syn7803US114, complete genome	117185-117214	9	0.7
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	KJ019165	Synechococcus phage ACG-2014d isolate Syn7803C40, complete genome	117190-117219	9	0.7
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	KJ019124	Synechococcus phage ACG-2014d isolate Syn7803US80, complete genome	117337-117366	9	0.7
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	KJ019074	Synechococcus phage ACG-2014d isolate Syn7803US110, complete genome	117188-117217	9	0.7
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	KJ019034	Synechococcus phage ACG-2014d isolate Syn7803C54, complete genome	117283-117312	9	0.7
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	KJ019127	Synechococcus phage ACG-2014d isolate Syn7803US85, complete genome	117194-117223	9	0.7
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	KJ019118	Synechococcus phage ACG-2014d isolate Syn7803US64, complete genome	117188-117217	9	0.7
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	KJ019075	Synechococcus phage ACG-2014d isolate Syn7803US111, complete genome	117188-117217	9	0.7
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	KJ019131	Synechococcus phage ACG-2014d isolate Syn7803US95, complete genome	117189-117218	9	0.7
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	KJ019057	Synechococcus phage ACG-2014d isolate Syn7803C89, complete genome	117188-117217	9	0.7
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	KJ019056	Synechococcus phage ACG-2014d isolate Syn7803C88, partial genome	117219-117248	9	0.7
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	KJ019160	Synechococcus phage ACG-2014d isolate Syn7803C35, complete genome	117287-117316	9	0.7
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	KJ019112	Synechococcus phage ACG-2014d isolate Syn7803US59, complete genome	117188-117217	9	0.7
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	KJ019073	Synechococcus phage ACG-2014d isolate Syn7803US109, complete genome	117191-117220	9	0.7
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	KJ019077	Synechococcus phage ACG-2014d isolate Syn7803US113, complete genome	117191-117220	9	0.7
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	KJ019129	Synechococcus phage ACG-2014d isolate Syn7803US89, complete genome	117219-117248	9	0.7
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	KJ019031	Synechococcus phage ACG-2014d isolate Syn7803C48, complete genome	117188-117217	9	0.7
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	KJ019079	Synechococcus phage ACG-2014d isolate Syn7803US115, complete genome	117188-117217	9	0.7
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	KJ019035	Synechococcus phage ACG-2014d isolate Syn7803C55, complete genome	115526-115555	9	0.7
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	KJ019120	Synechococcus phage ACG-2014d isolate Syn7803US71, complete genome	117191-117220	9	0.7
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	KJ019036	Synechococcus phage ACG-2014d isolate Syn7803C57, complete genome	117182-117211	9	0.7
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	KJ019048	Synechococcus phage ACG-2014d isolate Syn7803C75, complete genome	117188-117217	9	0.7
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	KJ019113	Synechococcus phage ACG-2014d isolate Syn7803US5, complete genome	117239-117268	9	0.7
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	KJ019140	Synechococcus phage ACG-2014d isolate Syn7803C109, complete genome	117192-117221	9	0.7
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	KJ019119	Synechococcus phage ACG-2014d isolate Syn7803US65, complete genome	117243-117272	9	0.7
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	KJ019162	Synechococcus phage ACG-2014d isolate Syn7803C37, complete genome	117236-117265	9	0.7
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	KJ019130	Synechococcus phage ACG-2014d isolate Syn7803US94, complete genome	117287-117316	9	0.7
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	KJ019115	Synechococcus phage ACG-2014d isolate Syn7803US61, complete genome	117118-117147	9	0.7
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	KJ019139	Synechococcus phage ACG-2014d isolate Syn7803C108, complete genome	117283-117312	9	0.7
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	KJ019125	Synechococcus phage ACG-2014d isolate Syn7803US82, complete genome	117191-117220	9	0.7
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	KJ019070	Synechococcus phage ACG-2014d isolate Syn7803US104, complete genome	117334-117363	9	0.7
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	KJ019028	Synechococcus phage ACG-2014d isolate Syn7803C45, complete genome	117194-117223	9	0.7
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	KJ019083	Synechococcus phage ACG-2014d isolate Syn7803US122, complete genome	117188-117217	9	0.7
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	KJ019164	Synechococcus phage ACG-2014d isolate Syn7803C39, complete genome	117254-117283	9	0.7
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	KJ019117	Synechococcus phage ACG-2014d isolate Syn7803US63, complete genome	117235-117264	9	0.7
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	KJ019046	Synechococcus phage ACG-2014d isolate Syn7803C72, complete genome	117189-117218	9	0.7
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	KJ019050	Synechococcus phage ACG-2014d isolate Syn7803C77, complete genome	117284-117313	9	0.7
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	KJ019029	Synechococcus phage ACG-2014d isolate Syn7803C46, complete genome	117185-117214	9	0.7
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	KJ019080	Synechococcus phage ACG-2014d isolate Syn7803US116, complete genome	117187-117216	9	0.7
NC_017761_3	3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT	1346807-1346836	30	NC_026923	Synechococcus phage ACG-2014d isolate Syn7803C102, complete genome	117194-117223	9	0.7
NC_017761_3	3.8|1346873|30|NC_017761|CRISPRCasFinder,CRT	1346873-1346902	30	MN694154	Marine virus AFVG_250M77, complete genome	19524-19553	9	0.7
NC_017761_3	3.10|1347005|30|NC_017761|CRISPRCasFinder,CRT	1347005-1347034	30	NZ_CP047629	Lactococcus raffinolactis strain Lr_19_14 plasmid pLraf_19_14_1, complete sequence	19605-19634	9	0.7
NC_017761_3	3.10|1347005|30|NC_017761|CRISPRCasFinder,CRT	1347005-1347034	30	MN693010	Marine virus AFVG_117M73, complete genome	13697-13726	9	0.7
NC_017761_3	3.10|1347005|30|NC_017761|CRISPRCasFinder,CRT	1347005-1347034	30	BK010471	TPA_asm: Uncultured crAssphage, complete genome	64772-64801	9	0.7
NC_017761_3	3.10|1347005|30|NC_017761|CRISPRCasFinder,CRT	1347005-1347034	30	NC_024711	Uncultured crAssphage, complete genome	64772-64801	9	0.7
NC_017761_3	3.10|1347005|30|NC_017761|CRISPRCasFinder,CRT	1347005-1347034	30	JQ995537	Uncultured phage crAssphage, complete genome	64772-64801	9	0.7
NC_017761_3	3.10|1347005|30|NC_017761|CRISPRCasFinder,CRT	1347005-1347034	30	MK415410	CrAssphage YS1-2_2437, complete genome	13750-13779	9	0.7
NC_017761_3	3.10|1347005|30|NC_017761|CRISPRCasFinder,CRT	1347005-1347034	30	MK415408	CrAssphage GF1-2_000079F, complete genome	15336-15365	9	0.7
NC_017761_3	3.10|1347005|30|NC_017761|CRISPRCasFinder,CRT	1347005-1347034	30	MN694652	Marine virus AFVG_250M647, complete genome	25293-25322	9	0.7
NC_017761_3	3.12|1347137|30|NC_017761|CRISPRCasFinder,CRT	1347137-1347166	30	NZ_CP029455	Bacillus cereus strain FORC087 plasmid pFORC087.1, complete sequence	10868-10897	9	0.7
NC_017761_3	3.12|1347137|30|NC_017761|CRISPRCasFinder,CRT	1347137-1347166	30	CP024686	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-2-313K, complete sequence	240263-240292	9	0.7
NC_017761_3	3.12|1347137|30|NC_017761|CRISPRCasFinder,CRT	1347137-1347166	30	NZ_CP045608	Bacillus cereus strain SB1 plasmid p2, complete sequence	268030-268059	9	0.7
NC_017761_3	3.12|1347137|30|NC_017761|CRISPRCasFinder,CRT	1347137-1347166	30	NZ_CP012100	Bacillus thuringiensis strain HS18-1 plasmid pHS18-1, complete sequence	480745-480774	9	0.7
NC_017761_3	3.12|1347137|30|NC_017761|CRISPRCasFinder,CRT	1347137-1347166	30	NZ_CP016596	Bacillus cereus strain K8 plasmid pBCM301, complete sequence	315029-315058	9	0.7
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	NC_007336	Cupriavidus pinatubonensis JMP134 megaplasmid, complete sequence	452389-452418	9	0.7
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	KJ019062	Synechococcus phage ACG-2014d isolate Syn7803C93, complete genome	117188-117217	9	0.7
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	KJ019121	Synechococcus phage ACG-2014d isolate Syn7803US78, complete genome	117185-117214	9	0.7
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	KJ019126	Synechococcus phage ACG-2014d isolate Syn7803US83, complete genome	117280-117309	9	0.7
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	KJ019047	Synechococcus phage ACG-2014d isolate Syn7803C73, complete genome	117188-117217	9	0.7
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	KJ019072	Synechococcus phage ACG-2014d isolate Syn7803US108, complete genome	117189-117218	9	0.7
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	KJ019032	Synechococcus phage ACG-2014d isolate Syn7803C49, complete genome	117195-117224	9	0.7
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	KJ019078	Synechococcus phage ACG-2014d isolate Syn7803US114, complete genome	117185-117214	9	0.7
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	KJ019165	Synechococcus phage ACG-2014d isolate Syn7803C40, complete genome	117190-117219	9	0.7
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	KJ019124	Synechococcus phage ACG-2014d isolate Syn7803US80, complete genome	117337-117366	9	0.7
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	KJ019074	Synechococcus phage ACG-2014d isolate Syn7803US110, complete genome	117188-117217	9	0.7
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	KJ019034	Synechococcus phage ACG-2014d isolate Syn7803C54, complete genome	117283-117312	9	0.7
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	KJ019127	Synechococcus phage ACG-2014d isolate Syn7803US85, complete genome	117194-117223	9	0.7
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	KJ019118	Synechococcus phage ACG-2014d isolate Syn7803US64, complete genome	117188-117217	9	0.7
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	KJ019075	Synechococcus phage ACG-2014d isolate Syn7803US111, complete genome	117188-117217	9	0.7
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	KJ019131	Synechococcus phage ACG-2014d isolate Syn7803US95, complete genome	117189-117218	9	0.7
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	KJ019057	Synechococcus phage ACG-2014d isolate Syn7803C89, complete genome	117188-117217	9	0.7
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	KJ019056	Synechococcus phage ACG-2014d isolate Syn7803C88, partial genome	117219-117248	9	0.7
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	KJ019160	Synechococcus phage ACG-2014d isolate Syn7803C35, complete genome	117287-117316	9	0.7
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	KJ019112	Synechococcus phage ACG-2014d isolate Syn7803US59, complete genome	117188-117217	9	0.7
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	KJ019073	Synechococcus phage ACG-2014d isolate Syn7803US109, complete genome	117191-117220	9	0.7
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	KJ019077	Synechococcus phage ACG-2014d isolate Syn7803US113, complete genome	117191-117220	9	0.7
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	KJ019129	Synechococcus phage ACG-2014d isolate Syn7803US89, complete genome	117219-117248	9	0.7
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	KJ019031	Synechococcus phage ACG-2014d isolate Syn7803C48, complete genome	117188-117217	9	0.7
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	KJ019079	Synechococcus phage ACG-2014d isolate Syn7803US115, complete genome	117188-117217	9	0.7
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	KJ019035	Synechococcus phage ACG-2014d isolate Syn7803C55, complete genome	115526-115555	9	0.7
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	KJ019120	Synechococcus phage ACG-2014d isolate Syn7803US71, complete genome	117191-117220	9	0.7
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	KJ019036	Synechococcus phage ACG-2014d isolate Syn7803C57, complete genome	117182-117211	9	0.7
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	KJ019048	Synechococcus phage ACG-2014d isolate Syn7803C75, complete genome	117188-117217	9	0.7
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	KJ019113	Synechococcus phage ACG-2014d isolate Syn7803US5, complete genome	117239-117268	9	0.7
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	KJ019140	Synechococcus phage ACG-2014d isolate Syn7803C109, complete genome	117192-117221	9	0.7
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	KJ019119	Synechococcus phage ACG-2014d isolate Syn7803US65, complete genome	117243-117272	9	0.7
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	KJ019162	Synechococcus phage ACG-2014d isolate Syn7803C37, complete genome	117236-117265	9	0.7
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	KJ019130	Synechococcus phage ACG-2014d isolate Syn7803US94, complete genome	117287-117316	9	0.7
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	KJ019115	Synechococcus phage ACG-2014d isolate Syn7803US61, complete genome	117118-117147	9	0.7
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	KJ019139	Synechococcus phage ACG-2014d isolate Syn7803C108, complete genome	117283-117312	9	0.7
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	KJ019125	Synechococcus phage ACG-2014d isolate Syn7803US82, complete genome	117191-117220	9	0.7
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	KJ019070	Synechococcus phage ACG-2014d isolate Syn7803US104, complete genome	117334-117363	9	0.7
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	KJ019028	Synechococcus phage ACG-2014d isolate Syn7803C45, complete genome	117194-117223	9	0.7
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	KJ019083	Synechococcus phage ACG-2014d isolate Syn7803US122, complete genome	117188-117217	9	0.7
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	KJ019164	Synechococcus phage ACG-2014d isolate Syn7803C39, complete genome	117254-117283	9	0.7
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	KJ019117	Synechococcus phage ACG-2014d isolate Syn7803US63, complete genome	117235-117264	9	0.7
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	KJ019046	Synechococcus phage ACG-2014d isolate Syn7803C72, complete genome	117189-117218	9	0.7
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	KJ019050	Synechococcus phage ACG-2014d isolate Syn7803C77, complete genome	117284-117313	9	0.7
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	KJ019029	Synechococcus phage ACG-2014d isolate Syn7803C46, complete genome	117185-117214	9	0.7
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	KJ019080	Synechococcus phage ACG-2014d isolate Syn7803US116, complete genome	117187-117216	9	0.7
NC_017761_3	3.17|1346477|30|NC_017761|PILER-CR	1346477-1346506	30	NC_026923	Synechococcus phage ACG-2014d isolate Syn7803C102, complete genome	117194-117223	9	0.7
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	NC_007336	Cupriavidus pinatubonensis JMP134 megaplasmid, complete sequence	452389-452418	9	0.7
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	KJ019062	Synechococcus phage ACG-2014d isolate Syn7803C93, complete genome	117188-117217	9	0.7
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	KJ019121	Synechococcus phage ACG-2014d isolate Syn7803US78, complete genome	117185-117214	9	0.7
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	KJ019126	Synechococcus phage ACG-2014d isolate Syn7803US83, complete genome	117280-117309	9	0.7
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	KJ019047	Synechococcus phage ACG-2014d isolate Syn7803C73, complete genome	117188-117217	9	0.7
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	KJ019072	Synechococcus phage ACG-2014d isolate Syn7803US108, complete genome	117189-117218	9	0.7
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	KJ019032	Synechococcus phage ACG-2014d isolate Syn7803C49, complete genome	117195-117224	9	0.7
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	KJ019078	Synechococcus phage ACG-2014d isolate Syn7803US114, complete genome	117185-117214	9	0.7
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	KJ019165	Synechococcus phage ACG-2014d isolate Syn7803C40, complete genome	117190-117219	9	0.7
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	KJ019124	Synechococcus phage ACG-2014d isolate Syn7803US80, complete genome	117337-117366	9	0.7
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	KJ019074	Synechococcus phage ACG-2014d isolate Syn7803US110, complete genome	117188-117217	9	0.7
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	KJ019034	Synechococcus phage ACG-2014d isolate Syn7803C54, complete genome	117283-117312	9	0.7
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	KJ019127	Synechococcus phage ACG-2014d isolate Syn7803US85, complete genome	117194-117223	9	0.7
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	KJ019118	Synechococcus phage ACG-2014d isolate Syn7803US64, complete genome	117188-117217	9	0.7
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	KJ019075	Synechococcus phage ACG-2014d isolate Syn7803US111, complete genome	117188-117217	9	0.7
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	KJ019131	Synechococcus phage ACG-2014d isolate Syn7803US95, complete genome	117189-117218	9	0.7
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	KJ019057	Synechococcus phage ACG-2014d isolate Syn7803C89, complete genome	117188-117217	9	0.7
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	KJ019056	Synechococcus phage ACG-2014d isolate Syn7803C88, partial genome	117219-117248	9	0.7
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	KJ019160	Synechococcus phage ACG-2014d isolate Syn7803C35, complete genome	117287-117316	9	0.7
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	KJ019112	Synechococcus phage ACG-2014d isolate Syn7803US59, complete genome	117188-117217	9	0.7
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	KJ019073	Synechococcus phage ACG-2014d isolate Syn7803US109, complete genome	117191-117220	9	0.7
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	KJ019077	Synechococcus phage ACG-2014d isolate Syn7803US113, complete genome	117191-117220	9	0.7
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	KJ019129	Synechococcus phage ACG-2014d isolate Syn7803US89, complete genome	117219-117248	9	0.7
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	KJ019031	Synechococcus phage ACG-2014d isolate Syn7803C48, complete genome	117188-117217	9	0.7
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	KJ019079	Synechococcus phage ACG-2014d isolate Syn7803US115, complete genome	117188-117217	9	0.7
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	KJ019035	Synechococcus phage ACG-2014d isolate Syn7803C55, complete genome	115526-115555	9	0.7
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	KJ019120	Synechococcus phage ACG-2014d isolate Syn7803US71, complete genome	117191-117220	9	0.7
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	KJ019036	Synechococcus phage ACG-2014d isolate Syn7803C57, complete genome	117182-117211	9	0.7
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	KJ019048	Synechococcus phage ACG-2014d isolate Syn7803C75, complete genome	117188-117217	9	0.7
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	KJ019113	Synechococcus phage ACG-2014d isolate Syn7803US5, complete genome	117239-117268	9	0.7
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	KJ019140	Synechococcus phage ACG-2014d isolate Syn7803C109, complete genome	117192-117221	9	0.7
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	KJ019119	Synechococcus phage ACG-2014d isolate Syn7803US65, complete genome	117243-117272	9	0.7
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	KJ019162	Synechococcus phage ACG-2014d isolate Syn7803C37, complete genome	117236-117265	9	0.7
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	KJ019130	Synechococcus phage ACG-2014d isolate Syn7803US94, complete genome	117287-117316	9	0.7
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	KJ019115	Synechococcus phage ACG-2014d isolate Syn7803US61, complete genome	117118-117147	9	0.7
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	KJ019139	Synechococcus phage ACG-2014d isolate Syn7803C108, complete genome	117283-117312	9	0.7
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	KJ019125	Synechococcus phage ACG-2014d isolate Syn7803US82, complete genome	117191-117220	9	0.7
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	KJ019070	Synechococcus phage ACG-2014d isolate Syn7803US104, complete genome	117334-117363	9	0.7
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	KJ019028	Synechococcus phage ACG-2014d isolate Syn7803C45, complete genome	117194-117223	9	0.7
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	KJ019083	Synechococcus phage ACG-2014d isolate Syn7803US122, complete genome	117188-117217	9	0.7
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	KJ019164	Synechococcus phage ACG-2014d isolate Syn7803C39, complete genome	117254-117283	9	0.7
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	KJ019117	Synechococcus phage ACG-2014d isolate Syn7803US63, complete genome	117235-117264	9	0.7
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	KJ019046	Synechococcus phage ACG-2014d isolate Syn7803C72, complete genome	117189-117218	9	0.7
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	KJ019050	Synechococcus phage ACG-2014d isolate Syn7803C77, complete genome	117284-117313	9	0.7
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	KJ019029	Synechococcus phage ACG-2014d isolate Syn7803C46, complete genome	117185-117214	9	0.7
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	KJ019080	Synechococcus phage ACG-2014d isolate Syn7803US116, complete genome	117187-117216	9	0.7
NC_017761_3	3.22|1346808|30|NC_017761|PILER-CR	1346808-1346837	30	NC_026923	Synechococcus phage ACG-2014d isolate Syn7803C102, complete genome	117194-117223	9	0.7
NC_017761_3	3.23|1346874|30|NC_017761|PILER-CR	1346874-1346903	30	MN694154	Marine virus AFVG_250M77, complete genome	19524-19553	9	0.7
NC_017761_3	3.25|1347006|30|NC_017761|PILER-CR	1347006-1347035	30	NZ_CP047629	Lactococcus raffinolactis strain Lr_19_14 plasmid pLraf_19_14_1, complete sequence	19605-19634	9	0.7
NC_017761_3	3.25|1347006|30|NC_017761|PILER-CR	1347006-1347035	30	MN693010	Marine virus AFVG_117M73, complete genome	13697-13726	9	0.7
NC_017761_3	3.25|1347006|30|NC_017761|PILER-CR	1347006-1347035	30	BK010471	TPA_asm: Uncultured crAssphage, complete genome	64772-64801	9	0.7
NC_017761_3	3.25|1347006|30|NC_017761|PILER-CR	1347006-1347035	30	NC_024711	Uncultured crAssphage, complete genome	64772-64801	9	0.7
NC_017761_3	3.25|1347006|30|NC_017761|PILER-CR	1347006-1347035	30	JQ995537	Uncultured phage crAssphage, complete genome	64772-64801	9	0.7
NC_017761_3	3.25|1347006|30|NC_017761|PILER-CR	1347006-1347035	30	MK415410	CrAssphage YS1-2_2437, complete genome	13750-13779	9	0.7
NC_017761_3	3.25|1347006|30|NC_017761|PILER-CR	1347006-1347035	30	MK415408	CrAssphage GF1-2_000079F, complete genome	15336-15365	9	0.7
NC_017761_3	3.25|1347006|30|NC_017761|PILER-CR	1347006-1347035	30	MN694652	Marine virus AFVG_250M647, complete genome	25293-25322	9	0.7
NC_017761_1	1.1|155023|32|NC_017761|PILER-CR	155023-155054	32	NC_014628	Paenibacillus polymyxa SC2 plasmid pSC2, complete sequence	386096-386127	10	0.688
NC_017761_1	1.1|155023|32|NC_017761|PILER-CR	155023-155054	32	HG531805	Clostridium phage CDMH1 complete genome	38487-38518	10	0.688
NC_017761_2	2.1|538882|32|NC_017761|PILER-CR	538882-538913	32	NC_014628	Paenibacillus polymyxa SC2 plasmid pSC2, complete sequence	386096-386127	10	0.688
NC_017761_2	2.1|538882|32|NC_017761|PILER-CR	538882-538913	32	HG531805	Clostridium phage CDMH1 complete genome	38487-38518	10	0.688
NC_017761_3	3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT	1346939-1346968	30	NC_016936	Saprospira grandis str. Lewin plasmid, complete sequence	34062-34091	10	0.667
NC_017761_3	3.24|1346940|30|NC_017761|PILER-CR	1346940-1346969	30	NC_016936	Saprospira grandis str. Lewin plasmid, complete sequence	34062-34091	10	0.667

1. spacer 4.8|1749212|28|NC_017761|PILER-CR matches to AP014353 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S39-C37, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.821

attttggcaagtaatgattatttggtag	CRISPR spacer
aattgggcaagtaatgattattggggtg	Protospacer
* ** ***************** **  *

2. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to NC_015512 (Haliscomenobacter hydrossis DSM 1100 plasmid pHALHY02, complete sequence) position: , mismatch: 6, identity: 0.8

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
gcagcaaccaaaaagcaaaaaactgccaca	Protospacer
..** .*. *********************

3. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to MN592896 (Alteromonas phage XX1924, complete genome) position: , mismatch: 6, identity: 0.8

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
atagagatgaaaaggcaaaaaggcggcaga	Protospacer
*************.*******. .* ** *

4. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to NC_015512 (Haliscomenobacter hydrossis DSM 1100 plasmid pHALHY02, complete sequence) position: , mismatch: 6, identity: 0.8

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
gcagcaaccaaaaagcaaaaaactgccaca	Protospacer
..** .*. *********************

5. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to MN592896 (Alteromonas phage XX1924, complete genome) position: , mismatch: 6, identity: 0.8

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
atagagatgaaaaggcaaaaaggcggcaga	Protospacer
*************.*******. .* ** *

6. spacer 3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP039061 (Piscirickettsia salmonis strain Psal-099 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaattctaaaaaa	Protospacer
*.  *.*************** *****.**

7. spacer 3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP013797 (Piscirickettsia salmonis strain AY6532B plasmid p1PS9, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaattctaaaaaa	Protospacer
*.  *.*************** *****.**

8. spacer 3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP013787 (Piscirickettsia salmonis strain PM58386B plasmid p1PS7, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaattctaaaaaa	Protospacer
*.  *.*************** *****.**

9. spacer 3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP039228 (Piscirickettsia salmonis strain SR1 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaatcctaaaaaa	Protospacer
*.  *.*************** *****.**

10. spacer 3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP013820 (Piscirickettsia salmonis strain AY3800B plasmid p4PS10, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaattctaaaaaa	Protospacer
*.  *.*************** *****.**

11. spacer 3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP013792 (Piscirickettsia salmonis strain AY6297B plasmid p1PS8, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaattctaaaaaa	Protospacer
*.  *.*************** *****.**

12. spacer 3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP013815 (Piscirickettsia salmonis strain AY3864B plasmid p4PS11, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaattctaaaaaa	Protospacer
*.  *.*************** *****.**

13. spacer 3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP011850 (Piscirickettsia salmonis LF-89 = ATCC VR-1361 plasmid pPSLF89-1, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaattctaaaaaa	Protospacer
*.  *.*************** *****.**

14. spacer 3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP039235 (Piscirickettsia salmonis strain BI1 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaatcctaaaaaa	Protospacer
*.  *.*************** *****.**

15. spacer 3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP039241 (Piscirickettsia salmonis strain MR5 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaatcctaaaaaa	Protospacer
*.  *.*************** *****.**

16. spacer 3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP039098 (Piscirickettsia salmonis strain Psal-117 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaattctaaaaaa	Protospacer
*.  *.*************** *****.**

17. spacer 3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP039056 (Piscirickettsia salmonis strain Psal-098 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaattctaaaaaa	Protospacer
*.  *.*************** *****.**

18. spacer 3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP039047 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaattctaaaaaa	Protospacer
*.  *.*************** *****.**

19. spacer 3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP013807 (Piscirickettsia salmonis strain PM31429B plasmid p1PS12, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaattctaaaaaa	Protospacer
*.  *.*************** *****.**

20. spacer 3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP013782 (Piscirickettsia salmonis strain PM49811B plasmid p1PS6, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaattctaaaaaa	Protospacer
*.  *.*************** *****.**

21. spacer 3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP039088 (Piscirickettsia salmonis strain Psal-111 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaattctaaaaaa	Protospacer
*.  *.*************** *****.**

22. spacer 3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP039113 (Piscirickettsia salmonis strain Psal-135 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaattctaaaaaa	Protospacer
*.  *.*************** *****.**

23. spacer 3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP038905 (Piscirickettsia salmonis strain Psal-008 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaattctaaaaaa	Protospacer
*.  *.*************** *****.**

24. spacer 3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP038928 (Piscirickettsia salmonis strain Psal-013 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaattctaaaaaa	Protospacer
*.  *.*************** *****.**

25. spacer 3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP039093 (Piscirickettsia salmonis strain Psal-114 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaattctaaaaaa	Protospacer
*.  *.*************** *****.**

26. spacer 3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP039172 (Piscirickettsia salmonis strain Psal-138 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaattctaaaaaa	Protospacer
*.  *.*************** *****.**

27. spacer 3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP012511 (Piscirickettsia salmonis strain PM32597B1 plasmid pPSB1-3, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaattctaaaaaa	Protospacer
*.  *.*************** *****.**

28. spacer 3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP013824 (Piscirickettsia salmonis strain PM25344B plasmid p3PS14, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaattctaaaaaa	Protospacer
*.  *.*************** *****.**

29. spacer 3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP013804 (Piscirickettsia salmonis strain PM22180B plasmid p3PS13, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaattctaaaaaa	Protospacer
*.  *.*************** *****.**

30. spacer 3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP039869 (Piscirickettsia salmonis strain Psal-113 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaattctaaaaaa	Protospacer
*.  *.*************** *****.**

31. spacer 3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP039071 (Piscirickettsia salmonis strain Psal-108 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaattctaaaaaa	Protospacer
*.  *.*************** *****.**

32. spacer 3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP039103 (Piscirickettsia salmonis strain Psal-118 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaattctaaaaaa	Protospacer
*.  *.*************** *****.**

33. spacer 3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP039177 (Piscirickettsia salmonis strain Psal-139 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaattctaaaaaa	Protospacer
*.  *.*************** *****.**

34. spacer 3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP039108 (Piscirickettsia salmonis strain Psal-134 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaattctaaaaaa	Protospacer
*.  *.*************** *****.**

35. spacer 3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP039051 (Piscirickettsia salmonis strain Psal-081 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaattctaaaaaa	Protospacer
*.  *.*************** *****.**

36. spacer 3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP013946 (Piscirickettsia salmonis strain PSCGR01 plasmid pPsCRG01-1, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaattctaaaaaa	Protospacer
*.  *.*************** *****.**

37. spacer 3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP039078 (Piscirickettsia salmonis strain Psal-109 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaattctaaaaaa	Protospacer
*.  *.*************** *****.**

38. spacer 3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP039082 (Piscirickettsia salmonis strain Psal-110 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaattctaaaaaa	Protospacer
*.  *.*************** *****.**

39. spacer 3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP038919 (Piscirickettsia salmonis strain Psal-010b plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaattctaaaaaa	Protospacer
*.  *.*************** *****.**

40. spacer 3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP038899 (Piscirickettsia salmonis strain Psal-006b plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaattctaaaaaa	Protospacer
*.  *.*************** *****.**

41. spacer 3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP048060 (Piscirickettsia salmonis strain Ps-8942B plasmid Ps8942B-p4, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaattctaaaaaa	Protospacer
*.  *.*************** *****.**

42. spacer 3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP048053 (Piscirickettsia salmonis strain Ps-11091B plasmid Ps11091B-p1, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaattctaaaaaa	Protospacer
*.  *.*************** *****.**

43. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to NC_015512 (Haliscomenobacter hydrossis DSM 1100 plasmid pHALHY02, complete sequence) position: , mismatch: 6, identity: 0.8

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
gcagcaaccaaaaagcaaaaaactgccaca	Protospacer
..** .*. *********************

44. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to MN592896 (Alteromonas phage XX1924, complete genome) position: , mismatch: 6, identity: 0.8

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
atagagatgaaaaggcaaaaaggcggcaga	Protospacer
*************.*******. .* ** *

45. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to NC_015512 (Haliscomenobacter hydrossis DSM 1100 plasmid pHALHY02, complete sequence) position: , mismatch: 6, identity: 0.8

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
gcagcaaccaaaaagcaaaaaactgccaca	Protospacer
..** .*. *********************

46. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to MN592896 (Alteromonas phage XX1924, complete genome) position: , mismatch: 6, identity: 0.8

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
atagagatgaaaaggcaaaaaggcggcaga	Protospacer
*************.*******. .* ** *

47. spacer 3.24|1346940|30|NC_017761|PILER-CR matches to NZ_CP039061 (Piscirickettsia salmonis strain Psal-099 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaattctaaaaaa	Protospacer
*.  *.*************** *****.**

48. spacer 3.24|1346940|30|NC_017761|PILER-CR matches to NZ_CP013797 (Piscirickettsia salmonis strain AY6532B plasmid p1PS9, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaattctaaaaaa	Protospacer
*.  *.*************** *****.**

49. spacer 3.24|1346940|30|NC_017761|PILER-CR matches to NZ_CP013787 (Piscirickettsia salmonis strain PM58386B plasmid p1PS7, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaattctaaaaaa	Protospacer
*.  *.*************** *****.**

50. spacer 3.24|1346940|30|NC_017761|PILER-CR matches to NZ_CP039228 (Piscirickettsia salmonis strain SR1 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaatcctaaaaaa	Protospacer
*.  *.*************** *****.**

51. spacer 3.24|1346940|30|NC_017761|PILER-CR matches to NZ_CP013820 (Piscirickettsia salmonis strain AY3800B plasmid p4PS10, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaattctaaaaaa	Protospacer
*.  *.*************** *****.**

52. spacer 3.24|1346940|30|NC_017761|PILER-CR matches to NZ_CP013792 (Piscirickettsia salmonis strain AY6297B plasmid p1PS8, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaattctaaaaaa	Protospacer
*.  *.*************** *****.**

53. spacer 3.24|1346940|30|NC_017761|PILER-CR matches to NZ_CP013815 (Piscirickettsia salmonis strain AY3864B plasmid p4PS11, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaattctaaaaaa	Protospacer
*.  *.*************** *****.**

54. spacer 3.24|1346940|30|NC_017761|PILER-CR matches to NZ_CP011850 (Piscirickettsia salmonis LF-89 = ATCC VR-1361 plasmid pPSLF89-1, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaattctaaaaaa	Protospacer
*.  *.*************** *****.**

55. spacer 3.24|1346940|30|NC_017761|PILER-CR matches to NZ_CP039235 (Piscirickettsia salmonis strain BI1 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaatcctaaaaaa	Protospacer
*.  *.*************** *****.**

56. spacer 3.24|1346940|30|NC_017761|PILER-CR matches to NZ_CP039241 (Piscirickettsia salmonis strain MR5 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaatcctaaaaaa	Protospacer
*.  *.*************** *****.**

57. spacer 3.24|1346940|30|NC_017761|PILER-CR matches to NZ_CP039098 (Piscirickettsia salmonis strain Psal-117 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaattctaaaaaa	Protospacer
*.  *.*************** *****.**

58. spacer 3.24|1346940|30|NC_017761|PILER-CR matches to NZ_CP039056 (Piscirickettsia salmonis strain Psal-098 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaattctaaaaaa	Protospacer
*.  *.*************** *****.**

59. spacer 3.24|1346940|30|NC_017761|PILER-CR matches to NZ_CP039047 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaattctaaaaaa	Protospacer
*.  *.*************** *****.**

60. spacer 3.24|1346940|30|NC_017761|PILER-CR matches to NZ_CP013807 (Piscirickettsia salmonis strain PM31429B plasmid p1PS12, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaattctaaaaaa	Protospacer
*.  *.*************** *****.**

61. spacer 3.24|1346940|30|NC_017761|PILER-CR matches to NZ_CP013782 (Piscirickettsia salmonis strain PM49811B plasmid p1PS6, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaattctaaaaaa	Protospacer
*.  *.*************** *****.**

62. spacer 3.24|1346940|30|NC_017761|PILER-CR matches to NZ_CP039088 (Piscirickettsia salmonis strain Psal-111 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaattctaaaaaa	Protospacer
*.  *.*************** *****.**

63. spacer 3.24|1346940|30|NC_017761|PILER-CR matches to NZ_CP039113 (Piscirickettsia salmonis strain Psal-135 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaattctaaaaaa	Protospacer
*.  *.*************** *****.**

64. spacer 3.24|1346940|30|NC_017761|PILER-CR matches to NZ_CP038905 (Piscirickettsia salmonis strain Psal-008 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaattctaaaaaa	Protospacer
*.  *.*************** *****.**

65. spacer 3.24|1346940|30|NC_017761|PILER-CR matches to NZ_CP038928 (Piscirickettsia salmonis strain Psal-013 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaattctaaaaaa	Protospacer
*.  *.*************** *****.**

66. spacer 3.24|1346940|30|NC_017761|PILER-CR matches to NZ_CP039093 (Piscirickettsia salmonis strain Psal-114 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaattctaaaaaa	Protospacer
*.  *.*************** *****.**

67. spacer 3.24|1346940|30|NC_017761|PILER-CR matches to NZ_CP039172 (Piscirickettsia salmonis strain Psal-138 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaattctaaaaaa	Protospacer
*.  *.*************** *****.**

68. spacer 3.24|1346940|30|NC_017761|PILER-CR matches to NZ_CP012511 (Piscirickettsia salmonis strain PM32597B1 plasmid pPSB1-3, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaattctaaaaaa	Protospacer
*.  *.*************** *****.**

69. spacer 3.24|1346940|30|NC_017761|PILER-CR matches to NZ_CP013824 (Piscirickettsia salmonis strain PM25344B plasmid p3PS14, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaattctaaaaaa	Protospacer
*.  *.*************** *****.**

70. spacer 3.24|1346940|30|NC_017761|PILER-CR matches to NZ_CP013804 (Piscirickettsia salmonis strain PM22180B plasmid p3PS13, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaattctaaaaaa	Protospacer
*.  *.*************** *****.**

71. spacer 3.24|1346940|30|NC_017761|PILER-CR matches to NZ_CP039869 (Piscirickettsia salmonis strain Psal-113 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaattctaaaaaa	Protospacer
*.  *.*************** *****.**

72. spacer 3.24|1346940|30|NC_017761|PILER-CR matches to NZ_CP039071 (Piscirickettsia salmonis strain Psal-108 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaattctaaaaaa	Protospacer
*.  *.*************** *****.**

73. spacer 3.24|1346940|30|NC_017761|PILER-CR matches to NZ_CP039103 (Piscirickettsia salmonis strain Psal-118 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaattctaaaaaa	Protospacer
*.  *.*************** *****.**

74. spacer 3.24|1346940|30|NC_017761|PILER-CR matches to NZ_CP039177 (Piscirickettsia salmonis strain Psal-139 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaattctaaaaaa	Protospacer
*.  *.*************** *****.**

75. spacer 3.24|1346940|30|NC_017761|PILER-CR matches to NZ_CP039108 (Piscirickettsia salmonis strain Psal-134 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaattctaaaaaa	Protospacer
*.  *.*************** *****.**

76. spacer 3.24|1346940|30|NC_017761|PILER-CR matches to NZ_CP039051 (Piscirickettsia salmonis strain Psal-081 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaattctaaaaaa	Protospacer
*.  *.*************** *****.**

77. spacer 3.24|1346940|30|NC_017761|PILER-CR matches to NZ_CP013946 (Piscirickettsia salmonis strain PSCGR01 plasmid pPsCRG01-1, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaattctaaaaaa	Protospacer
*.  *.*************** *****.**

78. spacer 3.24|1346940|30|NC_017761|PILER-CR matches to NZ_CP039078 (Piscirickettsia salmonis strain Psal-109 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaattctaaaaaa	Protospacer
*.  *.*************** *****.**

79. spacer 3.24|1346940|30|NC_017761|PILER-CR matches to NZ_CP039082 (Piscirickettsia salmonis strain Psal-110 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaattctaaaaaa	Protospacer
*.  *.*************** *****.**

80. spacer 3.24|1346940|30|NC_017761|PILER-CR matches to NZ_CP038919 (Piscirickettsia salmonis strain Psal-010b plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaattctaaaaaa	Protospacer
*.  *.*************** *****.**

81. spacer 3.24|1346940|30|NC_017761|PILER-CR matches to NZ_CP038899 (Piscirickettsia salmonis strain Psal-006b plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaattctaaaaaa	Protospacer
*.  *.*************** *****.**

82. spacer 3.24|1346940|30|NC_017761|PILER-CR matches to NZ_CP048060 (Piscirickettsia salmonis strain Ps-8942B plasmid Ps8942B-p4, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaattctaaaaaa	Protospacer
*.  *.*************** *****.**

83. spacer 3.24|1346940|30|NC_017761|PILER-CR matches to NZ_CP048053 (Piscirickettsia salmonis strain Ps-11091B plasmid Ps11091B-p1, complete sequence) position: , mismatch: 6, identity: 0.8

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
tgccgactttgccaatgaaattctaaaaaa	Protospacer
*.  *.*************** *****.**

84. spacer 4.5|1749210|30|NC_017761|CRISPRCasFinder matches to AP014353 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S39-C37, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.8

tgattttggcaagtaatgattatttggtag	CRISPR spacer
taaattgggcaagtaatgattattggggtg	Protospacer
*.* ** ***************** **  *

85. spacer 3.1|1346410|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP007453 (Peptoclostridium acidaminophilum DSM 3953 strain al-2 plasmid EAL2_808p, complete sequence) position: , mismatch: 7, identity: 0.767

atgacaagtctatacccgtttttatactcg	CRISPR spacer
aagacaattctacacccgtttttattcgtc	Protospacer
* ***** ****.************ * . 

86. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to NC_009998 (Shewanella baltica OS195 plasmid pS19501, complete sequence) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
atagagatgaaacagctaaaaacttgtcga	Protospacer
************ *** *******  .  *

87. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP025427 (Enterococcus faecium strain SC4 plasmid p2, complete sequence) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

88. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP041263 (Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R2) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

89. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP027511 (Enterococcus faecium strain AUSMDU00004055 plasmid unnamed5, complete sequence) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

90. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_LR135245 (Enterococcus faecium isolate E6988 plasmid 3) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

91. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_LR135256 (Enterococcus faecium isolate E7098 plasmid 3) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

92. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP038997 (Enterococcus faecium strain SRR24 plasmid pSRR24) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

93. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP019989 (Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

94. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_LR135490 (Enterococcus faecium isolate E8414 plasmid 3) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

95. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP044266 (Enterococcus faecium strain V1836 plasmid pHVH-V1836-2, complete sequence) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

96. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_LR134109 (Enterococcus faecium isolate E6043 plasmid 5) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

97. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP045014 (Enterococcus faecium strain LAC7.2 plasmid pII, complete sequence) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

98. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP040742 (Enterococcus faecium strain VRE1 plasmid pVRE1-VanA, complete sequence) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

99. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to MN831413 (Enterococcus faecium strain M17/0314 plasmid pM17/0314, complete sequence) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

100. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_AP022343 (Enterococcus faecium strain KUHS13 plasmid pELF2) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

101. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP041272 (Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S2) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

102. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP019994 (Enterococcus faecium isolate 2014-VREF-268 plasmid p268-2) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

103. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP035656 (Enterococcus faecium strain UAMSEF_09 plasmid unnamed2) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

104. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP035662 (Enterococcus faecium strain UAMSEF_20 plasmid unnamed2) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

105. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP039730 (Enterococcus faecium strain ZY2 plasmid pZY2) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

106. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP019971 (Enterococcus faecium isolate 2014-VREF-114 plasmid p114-1 sequence) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

107. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP012462 (Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p2) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

108. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_MG640601 (Enterococcus faecium strain SRR6 plasmid pEMSRR6, complete sequence) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

109. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to KX982260 (Alteromonas phage PB15, complete genome) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
atagagatgaaaaggcaaaaaggcggtaga	Protospacer
*************.*******. .* .* *

110. spacer 3.6|1346741|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP007453 (Peptoclostridium acidaminophilum DSM 3953 strain al-2 plasmid EAL2_808p, complete sequence) position: , mismatch: 7, identity: 0.767

atgacaagtctatacccgtttttatactcg	CRISPR spacer
aagacaattctacacccgtttttattcgtc	Protospacer
* ***** ****.************ * . 

111. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to NC_009998 (Shewanella baltica OS195 plasmid pS19501, complete sequence) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
atagagatgaaacagctaaaaacttgtcga	Protospacer
************ *** *******  .  *

112. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP025427 (Enterococcus faecium strain SC4 plasmid p2, complete sequence) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

113. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP041263 (Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R2) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

114. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP027511 (Enterococcus faecium strain AUSMDU00004055 plasmid unnamed5, complete sequence) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

115. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_LR135245 (Enterococcus faecium isolate E6988 plasmid 3) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

116. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_LR135256 (Enterococcus faecium isolate E7098 plasmid 3) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

117. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP038997 (Enterococcus faecium strain SRR24 plasmid pSRR24) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

118. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP019989 (Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

119. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_LR135490 (Enterococcus faecium isolate E8414 plasmid 3) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

120. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP044266 (Enterococcus faecium strain V1836 plasmid pHVH-V1836-2, complete sequence) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

121. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_LR134109 (Enterococcus faecium isolate E6043 plasmid 5) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

122. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP045014 (Enterococcus faecium strain LAC7.2 plasmid pII, complete sequence) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

123. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP040742 (Enterococcus faecium strain VRE1 plasmid pVRE1-VanA, complete sequence) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

124. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to MN831413 (Enterococcus faecium strain M17/0314 plasmid pM17/0314, complete sequence) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

125. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_AP022343 (Enterococcus faecium strain KUHS13 plasmid pELF2) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

126. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP041272 (Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S2) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

127. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP019994 (Enterococcus faecium isolate 2014-VREF-268 plasmid p268-2) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

128. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP035656 (Enterococcus faecium strain UAMSEF_09 plasmid unnamed2) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

129. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP035662 (Enterococcus faecium strain UAMSEF_20 plasmid unnamed2) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

130. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP039730 (Enterococcus faecium strain ZY2 plasmid pZY2) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

131. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP019971 (Enterococcus faecium isolate 2014-VREF-114 plasmid p114-1 sequence) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

132. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP012462 (Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p2) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

133. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_MG640601 (Enterococcus faecium strain SRR6 plasmid pEMSRR6, complete sequence) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

134. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to KX982260 (Alteromonas phage PB15, complete genome) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
atagagatgaaaaggcaaaaaggcggtaga	Protospacer
*************.*******. .* .* *

135. spacer 3.10|1347005|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP013040 (Clostridium perfringens strain JP838 plasmid pJFP838C, complete sequence) position: , mismatch: 7, identity: 0.767

acacttgatttagaaactttaaaagatgac	CRISPR spacer
ataactgatttagaacctttaaaagattta	Protospacer
*.* .********** ***********   

136. spacer 3.10|1347005|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP013041 (Clostridium perfringens strain JP55 plasmid pJFP55F, complete sequence) position: , mismatch: 7, identity: 0.767

acacttgatttagaaactttaaaagatgac	CRISPR spacer
ataactgatttagaacctttaaaagattta	Protospacer
*.* .********** ***********   

137. spacer 3.10|1347005|30|NC_017761|CRISPRCasFinder,CRT matches to MK416009 (Klebsiella phage ST11-OXA245phi3.1, complete genome) position: , mismatch: 7, identity: 0.767

acacttgatttagaaactttaaaagatgac	CRISPR spacer
aaaatttatttagaaactttaaaagagtta	Protospacer
* * ** *******************    

138. spacer 3.10|1347005|30|NC_017761|CRISPRCasFinder,CRT matches to MK422449 (Klebsiella phage ST512-KPC3phi13.2, complete genome) position: , mismatch: 7, identity: 0.767

acacttgatttagaaactttaaaagatgac	CRISPR spacer
aaaatttatttagaaactttaaaagagtta	Protospacer
* * ** *******************    

139. spacer 3.10|1347005|30|NC_017761|CRISPRCasFinder,CRT matches to MK422454 (Klebsiella phage ST340-VIM1phi10.2, complete genome) position: , mismatch: 7, identity: 0.767

acacttgatttagaaactttaaaagatgac	CRISPR spacer
aaaatttatttagaaactttaaaagagtta	Protospacer
* * ** *******************    

140. spacer 3.10|1347005|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP016898 (Acinetobacter soli strain GFJ2 plasmid pGFJ2, complete sequence) position: , mismatch: 7, identity: 0.767

acacttgatttagaaactttaaaagatgac	CRISPR spacer
aaaagtgatttagaaaatttaaaagattta	Protospacer
* *  *********** **********   

141. spacer 3.10|1347005|30|NC_017761|CRISPRCasFinder,CRT matches to MK416020 (Klebsiella phage ST11-VIM1phi8.4, complete genome) position: , mismatch: 7, identity: 0.767

acacttgatttagaaactttaaaagatgac	CRISPR spacer
aaaatttatttagaaactttaaaagagtta	Protospacer
* * ** *******************    

142. spacer 3.10|1347005|30|NC_017761|CRISPRCasFinder,CRT matches to MK433580 (Klebsiella phage ST11-OXA48phi15.3, complete genome) position: , mismatch: 7, identity: 0.767

acacttgatttagaaactttaaaagatgac	CRISPR spacer
aaaatttatttagaaactttaaaagagtta	Protospacer
* * ** *******************    

143. spacer 3.10|1347005|30|NC_017761|CRISPRCasFinder,CRT matches to MK433582 (Klebsiella phage ST258-KPC3phi16.2, complete genome) position: , mismatch: 7, identity: 0.767

acacttgatttagaaactttaaaagatgac	CRISPR spacer
aaaatttatttagaaactttaaaagagtta	Protospacer
* * ** *******************    

144. spacer 3.10|1347005|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP053657 (Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence) position: , mismatch: 7, identity: 0.767

acac-ttgatttagaaactttaaaagatgac	CRISPR spacer
-tacgttgatgtagaaactttaaaagctagt	Protospacer
 .** ***** *************** *...

145. spacer 3.10|1347005|30|NC_017761|CRISPRCasFinder,CRT matches to MH460460 (Dickeya phage vB_DsoM_JA13, complete genome) position: , mismatch: 7, identity: 0.767

acacttgatttagaaactttaaaagatgac	CRISPR spacer
agctttgatttcgaaactttcaaagatcgc	Protospacer
*  .******* ******** ****** .*

146. spacer 3.16|1346411|30|NC_017761|PILER-CR matches to NZ_CP007453 (Peptoclostridium acidaminophilum DSM 3953 strain al-2 plasmid EAL2_808p, complete sequence) position: , mismatch: 7, identity: 0.767

atgacaagtctatacccgtttttatactcg	CRISPR spacer
aagacaattctacacccgtttttattcgtc	Protospacer
* ***** ****.************ * . 

147. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to NC_009998 (Shewanella baltica OS195 plasmid pS19501, complete sequence) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
atagagatgaaacagctaaaaacttgtcga	Protospacer
************ *** *******  .  *

148. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to NZ_CP025427 (Enterococcus faecium strain SC4 plasmid p2, complete sequence) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

149. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to NZ_CP041263 (Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R2) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

150. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to NZ_CP027511 (Enterococcus faecium strain AUSMDU00004055 plasmid unnamed5, complete sequence) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

151. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to NZ_LR135245 (Enterococcus faecium isolate E6988 plasmid 3) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

152. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to NZ_LR135256 (Enterococcus faecium isolate E7098 plasmid 3) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

153. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to NZ_CP038997 (Enterococcus faecium strain SRR24 plasmid pSRR24) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

154. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to NZ_CP019989 (Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

155. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to NZ_LR135490 (Enterococcus faecium isolate E8414 plasmid 3) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

156. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to NZ_CP044266 (Enterococcus faecium strain V1836 plasmid pHVH-V1836-2, complete sequence) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

157. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to NZ_LR134109 (Enterococcus faecium isolate E6043 plasmid 5) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

158. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to NZ_CP045014 (Enterococcus faecium strain LAC7.2 plasmid pII, complete sequence) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

159. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to NZ_CP040742 (Enterococcus faecium strain VRE1 plasmid pVRE1-VanA, complete sequence) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

160. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to MN831413 (Enterococcus faecium strain M17/0314 plasmid pM17/0314, complete sequence) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

161. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to NZ_AP022343 (Enterococcus faecium strain KUHS13 plasmid pELF2) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

162. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to NZ_CP041272 (Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S2) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

163. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to NZ_CP019994 (Enterococcus faecium isolate 2014-VREF-268 plasmid p268-2) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

164. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to NZ_CP035656 (Enterococcus faecium strain UAMSEF_09 plasmid unnamed2) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

165. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to NZ_CP035662 (Enterococcus faecium strain UAMSEF_20 plasmid unnamed2) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

166. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to NZ_CP039730 (Enterococcus faecium strain ZY2 plasmid pZY2) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

167. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to NZ_CP019971 (Enterococcus faecium isolate 2014-VREF-114 plasmid p114-1 sequence) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

168. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to NZ_CP012462 (Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p2) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

169. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to NZ_MG640601 (Enterococcus faecium strain SRR6 plasmid pEMSRR6, complete sequence) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

170. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to KX982260 (Alteromonas phage PB15, complete genome) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
atagagatgaaaaggcaaaaaggcggtaga	Protospacer
*************.*******. .* .* *

171. spacer 3.21|1346742|30|NC_017761|PILER-CR matches to NZ_CP007453 (Peptoclostridium acidaminophilum DSM 3953 strain al-2 plasmid EAL2_808p, complete sequence) position: , mismatch: 7, identity: 0.767

atgacaagtctatacccgtttttatactcg	CRISPR spacer
aagacaattctacacccgtttttattcgtc	Protospacer
* ***** ****.************ * . 

172. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to NC_009998 (Shewanella baltica OS195 plasmid pS19501, complete sequence) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
atagagatgaaacagctaaaaacttgtcga	Protospacer
************ *** *******  .  *

173. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to NZ_CP025427 (Enterococcus faecium strain SC4 plasmid p2, complete sequence) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

174. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to NZ_CP041263 (Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R2) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

175. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to NZ_CP027511 (Enterococcus faecium strain AUSMDU00004055 plasmid unnamed5, complete sequence) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

176. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to NZ_LR135245 (Enterococcus faecium isolate E6988 plasmid 3) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

177. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to NZ_LR135256 (Enterococcus faecium isolate E7098 plasmid 3) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

178. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to NZ_CP038997 (Enterococcus faecium strain SRR24 plasmid pSRR24) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

179. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to NZ_CP019989 (Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

180. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to NZ_LR135490 (Enterococcus faecium isolate E8414 plasmid 3) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

181. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to NZ_CP044266 (Enterococcus faecium strain V1836 plasmid pHVH-V1836-2, complete sequence) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

182. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to NZ_LR134109 (Enterococcus faecium isolate E6043 plasmid 5) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

183. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to NZ_CP045014 (Enterococcus faecium strain LAC7.2 plasmid pII, complete sequence) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

184. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to NZ_CP040742 (Enterococcus faecium strain VRE1 plasmid pVRE1-VanA, complete sequence) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

185. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to MN831413 (Enterococcus faecium strain M17/0314 plasmid pM17/0314, complete sequence) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

186. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to NZ_AP022343 (Enterococcus faecium strain KUHS13 plasmid pELF2) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

187. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to NZ_CP041272 (Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S2) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

188. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to NZ_CP019994 (Enterococcus faecium isolate 2014-VREF-268 plasmid p268-2) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

189. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to NZ_CP035656 (Enterococcus faecium strain UAMSEF_09 plasmid unnamed2) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

190. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to NZ_CP035662 (Enterococcus faecium strain UAMSEF_20 plasmid unnamed2) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

191. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to NZ_CP039730 (Enterococcus faecium strain ZY2 plasmid pZY2) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

192. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to NZ_CP019971 (Enterococcus faecium isolate 2014-VREF-114 plasmid p114-1 sequence) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

193. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to NZ_CP012462 (Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p2) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

194. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to NZ_MG640601 (Enterococcus faecium strain SRR6 plasmid pEMSRR6, complete sequence) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca-	CRISPR spacer
taagagatgaaaaagcaaaatac-atcacgc	Protospacer
  ****************** ** ..***. 

195. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to KX982260 (Alteromonas phage PB15, complete genome) position: , mismatch: 7, identity: 0.767

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
atagagatgaaaaggcaaaaaggcggtaga	Protospacer
*************.*******. .* .* *

196. spacer 3.25|1347006|30|NC_017761|PILER-CR matches to NZ_CP013040 (Clostridium perfringens strain JP838 plasmid pJFP838C, complete sequence) position: , mismatch: 7, identity: 0.767

acacttgatttagaaactttaaaagatgac	CRISPR spacer
ataactgatttagaacctttaaaagattta	Protospacer
*.* .********** ***********   

197. spacer 3.25|1347006|30|NC_017761|PILER-CR matches to NZ_CP013041 (Clostridium perfringens strain JP55 plasmid pJFP55F, complete sequence) position: , mismatch: 7, identity: 0.767

acacttgatttagaaactttaaaagatgac	CRISPR spacer
ataactgatttagaacctttaaaagattta	Protospacer
*.* .********** ***********   

198. spacer 3.25|1347006|30|NC_017761|PILER-CR matches to MK416009 (Klebsiella phage ST11-OXA245phi3.1, complete genome) position: , mismatch: 7, identity: 0.767

acacttgatttagaaactttaaaagatgac	CRISPR spacer
aaaatttatttagaaactttaaaagagtta	Protospacer
* * ** *******************    

199. spacer 3.25|1347006|30|NC_017761|PILER-CR matches to MK422449 (Klebsiella phage ST512-KPC3phi13.2, complete genome) position: , mismatch: 7, identity: 0.767

acacttgatttagaaactttaaaagatgac	CRISPR spacer
aaaatttatttagaaactttaaaagagtta	Protospacer
* * ** *******************    

200. spacer 3.25|1347006|30|NC_017761|PILER-CR matches to MK422454 (Klebsiella phage ST340-VIM1phi10.2, complete genome) position: , mismatch: 7, identity: 0.767

acacttgatttagaaactttaaaagatgac	CRISPR spacer
aaaatttatttagaaactttaaaagagtta	Protospacer
* * ** *******************    

201. spacer 3.25|1347006|30|NC_017761|PILER-CR matches to NZ_CP016898 (Acinetobacter soli strain GFJ2 plasmid pGFJ2, complete sequence) position: , mismatch: 7, identity: 0.767

acacttgatttagaaactttaaaagatgac	CRISPR spacer
aaaagtgatttagaaaatttaaaagattta	Protospacer
* *  *********** **********   

202. spacer 3.25|1347006|30|NC_017761|PILER-CR matches to MK416020 (Klebsiella phage ST11-VIM1phi8.4, complete genome) position: , mismatch: 7, identity: 0.767

acacttgatttagaaactttaaaagatgac	CRISPR spacer
aaaatttatttagaaactttaaaagagtta	Protospacer
* * ** *******************    

203. spacer 3.25|1347006|30|NC_017761|PILER-CR matches to MK433580 (Klebsiella phage ST11-OXA48phi15.3, complete genome) position: , mismatch: 7, identity: 0.767

acacttgatttagaaactttaaaagatgac	CRISPR spacer
aaaatttatttagaaactttaaaagagtta	Protospacer
* * ** *******************    

204. spacer 3.25|1347006|30|NC_017761|PILER-CR matches to MK433582 (Klebsiella phage ST258-KPC3phi16.2, complete genome) position: , mismatch: 7, identity: 0.767

acacttgatttagaaactttaaaagatgac	CRISPR spacer
aaaatttatttagaaactttaaaagagtta	Protospacer
* * ** *******************    

205. spacer 3.25|1347006|30|NC_017761|PILER-CR matches to NZ_CP053657 (Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence) position: , mismatch: 7, identity: 0.767

acac-ttgatttagaaactttaaaagatgac	CRISPR spacer
-tacgttgatgtagaaactttaaaagctagt	Protospacer
 .** ***** *************** *...

206. spacer 3.25|1347006|30|NC_017761|PILER-CR matches to MH460460 (Dickeya phage vB_DsoM_JA13, complete genome) position: , mismatch: 7, identity: 0.767

acacttgatttagaaactttaaaagatgac	CRISPR spacer
agctttgatttcgaaactttcaaagatcgc	Protospacer
*  .******* ******** ****** .*

207. spacer 4.6|1749276|30|NC_017761|CRISPRCasFinder matches to MK250024 (Prevotella phage Lak-B5, complete genome) position: , mismatch: 7, identity: 0.767

taacctttgcttctgtccttgctatacttg	CRISPR spacer
tattatttgcttctgaccttgctatatatt	Protospacer
** . ********** **********. * 

208. spacer 4.6|1749276|30|NC_017761|CRISPRCasFinder matches to MK250028 (Prevotella phage Lak-B9, complete genome) position: , mismatch: 7, identity: 0.767

taacctttgcttctgtccttgctatacttg	CRISPR spacer
tattatttgcttctgaccttgctatatatt	Protospacer
** . ********** **********. * 

209. spacer 4.6|1749276|30|NC_017761|CRISPRCasFinder matches to MK250023 (Prevotella phage Lak-B4, complete genome) position: , mismatch: 7, identity: 0.767

taacctttgcttctgtccttgctatacttg	CRISPR spacer
tattatttgcttctgaccttgctatatatt	Protospacer
** . ********** **********. * 

210. spacer 4.6|1749276|30|NC_017761|CRISPRCasFinder matches to MK250025 (Prevotella phage Lak-B6, complete genome) position: , mismatch: 7, identity: 0.767

taacctttgcttctgtccttgctatacttg	CRISPR spacer
tattatttgcttctgaccttgctatatatt	Protospacer
** . ********** **********. * 

211. spacer 4.6|1749276|30|NC_017761|CRISPRCasFinder matches to MK250022 (Prevotella phage Lak-B3, complete genome) position: , mismatch: 7, identity: 0.767

taacctttgcttctgtccttgctatacttg	CRISPR spacer
tattatttgcttctgaccttgctatatatt	Protospacer
** . ********** **********. * 

212. spacer 4.6|1749276|30|NC_017761|CRISPRCasFinder matches to MK250027 (Prevotella phage Lak-B8, complete genome) position: , mismatch: 7, identity: 0.767

taacctttgcttctgtccttgctatacttg	CRISPR spacer
tattatttgcttctgaccttgctatatatt	Protospacer
** . ********** **********. * 

213. spacer 4.6|1749276|30|NC_017761|CRISPRCasFinder matches to MK250026 (Prevotella phage Lak-B7, complete genome) position: , mismatch: 7, identity: 0.767

taacctttgcttctgtccttgctatacttg	CRISPR spacer
tattatttgcttctgaccttgctatatatt	Protospacer
** . ********** **********. * 

214. spacer 4.6|1749276|30|NC_017761|CRISPRCasFinder matches to MK250020 (Prevotella phage Lak-B1, complete genome) position: , mismatch: 7, identity: 0.767

taacctttgcttctgtccttgctatacttg	CRISPR spacer
tattatttgcttctgaccttgctatatatt	Protospacer
** . ********** **********. * 

215. spacer 4.7|1749342|30|NC_017761|CRISPRCasFinder matches to MK250024 (Prevotella phage Lak-B5, complete genome) position: , mismatch: 7, identity: 0.767

taacctttgcttctgtccttgctatacttg	CRISPR spacer
tattatttgcttctgaccttgctatatatt	Protospacer
** . ********** **********. * 

216. spacer 4.7|1749342|30|NC_017761|CRISPRCasFinder matches to MK250028 (Prevotella phage Lak-B9, complete genome) position: , mismatch: 7, identity: 0.767

taacctttgcttctgtccttgctatacttg	CRISPR spacer
tattatttgcttctgaccttgctatatatt	Protospacer
** . ********** **********. * 

217. spacer 4.7|1749342|30|NC_017761|CRISPRCasFinder matches to MK250023 (Prevotella phage Lak-B4, complete genome) position: , mismatch: 7, identity: 0.767

taacctttgcttctgtccttgctatacttg	CRISPR spacer
tattatttgcttctgaccttgctatatatt	Protospacer
** . ********** **********. * 

218. spacer 4.7|1749342|30|NC_017761|CRISPRCasFinder matches to MK250025 (Prevotella phage Lak-B6, complete genome) position: , mismatch: 7, identity: 0.767

taacctttgcttctgtccttgctatacttg	CRISPR spacer
tattatttgcttctgaccttgctatatatt	Protospacer
** . ********** **********. * 

219. spacer 4.7|1749342|30|NC_017761|CRISPRCasFinder matches to MK250022 (Prevotella phage Lak-B3, complete genome) position: , mismatch: 7, identity: 0.767

taacctttgcttctgtccttgctatacttg	CRISPR spacer
tattatttgcttctgaccttgctatatatt	Protospacer
** . ********** **********. * 

220. spacer 4.7|1749342|30|NC_017761|CRISPRCasFinder matches to MK250027 (Prevotella phage Lak-B8, complete genome) position: , mismatch: 7, identity: 0.767

taacctttgcttctgtccttgctatacttg	CRISPR spacer
tattatttgcttctgaccttgctatatatt	Protospacer
** . ********** **********. * 

221. spacer 4.7|1749342|30|NC_017761|CRISPRCasFinder matches to MK250026 (Prevotella phage Lak-B7, complete genome) position: , mismatch: 7, identity: 0.767

taacctttgcttctgtccttgctatacttg	CRISPR spacer
tattatttgcttctgaccttgctatatatt	Protospacer
** . ********** **********. * 

222. spacer 4.7|1749342|30|NC_017761|CRISPRCasFinder matches to MK250020 (Prevotella phage Lak-B1, complete genome) position: , mismatch: 7, identity: 0.767

taacctttgcttctgtccttgctatacttg	CRISPR spacer
tattatttgcttctgaccttgctatatatt	Protospacer
** . ********** **********. * 

223. spacer 4.9|1749278|28|NC_017761|PILER-CR matches to MK250024 (Prevotella phage Lak-B5, complete genome) position: , mismatch: 7, identity: 0.75

acctttgcttctgtccttgctatacttg	CRISPR spacer
ttatttgcttctgaccttgctatatatt	Protospacer
 . ********** **********. * 

224. spacer 4.9|1749278|28|NC_017761|PILER-CR matches to MK250028 (Prevotella phage Lak-B9, complete genome) position: , mismatch: 7, identity: 0.75

acctttgcttctgtccttgctatacttg	CRISPR spacer
ttatttgcttctgaccttgctatatatt	Protospacer
 . ********** **********. * 

225. spacer 4.9|1749278|28|NC_017761|PILER-CR matches to MK250023 (Prevotella phage Lak-B4, complete genome) position: , mismatch: 7, identity: 0.75

acctttgcttctgtccttgctatacttg	CRISPR spacer
ttatttgcttctgaccttgctatatatt	Protospacer
 . ********** **********. * 

226. spacer 4.9|1749278|28|NC_017761|PILER-CR matches to MK250025 (Prevotella phage Lak-B6, complete genome) position: , mismatch: 7, identity: 0.75

acctttgcttctgtccttgctatacttg	CRISPR spacer
ttatttgcttctgaccttgctatatatt	Protospacer
 . ********** **********. * 

227. spacer 4.9|1749278|28|NC_017761|PILER-CR matches to MK250022 (Prevotella phage Lak-B3, complete genome) position: , mismatch: 7, identity: 0.75

acctttgcttctgtccttgctatacttg	CRISPR spacer
ttatttgcttctgaccttgctatatatt	Protospacer
 . ********** **********. * 

228. spacer 4.9|1749278|28|NC_017761|PILER-CR matches to MK250027 (Prevotella phage Lak-B8, complete genome) position: , mismatch: 7, identity: 0.75

acctttgcttctgtccttgctatacttg	CRISPR spacer
ttatttgcttctgaccttgctatatatt	Protospacer
 . ********** **********. * 

229. spacer 4.9|1749278|28|NC_017761|PILER-CR matches to MK250026 (Prevotella phage Lak-B7, complete genome) position: , mismatch: 7, identity: 0.75

acctttgcttctgtccttgctatacttg	CRISPR spacer
ttatttgcttctgaccttgctatatatt	Protospacer
 . ********** **********. * 

230. spacer 4.9|1749278|28|NC_017761|PILER-CR matches to MK250020 (Prevotella phage Lak-B1, complete genome) position: , mismatch: 7, identity: 0.75

acctttgcttctgtccttgctatacttg	CRISPR spacer
ttatttgcttctgaccttgctatatatt	Protospacer
 . ********** **********. * 

231. spacer 4.10|1749344|28|NC_017761|PILER-CR matches to MK250024 (Prevotella phage Lak-B5, complete genome) position: , mismatch: 7, identity: 0.75

acctttgcttctgtccttgctatacttg	CRISPR spacer
ttatttgcttctgaccttgctatatatt	Protospacer
 . ********** **********. * 

232. spacer 4.10|1749344|28|NC_017761|PILER-CR matches to MK250028 (Prevotella phage Lak-B9, complete genome) position: , mismatch: 7, identity: 0.75

acctttgcttctgtccttgctatacttg	CRISPR spacer
ttatttgcttctgaccttgctatatatt	Protospacer
 . ********** **********. * 

233. spacer 4.10|1749344|28|NC_017761|PILER-CR matches to MK250023 (Prevotella phage Lak-B4, complete genome) position: , mismatch: 7, identity: 0.75

acctttgcttctgtccttgctatacttg	CRISPR spacer
ttatttgcttctgaccttgctatatatt	Protospacer
 . ********** **********. * 

234. spacer 4.10|1749344|28|NC_017761|PILER-CR matches to MK250025 (Prevotella phage Lak-B6, complete genome) position: , mismatch: 7, identity: 0.75

acctttgcttctgtccttgctatacttg	CRISPR spacer
ttatttgcttctgaccttgctatatatt	Protospacer
 . ********** **********. * 

235. spacer 4.10|1749344|28|NC_017761|PILER-CR matches to MK250022 (Prevotella phage Lak-B3, complete genome) position: , mismatch: 7, identity: 0.75

acctttgcttctgtccttgctatacttg	CRISPR spacer
ttatttgcttctgaccttgctatatatt	Protospacer
 . ********** **********. * 

236. spacer 4.10|1749344|28|NC_017761|PILER-CR matches to MK250027 (Prevotella phage Lak-B8, complete genome) position: , mismatch: 7, identity: 0.75

acctttgcttctgtccttgctatacttg	CRISPR spacer
ttatttgcttctgaccttgctatatatt	Protospacer
 . ********** **********. * 

237. spacer 4.10|1749344|28|NC_017761|PILER-CR matches to MK250026 (Prevotella phage Lak-B7, complete genome) position: , mismatch: 7, identity: 0.75

acctttgcttctgtccttgctatacttg	CRISPR spacer
ttatttgcttctgaccttgctatatatt	Protospacer
 . ********** **********. * 

238. spacer 4.10|1749344|28|NC_017761|PILER-CR matches to MK250020 (Prevotella phage Lak-B1, complete genome) position: , mismatch: 7, identity: 0.75

acctttgcttctgtccttgctatacttg	CRISPR spacer
ttatttgcttctgaccttgctatatatt	Protospacer
 . ********** **********. * 

239. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 8, identity: 0.733

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
atagagatgaaaaagacaaaaacaaaagta	Protospacer
***************  ****** .  ..*

240. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to MN693415 (Marine virus AFVG_25M102, complete genome) position: , mismatch: 8, identity: 0.733

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
caatgaatgaaaaagcaaagaactcccacc	Protospacer
  * ..*************.**** **** 

241. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to MK448348 (Streptococcus satellite phage Javan175, complete genome) position: , mismatch: 8, identity: 0.733

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
tgattgcagaaaaagctaaaaactgccact	Protospacer
  *  *  ******** ************ 

242. spacer 3.5|1346675|30|NC_017761|CRISPRCasFinder,CRT matches to MG592671 (Vibrio phage 2.275.O._10N.286.54.E11, partial genome) position: , mismatch: 8, identity: 0.733

tggaatactcgctatagagatgaggatctt	CRISPR spacer
tacaatactcgctatagagaagaagaaaca	Protospacer
*. ***************** **.**  . 

243. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 8, identity: 0.733

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
atagagatgaaaaagacaaaaacaaaagta	Protospacer
***************  ****** .  ..*

244. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to MN693415 (Marine virus AFVG_25M102, complete genome) position: , mismatch: 8, identity: 0.733

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
caatgaatgaaaaagcaaagaactcccacc	Protospacer
  * ..*************.**** **** 

245. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to MK448348 (Streptococcus satellite phage Javan175, complete genome) position: , mismatch: 8, identity: 0.733

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
tgattgcagaaaaagctaaaaactgccact	Protospacer
  *  *  ******** ************ 

246. spacer 3.10|1347005|30|NC_017761|CRISPRCasFinder,CRT matches to CP016714 (Lactococcus lactis subsp. lactis strain UC77 plasmid pUC77B, complete sequence) position: , mismatch: 8, identity: 0.733

acacttgatttagaaactttaaaagatgac	CRISPR spacer
aaaaatgatttggaaactttaaaagagatt	Protospacer
* *  ******.************** . .

247. spacer 3.10|1347005|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP016694 (Lactococcus lactis subsp. lactis strain 229 plasmid p229A, complete sequence) position: , mismatch: 8, identity: 0.733

acacttgatttagaaactttaaaagatgac	CRISPR spacer
aaaaatgatttggaaactttaaaagagatt	Protospacer
* *  ******.************** . .

248. spacer 3.10|1347005|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP016701 (Lactococcus lactis subsp. lactis strain 275 plasmid p275C, complete sequence) position: , mismatch: 8, identity: 0.733

acacttgatttagaaactttaaaagatgac	CRISPR spacer
aaaaatgatttggaaactttaaaagagatt	Protospacer
* *  ******.************** . .

249. spacer 3.10|1347005|30|NC_017761|CRISPRCasFinder,CRT matches to AP014341 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S37-C76, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 8, identity: 0.733

acacttgatttagaaactttaaaagatgac	CRISPR spacer
caagaagatttagaatttttaaaagatgaa	Protospacer
  *   ********* .************ 

250. spacer 3.10|1347005|30|NC_017761|CRISPRCasFinder,CRT matches to MF417947 (Uncultured Caudovirales phage clone 3F_8, partial genome) position: , mismatch: 8, identity: 0.733

acacttgatttagaaactttaaaagatgac	CRISPR spacer
ggaacggacttagaaactttaaaagaagaa	Protospacer
. * . **.***************** ** 

251. spacer 3.10|1347005|30|NC_017761|CRISPRCasFinder,CRT matches to NC_010901 (Lactococcus lactis plasmid pNP40, complete sequence) position: , mismatch: 8, identity: 0.733

acacttgatttagaaactttaaaagatgac	CRISPR spacer
aaaaatgatttggaaactttaaaagagatt	Protospacer
* *  ******.************** . .

252. spacer 3.10|1347005|30|NC_017761|CRISPRCasFinder,CRT matches to NC_010183 (Bacillus mycoides KBAB4 plasmid pBWB404, complete sequence) position: , mismatch: 8, identity: 0.733

acacttgatttagaaactttaaaagatgac	CRISPR spacer
ggaacagatttagaaacgttaaaagaagaa	Protospacer
. * . *********** ******** ** 

253. spacer 3.10|1347005|30|NC_017761|CRISPRCasFinder,CRT matches to NC_015862 (Lactococcus lactis subsp. lactis plasmid pIL4, complete sequence) position: , mismatch: 8, identity: 0.733

acacttgatttagaaactttaaaagatgac	CRISPR spacer
aaaaatgatttggaaactttaaaagagatt	Protospacer
* *  ******.************** . .

254. spacer 3.10|1347005|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP010090 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB426, complete sequence) position: , mismatch: 8, identity: 0.733

acacttgatttagaaactttaaaagatgac	CRISPR spacer
ggaacagatttagaaacgttaaaagaagaa	Protospacer
. * . *********** ******** ** 

255. spacer 3.12|1347137|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP010112 (Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-6, complete sequence) position: , mismatch: 8, identity: 0.733

aagagcattttacaagcaatattatgtaga	CRISPR spacer
ctattcattttccaagcaatattatatagg	Protospacer
  .  ****** *************.***.

256. spacer 3.12|1347137|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP016589 (Bacillus thuringiensis strain KNU-07 plasmid pBTKNU07-01, complete sequence) position: , mismatch: 8, identity: 0.733

aagagcattttacaagcaatattatgtaga	CRISPR spacer
aattttattttacaagaaatattatgttat	Protospacer
**   .********** ********** . 

257. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 8, identity: 0.733

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
atagagatgaaaaagacaaaaacaaaagta	Protospacer
***************  ****** .  ..*

258. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to MN693415 (Marine virus AFVG_25M102, complete genome) position: , mismatch: 8, identity: 0.733

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
caatgaatgaaaaagcaaagaactcccacc	Protospacer
  * ..*************.**** **** 

259. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to MK448348 (Streptococcus satellite phage Javan175, complete genome) position: , mismatch: 8, identity: 0.733

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
tgattgcagaaaaagctaaaaactgccact	Protospacer
  *  *  ******** ************ 

260. spacer 3.20|1346676|30|NC_017761|PILER-CR matches to MG592671 (Vibrio phage 2.275.O._10N.286.54.E11, partial genome) position: , mismatch: 8, identity: 0.733

tggaatactcgctatagagatgaggatctt	CRISPR spacer
tacaatactcgctatagagaagaagaaaca	Protospacer
*. ***************** **.**  . 

261. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 8, identity: 0.733

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
atagagatgaaaaagacaaaaacaaaagta	Protospacer
***************  ****** .  ..*

262. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to MN693415 (Marine virus AFVG_25M102, complete genome) position: , mismatch: 8, identity: 0.733

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
caatgaatgaaaaagcaaagaactcccacc	Protospacer
  * ..*************.**** **** 

263. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to MK448348 (Streptococcus satellite phage Javan175, complete genome) position: , mismatch: 8, identity: 0.733

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
tgattgcagaaaaagctaaaaactgccact	Protospacer
  *  *  ******** ************ 

264. spacer 3.25|1347006|30|NC_017761|PILER-CR matches to CP016714 (Lactococcus lactis subsp. lactis strain UC77 plasmid pUC77B, complete sequence) position: , mismatch: 8, identity: 0.733

acacttgatttagaaactttaaaagatgac	CRISPR spacer
aaaaatgatttggaaactttaaaagagatt	Protospacer
* *  ******.************** . .

265. spacer 3.25|1347006|30|NC_017761|PILER-CR matches to NZ_CP016694 (Lactococcus lactis subsp. lactis strain 229 plasmid p229A, complete sequence) position: , mismatch: 8, identity: 0.733

acacttgatttagaaactttaaaagatgac	CRISPR spacer
aaaaatgatttggaaactttaaaagagatt	Protospacer
* *  ******.************** . .

266. spacer 3.25|1347006|30|NC_017761|PILER-CR matches to NZ_CP016701 (Lactococcus lactis subsp. lactis strain 275 plasmid p275C, complete sequence) position: , mismatch: 8, identity: 0.733

acacttgatttagaaactttaaaagatgac	CRISPR spacer
aaaaatgatttggaaactttaaaagagatt	Protospacer
* *  ******.************** . .

267. spacer 3.25|1347006|30|NC_017761|PILER-CR matches to AP014341 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S37-C76, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 8, identity: 0.733

acacttgatttagaaactttaaaagatgac	CRISPR spacer
caagaagatttagaatttttaaaagatgaa	Protospacer
  *   ********* .************ 

268. spacer 3.25|1347006|30|NC_017761|PILER-CR matches to MF417947 (Uncultured Caudovirales phage clone 3F_8, partial genome) position: , mismatch: 8, identity: 0.733

acacttgatttagaaactttaaaagatgac	CRISPR spacer
ggaacggacttagaaactttaaaagaagaa	Protospacer
. * . **.***************** ** 

269. spacer 3.25|1347006|30|NC_017761|PILER-CR matches to NC_010901 (Lactococcus lactis plasmid pNP40, complete sequence) position: , mismatch: 8, identity: 0.733

acacttgatttagaaactttaaaagatgac	CRISPR spacer
aaaaatgatttggaaactttaaaagagatt	Protospacer
* *  ******.************** . .

270. spacer 3.25|1347006|30|NC_017761|PILER-CR matches to NC_010183 (Bacillus mycoides KBAB4 plasmid pBWB404, complete sequence) position: , mismatch: 8, identity: 0.733

acacttgatttagaaactttaaaagatgac	CRISPR spacer
ggaacagatttagaaacgttaaaagaagaa	Protospacer
. * . *********** ******** ** 

271. spacer 3.25|1347006|30|NC_017761|PILER-CR matches to NC_015862 (Lactococcus lactis subsp. lactis plasmid pIL4, complete sequence) position: , mismatch: 8, identity: 0.733

acacttgatttagaaactttaaaagatgac	CRISPR spacer
aaaaatgatttggaaactttaaaagagatt	Protospacer
* *  ******.************** . .

272. spacer 3.25|1347006|30|NC_017761|PILER-CR matches to NZ_CP010090 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB426, complete sequence) position: , mismatch: 8, identity: 0.733

acacttgatttagaaactttaaaagatgac	CRISPR spacer
ggaacagatttagaaacgttaaaagaagaa	Protospacer
. * . *********** ******** ** 

273. spacer 4.4|1749144|30|NC_017761|CRISPRCasFinder matches to MH617026 (Microviridae sp. isolate ctcj618, complete genome) position: , mismatch: 8, identity: 0.733

agagaagaaacagcaagctaattaatcaaa	CRISPR spacer
cttgcagaaaaagcaagctaataaatcact	Protospacer
   * ***** *********** *****  

274. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to NC_007336 (Cupriavidus pinatubonensis JMP134 megaplasmid, complete sequence) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
tagaagatgagaaagcaaaagactgccctt	Protospacer
  ..******.*********.****** . 

275. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019062 (Synechococcus phage ACG-2014d isolate Syn7803C93, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

276. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019121 (Synechococcus phage ACG-2014d isolate Syn7803US78, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

277. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019126 (Synechococcus phage ACG-2014d isolate Syn7803US83, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

278. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019047 (Synechococcus phage ACG-2014d isolate Syn7803C73, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

279. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019072 (Synechococcus phage ACG-2014d isolate Syn7803US108, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

280. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019032 (Synechococcus phage ACG-2014d isolate Syn7803C49, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

281. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019078 (Synechococcus phage ACG-2014d isolate Syn7803US114, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

282. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019165 (Synechococcus phage ACG-2014d isolate Syn7803C40, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

283. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019124 (Synechococcus phage ACG-2014d isolate Syn7803US80, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

284. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019074 (Synechococcus phage ACG-2014d isolate Syn7803US110, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

285. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019034 (Synechococcus phage ACG-2014d isolate Syn7803C54, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

286. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019127 (Synechococcus phage ACG-2014d isolate Syn7803US85, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

287. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019118 (Synechococcus phage ACG-2014d isolate Syn7803US64, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

288. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019075 (Synechococcus phage ACG-2014d isolate Syn7803US111, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

289. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019131 (Synechococcus phage ACG-2014d isolate Syn7803US95, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

290. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019057 (Synechococcus phage ACG-2014d isolate Syn7803C89, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

291. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019056 (Synechococcus phage ACG-2014d isolate Syn7803C88, partial genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

292. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019160 (Synechococcus phage ACG-2014d isolate Syn7803C35, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

293. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019112 (Synechococcus phage ACG-2014d isolate Syn7803US59, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

294. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019073 (Synechococcus phage ACG-2014d isolate Syn7803US109, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

295. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019077 (Synechococcus phage ACG-2014d isolate Syn7803US113, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

296. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019129 (Synechococcus phage ACG-2014d isolate Syn7803US89, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

297. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019031 (Synechococcus phage ACG-2014d isolate Syn7803C48, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

298. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019079 (Synechococcus phage ACG-2014d isolate Syn7803US115, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

299. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019035 (Synechococcus phage ACG-2014d isolate Syn7803C55, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

300. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019120 (Synechococcus phage ACG-2014d isolate Syn7803US71, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

301. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019036 (Synechococcus phage ACG-2014d isolate Syn7803C57, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

302. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019048 (Synechococcus phage ACG-2014d isolate Syn7803C75, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

303. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019113 (Synechococcus phage ACG-2014d isolate Syn7803US5, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

304. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019140 (Synechococcus phage ACG-2014d isolate Syn7803C109, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

305. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019119 (Synechococcus phage ACG-2014d isolate Syn7803US65, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

306. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019162 (Synechococcus phage ACG-2014d isolate Syn7803C37, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

307. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019130 (Synechococcus phage ACG-2014d isolate Syn7803US94, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

308. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019115 (Synechococcus phage ACG-2014d isolate Syn7803US61, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

309. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019139 (Synechococcus phage ACG-2014d isolate Syn7803C108, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

310. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019125 (Synechococcus phage ACG-2014d isolate Syn7803US82, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

311. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019070 (Synechococcus phage ACG-2014d isolate Syn7803US104, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

312. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019028 (Synechococcus phage ACG-2014d isolate Syn7803C45, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

313. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019083 (Synechococcus phage ACG-2014d isolate Syn7803US122, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

314. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019164 (Synechococcus phage ACG-2014d isolate Syn7803C39, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

315. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019117 (Synechococcus phage ACG-2014d isolate Syn7803US63, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

316. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019046 (Synechococcus phage ACG-2014d isolate Syn7803C72, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

317. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019050 (Synechococcus phage ACG-2014d isolate Syn7803C77, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

318. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019029 (Synechococcus phage ACG-2014d isolate Syn7803C46, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

319. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019080 (Synechococcus phage ACG-2014d isolate Syn7803US116, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

320. spacer 3.2|1346476|30|NC_017761|CRISPRCasFinder,CRT matches to NC_026923 (Synechococcus phage ACG-2014d isolate Syn7803C102, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

321. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to NC_007336 (Cupriavidus pinatubonensis JMP134 megaplasmid, complete sequence) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
tagaagatgagaaagcaaaagactgccctt	Protospacer
  ..******.*********.****** . 

322. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019062 (Synechococcus phage ACG-2014d isolate Syn7803C93, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

323. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019121 (Synechococcus phage ACG-2014d isolate Syn7803US78, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

324. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019126 (Synechococcus phage ACG-2014d isolate Syn7803US83, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

325. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019047 (Synechococcus phage ACG-2014d isolate Syn7803C73, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

326. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019072 (Synechococcus phage ACG-2014d isolate Syn7803US108, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

327. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019032 (Synechococcus phage ACG-2014d isolate Syn7803C49, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

328. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019078 (Synechococcus phage ACG-2014d isolate Syn7803US114, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

329. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019165 (Synechococcus phage ACG-2014d isolate Syn7803C40, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

330. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019124 (Synechococcus phage ACG-2014d isolate Syn7803US80, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

331. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019074 (Synechococcus phage ACG-2014d isolate Syn7803US110, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

332. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019034 (Synechococcus phage ACG-2014d isolate Syn7803C54, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

333. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019127 (Synechococcus phage ACG-2014d isolate Syn7803US85, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

334. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019118 (Synechococcus phage ACG-2014d isolate Syn7803US64, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

335. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019075 (Synechococcus phage ACG-2014d isolate Syn7803US111, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

336. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019131 (Synechococcus phage ACG-2014d isolate Syn7803US95, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

337. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019057 (Synechococcus phage ACG-2014d isolate Syn7803C89, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

338. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019056 (Synechococcus phage ACG-2014d isolate Syn7803C88, partial genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

339. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019160 (Synechococcus phage ACG-2014d isolate Syn7803C35, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

340. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019112 (Synechococcus phage ACG-2014d isolate Syn7803US59, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

341. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019073 (Synechococcus phage ACG-2014d isolate Syn7803US109, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

342. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019077 (Synechococcus phage ACG-2014d isolate Syn7803US113, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

343. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019129 (Synechococcus phage ACG-2014d isolate Syn7803US89, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

344. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019031 (Synechococcus phage ACG-2014d isolate Syn7803C48, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

345. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019079 (Synechococcus phage ACG-2014d isolate Syn7803US115, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

346. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019035 (Synechococcus phage ACG-2014d isolate Syn7803C55, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

347. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019120 (Synechococcus phage ACG-2014d isolate Syn7803US71, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

348. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019036 (Synechococcus phage ACG-2014d isolate Syn7803C57, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

349. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019048 (Synechococcus phage ACG-2014d isolate Syn7803C75, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

350. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019113 (Synechococcus phage ACG-2014d isolate Syn7803US5, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

351. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019140 (Synechococcus phage ACG-2014d isolate Syn7803C109, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

352. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019119 (Synechococcus phage ACG-2014d isolate Syn7803US65, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

353. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019162 (Synechococcus phage ACG-2014d isolate Syn7803C37, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

354. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019130 (Synechococcus phage ACG-2014d isolate Syn7803US94, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

355. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019115 (Synechococcus phage ACG-2014d isolate Syn7803US61, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

356. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019139 (Synechococcus phage ACG-2014d isolate Syn7803C108, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

357. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019125 (Synechococcus phage ACG-2014d isolate Syn7803US82, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

358. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019070 (Synechococcus phage ACG-2014d isolate Syn7803US104, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

359. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019028 (Synechococcus phage ACG-2014d isolate Syn7803C45, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

360. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019083 (Synechococcus phage ACG-2014d isolate Syn7803US122, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

361. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019164 (Synechococcus phage ACG-2014d isolate Syn7803C39, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

362. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019117 (Synechococcus phage ACG-2014d isolate Syn7803US63, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

363. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019046 (Synechococcus phage ACG-2014d isolate Syn7803C72, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

364. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019050 (Synechococcus phage ACG-2014d isolate Syn7803C77, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

365. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019029 (Synechococcus phage ACG-2014d isolate Syn7803C46, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

366. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to KJ019080 (Synechococcus phage ACG-2014d isolate Syn7803US116, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

367. spacer 3.7|1346807|30|NC_017761|CRISPRCasFinder,CRT matches to NC_026923 (Synechococcus phage ACG-2014d isolate Syn7803C102, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

368. spacer 3.8|1346873|30|NC_017761|CRISPRCasFinder,CRT matches to MN694154 (Marine virus AFVG_250M77, complete genome) position: , mismatch: 9, identity: 0.7

tctagcacaatttaacaagtttaaccgcaa	CRISPR spacer
aatagcacaatttaaaaagtttactcaagc	Protospacer
  ************* ******* .*. . 

369. spacer 3.10|1347005|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP047629 (Lactococcus raffinolactis strain Lr_19_14 plasmid pLraf_19_14_1, complete sequence) position: , mismatch: 9, identity: 0.7

acacttgatttagaaactttaaaagatgac	CRISPR spacer
gatgatgattttgaaactttaaaagataca	Protospacer
.    ****** ***************.  

370. spacer 3.10|1347005|30|NC_017761|CRISPRCasFinder,CRT matches to MN693010 (Marine virus AFVG_117M73, complete genome) position: , mismatch: 9, identity: 0.7

acacttgatttagaaactttaaaagatgac	CRISPR spacer
ttggaagatatagaaactttaaaagataaa	Protospacer
 ..   *** *****************.* 

371. spacer 3.10|1347005|30|NC_017761|CRISPRCasFinder,CRT matches to BK010471 (TPA_asm: Uncultured crAssphage, complete genome) position: , mismatch: 9, identity: 0.7

acacttgatttagaaactttaaaagatgac	CRISPR spacer
caaactgatttagaaattttaaaagaatca	Protospacer
  * .***********.*********    

372. spacer 3.10|1347005|30|NC_017761|CRISPRCasFinder,CRT matches to NC_024711 (Uncultured crAssphage, complete genome) position: , mismatch: 9, identity: 0.7

acacttgatttagaaactttaaaagatgac	CRISPR spacer
caaactgatttagaaattttaaaagaatca	Protospacer
  * .***********.*********    

373. spacer 3.10|1347005|30|NC_017761|CRISPRCasFinder,CRT matches to JQ995537 (Uncultured phage crAssphage, complete genome) position: , mismatch: 9, identity: 0.7

acacttgatttagaaactttaaaagatgac	CRISPR spacer
caaactgatttagaaattttaaaagaatca	Protospacer
  * .***********.*********    

374. spacer 3.10|1347005|30|NC_017761|CRISPRCasFinder,CRT matches to MK415410 (CrAssphage YS1-2_2437, complete genome) position: , mismatch: 9, identity: 0.7

acacttgatttagaaactttaaaagatgac	CRISPR spacer
caaactgatttagaaattttaaaagaatca	Protospacer
  * .***********.*********    

375. spacer 3.10|1347005|30|NC_017761|CRISPRCasFinder,CRT matches to MK415408 (CrAssphage GF1-2_000079F, complete genome) position: , mismatch: 9, identity: 0.7

acacttgatttagaaactttaaaagatgac	CRISPR spacer
caaactgatttagaaattttaaaagaatca	Protospacer
  * .***********.*********    

376. spacer 3.10|1347005|30|NC_017761|CRISPRCasFinder,CRT matches to MN694652 (Marine virus AFVG_250M647, complete genome) position: , mismatch: 9, identity: 0.7

acacttgatttagaaactttaaaagatgac	CRISPR spacer
ttggaagatatagaaactttaaaagataaa	Protospacer
 ..   *** *****************.* 

377. spacer 3.12|1347137|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP029455 (Bacillus cereus strain FORC087 plasmid pFORC087.1, complete sequence) position: , mismatch: 9, identity: 0.7

aagagcattttacaagcaatattatgtaga	CRISPR spacer
ctattcatttttcaagcaatattatatatg	Protospacer
  .  ****** *************.** .

378. spacer 3.12|1347137|30|NC_017761|CRISPRCasFinder,CRT matches to CP024686 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-2-313K, complete sequence) position: , mismatch: 9, identity: 0.7

aagagcattttacaagcaatattatgtaga	CRISPR spacer
ctattcattttccaagcaatattatatatg	Protospacer
  .  ****** *************.** .

379. spacer 3.12|1347137|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP045608 (Bacillus cereus strain SB1 plasmid p2, complete sequence) position: , mismatch: 9, identity: 0.7

aagagcattttacaagcaatattatgtaga	CRISPR spacer
ctattcattttccaagcaatattatatatg	Protospacer
  .  ****** *************.** .

380. spacer 3.12|1347137|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP012100 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-1, complete sequence) position: , mismatch: 9, identity: 0.7

aagagcattttacaagcaatattatgtaga	CRISPR spacer
ctattcattttccaagcaatattatatatg	Protospacer
  .  ****** *************.** .

381. spacer 3.12|1347137|30|NC_017761|CRISPRCasFinder,CRT matches to NZ_CP016596 (Bacillus cereus strain K8 plasmid pBCM301, complete sequence) position: , mismatch: 9, identity: 0.7

aagagcattttacaagcaatattatgtaga	CRISPR spacer
ctattcattttccaagcaatattatatatg	Protospacer
  .  ****** *************.** .

382. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to NC_007336 (Cupriavidus pinatubonensis JMP134 megaplasmid, complete sequence) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
tagaagatgagaaagcaaaagactgccctt	Protospacer
  ..******.*********.****** . 

383. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to KJ019062 (Synechococcus phage ACG-2014d isolate Syn7803C93, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

384. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to KJ019121 (Synechococcus phage ACG-2014d isolate Syn7803US78, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

385. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to KJ019126 (Synechococcus phage ACG-2014d isolate Syn7803US83, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

386. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to KJ019047 (Synechococcus phage ACG-2014d isolate Syn7803C73, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

387. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to KJ019072 (Synechococcus phage ACG-2014d isolate Syn7803US108, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

388. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to KJ019032 (Synechococcus phage ACG-2014d isolate Syn7803C49, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

389. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to KJ019078 (Synechococcus phage ACG-2014d isolate Syn7803US114, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

390. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to KJ019165 (Synechococcus phage ACG-2014d isolate Syn7803C40, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

391. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to KJ019124 (Synechococcus phage ACG-2014d isolate Syn7803US80, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

392. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to KJ019074 (Synechococcus phage ACG-2014d isolate Syn7803US110, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

393. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to KJ019034 (Synechococcus phage ACG-2014d isolate Syn7803C54, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

394. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to KJ019127 (Synechococcus phage ACG-2014d isolate Syn7803US85, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

395. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to KJ019118 (Synechococcus phage ACG-2014d isolate Syn7803US64, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

396. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to KJ019075 (Synechococcus phage ACG-2014d isolate Syn7803US111, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

397. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to KJ019131 (Synechococcus phage ACG-2014d isolate Syn7803US95, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

398. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to KJ019057 (Synechococcus phage ACG-2014d isolate Syn7803C89, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

399. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to KJ019056 (Synechococcus phage ACG-2014d isolate Syn7803C88, partial genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

400. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to KJ019160 (Synechococcus phage ACG-2014d isolate Syn7803C35, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

401. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to KJ019112 (Synechococcus phage ACG-2014d isolate Syn7803US59, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

402. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to KJ019073 (Synechococcus phage ACG-2014d isolate Syn7803US109, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

403. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to KJ019077 (Synechococcus phage ACG-2014d isolate Syn7803US113, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

404. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to KJ019129 (Synechococcus phage ACG-2014d isolate Syn7803US89, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

405. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to KJ019031 (Synechococcus phage ACG-2014d isolate Syn7803C48, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

406. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to KJ019079 (Synechococcus phage ACG-2014d isolate Syn7803US115, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

407. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to KJ019035 (Synechococcus phage ACG-2014d isolate Syn7803C55, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

408. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to KJ019120 (Synechococcus phage ACG-2014d isolate Syn7803US71, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

409. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to KJ019036 (Synechococcus phage ACG-2014d isolate Syn7803C57, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

410. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to KJ019048 (Synechococcus phage ACG-2014d isolate Syn7803C75, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

411. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to KJ019113 (Synechococcus phage ACG-2014d isolate Syn7803US5, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

412. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to KJ019140 (Synechococcus phage ACG-2014d isolate Syn7803C109, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

413. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to KJ019119 (Synechococcus phage ACG-2014d isolate Syn7803US65, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

414. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to KJ019162 (Synechococcus phage ACG-2014d isolate Syn7803C37, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

415. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to KJ019130 (Synechococcus phage ACG-2014d isolate Syn7803US94, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

416. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to KJ019115 (Synechococcus phage ACG-2014d isolate Syn7803US61, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

417. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to KJ019139 (Synechococcus phage ACG-2014d isolate Syn7803C108, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

418. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to KJ019125 (Synechococcus phage ACG-2014d isolate Syn7803US82, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

419. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to KJ019070 (Synechococcus phage ACG-2014d isolate Syn7803US104, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

420. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to KJ019028 (Synechococcus phage ACG-2014d isolate Syn7803C45, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

421. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to KJ019083 (Synechococcus phage ACG-2014d isolate Syn7803US122, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

422. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to KJ019164 (Synechococcus phage ACG-2014d isolate Syn7803C39, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

423. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to KJ019117 (Synechococcus phage ACG-2014d isolate Syn7803US63, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

424. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to KJ019046 (Synechococcus phage ACG-2014d isolate Syn7803C72, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

425. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to KJ019050 (Synechococcus phage ACG-2014d isolate Syn7803C77, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

426. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to KJ019029 (Synechococcus phage ACG-2014d isolate Syn7803C46, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

427. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to KJ019080 (Synechococcus phage ACG-2014d isolate Syn7803US116, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

428. spacer 3.17|1346477|30|NC_017761|PILER-CR matches to NC_026923 (Synechococcus phage ACG-2014d isolate Syn7803C102, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

429. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to NC_007336 (Cupriavidus pinatubonensis JMP134 megaplasmid, complete sequence) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
tagaagatgagaaagcaaaagactgccctt	Protospacer
  ..******.*********.****** . 

430. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to KJ019062 (Synechococcus phage ACG-2014d isolate Syn7803C93, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

431. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to KJ019121 (Synechococcus phage ACG-2014d isolate Syn7803US78, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

432. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to KJ019126 (Synechococcus phage ACG-2014d isolate Syn7803US83, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

433. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to KJ019047 (Synechococcus phage ACG-2014d isolate Syn7803C73, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

434. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to KJ019072 (Synechococcus phage ACG-2014d isolate Syn7803US108, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

435. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to KJ019032 (Synechococcus phage ACG-2014d isolate Syn7803C49, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

436. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to KJ019078 (Synechococcus phage ACG-2014d isolate Syn7803US114, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

437. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to KJ019165 (Synechococcus phage ACG-2014d isolate Syn7803C40, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

438. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to KJ019124 (Synechococcus phage ACG-2014d isolate Syn7803US80, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

439. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to KJ019074 (Synechococcus phage ACG-2014d isolate Syn7803US110, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

440. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to KJ019034 (Synechococcus phage ACG-2014d isolate Syn7803C54, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

441. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to KJ019127 (Synechococcus phage ACG-2014d isolate Syn7803US85, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

442. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to KJ019118 (Synechococcus phage ACG-2014d isolate Syn7803US64, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

443. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to KJ019075 (Synechococcus phage ACG-2014d isolate Syn7803US111, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

444. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to KJ019131 (Synechococcus phage ACG-2014d isolate Syn7803US95, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

445. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to KJ019057 (Synechococcus phage ACG-2014d isolate Syn7803C89, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

446. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to KJ019056 (Synechococcus phage ACG-2014d isolate Syn7803C88, partial genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

447. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to KJ019160 (Synechococcus phage ACG-2014d isolate Syn7803C35, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

448. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to KJ019112 (Synechococcus phage ACG-2014d isolate Syn7803US59, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

449. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to KJ019073 (Synechococcus phage ACG-2014d isolate Syn7803US109, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

450. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to KJ019077 (Synechococcus phage ACG-2014d isolate Syn7803US113, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

451. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to KJ019129 (Synechococcus phage ACG-2014d isolate Syn7803US89, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

452. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to KJ019031 (Synechococcus phage ACG-2014d isolate Syn7803C48, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

453. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to KJ019079 (Synechococcus phage ACG-2014d isolate Syn7803US115, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

454. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to KJ019035 (Synechococcus phage ACG-2014d isolate Syn7803C55, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

455. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to KJ019120 (Synechococcus phage ACG-2014d isolate Syn7803US71, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

456. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to KJ019036 (Synechococcus phage ACG-2014d isolate Syn7803C57, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

457. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to KJ019048 (Synechococcus phage ACG-2014d isolate Syn7803C75, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

458. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to KJ019113 (Synechococcus phage ACG-2014d isolate Syn7803US5, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

459. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to KJ019140 (Synechococcus phage ACG-2014d isolate Syn7803C109, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

460. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to KJ019119 (Synechococcus phage ACG-2014d isolate Syn7803US65, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

461. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to KJ019162 (Synechococcus phage ACG-2014d isolate Syn7803C37, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

462. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to KJ019130 (Synechococcus phage ACG-2014d isolate Syn7803US94, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

463. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to KJ019115 (Synechococcus phage ACG-2014d isolate Syn7803US61, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

464. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to KJ019139 (Synechococcus phage ACG-2014d isolate Syn7803C108, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

465. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to KJ019125 (Synechococcus phage ACG-2014d isolate Syn7803US82, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

466. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to KJ019070 (Synechococcus phage ACG-2014d isolate Syn7803US104, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

467. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to KJ019028 (Synechococcus phage ACG-2014d isolate Syn7803C45, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

468. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to KJ019083 (Synechococcus phage ACG-2014d isolate Syn7803US122, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

469. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to KJ019164 (Synechococcus phage ACG-2014d isolate Syn7803C39, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

470. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to KJ019117 (Synechococcus phage ACG-2014d isolate Syn7803US63, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

471. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to KJ019046 (Synechococcus phage ACG-2014d isolate Syn7803C72, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

472. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to KJ019050 (Synechococcus phage ACG-2014d isolate Syn7803C77, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

473. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to KJ019029 (Synechococcus phage ACG-2014d isolate Syn7803C46, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

474. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to KJ019080 (Synechococcus phage ACG-2014d isolate Syn7803US116, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

475. spacer 3.22|1346808|30|NC_017761|PILER-CR matches to NC_026923 (Synechococcus phage ACG-2014d isolate Syn7803C102, complete genome) position: , mismatch: 9, identity: 0.7

atagagatgaaaaagcaaaaaactgccaca	CRISPR spacer
taagagatgaaaaagcaaaagtctgattat	Protospacer
  ******************. *** .   

476. spacer 3.23|1346874|30|NC_017761|PILER-CR matches to MN694154 (Marine virus AFVG_250M77, complete genome) position: , mismatch: 9, identity: 0.7

tctagcacaatttaacaagtttaaccgcaa	CRISPR spacer
aatagcacaatttaaaaagtttactcaagc	Protospacer
  ************* ******* .*. . 

477. spacer 3.25|1347006|30|NC_017761|PILER-CR matches to NZ_CP047629 (Lactococcus raffinolactis strain Lr_19_14 plasmid pLraf_19_14_1, complete sequence) position: , mismatch: 9, identity: 0.7

acacttgatttagaaactttaaaagatgac	CRISPR spacer
gatgatgattttgaaactttaaaagataca	Protospacer
.    ****** ***************.  

478. spacer 3.25|1347006|30|NC_017761|PILER-CR matches to MN693010 (Marine virus AFVG_117M73, complete genome) position: , mismatch: 9, identity: 0.7

acacttgatttagaaactttaaaagatgac	CRISPR spacer
ttggaagatatagaaactttaaaagataaa	Protospacer
 ..   *** *****************.* 

479. spacer 3.25|1347006|30|NC_017761|PILER-CR matches to BK010471 (TPA_asm: Uncultured crAssphage, complete genome) position: , mismatch: 9, identity: 0.7

acacttgatttagaaactttaaaagatgac	CRISPR spacer
caaactgatttagaaattttaaaagaatca	Protospacer
  * .***********.*********    

480. spacer 3.25|1347006|30|NC_017761|PILER-CR matches to NC_024711 (Uncultured crAssphage, complete genome) position: , mismatch: 9, identity: 0.7

acacttgatttagaaactttaaaagatgac	CRISPR spacer
caaactgatttagaaattttaaaagaatca	Protospacer
  * .***********.*********    

481. spacer 3.25|1347006|30|NC_017761|PILER-CR matches to JQ995537 (Uncultured phage crAssphage, complete genome) position: , mismatch: 9, identity: 0.7

acacttgatttagaaactttaaaagatgac	CRISPR spacer
caaactgatttagaaattttaaaagaatca	Protospacer
  * .***********.*********    

482. spacer 3.25|1347006|30|NC_017761|PILER-CR matches to MK415410 (CrAssphage YS1-2_2437, complete genome) position: , mismatch: 9, identity: 0.7

acacttgatttagaaactttaaaagatgac	CRISPR spacer
caaactgatttagaaattttaaaagaatca	Protospacer
  * .***********.*********    

483. spacer 3.25|1347006|30|NC_017761|PILER-CR matches to MK415408 (CrAssphage GF1-2_000079F, complete genome) position: , mismatch: 9, identity: 0.7

acacttgatttagaaactttaaaagatgac	CRISPR spacer
caaactgatttagaaattttaaaagaatca	Protospacer
  * .***********.*********    

484. spacer 3.25|1347006|30|NC_017761|PILER-CR matches to MN694652 (Marine virus AFVG_250M647, complete genome) position: , mismatch: 9, identity: 0.7

acacttgatttagaaactttaaaagatgac	CRISPR spacer
ttggaagatatagaaactttaaaagataaa	Protospacer
 ..   *** *****************.* 

485. spacer 1.1|155023|32|NC_017761|PILER-CR matches to NC_014628 (Paenibacillus polymyxa SC2 plasmid pSC2, complete sequence) position: , mismatch: 10, identity: 0.688

gccattgattgattctttggctcaaattcccc	CRISPR spacer
aacattgattgatgctttgcctcaagtggatg	Protospacer
. *********** ***** *****.*   . 

486. spacer 1.1|155023|32|NC_017761|PILER-CR matches to HG531805 (Clostridium phage CDMH1 complete genome) position: , mismatch: 10, identity: 0.688

gccattgattgattctttggctcaaattcccc	CRISPR spacer
ttttgcgattgattcttaggttcaaattcttc	Protospacer
 ..  .*********** **.********..*

487. spacer 2.1|538882|32|NC_017761|PILER-CR matches to NC_014628 (Paenibacillus polymyxa SC2 plasmid pSC2, complete sequence) position: , mismatch: 10, identity: 0.688

gccattgattgattctttggctcaaattcccc	CRISPR spacer
aacattgattgatgctttgcctcaagtggatg	Protospacer
. *********** ***** *****.*   . 

488. spacer 2.1|538882|32|NC_017761|PILER-CR matches to HG531805 (Clostridium phage CDMH1 complete genome) position: , mismatch: 10, identity: 0.688

gccattgattgattctttggctcaaattcccc	CRISPR spacer
ttttgcgattgattcttaggttcaaattcttc	Protospacer
 ..  .*********** **.********..*

489. spacer 3.9|1346939|30|NC_017761|CRISPRCasFinder,CRT matches to NC_016936 (Saprospira grandis str. Lewin plasmid, complete sequence) position: , mismatch: 10, identity: 0.667

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
ctctacttttgccaatgaaacgctaaaggt	Protospacer
.   . .*************.*******. 

490. spacer 3.24|1346940|30|NC_017761|PILER-CR matches to NC_016936 (Saprospira grandis str. Lewin plasmid, complete sequence) position: , mismatch: 10, identity: 0.667

taaaggctttgccaatgaaatgctaaagaa	CRISPR spacer
ctctacttttgccaatgaaacgctaaaggt	Protospacer
.   . .*************.*******.