CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NC_018407	Mycoplasma gallisepticum NC95_13295-2-2P, complete sequence	2 crisprs	cas9,cas1,cas2,csn2	0	35	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_018407_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_018407_1

381805-381894

Orphan

Consensus_repeat	Method
TTTTCTTAACAAAATAATTGTACAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_018407_1

>merge|NC_018407|1|381805-381894|CRISPRCasFinder
TTTTCTTAACAAAATAATTGTACAATACCAAAAGGTTTTTCCTGTAATTCCTGAATGCTTTCAGTTTTACTTAACAAAATAATTGTACAA

>NC_018407|1|1|381805-381894|CRISPRCasFinder
TTTTCTTAACAAAATAATTGTACAA	TACCAAAAGGTTTTTCCTGTAATTCCTGAATGCTTTCAGT
TTTACTTAACAAAATAATTGTACAA

Protein	Signature genes	Signature genes Name	Protein_function
NC_018407.1\|WP_014885971.1\|372836_373853_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224054
NC_018407.1\|WP_014885973.1\|376960_378208_-\|tyrosine--tRNA-ligase	unknown	unknown	gnl\|CDD\|235645
NC_018407.1\|WP_011113540.1\|388999_389509_+\|MG406-family-protein	unknown	unknown	unknown
NC_018407.1\|WP_011113538.1\|386322_386955_+\|uracil-phosphoribosyltransferase	unknown	unknown	gnl\|CDD\|234653
NC_018407.1\|WP_011113536.1\|384791_385184_+\|30S-ribosomal-protein-S9	unknown	unknown	gnl\|CDD\|178888
NC_018407.1\|WP_011113530.1\|375105_375543_-\|Ohr-family-peroxiredoxin	unknown	unknown	gnl\|CDD\|274649
NC_018407.1\|WP_011113533.1\|378254_379484_-\|serine-hydroxymethyltransferase	unknown	unknown	gnl\|CDD\|234571
NC_018407.1\|WP_014885976.1\|387069_388824_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|307204
NC_018407.1\|WP_011113529.1\|373852_374959_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|378925
NC_018407.1\|WP_014885978.1\|390758_391355_+\|F0F1-ATP-synthase-subunit-B	unknown	unknown	gnl\|CDD\|180481
NC_018407.1\|WP_011113542.1\|390465_390756_+\|ATP-synthase-subunit-C	unknown	unknown	gnl\|CDD\|349424
NC_018407.1\|WP_041593689.1\|375617_376955_-\|signal-recognition-particle-protein	unknown	unknown	gnl\|CDD\|236780
NC_018407.1\|WP_014885969.1\|370687_371677_+\|NAD(P)-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|223318
NC_018407.1\|WP_014885970.1\|371680_372577_+\|DnaJ-domain-containing-protein	unknown	unknown	gnl\|CDD\|237663
NC_018407.1\|WP_014885968.1\|369475_370606_+\|DnaJ-domain-containing-protein	unknown	unknown	gnl\|CDD\|237663
NC_018407.1\|WP_011113537.1\|385107_386319_+\|flavodoxin-dependent-(E)-4-hydroxy-3-methylbut-2-enyl-diphosphate-synthase	unknown	unknown	gnl\|CDD\|377382
NC_018407.1\|WP_135811415.1\|380706_381483_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227708
NC_018407.1\|WP_014885977.1\|389471_390365_+\|F0F1-ATP-synthase-subunit-A	unknown	unknown	gnl\|CDD\|376294
NC_018407.1\|WP_011113535.1\|384348_384792_+\|50S-ribosomal-protein-L13	unknown	unknown	gnl\|CDD\|181703
NC_018407.1\|WP_014885975.1\|382505_384206_-\|C1-family-peptidase	unknown	unknown	gnl\|CDD\|239110

Protein	Function_ID	Function_description	E-value
NC_018407.1\|WP_014885971.1\|372836_373853_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224054	COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms].	6.54411e-89
NC_018407.1\|WP_014885973.1\|376960_378208_-\|tyrosine--tRNA-ligase	gnl\|CDD\|235645	PRK05912, PRK05912, tyrosyl-tRNA synthetase; Validated.	3.08157e-136
NC_018407.1\|WP_011113538.1\|386322_386955_+\|uracil-phosphoribosyltransferase	gnl\|CDD\|234653	PRK00129, upp, uracil phosphoribosyltransferase; Reviewed.	4.10701e-114
NC_018407.1\|WP_011113536.1\|384791_385184_+\|30S-ribosomal-protein-S9	gnl\|CDD\|178888	PRK00132, rpsI, 30S ribosomal protein S9; Reviewed.	5.551e-68
NC_018407.1\|WP_011113530.1\|375105_375543_-\|Ohr-family-peroxiredoxin	gnl\|CDD\|274649	TIGR03561, organ_hyd_perox, peroxiredoxin, Ohr subfamily. pfam02566, OsmC-like protein, contains several deeply split clades of homologous proteins. The clade modeled here includes the protein Ohr, or organic hydroperoxide resistance protein. [Cellular processes, Detoxification].	1.33525e-34
NC_018407.1\|WP_011113533.1\|378254_379484_-\|serine-hydroxymethyltransferase	gnl\|CDD\|234571	PRK00011, glyA, serine hydroxymethyltransferase; Reviewed.	0
NC_018407.1\|WP_014885976.1\|387069_388824_+\|hypothetical-protein	gnl\|CDD\|307204	pfam00949, Peptidase_S7, Peptidase S7, Flavivirus NS3 serine protease. The viral genome is a positive strand RNA that encodes a single polyprotein precursor. Processing of the polyprotein precursor into mature proteins is carried out by the host signal peptidase and by NS3 serine protease, which requires NS2B (pfam01002) as a cofactor.	2.49493e-40
NC_018407.1\|WP_011113529.1\|373852_374959_+\|ABC-transporter-permease	gnl\|CDD\|378925	pfam12698, ABC2_membrane_3, ABC-2 family transporter protein. This family is related to the ABC-2 membrane transporter family pfam01061.	5.50047e-07
NC_018407.1\|WP_014885978.1\|390758_391355_+\|F0F1-ATP-synthase-subunit-B	gnl\|CDD\|180481	PRK06231, PRK06231, F0F1 ATP synthase subunit B; Validated.	6.2266e-87
NC_018407.1\|WP_011113542.1\|390465_390756_+\|ATP-synthase-subunit-C	gnl\|CDD\|349424	cd18184, ATP-synt_Fo_c_NaATPase, F-type sodium ion-translocating ATP synthase and similar proteins. This family includes F-type Na(+)-coupled ATP synthase and similar proteins.	5.24176e-20
NC_018407.1\|WP_041593689.1\|375617_376955_-\|signal-recognition-particle-protein	gnl\|CDD\|236780	PRK10867, PRK10867, signal recognition particle protein; Provisional.	0
NC_018407.1\|WP_014885969.1\|370687_371677_+\|NAD(P)-binding-domain-containing-protein	gnl\|CDD\|223318	COG0240, GpsA, Glycerol-3-phosphate dehydrogenase [Energy production and conversion].	4.99078e-93
NC_018407.1\|WP_014885970.1\|371680_372577_+\|DnaJ-domain-containing-protein	gnl\|CDD\|237663	PRK14293, PRK14293, molecular chaperone DnaJ.	1.0289e-20
NC_018407.1\|WP_014885968.1\|369475_370606_+\|DnaJ-domain-containing-protein	gnl\|CDD\|237663	PRK14293, PRK14293, molecular chaperone DnaJ.	1.9467e-29
NC_018407.1\|WP_011113537.1\|385107_386319_+\|flavodoxin-dependent-(E)-4-hydroxy-3-methylbut-2-enyl-diphosphate-synthase	gnl\|CDD\|377382	pfam04551, GcpE, GcpE protein. In a variety of organisms, including plants and several eubacteria, isoprenoids are synthesized by the mevalonate-independent 2-C-methyl-D-erythritol 4-phosphate (MEP) pathway. Although different enzymes of this pathway have been described, the terminal biosynthetic steps of the MEP pathway have not been fully elucidated. GcpE gene of Escherichia coli is involved in this pathway.	0
NC_018407.1\|WP_135811415.1\|380706_381483_+\|hypothetical-protein	gnl\|CDD\|227708	COG5421, COG5421, Transposase [DNA replication, recombination, and repair].	0.000322109
NC_018407.1\|WP_014885977.1\|389471_390365_+\|F0F1-ATP-synthase-subunit-A	gnl\|CDD\|376294	pfam00119, ATP-synt_A, ATP synthase A chain.	9.88353e-39
NC_018407.1\|WP_011113535.1\|384348_384792_+\|50S-ribosomal-protein-L13	gnl\|CDD\|181703	PRK09216, rplM, 50S ribosomal protein L13; Reviewed.	1.83394e-78
NC_018407.1\|WP_014885975.1\|382505_384206_-\|C1-family-peptidase	gnl\|CDD\|239110	cd02619, Peptidase_C1, C1 Peptidase family (MEROPS database nomenclature), also referred to as the papain family; composed of two subfamilies of cysteine peptidases (CPs), C1A (papain) and C1B (bleomycin hydrolase). Papain-like enzymes are mostly endopeptidases with some exceptions like cathepsins B, C, H and X, which are exopeptidases. Papain-like CPs have different functions in various organisms. Plant CPs are used to mobilize storage proteins in seeds while mammalian CPs are primarily lysosomal enzymes responsible for protein degradation in the lysosome. Papain-like CPs are synthesized as inactive proenzymes with N-terminal propeptide regions, which are removed upon activation. Bleomycin hydrolase (BH) is a CP that detoxifies bleomycin by hydrolysis of an amide group. It acts as a carboxypeptidase on its C-terminus to convert itself into an aminopeptidase and peptide ligase. BH is found in all tissues in mammals as well as in many other eukaryotes. It forms a hexameric ring barrel structure with the active sites imbedded in the central channel. Some members of the C1 family are proteins classified as non-peptidase homologs which lack peptidase activity or have missing active site residues.	7.82555e-38

>NC_018407.1|WP_135811415.1|380706_381483_+|hypothetical-protein
MAYKIKGKENKIEGIYDLETYKMMYEEFGVKKQDHKEFFKSNNTFYEIDNKLILTFSRKRQKKDKKDRERLIKKAEKSLNLSAIKSEMKRGGKKYLKFAANEVELDHQAILKDEAADGFYGILTSHEDMNEEDMNEKEIIKQYSKLWKIEESFRVMKTNFELRPIFLSAEKTIKGHFLICFLALIIQRYLEFVLDCCGYPMPTNKIIDAIKNQKLSIIPEINTYIKTEESEDFKTILKVFGIKLIETIGKYEDIKFTI
>NC_018407.1|WP_011113533.1|378254_379484_-|serine-hydroxymethyltransferase
MEIFKLINQELQRQQDQIELIASENYVSEAVLRATGSVLTNKYAEGTPNKRYYGGCEYVDQIELIAIEKLKKLFGARHANVQPHSGSTANAAAYLALLQPHDKVLAMGLNDGGHLTHGSKVNFSGKIYDFYHYNVDPNTYLLDYDEILKKAIEVKPKLIVCGASNYSRAIDFAKFRQIADHVSAYLMADIAHIAGLIVAGYHQNPVEYCDIITSTTHKTLRGPRGGIILTNREDLIKKIDSAVFPGELGGPLMHVIAAKAIAFDEALQPKFKTYIKNVIDNSKAFCEAFINKGYQIIANGTDNHLFSINLFKKFNLTGDLVENWLYQANIVVNKNMIPYDSNKSMNPSGIRLGTAAMTSRGLVQSDFVQIADWIDQIIKAKGDLNVINKVKSEVKKLLVKYPIYQDRDY
>NC_018407.1|WP_014885973.1|376960_378208_-|tyrosine--tRNA-ligase
MDFISELKKRNIIKQISNEEKLALALKNQKGVYVGFDPSGESLHLGNLIPIIVLRYLKKVGFKTYAILGGATGLIGDPSGKTSERKVQDYEKIKANANKIKVQLERYTQAKIINNIDFYQNMNLLNFLRDTGKLINIGYLLDKEFIRSRIENGISYAEFSYNIIQGHDFLHLYEQYDVQVQCGGSDQWGNITTGIDLIKRKYGEEKTPYLCGLTFNLLLNPNGNKFGKSEQGALYLDENLTHPYLIWQYIYNQDDQFIIDLIHRYVLDQSLEQLQELIEAHLANKKTRIAQKFLADYLVKFIHSQEHLDTVHKMNKALFDNQLDQLSDQEKLVVFASFDKVELDRNQSFMVIDFLLQAKVADSKRILRELIAQGSIQIDDLKITDPQAQLNVRKDQQLTVIKKGKKNYFIVVWKG
>NC_018407.1|WP_041593689.1|375617_376955_-|signal-recognition-particle-protein
MLKSMISSIVTKSLKKRLLNQTIKEEDLTEVLREIRIALLDADVNINVVKTFIKAIKEKAIGQAVDRNTDVHAYFLKIIKDELVNILGKDQQPLKTDKKLAKIMLVGLQGSGKTTTVAKLAKFLNKQKQKNSLLVGLDVYRPAAINQLNTLAEQINMPFYNEGLSDPVKTAKNSIEIAKEKNCDLIIYDTAGRLQTNVELMNELVNIRNTVDPDEIILVVDGLSGQEIINIATEFNNYLKLSGIIITKLDSDARAGAALSLRSILNVPIKFTTSGEKLDAIELFYPERIADRILGFGDVMTLAEKAQEVYDEKSTMKTFEKMLSGRMDLEDLLQQTQSITKMGGLGSLVKMLPGFANKISEDKVEEATQKIHVWKILMSSMTLKERRNPKLLMKNPSRKSRIIKGSGRKVEELNKLLKDWQNASGKMEEIGRMLKANKNPFGSLF
>NC_018407.1|WP_011113530.1|375105_375543_-|Ohr-family-peroxiredoxin
MFKKVYETAAVAKVGREGLVKTTDGQLSLNLGFPKAMGGSHSDRLNPEQLFAAGYASCFSQAVFAVSKKLGHDLKEAPIEVTVQLHVQEEPMAFELRVGISLTVDLPEAKAKELMKLSHETCPYSKLAKPSQIIWLKVNGMDVPY
>NC_018407.1|WP_011113529.1|373852_374959_+|ABC-transporter-permease
MIYAKTTFGSLLARNIKLFLRNKTRFFFILLGPVITLLVFVLIIKRNSFDPGGRAVEFLNLSSLSRESQTSLRDLGAIELVYSTEFTTEISNYIFNGTLLSGLISITALTTAVQLSQNIVQDREERILEDFFITPTKTTTVRLSYVVFNILFNMLITLLALFFIYVYIVARFPTSPFSKPETVLATVGVTILICLINSVFFVFIFSYIKKLSIFLVLTAMVSSAGGFLIGGYFPISLLPKGLSAAISLIPQTEASILLNNVSLNHDIITSSVNTLTAENVSVTLSNDTTKNLLTFFMDNARMPREQALQTANEIVQKLTDGINMGIRDYAKTTLVGQDVEPYVSVIYAAGLLGLFTFLLYAVKYSRKR
>NC_018407.1|WP_014885971.1|372836_373853_+|ABC-transporter-ATP-binding-protein
MENLEKNEVILKITNLNKSFDKHKRSGTKKALDDLTFKVYKRQFYGFLGVNGAGKTTTLNIIMGLLSKDSGSIELFGEEVKGDFTRIRNNIGIVFQNSILDKNLSVYENLYSRLSLYKNEFKDKTTKQVVDEMVVNFKLEDIIWKKYGSLSGGQRRRVDIARALAHNPSILFLDEPTTGLDPISRRMVWDILEKLRIERGLTIILTTHYMDEADGCDYTIVIKKGKKLAEGTPAELKTRYAKSWVLVQDKPDHSIRKLIETKSLTYEIKGGYLRVAFDTYYQAHKFTQEHIGVLENFELIKGNMEDVFINLTNEENKKHPEETESTKHRSWWKLGGAK
>NC_018407.1|WP_014885970.1|371680_372577_+|DnaJ-domain-containing-protein
MADKQQPTQLNLIAYFDDYQSVQNEQQNSTTLRPIELDQFYRNLIRDISLSQTSSVYQQYDQPQYEEPATNNYQTSSYKITPDQEKAYYQEQTEAFNDHLNNGNYYNKNTTSFMFDDSLYNYQYDHSKINNKHVNSFSDGRERLFSDSVVNNKGAEKTAEFQIEDFIQWVAKKKEKWKKAREAKRKQREFKKRKLDDENAWYEKVMSEGTQAFRGSFGFDFNSIDWDNIDFNGSSNEEEINNAYRILGLSIHDSSDDVRSAYRRLAKKYHPDLNKDPGAEEMFKRINYAYEILNEYVL
>NC_018407.1|WP_014885969.1|370687_371677_+|NAD(P)-binding-domain-containing-protein
MKTKIGVLGTGAWGTALASILLKNGHIVKMWGIDQDEINNLKTGYNNRYFGHKKLVKSPDLVSSDLAAVVDGCDYLLLAIPSKFFNDVLAKLANVLKDRKVNLINVAKGMDGQTKQFWSEVIKQAFSKNLLSLTSLLGPSFATEVFDNHPTVINAVSNDMTSCKKVCELFNNDTFQLVPFDNELSAQMFAAIKNVCAIGTGIVFEQTTSANTRSALLTKLFNEMDRLYESLAKDKYRPKDCTQLNGIGDFILTCTNDQSRNFSFGKLVAKYGIKNALEKNINTVEGYLAAKTMYEIIKNNNLELKLLITIYQILYEDLDKSVLVKKLIN
>NC_018407.1|WP_014885968.1|369475_370606_+|DnaJ-domain-containing-protein
MRPFLESNYYELLGVNETASKEEIKRAFRRLAREYHPDVNKAPDAEAKFKEINRAYSILSNETTRFDFDRRLKQRRAKASATNTTSFFHQRNQNQNYYEILKVNQNDSTEKITIQYKMMRLQYSTVFAKDAHSAEMSRKIERAYEILGDPLKRARYDQYLKLANTSLMSFELWCAKNSEEPPIKKKAATPPFKEDKKAKEDKKTKTKAEKQSESEKNTEQVKVKKNKKKKGEKPPKQAQEIDPDLLFPKRWNDTWRMMKIITNVQLVLSYTLILCIVLSLIFIFLQNNSVLEKFYNELSLGWFPFVWILFGTITLLSFLNIYLASDFSATNPEFKKVKVVWIITAVLFISVFYASYLTKKAIEAQEVHNNTANKSG
>NC_018407.1|WP_014885975.1|382505_384206_-|C1-family-peptidase
MRLKNKKILTSLLVSPGLLIPFSTMSATTSVNSNAPKLDFFKNKSAEEIAKMEFFDARDYNLVTSVKHQGNEGLCWAYTIASILETNMLKNNIGNYTKNSLDIDEHAIDYISNSWNHNADKLNLNSNAQQWGGIFGEGNYLSHAFTGLMRNTSPIAQTNQTEFPNFDNPTIAKIKNAVKVNPTVEDIKLAIAKYGSVGVAYAFNAMNFHPKTIWYNEPNSSIVNKSADQKNIKNHASVIVGWDDNYYESNFKPERPKRRGGFIVKNSWGTKKMHSQGYFILSYDSLDLIQELMAVEVEKNDAYKNTYYYDTKNSFSLFATLDTKERTMANIFPVKKANDEVVEKLKSINFALRGLNITAEIKIYVKDSLMSNPEDGELKLTQRVQIPNSGEKGFYTIDLDKEIILNKGQYFSIIVDVTNEGEKVVDLMASGETREILSFYKYKNEWVNSKKSFVVFGIKAHTLEMPITELNKDIAADEKNNPISKESNTSETKSNTTPSSESQTNNSVKTGKQTNSNTATHESSVTENKTNVILWSILGALAGIATFGVTTFFIVKLMKKELKSNL
>NC_018407.1|WP_011113535.1|384348_384792_+|50S-ribosomal-protein-L13
MQKTTMQKPVVATKNRKWYLVDASGLVLGRLAVKAANLLRGKNKPDFTPNVDCGDYLIILNSDKVVLTGNKLDNEKWYRHSNYMGGIKSRTGREMVDHYSDQLVYDAIRRMLPKNRLAKDMMRKLKVYKNDRHEHDAQQPTKLDWSK
>NC_018407.1|WP_011113536.1|384791_385184_+|30S-ribosomal-protein-S9
MAVVTFKGLGRRKSSTALVKLTPGSGKLVINNRKAEDYFPNKIVIQDMRQPLEVTKTASIYDINVVVNGGGFTGQAGAIRLGIARALVNMNPELKKQLKQHKLVTRDARVKERKKFGLYGARRAPQFTKR
>NC_018407.1|WP_011113537.1|385107_386319_+|flavodoxin-dependent-(E)-4-hydroxy-3-methylbut-2-enyl-diphosphate-synthase
MMHVLKNVRNSDYTVLEERLNLLSVRALKSLLYGDFIFISQSDFMYTRTKTKKVFVGDVQIGGQNKIVLQSMTIAKTKHVKKSLKEINDLVKEGADLVRIAVFDDADKRAIRKVVDQSPCPIIADIHFNPDYAIAAIKAGCKKIRLNPGNIKSKEKLREICLLANQYNIPIRVGVNSGSIPYDLMREYGVTSTAMIIAAQRYVRMLKRFGFDNIVISLKTSSALLSMQAYELGAKKFSYPLHLGITEAGTLINGTIKSVAGLTPLLLKGIGDTIRISLSTNPVDEIKVAKKMLNSLGLYENLVDVVACPTCGRLNFDLFKVTKEIEEFVKDLHFPLKVSILGCSVNGPGEAKEADIGIAGGKQEGIIFKKGVVVKSVKQEYLVDELKQMILEEYELFKKKNGK
>NC_018407.1|WP_011113538.1|386322_386955_+|uracil-phosphoribosyltransferase
MKNFIFNHPLISDKLSKMRDVNTGYNFFKQLLTEITTLMMYEVGKGYELEEISVTTPLATTKAHKLKHNFVIVPILRAGLGMVDGVHNVIPTARVGHIGLYRDEKTFQPVEYYSKFPQTMDDGHVIVLDPMLATGASVIKAISLVKNIQPKKPRSIKFMGLLGAPEGLKALNQAHPDVDVYLACLDEKLNDKNYIYPGLGDAGDRIFGTK
>NC_018407.1|WP_014885976.1|387069_388824_+|hypothetical-protein
MGLSRKKIFTWPLLLTGMAVVSTTFSSCSVFNFFSNLPTTTDNNNYGPTVQNLSAFLPTSDYKKIYDLSFSLEFNNSGGYNPSRSMSNNEGVTAENVNRPYRVFGTGWLFDWQAQPVDENDQNAKWTGYFATNLHVAEALLNPLDNKNYRPAWYKNELPLPGVDQTLYFNLGKWDENLAVQNKHNPKSLTYLPLSNLPKTVYTATSFYKESPKWITPIEADNPGIREYIDFAVLSITLDLSWTMRNGEKVHRYNDEYQLYNRWIMPAMNVAKALWDNKGVLNQPATPPNKKEEDDQLTDQLPYHGFFDRSNYTNPNVSLNNFSVYLGGYPYYANWPTTPQYTKFSVPSLSRRQIPITSDSRGSPGWTINALNPTELDGQKIASSTSLSSTGGIRAGIYNADIARNFQLVYRNVKYKQYGYGYIIQNSNLSAGSSGSLALTSNNQALGIYFGTVSVDAKKEATFGLVASLFNPNKIQVNVVTSNNVFETDTIQPYDLIYGNDLMTDDYGSYIRSLQTLNLSSRLLTKIKDNLPKKEGSTNQANQQTNQTNRSTETTKKDSSSDETNKNPLAELLSDIFKNLPNWN
>NC_018407.1|WP_011113540.1|388999_389509_+|MG406-family-protein
MIVDKKIIKYNLIIFNVFSIVGLIILLGLTFTKIIGFQWVYSSLLTVVFSNISLVIGLILPNLLYTSATKLNTQQVKSARFGFFILGIITLSSRLFWYAVPIVIIGFVNQWQFQGAVFNVFPAILWPLSMIAVHVVVNYLLLNKEIKERNKLKELNNNVATGDSLHEAF
>NC_018407.1|WP_014885977.1|389471_390365_+|F0F1-ATP-synthase-subunit-A
MLPQEIVYTKLSSTETENGWINFLTTKPLASQGIEWTPLIPTAHVLSIFMVLFMIAILTAVYYTKLKKLKPTEPPTGYVLVVQLLILQFENLTVDLLGEKNRRLSLLFIIIFVYILISNLMSMVGGIAAPTSSSTVTFSLGLMSFFGTFIMGVKYQKLAYFRDFFVIIKIKKKTIPLMINPLNVIGYFAPLLSISLRLWGNVLAGSIFIALLYSLFRTFFTLGSPSSFSVGLVFGTLVGGLVIPAFHVYFDILVSAIQAFVFVSLMLTYWSQPIKAAENAAEEKRQQMIENQRLNVK
>NC_018407.1|WP_011113542.1|390465_390756_+|ATP-synthase-subunit-C
MNIFLVIHELINQADQVNVTLTNHVGAYIGAGMAMTAAAGVGVGQGFASGLCATALARNPELLPKIQLFWIVGSAIAESSAIYGLIIAFILIFVAR
>NC_018407.1|WP_014885978.1|390758_391355_+|F0F1-ATP-synthase-subunit-B
MWSTRVKKLLLLSFNFLIISAIVSSCSIPEELQAKTIVNEFFPNFWVFVAHTIALSIIILLGIFLLWKPTKRFLAKRSELIQAEINNANEIKKQAQFLLDNAKKQKQNAELQAREIINLATNQAYRLKNDLETDAKRKANRIIENAHAEIIKQESILKRELEGRIVDVALEATSTLIKKNVAKEDHERLVNELLRNLD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_018407_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_018407_2

877688-880695

TypeII

Consensus_repeat	Method
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	CRISPRCasFinder
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	CRT
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	PILER-CR

45 spacers

csn2,cas2,cas1,cas9

The CRISPR arrays of NC_018407_2

>merge|NC_018407|2|877688-880695|CRISPRCasFinder,CRT,PILER-CR
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAACAATCGAATAATTATGTTCAGATGTACTTTGGTTTTAGCACTGTACAATACTTGTGTAAGCAATAACGAAACGGCCGCAAGTTACTTACATACAATTGTTTTAGCACTGTACAATACTTGTGTAAGCAATAACTTTGCATATTTAGATCGTTACTTTGACAAAGTTTTAGCACTGTACAATACTTGTGTAAGCAATAACAATAAATTTAAAATTGCCGATTGTGTTCAAGTTTTAGCACTGTACAATACTTGTGTAAGCAATAACTTATAACAGATAATAACACTTGACGCGCTTGTTTTAGCACTGTACAATACTTGTGTAAGCAATAACTCAGATAATTCTTCAACTGCAACAACGTTAGTTTTAGCACTGTACAATACTTGTGTAAGCAATAACTTTATAACAACAGATTACGCTTTTTTATTCGTTTTAGCACTGTACAATACTTGTGTAAGCAATAACTTATTTATTAAACGACGAACAAAGACGTTTGTTTTAGCACTGTACAATACTTGTGTAAGCAATAACTTGGGCTAATTTACCGTATAAACTATTAAGGTTTTAGCACTGTACAATACTTGTGTAAGCAATAACAAAGCCCCGAACAACTAGCTTTCGAAAAGAGTTTTAGCACTGTACAATACTTGTGTAAGCAATAACATTCATTAACAAAAAAGATGTTAAATAAACGTTTTAGCACTGTACAATACTTGTGTAAGCAATAACTTTTTTCAAAATTATACAATAACGATTTAAGTTTTAGCACTGTACAATACTTGTGTAAGCAATAACCAGATTTTAAGAAAGAACGTTTAATTACAAGTTTTAGCACTGTACAATACTTGTGTAAGCAATAACGTAATACTCAAGAACTGCATCGCGCAAGTCGTTTTAGCACTGTACAATACTTGTGTAAGCAATAACATCTTGTTATTATTAGCGTTTATTTGGCCAGTTTTAGCACTGTACAATACTTGTGTAAGCAATAACTCTTGTGTCTTGAAACTTGCTATAAAAGTAGTTTTAGCACTGTACAATACTTGTGTAAGCAATAACAAAGTTGTATTGTGTTTGAACCATTTCACTGTTTTAGCACTGTACAATACTTGTGTAAGCAATAACAGGTTGTTCATGATTGACATTAAAATTAAAGTTTTAGCACTGTACAATACTTGTGTAAGCAATAACATTCAATTGCGTTTTTTAAACGTACAAATAGTTTTAGCACTGTACAATACTTGTGTAAGCAATAACTTTGTTTTTATCTTGATTCGAAAGACATTAGTTTTAGCACTGTACAATACTTGTGTAAGCAATAACATTCTGCCGCCACGATATCGATTTCAGTTCGTTTTAGCACTGTACAATACTTGTGTAAGCAATAACATAAGAACAAGAACTATCTAACGCTTTTTTGTTTTAGCACTGTACAATACTTGTGTAAGCAATAACGTAAGTTGTCGATCTCTTCACTAACGACAGGTTTTAACACTGTACAATACTTGTGTAAGCAATAACTTGTTGAGCTAATTGGACTTAAAGCAAATAGTTTTAGCACTGTACAATACTTGTGTAAGCAATAACTTGAAATTTGAATGTTTGGAAATCTTCACGGTTTTAGCACTGTACAATACTTGTGTAAGCAATAACGCAATAGTTTGTAAGCAAAACGTGGGAGGGGGTTTTAGCACTGTACAATACTTGTGTAAGCAATAACAATTAAAAGTTAAGAACGTTGTTGCTGACGGTTTTAGCACTGTACAATACTTGTGTAAGCAATAACTAGTGTATTTTAACCACCGTTCAAGCGCTCGTTTTAGCACTGTACAATACTTGTGTAAGCAATAACTTTTTTGTTAATGAATTAAAAATCTTATCAGGTTTTAGCACTGTACAATACTTGTGTAAGCAATAACTTTTTTAAGCTCATCTTCAAGGTGTTGATTGTTTTAGCACTGTACAATACTTGTGTAAGCAATAACTTTAAGCGTTCCGATCGTTTGTCAAATGTGGTTTTAGCACTGTACAATACTTGTGTAAGCAATAACAACTTATCTGCATAACCCTTTTGAATCTCTGTTTTAGCACTGTACAATACTTGTGTAAGCAATAACAAGTTGATCATTTAAATGAGCTTTTAAAAAGTTTTAGCACTGTACAATACTTGTGTAAGCAATAACACGTTTGAGGTTCAGCTAATTCTGGGGTTAGTTTTAGCACTGTACAATACTTGTGTAAGCAATAACTAATTAATCGCGATAATACAATGTATTTTGGTTTTAGCACTGTACAATACTTGTGTAAGCAATAACTTTGATCATCGACTGTTCAAAGAAGGCGTAGTTTTAGCACTGTACAATACTTGTGTAAGCAATAACTAGTTAAATTAATTTTTAAAGGATGGTTTAGTTTTAGCACTGTACAATACTTGTGTAAGCAATAACTAATAATCTTAATTTTAGTGTGTTTGTCGTGTTTTAGCACTGTACAATACTTGTGTAAGCAATAACGAATTAAATTATCTTTATAAGTAAAATAAAGTTTTAGCACTGTACAATACTTGTGTAAGCAATAACTAATAATCTTAATTTTAGTGTGTTTGTCGTGTTTTAGCACTGTACAATACTTGTGTAAGCAATAACGAATTAAATTATCTTTATAAGTAAAATAAAGTTTTAGCACTGTACAATACTTGTGTAAGCAATAACGTTTTGCTTATAAATTGTTACAAGACTTCTGTTTTAGCACTGTACAATACTTGTGTAAGCAATAACATTCTGCCGCCACGATATCGATTTCTGTTCGTTTTAGCACTGTACAATACTTGTGTAAGCAATAACATGGTGACGAATATAAACCCCAACTTGATCGTTTTAGCACTGTACAATACTTGTGTAAGCAATAACCAACAGCCGTTGTTAAAATTAAAAAAACTAGTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC

>NC_018407|2|2|877688-880695|CRISPRCasFinder
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	AATCGAATAATTATGTTCAGATGTACTTTG
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	GAAACGGCCGCAAGTTACTTACATACAATT
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	TTTGCATATTTAGATCGTTACTTTGACAAA
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	AATAAATTTAAAATTGCCGATTGTGTTCAA
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	TTATAACAGATAATAACACTTGACGCGCTT
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	TCAGATAATTCTTCAACTGCAACAACGTTA
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	TTTATAACAACAGATTACGCTTTTTTATTC
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	TTATTTATTAAACGACGAACAAAGACGTTT
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	TTGGGCTAATTTACCGTATAAACTATTAAG
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	AAAGCCCCGAACAACTAGCTTTCGAAAAGA
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	ATTCATTAACAAAAAAGATGTTAAATAAAC
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	TTTTTTCAAAATTATACAATAACGATTTAA
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	CAGATTTTAAGAAAGAACGTTTAATTACAA
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	GTAATACTCAAGAACTGCATCGCGCAAGTC
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	ATCTTGTTATTATTAGCGTTTATTTGGCCA
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	TCTTGTGTCTTGAAACTTGCTATAAAAGTA
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	AAAGTTGTATTGTGTTTGAACCATTTCACT
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	AGGTTGTTCATGATTGACATTAAAATTAAA
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	ATTCAATTGCGTTTTTTAAACGTACAAATA
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	TTTGTTTTTATCTTGATTCGAAAGACATTA
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	ATTCTGCCGCCACGATATCGATTTCAGTTC
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	ATAAGAACAAGAACTATCTAACGCTTTTTT
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	GTAAGTTGTCGATCTCTTCACTAACGACAG
GTTTTAACACTGTACAATACTTGTGTAAGCAATAAC	TTGTTGAGCTAATTGGACTTAAAGCAAATA
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	TTGAAATTTGAATGTTTGGAAATCTTCACG
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	GCAATAGTTTGTAAGCAAAACGTGGGAGGGG
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	AATTAAAAGTTAAGAACGTTGTTGCTGACG
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	TAGTGTATTTTAACCACCGTTCAAGCGCTC
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	TTTTTTGTTAATGAATTAAAAATCTTATCAG
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	TTTTTTAAGCTCATCTTCAAGGTGTTGATT
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	TTTAAGCGTTCCGATCGTTTGTCAAATGTG
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	AACTTATCTGCATAACCCTTTTGAATCTCT
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	AAGTTGATCATTTAAATGAGCTTTTAAAAA
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	ACGTTTGAGGTTCAGCTAATTCTGGGGTTA
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	TAATTAATCGCGATAATACAATGTATTTTG
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	TTTGATCATCGACTGTTCAAAGAAGGCGTA
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	TAGTTAAATTAATTTTTAAAGGATGGTTTA
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	TAATAATCTTAATTTTAGTGTGTTTGTCGT
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	GAATTAAATTATCTTTATAAGTAAAATAAA
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	TAATAATCTTAATTTTAGTGTGTTTGTCGT
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	GAATTAAATTATCTTTATAAGTAAAATAAA
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	GTTTTGCTTATAAATTGTTACAAGACTTCT
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	ATTCTGCCGCCACGATATCGATTTCTGTTC
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	ATGGTGACGAATATAAACCCCAACTTGATC
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	CAACAGCCGTTGTTAAAATTAAAAAAACTA
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC

>NC_018407|2|1|877688-880695|CRT
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	AATCGAATAATTATGTTCAGATGTACTTTG
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	GAAACGGCCGCAAGTTACTTACATACAATT
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	TTTGCATATTTAGATCGTTACTTTGACAAA
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	AATAAATTTAAAATTGCCGATTGTGTTCAA
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	TTATAACAGATAATAACACTTGACGCGCTT
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	TCAGATAATTCTTCAACTGCAACAACGTTA
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	TTTATAACAACAGATTACGCTTTTTTATTC
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	TTATTTATTAAACGACGAACAAAGACGTTT
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	TTGGGCTAATTTACCGTATAAACTATTAAG
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	AAAGCCCCGAACAACTAGCTTTCGAAAAGA
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	ATTCATTAACAAAAAAGATGTTAAATAAAC
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	TTTTTTCAAAATTATACAATAACGATTTAA
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	CAGATTTTAAGAAAGAACGTTTAATTACAA
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	GTAATACTCAAGAACTGCATCGCGCAAGTC
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	ATCTTGTTATTATTAGCGTTTATTTGGCCA
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	TCTTGTGTCTTGAAACTTGCTATAAAAGTA
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	AAAGTTGTATTGTGTTTGAACCATTTCACT
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	AGGTTGTTCATGATTGACATTAAAATTAAA
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	ATTCAATTGCGTTTTTTAAACGTACAAATA
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	TTTGTTTTTATCTTGATTCGAAAGACATTA
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	ATTCTGCCGCCACGATATCGATTTCAGTTC
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	ATAAGAACAAGAACTATCTAACGCTTTTTT
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	GTAAGTTGTCGATCTCTTCACTAACGACAG
GTTTTAACACTGTACAATACTTGTGTAAGCAATAAC	TTGTTGAGCTAATTGGACTTAAAGCAAATA
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	TTGAAATTTGAATGTTTGGAAATCTTCACG
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	GCAATAGTTTGTAAGCAAAACGTGGGAGGGG
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	AATTAAAAGTTAAGAACGTTGTTGCTGACG
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	TAGTGTATTTTAACCACCGTTCAAGCGCTC
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	TTTTTTGTTAATGAATTAAAAATCTTATCAG
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	TTTTTTAAGCTCATCTTCAAGGTGTTGATT
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	TTTAAGCGTTCCGATCGTTTGTCAAATGTG
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	AACTTATCTGCATAACCCTTTTGAATCTCT
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	AAGTTGATCATTTAAATGAGCTTTTAAAAA
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	ACGTTTGAGGTTCAGCTAATTCTGGGGTTA
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	TAATTAATCGCGATAATACAATGTATTTTG
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	TTTGATCATCGACTGTTCAAAGAAGGCGTA
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	TAGTTAAATTAATTTTTAAAGGATGGTTTA
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	TAATAATCTTAATTTTAGTGTGTTTGTCGT
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	GAATTAAATTATCTTTATAAGTAAAATAAA
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	TAATAATCTTAATTTTAGTGTGTTTGTCGT
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	GAATTAAATTATCTTTATAAGTAAAATAAA
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	GTTTTGCTTATAAATTGTTACAAGACTTCT
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	ATTCTGCCGCCACGATATCGATTTCTGTTC
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	ATGGTGACGAATATAAACCCCAACTTGATC
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	CAACAGCCGTTGTTAAAATTAAAAAAACTA
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC

>NC_018407|2|1|878876-880695|PILER-CR
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	ATTCAATTGCGTTTTTTAAACGTACAAATA
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	TTTGTTTTTATCTTGATTCGAAAGACATTA
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	ATTCTGCCGCCACGATATCGATTTCAGTTC
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	ATAAGAACAAGAACTATCTAACGCTTTTTT
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	GTAAGTTGTCGATCTCTTCACTAACGACAG
GTTTTAACACTGTACAATACTTGTGTAAGCAATAAC	TTGTTGAGCTAATTGGACTTAAAGCAAATA
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	TTGAAATTTGAATGTTTGGAAATCTTCACG
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	GCAATAGTTTGTAAGCAAAACGTGGGAGGGG
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	AATTAAAAGTTAAGAACGTTGTTGCTGACG
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	TAGTGTATTTTAACCACCGTTCAAGCGCTC
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	TTTTTTGTTAATGAATTAAAAATCTTATCAG
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	TTTTTTAAGCTCATCTTCAAGGTGTTGATT
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	TTTAAGCGTTCCGATCGTTTGTCAAATGTG
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	AACTTATCTGCATAACCCTTTTGAATCTCT
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	AAGTTGATCATTTAAATGAGCTTTTAAAAA
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	ACGTTTGAGGTTCAGCTAATTCTGGGGTTA
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	TAATTAATCGCGATAATACAATGTATTTTG
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	TTTGATCATCGACTGTTCAAAGAAGGCGTA
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	TAGTTAAATTAATTTTTAAAGGATGGTTTA
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	TAATAATCTTAATTTTAGTGTGTTTGTCGT
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	GAATTAAATTATCTTTATAAGTAAAATAAA
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	TAATAATCTTAATTTTAGTGTGTTTGTCGT
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	GAATTAAATTATCTTTATAAGTAAAATAAA
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	GTTTTGCTTATAAATTGTTACAAGACTTCT
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	ATTCTGCCGCCACGATATCGATTTCTGTTC
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	ATGGTGACGAATATAAACCCCAACTTGATC
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC	CAACAGCCGTTGTTAAAATTAAAAAAACTA
GTTTTAGCACTGTACAATACTTGTGTAAGCAATAAC

Protein	Signature genes	Signature genes Name	Protein_function
NC_018407.1\|WP_014886268.1\|883666_885955_-\|S8-family-peptidase	unknown	unknown	gnl\|CDD\|173793
NC_018407.1\|WP_014886350.1\|897571_899839_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|338744
NC_018407.1\|WP_041593708.1\|883050_883389_-\|hypothetical-protein	unknown	unknown	unknown
NC_018407.1\|WP_014886262.1\|867762_869205_-\|hypothetical-protein	unknown	unknown	unknown
NC_018407.1\|WP_014886272.1\|888711_889278_-\|hypothetical-protein	unknown	unknown	unknown
NC_018407.1\|WP_014886260.1\|865333_865780_+\|hypothetical-protein	unknown	unknown	unknown
NC_018407.1\|WP_014886275.1\|893955_897552_-\|hypothetical-protein	unknown	unknown	unknown
NC_018407.1\|WP_014886266.1\|880777_881560_-\|23S-rRNA-(guanosine(2251)-2'-O)-methyltransferase-RlmB	unknown	unknown	gnl\|CDD\|129290
NC_018407.1\|WP_014574791.1\|876572_876902_+\|CRISPR-associated-endonuclease-Cas2	cas2	COG3512_cas2_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|226043
NC_018407.1\|WP_014886265.1\|876901_877666_+\|hypothetical-protein	csn2	cls000024_csn2_CAS-II-A	unknown
NC_018407.1\|WP_014886269.1\|885958_886996_-\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|365803
NC_018407.1\|WP_014886273.1\|889610_890453_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|271367
NC_018407.1\|WP_014886274.1\|890595_893886_-\|hypothetical-protein	unknown	unknown	unknown
NC_018407.1\|WP_014886267.1\|881563_882871_-\|cysteine--tRNA-ligase	unknown	unknown	gnl\|CDD\|234705
NC_018407.1\|WP_014886261.1\|865727_866678_+\|class-I-mannose-6-phosphate-isomerase	unknown	unknown	gnl\|CDD\|380413
NC_018407.1\|WP_011113929.1\|863297_865331_+\|PTS-sugar-transporter-subunit-IIA	unknown	unknown	gnl\|CDD\|182066
NC_018407.1\|WP_014886349.1\|871782_875592_+\|type-II-CRISPR-RNA-guided-endonuclease-Cas9	cas9	cd09643_cas9_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|273840
NC_018407.1\|WP_014886263.1\|869113_871303_-\|S8-family-serine-peptidase	unknown	unknown	gnl\|CDD\|173813
NC_018407.1\|WP_014886264.1\|875659_876586_+\|type-II-CRISPR-associated-endonuclease-Cas1	cas1	cd09720_cas1_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|187851
NC_018407.1\|WP_014886259.1\|862194_863058_+\|tRNA-lysidine(34)-synthetase-TilS	unknown	unknown	gnl\|CDD\|238950

Protein	Function_ID	Function_description	E-value
NC_018407.1\|WP_014886268.1\|883666_885955_-\|S8-family-peptidase	gnl\|CDD\|173793	cd04847, Peptidases_S8_Subtilisin_like_2, Peptidase S8 family domain in Subtilisin-like proteins. This family is a member of the Peptidases S8 or Subtilases serine endo- and exo-peptidase clan. They have an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. The stability of subtilases may be enhanced by calcium, some members have been shown to bind up to 4 ions via binding sites with different affinity. Some members of this clan contain disulfide bonds. These enzymes can be intra- and extracellular, some function at extreme temperatures and pH values.	7.15869e-69
NC_018407.1\|WP_014886263.1\|869113_871303_-\|S8-family-serine-peptidase	gnl\|CDD\|173813	cd07488, Peptidases_S8_2, Peptidase S8 family domain, uncharacterized subfamily 2. This family is a member of the Peptidases S8 or Subtilases serine endo- and exo-peptidase clan. They have an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. The stability of subtilases may be enhanced by calcium, some members have been shown to bind up to 4 ions via binding sites with different affinity. Some members of this clan contain disulfide bonds. These enzymes can be intra- and extracellular, some function at extreme temperatures and pH values.	1.21375e-41
NC_018407.1\|WP_014886266.1\|880777_881560_-\|23S-rRNA-(guanosine(2251)-2'-O)-methyltransferase-RlmB	gnl\|CDD\|129290	TIGR00186, Uncharacterized_tRNA/rRNA_methyltransferase_MG252, rRNA methylase, putative, group 3. this is part of the trmH (spoU) family of rRNA methylases [Protein synthesis, tRNA and rRNA base modification].	1.25358e-74
NC_018407.1\|WP_014886267.1\|881563_882871_-\|cysteine--tRNA-ligase	gnl\|CDD\|234705	PRK00260, cysS, cysteinyl-tRNA synthetase; Validated.	0
NC_018407.1\|WP_014886269.1\|885958_886996_-\|AAA-family-ATPase	gnl\|CDD\|365803	pfam00004, AAA, ATPase family associated with various cellular activities (AAA). AAA family proteins often perform chaperone-like functions that assist in the assembly, operation, or disassembly of protein complexes.	7.82917e-21
NC_018407.1\|WP_014886273.1\|889610_890453_-\|hypothetical-protein	gnl\|CDD\|271367	cd10336, SLC6sbd_Tyt1-Like, solute carrier 6 subfamily, Fusobacterium nucleatum Tyt1-like; solute-binding domain. SLC6 proteins (also called the sodium- and chloride-dependent neurotransmitter transporter family or Na+/Cl--dependent transporter family) include neurotransmitter transporters (NTTs): these are sodium- and chloride-dependent plasma membrane transporters for the monoamine neurotransmitters serotonin (5-hydroxytryptamine), dopamine, and norepinephrine, and the amino acid neurotransmitters GABA and glycine. These NTTs are widely expressed in the mammalian brain, involved in regulating neurotransmitter signaling and homeostasis, and the target of a range of therapeutic drugs for the treatment of psychiatric diseases. Bacterial members of the SLC6 family include the LeuT amino acid transporter. An arrangement of 12 transmembrane (TM) helices appears to be as a common topological motif for eukaryotic and some prokaryotic and archaeal NTTs. However, this subfamily which contains the majority of bacterial members and some archaeal members, appears to contain only 11 TMs; for example the functional Fusobacterium nucleatum tyrosine transporter Tyt1.	0.00191496
NC_018407.1\|WP_014886350.1\|897571_899839_-\|hypothetical-protein	gnl\|CDD\|338744	pfam13441, Gly-zipper_YMGG, YMGG-like Gly-zipper.	0.000784804
NC_018407.1\|WP_014886261.1\|865727_866678_+\|class-I-mannose-6-phosphate-isomerase	gnl\|CDD\|380413	cd07010, cupin_PMI_type_I_N_bac, Phosphomannose isomerase in bacteria and archaea, N-terminal cupin domain. This subfamily contains type I phosphomannose isomerase (PMI; E.C. 5.3.1.8; also known as mannose-6-phosphate isomerase) found in many bacteria (e.g. Bacillus subtilis) and archaea. PMI catalyzes the reversible isomerization of fructose-6-phosphate (F6P) and mannose-6-phosphate (M6P), the first committed step in the synthesis of mannosylated glycoproteins. The active site, located within the N-terminal jelly roll-like beta-barrel cupin fold, contains a single essential zinc atom and forms a deep, open cavity large enough to contain M6P or F6P. PMI type I also has a C-terminal beta-barrel fold which has diverged considerably from the N-terminal domain and is not included here. This subfamily does not contain an alpha helical domain that exists in eukaryotic and some prokaryotic PMIs. F6P is a substrate for glycolysis and gluconeogenesis, while M6P is a substrate for production of activated mannose donor guanosine 5'-diphosphate D-mannose, an important precursor of mannosylated biomolecules such as glycoproteins, bacterial exopolysaccharides and fungal cell wall components. PMI is also essential for survival, virulence and possibly pathogenicity of some bacteria and protozoan parasites, as well as for cell wall integrity of certain yeasts. Thus, PMI is a potential target against fungal infections causing serious illness or death.	3.76462e-72
NC_018407.1\|WP_011113929.1\|863297_865331_+\|PTS-sugar-transporter-subunit-IIA	gnl\|CDD\|182066	PRK09765, PRK09765, PTS system 2-O-a-mannosyl-D-glycerate specific transporter subunit IIABC; Provisional.	1.4205e-99
NC_018407.1\|WP_014886349.1\|871782_875592_+\|type-II-CRISPR-RNA-guided-endonuclease-Cas9	gnl\|CDD\|273840	TIGR01865, conserved_hypothetical_protein, CRISPR subtype II/NMENI RNA-guided endonuclease Cas9/Csn1. CRISPR loci appear to be mobile elements with a wide host range. This model represents a protein found only in CRISPR-containing species, near other CRISPR-associated proteins (cas), as part of the NMENI subtype of CRISPR/Cas locus. The species range so far for this protein is animal pathogens and commensals only.	0
NC_018407.1\|WP_014574791.1\|876572_876902_+\|CRISPR-associated-endonuclease-Cas2	gnl\|CDD\|226043	COG3512, COG3512, CRISPR-associated protein, Cas2 homolog [Defense mechanisms].	2.5705e-21
NC_018407.1\|WP_014886264.1\|875659_876586_+\|type-II-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|187851	cd09720, Cas1_II, CRISPR/Cas system-associated protein Cas1. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas1 is the most universal CRISPR system protein thought to be involved in spacer intergration. Cas1 is metal-dependent deoxyribonuclease, also binds RNA; Shown to possess a unique fold consisting of a N-terminal beta-strand domain and a C-terminal alpha-helical domain.	1.37637e-125
NC_018407.1\|WP_014886259.1\|862194_863058_+\|tRNA-lysidine(34)-synthetase-TilS	gnl\|CDD\|238950	cd01992, PP-ATPase, N-terminal domain of predicted ATPase of the PP-loop faimly implicated in cell cycle control [Cell division and chromosome partitioning]. This is a subfamily of Adenine nucleotide alpha hydrolases superfamily.Adeninosine nucleotide alpha hydrolases superfamily includes N type ATP PPases and ATP sulphurylases. It forms a apha/beta/apha fold which binds to Adenosine group. This domain has a strongly conserved motif SGGXD at the N terminus.	1.38547e-59

>NC_018407.1|WP_014886265.1|876901_877666_+|hypothetical-protein
MKIKIHNQEIENFNGLLLIDVKNTSEYLKRLYMYEKQHETSVFEINNVNVDISDCLIITPFSKYSDLISYTAKNVFTKLLGNINFEHDKILNEEYLDKEVVAKLNETLGRDIISLDTSYSKILKSIIKISEDYIDHEFIYSYLELLHWSKEIKTIILKDFDNIDLKRLSNLTQTTNLIIMKNDIIYDLEKHFEFFETYCLIDHDYENMIKIDNMPSFEYLLEDIFKVMVDEEFKTTMSFHQLEIIKKELKKHIN
>NC_018407.1|WP_014574791.1|876572_876902_+|CRISPR-associated-endonuclease-Cas2
MIEVNSRYMRIVIFYDIYETEEVDKLAKKFRDNLISLGYFMIQYSVYCKCIGSHTMYDYEIKKIRKILPVKANVRILLLSEKQYQNMLIISGEKNLNEIYNDREDYIEI
>NC_018407.1|WP_014886264.1|875659_876586_+|type-II-CRISPR-associated-endonuclease-Cas1
MQLPHPPEHLCSGFLFFMSKKVLEVSETEFISLHLDTLIVRKHGARVTLPLKTLDTILITNPYCNISVPLLNKIVENNINLIVCNTKFQPTMQILPISSYYSNKNYLWQIRWTDEQKNQIWKQLVKLKIINYARLINHLNITTDDNIEKLTNYYTNVVDGDLNNCEGHAAKLSFKLLYGEDFSRSQKDDIINKYLNYGYIVLMTYVSRTLIKNGLDNRIGIFHKSFNNHFALSCDIMEPFRPIIDYLTFSYLIKNQNDDFKSYKKDLFISFENFIFPNGKNLNQVIDMLVKAIINNKINERDFNIDWS
>NC_018407.1|WP_014886349.1|871782_875592_+|type-II-CRISPR-RNA-guided-endonuclease-Cas9
MNNSIKSKPEVTIGLDLGVGSVGWAIVDNETNIIHHLGSRLFSQAKTAEDRRSFRGARRLIRRRKYKLKRFINLIWKYNSYFGFKNKEDILNNYQEQQKLHNTVLNLKLEALNAKIDPKALSWILHDYLKNRGHFYEDNRDFNVYPTEELANYFGEYGYYKGIIDSKEDNDDKLEEGLTKYKFSNQHWLEEIKKVLSNQTGLPEKFKEEYESLFSYVRNYSEGPGSINSVSPYGIYHLDEKEGKVVQKYNNIWDKTIGKCSIFPDEYRAPKNSPIAMIFNEINELSTIRSYSIYLTGWFINQEFKKAYLNKLLDLLIKTNSEKPIDARQFKKLREETIAESIGKETLKDVEREEKLEKEDHKWKLKGLKLNTNGKIQYNDLSSLAKFVHKLKQHLKLDFLLEDQYTTLDKINFLQSLFVYLGKHLRYSNRVDSANLKEFSDSNKLFERVLQEQKDDLFKLFEQTDKDDEKILAQTHSLSTKAMLLAITRMTNLDNDEDNQKNNDKGWNFEAIKNFDQKFIDITKKNNNLSLKQDKRYLDDRFINDAILSPGVKRILREATKVFNAILKQFSEEYDVTKVVIELARELSEEKELENTKNYEKLIKKNSDKISERLEALDIAEDKIEDILKSPTKSYKVLLWLQQDHIDPYSQKEIAFEDILTKTEKTEIDHIIPYSISFDDSSSNKLLVLAESNQAKSNQTPYEFITSGNAGIKWEDYEAYCRKFKDGDTSLLDSTQRSKKFAKMMKTDTSSKYDIGFLARNLNDTRYATIVFRDALKDYANNHLVEDKPMFKVVCINGGVTSFLRKNFDKSWYAKKDRDKNIHHAVDASIISIFSNETKTLFNQLTQFADYKLFKNTDGSWKKIDPKTGVVTEVTDENWKQIRVRNQVSEIAKVINKCIQDSNIERKARYSRKIENKTNISLFNDTVYSAKKVGYEDQIKRKNLKTLDIHESAEENKNSKVKKQFVYRKLVNVSLLNNDKLADLFAEKEDILMYRANPWVINLAEQIFNEYTENKKIKSQNVFEKYMLDLTKEFPEKFSEAFVKSMLRNKTAIIYNVEKKVVHRIKRLKILSSELKENKLSNVIIRSKNESGTKLSYQDTINSIALMIMRSIDPTAKKQYIRVPLNTLNLHLGDQDFDLHNIDAYLKKPKFVKYLKANEIGDEYKPWRVLTSGTLLIHKKDKKLMYISSFQNLKDVIEIKNLIETEYKENDDSDPKKKKKANRFLMTLSTILNDYILLDAKDNFDILGLSKNRIDEILNSKLGLDKITK
>NC_018407.1|WP_014886263.1|869113_871303_-|S8-family-serine-peptidase
MPSIPDWLLHTQNSFLNKEYQMRITKIISVISIGVAATTVPISMNLNNKIETTLKNKRNIYKNIDLINNSSLVDQEASIVLDSKNNDHEVVGDFTYDFENNEYYSGFITFKGNVAIYDHDNILKLIRNQPQVLSATKSIALENYYLVTFAFKKNSEDQNQFDKFLDKYDLVGDFYPIDPNQEELFIQPYDDSDVVPNRQIYPGFNYDYINKRIWERYPNSFKKNFSINGYTDYERSNAITDVRQKVLYENQERIGVAILEASNREDRTKALIDTKDYYYFDKETNVTNNLSPYKEGNKYYLPKPNDHATKVAAIVSGRHGVNTYHDLYGLRLDTSTNSSDLYSGLEDEIAYIKRMKNIKIVNNSWGILHKKESDLNNSNRNWFNYNYYSRYLDLLTANERELIFVKSAGNNGDAVKDYLKNLSSFTLSYNSIVVGSNDRAEKLSSFSSRGSLTYNAPLILATGEKYNFWGKYQEYNSQGTSFSAPFVSGVIANTLVQYKEKYKLGINSIIAKAILGVSSSNVKKAKSELSDLSENGPEISTQVGLNKDYGVGLLNYRKIKSAFDNLKYIRWTNNKQVLVNNIWTNKEDDRTLPVARLKLKKGDELRISLSWLFKPKNTTLYNTKKNEAILTDSIDYSLQDFELYLYKEGDKLPVQSTLRNNYEFIKIRANEDANYKIVVKKWRNENPFNQTELALSWTVSDKYYSFSDYPSELYYSYPYDLYGNNSQIF
>NC_018407.1|WP_014886262.1|867762_869205_-|hypothetical-protein
MTNIILLATTLLNYIILTLMIFMATTRKFSKKILVTLGLLSFITLPIIQTSCSNTGEKKEQNQPDFWNEGLYKVGLKLKEEFNNPSLSLSPIKITPNDNDKPFSELKPTNNFESKIFNSLHQYDYKQNIPSSELSDYIKTNANKTNQNQERINTEVNMINSWSNIFNTNHELPYLFNTNPVLKTDEITVNIDKFGFGSILGMLRYTTLDNLEQNYYLLYVLTTKSVSQALSKNINKVLDYYPHRIGFTYNHYLVNGEKQTDYKTTTFNNVKSKIYYESPDSDIAIIRYVMFSEDRPMYDVELNNMMEYSPLKNYLNTIVPIFGVDLMFDRENALNYTALKKDSGSDLSRTLFVNPFRIRNNTKISPVPNTLTASLLDSVPSTVGSGTYFLMRNEQGSIVKVLNGVVGGQYLSTSDQDKLASSRESNNLNFDFVVDNNFVGLSYINHNLVPLKSVISKIRADYNKHLEDMLLYAIKGGISR
>NC_018407.1|WP_014886261.1|865727_866678_+|class-I-mannose-6-phosphate-isomerase
MVTVPLIKNTKKKMHKPKILKLLPHFEYRVWSGDKIKTLFNLDQEKIGEAWIISALENKSAKISENQTLLQFYQDKDNAYFFNSFNLENQYPLLVKIIDAKADLSVQIHPDDAYAKQLNSLGKTECWYILDTKKDNQIVFGHQAKTLDQFKSMVDHKQWNDLLLRKPIKKDDFIYVPSKKLHAIKADTLIYELQQSSDITYRVYDYDRLDQGKKRELHLEHVFNLVDCPDLDLSKEEISNTSDYLVANKLFNLIKIENKDQNTYKFDDAQWVQLTVIKNHGTINNLQANLYDSFIIAHNEPIVIKGNLTCLISYVK
>NC_018407.1|WP_014886260.1|865333_865780_+|hypothetical-protein
MKKKIFKDQKQKNKFLFYLLLVITLVALLIGIILLALNTANYNDQVARTRDYLVLQTDKSSIESANFNMQGLMLGKFKDTLMNVKNQAELNTTVAKIIQDNQLISTIDAPAFAYGIFMVLVGILTGLATILFGNSTFNKKYQKEDAQA
>NC_018407.1|WP_011113929.1|863297_865331_+|PTS-sugar-transporter-subunit-IIA
MSIKERGDPKTMEINKPEFVFINLKQKNRDDILKELATRAVKLNLATNQDELYQAFLAREKESSTALPDLFGIPHARTATVKQPALLFAKLHQAVEWDEEKKQVQYLFVILVPQDASNTHLEIISNVAKLIMDKNANQKLISSNNPDEISKLIVSYLNSSATQTTNNNSEKLILALTACPVGVAHTYLAAEKLSEAATKMGYRIKVETHGSVGAKNPFSEEEIKNADLVIVAADIGLDTSRFNHKRVFQTTIKPAIHEPEKLINEAFNKATTLNQKGSNQTTLGQDAKRPGIMRHILAGVSYMVPFVILGGICIAIAIGVGKLIYGQQYNAVEGDFFFYLLKIGVVAFTLMIGALGAFIANSIGGRAAIAPAFIVCVLANTPEAIFPIAGIKVVTAMGFIGSIFFGLAIGFTVKWINTWRINKALAPIMPVFVIPLGVGLFYALIAVFVLGAPIGFIMDKFIKALEEAFRNGNIGIGLGIGLGILIGAMTGFDMGGPVNKVAFLTCATLITSNIYEPMGMMAAAIPIAPLGMGLCTLIFRKKFNEGEKSLGISAILMGTIGISEGAIPFAVTDPKKAIISNVVGSAVAGAIAGAFGVTCAAAHGGPIVGFLLAVSSNRPQGLAWGLSFFFLAIIIGSLVTCFMYGFWRTKPAEAGVVLPVNKWTFWRKKKANLNIQG
>NC_018407.1|WP_014886259.1|862194_863058_+|tRNA-lysidine(34)-synthetase-TilS
MSTTNKKQYLIGVSGGPDSIYLLDRYQDQIKVACHINYNKRPTALRDQLIVSDYCLKNKIPLEILSVSPSYQYHKNFQDQARKIRYDFFLSTGLKYQVDQCLIAHHKDDFLETAIMQYDKNQEQLFYGLHQDSSYRSLKIFRPLLNLWKDEILSYLEQDNIVYGVDESNFLSTYQRNKIRTNLSKLTQEQKQAQLDFFLELNKKNQVRYQSVKDFFSSWDCNYLDLINSLEYYNLLYLWFSKNNIKYSKQKAENILSFLQKKNNKRFRLKAGVYLIKEGIKLKIVKL
>NC_018407.1|WP_014886266.1|880777_881560_-|23S-rRNA-(guanosine(2251)-2'-O)-methyltransferase-RlmB
MKNQFKPQFNNKHQNKHKKDRLCLFGYNAVYEGLINNLKIKKVYLHKEDHPLLKLIKQKGIEYELHTIKWFDNQYRDLSNHQGFVAEIDGSSLTISFNQFCEKIKKEQQGIVVVLDQIHDPGNFGGILRSCLAANVLGVIFKKDNQASINNTVIKTSLGACFYLNLIEVANLSYAIKDLQDKYGFWSYVSNLSDQAQDYNVDYANKSILIVGNEQKGVSSQLIKNADYQIKIPMYTDKIQSLNVSVATGIMLFNMKQKIK
>NC_018407.1|WP_014886267.1|881563_882871_-|cysteine--tRNA-ligase
MKLYDTLTKTNVDINANEINIYVCGPTVYDHIHIGNLRPIVTFDVLRRLLEHSNKKVNFVHNITDIDDKIINQAQRLNLSEEEVTKRYTSAYFEILDELNIKLPKIVKVTDVMNGIIKYIEKIYDKQYAYELDGDIYFDTTKIADYGVLSKRKLDEQISGIRVKSNENKTSPNDFVLWKKTIEGIKWNSRFGLGRPGWHTECAYIIDQEFKQKGFVIHGGGIDLVFPHHENENAQNLALHNKNLVNCWVHVGYLLIDNEKMSKSLNNFIYVKHLIESHNYRAIRWVFYNTAHTQPLNFDGTIIKAAQKDVEKIISTVNRFRTFLIANKNNIPSSSLVCEEFKKALFDNLNFANATKVIWDLIKVLNESIAYKKIDENIWAYQQLIWCLEIYGIVPDMIHNEQIIDQINQWTKLLNNKDYEKADTIRNKLINKKVL
>NC_018407.1|WP_041593708.1|883050_883389_-|hypothetical-protein
MSIDRNDEDYMEQLTNLWNVRIAPQAGIFEVKPESASKNLDELTGDDFTFKDRINSYAEVMGPISVVNKKQNKDNNGYIYTLKYKVRLNNKVNDDTWYEGQSDVQLFDKVNV
>NC_018407.1|WP_014886268.1|883666_885955_-|S8-family-peptidase
MNEILKLRVNFSDAKPNPVRASAANIPKYQSVDLKKIEDLKNDLNYVIEYWNNVNQSLPIKPLINIHYKELIAKSNRIKGLLENSSQKNNESVVGAKFSDDGKHKHIITHCVEKKVLVNGLKRIQNVIYIFKKQFKNKITHGDIIKINSGQYNELFNNDQNQSVSKSSFINIIVDAYYVEKISVQEKVSEIARNNGLITIYKTGYDLKKLLNHLGLDVLDSQIIDETTLMLEPRNYEILRLKAPQLISMAVSDISLIDNLPSIGLNNEWQIKIDDPKDEPIIGVIDTLFDKNVYFSKWVEYEEHIPVGVTKSTRDYFHGTAVSSIIVDGPSFNKKELNDGCGRFRVKHFGVALADKFNTSTLMRKIEEIVKQNKHKIKVWNLSLGSAHEINNNFISWEGSILDKIQYEHDVIFVVAGTNKHEKFPVEKIGAPADSINSLIVNSVDHRKNPSIFSRRGKVLSFFNKPDISYYGEGIRTCTPIGEDICQGTSFAAPWIARKLAYLIYVLDFSIEEAKALIIDSAIKWPSHKQINNDERETINKEELIGYGVVPIKIDDIVKTATEDIKIVISGVAEEFNTYFHNIPIPHQNNQQPFIARATLCYLTKCSRNQGVDYTDTELDFKFGQVRVDKNKNEKIDDLKKNKQSEDKNLNLREKKVRSEYRKWDNVKHISETLYTPKGYKKKPRNGTNSWGISIKKKNRSTNSQSESIKFGLVITLKEINGLNKINDFLNLCQMNNLIVHKVNIKKHVDIKEKAKEDINFE
>NC_018407.1|WP_014886269.1|885958_886996_-|AAA-family-ATPase
MKKETVINLIRYYTENDDYRFRNEAYEIARAFDKAGDRELAEYIMALLSDGLSFVPQINEDNLVFLKKIKVNGDPLPLPKQIESDLLGIVNALKSGVNKFLFQGSPGTGKTESVKHLARILGRDCYVVDFDTLIDSKLGQTTRNISNLFQEINKYLIAQKSVILFDEIDALALDRTNSRDVREMGRATTSVLKGLDNLDPNVLLIATTNLYNHFDKALTRRFDYIINFNRYEKEDLIRISEILLNSYLPKFKHASSNVRLFKKIISSMSDIPYPGDLKNLIRSSLAFSNPNDEYDYLKRLYIAVNNEDESEISLNNIQDKGFTVREIEILTGISKSKVARELKSR
>NC_018407.1|WP_014886272.1|888711_889278_-|hypothetical-protein
MKIDQVTKLIFMKINILNRKIIMKSISIFTWITLIISLIFLPIFIYILNDQLRWATYPSIQEQISYSLTHFSNWNILKFFVPLWTVILFSFLLYFISLKTVHKNNSLNSLLVVRNVGFINPKLSKRNDLIIASIMLFLMSLVIMAFASLILPSTVYIHMAVTIPFFVLMLIHLFLNMFNFIAIIKEKN
>NC_018407.1|WP_014886273.1|889610_890453_-|hypothetical-protein
MKSKKVNKENEEIAIEEQEVQSNEVQQEVSYEFEKGKIRRRIGILPIILSITGIIAVWIGAWLISYVIGSITQRVLDLTEVNGAEMSNFGEIFKNELTKISYVMLAFGGILIIAGIALLVVSIILVIKDFKNRNKKLELFFIKYQEMLEESEQFNLKLDNLNRINQENLNKINLLNQEITYLRKNNNNSLAIIQQQKTIEKVAPKPQQVPQLQQPKLLINYNPQINKTQQNQQVLKKTVVRTTQTLIKNIEPKRVQITAGPTLPATKRSLINQPWSPTKR
>NC_018407.1|WP_014886274.1|890595_893886_-|hypothetical-protein
MADRPMNNKAKLAKVAKLKKSLSIRIKKQLLYGAVAFASAGLISGIIGASISATIVSDNKLTSIIQSNSNLVTSTNEGFNDKIDPRKPNPDLNKFIGDLSASYADREKGIVDLTTNQIKPFDQNKLSDAYIGANGELLTKEQAAASLLPEYKLIKKYAYGSGDKLYDSLDELKNNFWNNISENSIAYYVFKGKNGQNHYFNPLNKNDINKFKEFVINQVINGDDKFSLDYYIPYSNDKNNSTYVSLSKSSAVFSDQGNFTLSSNANLGRAFDQKINQLFYQKTNDIFSQSSFLPTISLPKAAISVHRRSGLYLDYPTAPNYGFDKYFGIGFKDQNQDWNNVSISDKLVINQGFSVNDLIANLQKISSPDFVSKNFDSVQLNSRYQRNNKGLIIPSTTSLDSSVSNYGLGLNQEQDNLKPLIATYSSIGRNKSDTEVAKLLDKEFLKTHAYIKNRSFITKDGVKLFGKNIGLIYKGNLYGYTVHGDPYIAKNNYNGDHRNKVFIYHDTFSNNSWWLKAGNFNKDGFIQYSPYYFGFGNLENANKVYGLYPESVGISNDTLHVGADIFDLTTNRRNAAGLVADIKNPGKRWDGWVSALTFIPSYWESYRISAENRKLYLNVDVDWKLDNQTITNKEEFIRKISEKFGLNYSGNNNFAINPNSEFYKSYLSQSYINGASTYAILSGFSNFSSLNKILDENFLNVAKSQVNKFAQFYDKTVATFSLGNGRDNRFVDYVFTYYDLLRANSNLSYNSINLSSAYNTNFLTRHVFDVKDIKPVLTYGTNKQPLFEIDLSSDKKNLLIQSLGSNQNNFKQALLSTLTRLPLDQLHNSLTNLSNHYKVDGIDLSAYSYDLKYQKYLELNSNNNQVKLKAEYQTNNKINLPILPKGIDQDQFATLVTDNNTWFPITYMWKFYQEALSRLSSDSIAKSGDQIVTDPNNLLVLQGGINTFTELRYGKYYNITGTDINLSIDSSSDKHSLFFDSIQSRELTKYFIGQFSNKANVDDNYEIVLYYNNATNQKLGLVRGNYKNLSRLEKEAKNRALIELKPKVDENYKFYIDKDTTTKIKNTVFTLYPLKLQNGRTLYFDSLDHLKAYRGE
>NC_018407.1|WP_014886275.1|893955_897552_-|hypothetical-protein
MKKSKLFKKQLAIGLFILPSFILSSCNNVIRPPIVRQSSELEKTAPSFAGSSEEYKGEKVNKESYYSLLSSNDLVENYQSYTDPKTKSLYDNVFAKNFYEPSALKEGFVGFDQNVYAKKEQAQDSLYREDNVLFYDGSLFSSQADLTAYIETKKDLLSEEAGKIVVLRNSDNTNSEPINVDQLRKNSQTERLKLFNYITKNSKLQVEINKGDTTTTINVDPSLNLSDTVQQIKSNVPAKDIPVHYQRISANNNASQYFVDTSEDDNYNFYGPLLFQGNADINTITNPDNWTKTSTLPIGLYRSISSDIVTSGFDFLLGEISIGDEKEIKILNRNLETKDFIFYFPYSEQELRTAQYSNNLKLNLAWADFIYQLKIQQPEVYKGLLDTVAKFNKAKRFSSFYKIPILYSYLLDSLIANKAKEQLIFLLKDFFIKLSNKIDSTLQLINSYAKPSGFDILANRDLNGNSFSFKVYFGIGNNDFDVSASLENLLPNLYDQFSNLTIFMTMLMLSNIVAATPGAILNEQGLIDTIKGINLFGNKQIQEIETKIKNSWPTLSAIWWLLSAQNLTQALFVAGFSPSSLMQNNLDENTLRIINGFQDAFSLKWIRNQFLQTSAIETIKNEIPLVLRDVPTERPKVRELFADIPKNVLEYLQGINVDFGTVIHIRNLYRKIKEVQKTDLKKAAEYLSQVSTFVKSLSSDHYVDLYLTYMQQFPSVINNKPEARSASLSLRSSIRLVEDNSEQPSTSNSNENANKIVINNSETFSTSKKAGSPAILQNPKEVNVNELSALEKLQKDQKKLQTVFVISSVLEGFGTILSSAVTVNTLINSPSVLNRTKDLVIAGLQTAASTISVSLSLAGEFTSFIKKSTAIVGALFPVFYGLTVAMHIAVLLVNVFFPTEEEYYYVFQIGQVQYVWTGGYKKTQLLGLKTLKERTIKDIKLIKPIQITRPQNASFLYYNQKQYSPTDIDKIKDLQITEWLENKNLYAMDKAYINNVNKIYSLHKPTRGSSVAGVYASSNLIDLYQNLLATLLSNSLITIPHTVSTSLNGSYISNKNNLSAVVVRDELNKAQNWTLVQVPSNEAGGYLYEPSKNIKITEIVSYDPETKIGVAKGMGKFGLNSTEFIFYNNNDASASHNTLKAKFNELLKTRKTVYLDSVGSRTKLIYRSELFSVFDQKLKKTIFFLSLRDAHNYIDQWM
>NC_018407.1|WP_014886350.1|897571_899839_-|hypothetical-protein
MIMSKKVPLKKTILLSSLGVVTAATAVAIPVSLTTANLNRVIQPIQNKSADSSKPTNPNNRPSRGNTQYEPINGGSDFSKPTKPNNIPSRGNTQYEPINGGSDSSKYATGSEGYDDTSAHEGDDGIINQNFHPEEGMDSNEAINSPGVSVPGLVPHEGMITDNNGNLSKNLNVGAAAGGVIGGIAAVGAIGAGIGLLLNTYKSSKDVTPKPTSTVEKSTVLRDFNLTKSNIADLADASLERFDLIEIKDKDGKRGAYWAPKFWFDNDRKNTGIVGGEYVANPQFRSFLKYINQNPNEMGNPNAIINYLAKQNSGEINFEDVAVGSNSNVTSPSAFRRSNSTSSSSTDSWESYDLDELFDSSDSKVAKPNQSDKDSAKRFLSRSNSTVSTSSTSSSSNKYSILSEGGIARSYSISDIEKELTKTSNIKPSIGQTSNLSFLTVLSDGFRGRRLEKRIVPRDNLGRPLISQPVNVVAKKLTREGNNAFEQGFYLAQVTYNGANNERKVSPVFLPVESLSEANKYETAASLKSLFSSRSNSTDPSVYAAALLTENLYQSGSSTYAIPRVDLYGSVSDYQSIYDSSKNSIILVTGDNKEKQETDYSIYARIDKTRKPAVASAATINEANEMKKRQQALRELAEVPPPLPERNYDTIKSTSSTEKGYSVTLNDTQASSLGSSILSRLNRWGSQIKSVFTKKSKDDSIQFPWYRPHFGMWDETELNKVSANNNVPRPTKIKNRLTSWSSSIRSKFSGFFTKI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_018407_2	2.39\|880234\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880234-880263	30	NZ_CP004866	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB7921, complete sequence	2134-2163	3	0.9
NC_018407_2	2.39\|880234\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880234-880263	30	CP045775	Bacillus paranthracis strain CFSAN068816 plasmid p2CFSAN068816, complete sequence	185-214	3	0.9
NC_018407_2	2.41\|880366\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880366-880395	30	NZ_CP004866	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB7921, complete sequence	2134-2163	3	0.9
NC_018407_2	2.41\|880366\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880366-880395	30	CP045775	Bacillus paranthracis strain CFSAN068816 plasmid p2CFSAN068816, complete sequence	185-214	3	0.9
NC_018407_2	2.11\|878384\|30\|NC_018407\|CRISPRCasFinder,CRT	878384-878413	30	MN694034	Marine virus AFVG_250M807, complete genome	39673-39702	5	0.833
NC_018407_2	2.12\|878450\|30\|NC_018407\|CRISPRCasFinder,CRT	878450-878479	30	MH616963	CrAssphage sp. isolate ctbg_1, complete genome	31854-31883	5	0.833
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	MT939241	Enterococcus phage 9183, complete genome	50039-50068	5	0.833
NC_018407_2	2.37\|880102\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880102-880131	30	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	458576-458605	5	0.833
NC_018407_2	2.39\|880234\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880234-880263	30	NZ_CP022446	Bacillus cereus C1L plasmid pC1L1, complete sequence	39784-39813	5	0.833
NC_018407_2	2.39\|880234\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880234-880263	30	NC_014557	Bacillus sp. BS-02 plasmid pBS-02, complete sequence	2774-2803	5	0.833
NC_018407_2	2.39\|880234\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880234-880263	30	NZ_CP024656	Bacillus cereus strain MLY1 plasmid pMLY1.2, complete sequence	6943-6972	5	0.833
NC_018407_2	2.39\|880234\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880234-880263	30	NZ_CP024656	Bacillus cereus strain MLY1 plasmid pMLY1.2, complete sequence	97696-97725	5	0.833
NC_018407_2	2.39\|880234\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880234-880263	30	NZ_CP013669	Piscirickettsia salmonis LF-89 = ATCC VR-1361 plasmid pPSLF89-4, complete sequence	29909-29938	5	0.833
NC_018407_2	2.39\|880234\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880234-880263	30	NZ_CP013789	Piscirickettsia salmonis strain PM58386B plasmid p3PS7, complete sequence	19239-19268	5	0.833
NC_018407_2	2.39\|880234\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880234-880263	30	NZ_CP013817	Piscirickettsia salmonis strain AY3800B plasmid p1PS10, complete sequence	15543-15572	5	0.833
NC_018407_2	2.39\|880234\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880234-880263	30	NZ_CP013793	Piscirickettsia salmonis strain AY6297B plasmid p2PS8, complete sequence	15538-15567	5	0.833
NC_018407_2	2.39\|880234\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880234-880263	30	NZ_CP013809	Piscirickettsia salmonis strain PM31429B plasmid p3PS12, complete sequence	19236-19265	5	0.833
NC_018407_2	2.39\|880234\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880234-880263	30	NZ_CP013784	Piscirickettsia salmonis strain PM49811B plasmid p3PS6, complete sequence	19228-19257	5	0.833
NC_018407_2	2.39\|880234\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880234-880263	30	NZ_CP039089	Piscirickettsia salmonis strain Psal-111 plasmid unnamed2, complete sequence	29630-29659	5	0.833
NC_018407_2	2.39\|880234\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880234-880263	30	NZ_CP013798	Piscirickettsia salmonis strain AY6532B plasmid p2PS9, complete sequence	28292-28321	5	0.833
NC_018407_2	2.39\|880234\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880234-880263	30	NZ_CP013978	Piscirickettsia salmonis strain CGR02 plasmid pPSCRG02-4, complete sequence	4528-4557	5	0.833
NC_018407_2	2.39\|880234\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880234-880263	30	NZ_CP013978	Piscirickettsia salmonis strain CGR02 plasmid pPSCRG02-4, complete sequence	63507-63536	5	0.833
NC_018407_2	2.39\|880234\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880234-880263	30	NZ_CP012509	Piscirickettsia salmonis strain PM32597B1 plasmid pPSB1-1, complete sequence	43567-43596	5	0.833
NC_018407_2	2.39\|880234\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880234-880263	30	NC_014633	Ilyobacter polytropus DSM 2926 plasmid pILYOP01, complete sequence	826389-826418	5	0.833
NC_018407_2	2.39\|880234\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880234-880263	30	NZ_CP013822	Piscirickettsia salmonis strain PM25344B plasmid p1PS14, complete sequence	43615-43644	5	0.833
NC_018407_2	2.39\|880234\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880234-880263	30	NZ_CP039052	Piscirickettsia salmonis strain Psal-081 plasmid unnamed2, complete sequence	28524-28553	5	0.833
NC_018407_2	2.39\|880234\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880234-880263	30	NZ_CP013945	Piscirickettsia salmonis strain PSCGR01 plasmid pPSCRG01-4, complete sequence	37558-37587	5	0.833
NC_018407_2	2.39\|880234\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880234-880263	30	NZ_CP039057	Piscirickettsia salmonis strain Psal-098 plasmid unnamed2, complete sequence	28524-28553	5	0.833
NC_018407_2	2.39\|880234\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880234-880263	30	NZ_CP038933	Piscirickettsia salmonis strain Psal-025 plasmid unnamed1, complete sequence	55671-55700	5	0.833
NC_018407_2	2.39\|880234\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880234-880263	30	NZ_CP038901	Piscirickettsia salmonis strain Psal-006b plasmid unnamed3, complete sequence	28524-28553	5	0.833
NC_018407_2	2.41\|880366\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880366-880395	30	NZ_CP022446	Bacillus cereus C1L plasmid pC1L1, complete sequence	39784-39813	5	0.833
NC_018407_2	2.41\|880366\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880366-880395	30	NC_014557	Bacillus sp. BS-02 plasmid pBS-02, complete sequence	2774-2803	5	0.833
NC_018407_2	2.41\|880366\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880366-880395	30	NZ_CP024656	Bacillus cereus strain MLY1 plasmid pMLY1.2, complete sequence	6943-6972	5	0.833
NC_018407_2	2.41\|880366\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880366-880395	30	NZ_CP024656	Bacillus cereus strain MLY1 plasmid pMLY1.2, complete sequence	97696-97725	5	0.833
NC_018407_2	2.41\|880366\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880366-880395	30	NZ_CP013669	Piscirickettsia salmonis LF-89 = ATCC VR-1361 plasmid pPSLF89-4, complete sequence	29909-29938	5	0.833
NC_018407_2	2.41\|880366\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880366-880395	30	NZ_CP013789	Piscirickettsia salmonis strain PM58386B plasmid p3PS7, complete sequence	19239-19268	5	0.833
NC_018407_2	2.41\|880366\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880366-880395	30	NZ_CP013817	Piscirickettsia salmonis strain AY3800B plasmid p1PS10, complete sequence	15543-15572	5	0.833
NC_018407_2	2.41\|880366\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880366-880395	30	NZ_CP013793	Piscirickettsia salmonis strain AY6297B plasmid p2PS8, complete sequence	15538-15567	5	0.833
NC_018407_2	2.41\|880366\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880366-880395	30	NZ_CP013809	Piscirickettsia salmonis strain PM31429B plasmid p3PS12, complete sequence	19236-19265	5	0.833
NC_018407_2	2.41\|880366\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880366-880395	30	NZ_CP013784	Piscirickettsia salmonis strain PM49811B plasmid p3PS6, complete sequence	19228-19257	5	0.833
NC_018407_2	2.41\|880366\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880366-880395	30	NZ_CP039089	Piscirickettsia salmonis strain Psal-111 plasmid unnamed2, complete sequence	29630-29659	5	0.833
NC_018407_2	2.41\|880366\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880366-880395	30	NZ_CP013798	Piscirickettsia salmonis strain AY6532B plasmid p2PS9, complete sequence	28292-28321	5	0.833
NC_018407_2	2.41\|880366\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880366-880395	30	NZ_CP013978	Piscirickettsia salmonis strain CGR02 plasmid pPSCRG02-4, complete sequence	4528-4557	5	0.833
NC_018407_2	2.41\|880366\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880366-880395	30	NZ_CP013978	Piscirickettsia salmonis strain CGR02 plasmid pPSCRG02-4, complete sequence	63507-63536	5	0.833
NC_018407_2	2.41\|880366\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880366-880395	30	NZ_CP012509	Piscirickettsia salmonis strain PM32597B1 plasmid pPSB1-1, complete sequence	43567-43596	5	0.833
NC_018407_2	2.41\|880366\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880366-880395	30	NC_014633	Ilyobacter polytropus DSM 2926 plasmid pILYOP01, complete sequence	826389-826418	5	0.833
NC_018407_2	2.41\|880366\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880366-880395	30	NZ_CP013822	Piscirickettsia salmonis strain PM25344B plasmid p1PS14, complete sequence	43615-43644	5	0.833
NC_018407_2	2.41\|880366\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880366-880395	30	NZ_CP039052	Piscirickettsia salmonis strain Psal-081 plasmid unnamed2, complete sequence	28524-28553	5	0.833
NC_018407_2	2.41\|880366\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880366-880395	30	NZ_CP013945	Piscirickettsia salmonis strain PSCGR01 plasmid pPSCRG01-4, complete sequence	37558-37587	5	0.833
NC_018407_2	2.41\|880366\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880366-880395	30	NZ_CP039057	Piscirickettsia salmonis strain Psal-098 plasmid unnamed2, complete sequence	28524-28553	5	0.833
NC_018407_2	2.41\|880366\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880366-880395	30	NZ_CP038933	Piscirickettsia salmonis strain Psal-025 plasmid unnamed1, complete sequence	55671-55700	5	0.833
NC_018407_2	2.41\|880366\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880366-880395	30	NZ_CP038901	Piscirickettsia salmonis strain Psal-006b plasmid unnamed3, complete sequence	28524-28553	5	0.833
NC_018407_2	2.4\|877922\|30\|NC_018407\|CRISPRCasFinder,CRT	877922-877951	30	NC_009929	Acaryochloris marina MBIC11017 plasmid pREB4, complete sequence	39141-39170	6	0.8
NC_018407_2	2.8\|878186\|30\|NC_018407\|CRISPRCasFinder,CRT	878186-878215	30	NZ_CP045370	Microbulbifer sp. THAF38 plasmid pTHAF38_a, complete sequence	78726-78755	6	0.8
NC_018407_2	2.11\|878384\|30\|NC_018407\|CRISPRCasFinder,CRT	878384-878413	30	NC_018878	Bacillus thuringiensis Bt407 plasmid BTB_502p, complete sequence	189273-189302	6	0.8
NC_018407_2	2.11\|878384\|30\|NC_018407\|CRISPRCasFinder,CRT	878384-878413	30	MK448960	Streptococcus phage Javan492, complete genome	40800-40829	6	0.8
NC_018407_2	2.11\|878384\|30\|NC_018407\|CRISPRCasFinder,CRT	878384-878413	30	MK448762	Streptococcus phage Javan447, complete genome	40933-40962	6	0.8
NC_018407_2	2.11\|878384\|30\|NC_018407\|CRISPRCasFinder,CRT	878384-878413	30	MK448795	Streptococcus phage Javan527, complete genome	47013-47042	6	0.8
NC_018407_2	2.11\|878384\|30\|NC_018407\|CRISPRCasFinder,CRT	878384-878413	30	MK448774	Streptococcus phage Javan487, complete genome	32956-32985	6	0.8
NC_018407_2	2.11\|878384\|30\|NC_018407\|CRISPRCasFinder,CRT	878384-878413	30	MK448773	Streptococcus phage Javan485, complete genome	35728-35757	6	0.8
NC_018407_2	2.11\|878384\|30\|NC_018407\|CRISPRCasFinder,CRT	878384-878413	30	MK448958	Streptococcus phage Javan486, complete genome	41006-41035	6	0.8
NC_018407_2	2.11\|878384\|30\|NC_018407\|CRISPRCasFinder,CRT	878384-878413	30	MK448783	Streptococcus phage Javan503, complete genome	37320-37349	6	0.8
NC_018407_2	2.11\|878384\|30\|NC_018407\|CRISPRCasFinder,CRT	878384-878413	30	MK448954	Streptococcus phage Javan476, complete genome	40673-40702	6	0.8
NC_018407_2	2.12\|878450\|30\|NC_018407\|CRISPRCasFinder,CRT	878450-878479	30	NZ_LR215018	Mycoplasma canis strain NCTC10146 plasmid 9	8231-8260	6	0.8
NC_018407_2	2.19\|878912\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	878912-878941	30	NZ_LR214939	Mycoplasma salivarium strain NCTC10113 plasmid 2	18509-18538	6	0.8
NC_018407_2	2.25\|879308\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	879308-879337	30	NC_049490	Acinetobacter phage vB_AbaP_Berthold, complete genome	17571-17600	6	0.8
NC_018407_2	2.25\|879308\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	879308-879337	30	MN709128	Acinetobacter phage Berthold, complete genome	17571-17600	6	0.8
NC_018407_2	2.29\|879573\|31\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	879573-879603	31	NZ_CP009639	Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence	202665-202695	6	0.806
NC_018407_2	2.29\|879573\|31\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	879573-879603	31	NZ_CP053963	Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence	244249-244279	6	0.806
NC_018407_2	2.33\|879838\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	879838-879867	30	NC_010631	Nostoc punctiforme PCC 73102 plasmid pNPUN01, complete sequence	203926-203955	6	0.8
NC_018407_2	2.33\|879838\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	879838-879867	30	JX145342	Clostridium phage phiMMP04, complete genome	2851-2880	6	0.8
NC_018407_2	2.33\|879838\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	879838-879867	30	KY197768	Bacillus phage phi105 N-acetylmuramoyl-L-alanine amidase CwlH gene, complete cds	2121-2150	6	0.8
NC_018407_2	2.33\|879838\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	879838-879867	30	NZ_AP014952	Klebsiella oxytoca strain JKo3 plasmid pKO_JKo3_1, complete sequence	183678-183707	6	0.8
NC_018407_2	2.37\|880102\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880102-880131	30	MH552532	Siphoviridae sp. isolate ctbf3, complete genome	20004-20033	6	0.8
NC_018407_2	2.38\|880168\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880168-880197	30	AP019522	Staphylococcal phage MR003 DNA, complete genome	45032-45061	6	0.8
NC_018407_2	2.39\|880234\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880234-880263	30	NZ_CP044979	Bacillus thuringiensis strain BT62 plasmid pBT62A, complete sequence	207117-207146	6	0.8
NC_018407_2	2.39\|880234\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880234-880263	30	NZ_CP020859	Lactobacillus salivarius strain ZLS006 plasmid unnamed1, complete sequence	3901-3930	6	0.8
NC_018407_2	2.39\|880234\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880234-880263	30	NZ_CP023312	Vibrio anguillarum strain VIB12 isolate Sea bass plasmid p292, complete sequence	10297-10326	6	0.8
NC_018407_2	2.40\|880300\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880300-880329	30	AP019522	Staphylococcal phage MR003 DNA, complete genome	45032-45061	6	0.8
NC_018407_2	2.41\|880366\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880366-880395	30	NZ_CP044979	Bacillus thuringiensis strain BT62 plasmid pBT62A, complete sequence	207117-207146	6	0.8
NC_018407_2	2.41\|880366\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880366-880395	30	NZ_CP020859	Lactobacillus salivarius strain ZLS006 plasmid unnamed1, complete sequence	3901-3930	6	0.8
NC_018407_2	2.41\|880366\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880366-880395	30	NZ_CP023312	Vibrio anguillarum strain VIB12 isolate Sea bass plasmid p292, complete sequence	10297-10326	6	0.8
NC_018407_2	2.45\|880630\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880630-880659	30	NC_011720	Borreliella burgdorferi ZS7 plasmid ZS7_cp32-3+10, complete sequence	16482-16511	6	0.8
NC_018407_2	2.45\|880630\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880630-880659	30	NC_011720	Borreliella burgdorferi ZS7 plasmid ZS7_cp32-3+10, complete sequence	44181-44210	6	0.8
NC_018407_2	2.45\|880630\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880630-880659	30	NZ_CP031402	Borreliella burgdorferi strain MM1 plasmid plsm_lp28-3, complete sequence	7113-7142	6	0.8
NC_018407_2	2.3\|877856\|30\|NC_018407\|CRISPRCasFinder,CRT	877856-877885	30	NZ_CP013139	Pseudoalteromonas sp. Bsw20308 plasmid pPBSW1, complete sequence	645253-645282	7	0.767
NC_018407_2	2.6\|878054\|30\|NC_018407\|CRISPRCasFinder,CRT	878054-878083	30	MN693734	Marine virus AFVG_250M835, complete genome	14131-14160	7	0.767
NC_018407_2	2.6\|878054\|30\|NC_018407\|CRISPRCasFinder,CRT	878054-878083	30	MN694626	Marine virus AFVG_250M967, complete genome	14297-14326	7	0.767
NC_018407_2	2.11\|878384\|30\|NC_018407\|CRISPRCasFinder,CRT	878384-878413	30	NZ_KY940428	UNVERIFIED: Bacillus sp. (in: Bacteria) strain PUMK-07 plasmid pMK-07, complete sequence	165004-165033	7	0.767
NC_018407_2	2.11\|878384\|30\|NC_018407\|CRISPRCasFinder,CRT	878384-878413	30	NZ_CP047086	Bacillus paranthracis strain BC307 plasmid pCE1, complete sequence	20540-20569	7	0.767
NC_018407_2	2.11\|878384\|30\|NC_018407\|CRISPRCasFinder,CRT	878384-878413	30	NZ_CP041978	Bacillus pacificus strain NCCP 15909 plasmid unnamed1, complete sequence	94419-94448	7	0.767
NC_018407_2	2.11\|878384\|30\|NC_018407\|CRISPRCasFinder,CRT	878384-878413	30	NC_011655	Bacillus cereus AH187 plasmid pAH187_270, complete sequence	146117-146146	7	0.767
NC_018407_2	2.11\|878384\|30\|NC_018407\|CRISPRCasFinder,CRT	878384-878413	30	NZ_CP045534	Bacillaceae bacterium C02 plasmid unnamed1, complete sequence	109542-109571	7	0.767
NC_018407_2	2.11\|878384\|30\|NC_018407\|CRISPRCasFinder,CRT	878384-878413	30	NC_010924	Bacillus cereus strain AH187 plasmid pCER270, complete sequence	202526-202555	7	0.767
NC_018407_2	2.11\|878384\|30\|NC_018407\|CRISPRCasFinder,CRT	878384-878413	30	CP045776	Bacillus paranthracis strain CFSAN068816 plasmid p1CFSAN068816, complete sequence	194952-194981	7	0.767
NC_018407_2	2.11\|878384\|30\|NC_018407\|CRISPRCasFinder,CRT	878384-878413	30	CP041980	Bacillus paranthracis strain NCCP 15910 plasmid unnamed, complete sequence	77377-77406	7	0.767
NC_018407_2	2.11\|878384\|30\|NC_018407\|CRISPRCasFinder,CRT	878384-878413	30	NC_016792	Bacillus cereus NC7401 plasmid pNCcld, complete sequence	201395-201424	7	0.767
NC_018407_2	2.11\|878384\|30\|NC_018407\|CRISPRCasFinder,CRT	878384-878413	30	NZ_CP040343	Bacillus cereus strain DLOU-Weihai plasmid unnamed1, complete sequence	17339-17368	7	0.767
NC_018407_2	2.11\|878384\|30\|NC_018407\|CRISPRCasFinder,CRT	878384-878413	30	LT603679	Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 2	199652-199681	7	0.767
NC_018407_2	2.11\|878384\|30\|NC_018407\|CRISPRCasFinder,CRT	878384-878413	30	NZ_AP022342	Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence	124638-124667	7	0.767
NC_018407_2	2.11\|878384\|30\|NC_018407\|CRISPRCasFinder,CRT	878384-878413	30	NZ_CP033789	Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence	46623-46652	7	0.767
NC_018407_2	2.11\|878384\|30\|NC_018407\|CRISPRCasFinder,CRT	878384-878413	30	MK448952	Streptococcus phage Javan472, complete genome	39877-39906	7	0.767
NC_018407_2	2.12\|878450\|30\|NC_018407\|CRISPRCasFinder,CRT	878450-878479	30	NZ_CP010910	Candidatus Pantoea carbekii strain US plasmid pBMSBPS3, complete sequence	2128-2157	7	0.767
NC_018407_2	2.15\|878648\|30\|NC_018407\|CRISPRCasFinder,CRT	878648-878677	30	NC_014633	Ilyobacter polytropus DSM 2926 plasmid pILYOP01, complete sequence	579549-579578	7	0.767
NC_018407_2	2.19\|878912\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	878912-878941	30	NC_019728	Calothrix sp. PCC 6303 plasmid pCAL6303.02, complete sequence	5075-5104	7	0.767
NC_018407_2	2.22\|879110\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	879110-879139	30	MT774410	CrAssphage cr272_1, complete genome	20994-21023	7	0.767
NC_018407_2	2.22\|879110\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	879110-879139	30	MT774411	CrAssphage cr273_1, complete genome	16522-16551	7	0.767
NC_018407_2	2.27\|879441\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	879441-879470	30	NZ_CP050314	Shewanella aestuarii strain PN3F2 plasmid pPN3F2_1, complete sequence	59064-59093	7	0.767
NC_018407_2	2.27\|879441\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	879441-879470	30	MK373771	Escherichia phage vB_EcoP_R4596, complete genome	35293-35322	7	0.767
NC_018407_2	2.29\|879573\|31\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	879573-879603	31	NZ_CP015632	Borrelia turicatae strain BTE5EL plasmid lp30	422-452	7	0.774
NC_018407_2	2.29\|879573\|31\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	879573-879603	31	NZ_CP015634	Borrelia turicatae strain BTE5EL plasmid lp40	417-447	7	0.774
NC_018407_2	2.29\|879573\|31\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	879573-879603	31	NZ_LR214986	Mycoplasma cynos strain NCTC10142 plasmid 13	368517-368547	7	0.774
NC_018407_2	2.29\|879573\|31\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	879573-879603	31	NZ_CP040048	Acinetobacter baumannii strain VB1190 plasmid unnamed1, complete sequence	274577-274607	7	0.774
NC_018407_2	2.32\|879772\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	879772-879801	30	MN693021	Marine virus AFVG_117M32, complete genome	31133-31162	7	0.767
NC_018407_2	2.33\|879838\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	879838-879867	30	AP013481	Uncultured Mediterranean phage uvMED DNA, complete genome, group G18, isolate: uvMED-CGR-U-MedDCM-OCT-S44-C29	26777-26806	7	0.767
NC_018407_2	2.33\|879838\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	879838-879867	30	NZ_CP053838	Aliiarcobacter faecis strain CCUG 66484 plasmid pAFAEC, complete sequence	73981-74010	7	0.767
NC_018407_2	2.33\|879838\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	879838-879867	30	NC_015426	Clostridium botulinum BKT015925 plasmid p2BKT015925, complete sequence	6877-6906	7	0.767
NC_018407_2	2.34\|879904\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	879904-879933	30	MG676466	Pseudomonas phage TC6, complete genome	18855-18884	7	0.767
NC_018407_2	2.34\|879904\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	879904-879933	30	DQ163915	Bacteriophage PA11, complete genome	23451-23480	7	0.767
NC_018407_2	2.34\|879904\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	879904-879933	30	NC_007808	Pseudomonas phage PA11, complete genome	23451-23480	7	0.767
NC_018407_2	2.37\|880102\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880102-880131	30	NZ_CP042928	Bacillus cereus strain G1-1 plasmid unnamed, complete sequence	314619-314648	7	0.767
NC_018407_2	2.37\|880102\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880102-880131	30	MG945221	UNVERIFIED: Microviridae sp. isolate 1196-1602, partial genome	3104-3133	7	0.767
NC_018407_2	2.37\|880102\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880102-880131	30	NC_047948	Staphylococcus phage phiSA_BS2, complete genome	50090-50119	7	0.767
NC_018407_2	2.37\|880102\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880102-880131	30	MH078572	Staphylococcus phage phiSA_BS1, complete genome	4944-4973	7	0.767
NC_018407_2	2.37\|880102\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880102-880131	30	NZ_CP040341	Bacillus cereus strain DLOU-Tangshan plasmid unnamed1, complete sequence	303059-303088	7	0.767
NC_018407_2	2.37\|880102\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880102-880131	30	LC557520	Staphylococcus phage vB_SsapH-Golestan101-M DNA, complete genome	99829-99858	7	0.767
NC_018407_2	2.37\|880102\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880102-880131	30	AP014380	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S43-C70, * SEQUENCING IN PROGRESS *	22235-22264	7	0.767
NC_018407_2	2.38\|880168\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880168-880197	30	NZ_CP022446	Bacillus cereus C1L plasmid pC1L1, complete sequence	632153-632182	7	0.767
NC_018407_2	2.39\|880234\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880234-880263	30	NZ_CP004877	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence	165042-165071	7	0.767
NC_018407_2	2.39\|880234\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880234-880263	30	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	578179-578208	7	0.767
NC_018407_2	2.39\|880234\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880234-880263	30	NZ_CP011358	Bacillus thuringiensis strain YC-10 plasmid pYC2226, complete sequence	21497-21526	7	0.767
NC_018407_2	2.39\|880234\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880234-880263	30	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	215054-215083	7	0.767
NC_018407_2	2.39\|880234\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880234-880263	30	NZ_CP013057	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-2, complete sequence	18483-18512	7	0.767
NC_018407_2	2.39\|880234\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880234-880263	30	NZ_CP013058	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-3, complete sequence	82351-82380	7	0.767
NC_018407_2	2.39\|880234\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880234-880263	30	NZ_CP004860	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence	184835-184864	7	0.767
NC_018407_2	2.39\|880234\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880234-880263	30	NZ_CP004875	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB95, complete sequence	75361-75390	7	0.767
NC_018407_2	2.39\|880234\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880234-880263	30	NZ_CP011357	Bacillus thuringiensis strain YC-10 plasmid pYC20, complete sequence	6997-7026	7	0.767
NC_018407_2	2.39\|880234\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880234-880263	30	NZ_CP011357	Bacillus thuringiensis strain YC-10 plasmid pYC20, complete sequence	89501-89530	7	0.767
NC_018407_2	2.39\|880234\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880234-880263	30	NZ_CP015155	Bacillus thuringiensis strain Bc601 plasmid pBTBC5, complete sequence	21616-21645	7	0.767
NC_018407_2	2.39\|880234\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880234-880263	30	NZ_CP015156	Bacillus thuringiensis strain Bc601 plasmid pBTBC6, complete sequence	87518-87547	7	0.767
NC_018407_2	2.39\|880234\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880234-880263	30	NZ_CP007616	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence	193590-193619	7	0.767
NC_018407_2	2.39\|880234\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880234-880263	30	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	227532-227561	7	0.767
NC_018407_2	2.39\|880234\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880234-880263	30	NC_007110	Rickettsia felis URRWXCal2 plasmid pRF, complete sequence	49985-50014	7	0.767
NC_018407_2	2.39\|880234\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880234-880263	30	NC_007111	Rickettsia felis URRWXCal2 plasmid pRFdelta, complete sequence	26419-26448	7	0.767
NC_018407_2	2.39\|880234\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880234-880263	30	NC_019229	Rickettsia felis plasmid pRF, complete sequence	33606-33635	7	0.767
NC_018407_2	2.39\|880234\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880234-880263	30	NC_019229	Rickettsia felis plasmid pRF, complete sequence	50008-50037	7	0.767
NC_018407_2	2.39\|880234\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880234-880263	30	NC_018878	Bacillus thuringiensis Bt407 plasmid BTB_502p, complete sequence	176897-176926	7	0.767
NC_018407_2	2.39\|880234\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880234-880263	30	NZ_MK715471	Arcobacter cryaerophilus strain M830MA plasmid pM830MA, complete sequence	48316-48345	7	0.767
NC_018407_2	2.39\|880234\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880234-880263	30	NZ_AP018284	Chondrocystis sp. NIES-4102 plasmid plasmid3 DNA, complete genome	15926-15955	7	0.767
NC_018407_2	2.40\|880300\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880300-880329	30	NZ_CP022446	Bacillus cereus C1L plasmid pC1L1, complete sequence	632153-632182	7	0.767
NC_018407_2	2.41\|880366\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880366-880395	30	NZ_CP004877	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence	165042-165071	7	0.767
NC_018407_2	2.41\|880366\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880366-880395	30	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	578179-578208	7	0.767
NC_018407_2	2.41\|880366\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880366-880395	30	NZ_CP011358	Bacillus thuringiensis strain YC-10 plasmid pYC2226, complete sequence	21497-21526	7	0.767
NC_018407_2	2.41\|880366\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880366-880395	30	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	215054-215083	7	0.767
NC_018407_2	2.41\|880366\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880366-880395	30	NZ_CP013057	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-2, complete sequence	18483-18512	7	0.767
NC_018407_2	2.41\|880366\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880366-880395	30	NZ_CP013058	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-3, complete sequence	82351-82380	7	0.767
NC_018407_2	2.41\|880366\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880366-880395	30	NZ_CP004860	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence	184835-184864	7	0.767
NC_018407_2	2.41\|880366\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880366-880395	30	NZ_CP004875	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB95, complete sequence	75361-75390	7	0.767
NC_018407_2	2.41\|880366\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880366-880395	30	NZ_CP011357	Bacillus thuringiensis strain YC-10 plasmid pYC20, complete sequence	6997-7026	7	0.767
NC_018407_2	2.41\|880366\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880366-880395	30	NZ_CP011357	Bacillus thuringiensis strain YC-10 plasmid pYC20, complete sequence	89501-89530	7	0.767
NC_018407_2	2.41\|880366\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880366-880395	30	NZ_CP015155	Bacillus thuringiensis strain Bc601 plasmid pBTBC5, complete sequence	21616-21645	7	0.767
NC_018407_2	2.41\|880366\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880366-880395	30	NZ_CP015156	Bacillus thuringiensis strain Bc601 plasmid pBTBC6, complete sequence	87518-87547	7	0.767
NC_018407_2	2.41\|880366\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880366-880395	30	NZ_CP007616	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence	193590-193619	7	0.767
NC_018407_2	2.41\|880366\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880366-880395	30	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	227532-227561	7	0.767
NC_018407_2	2.41\|880366\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880366-880395	30	NC_007110	Rickettsia felis URRWXCal2 plasmid pRF, complete sequence	49985-50014	7	0.767
NC_018407_2	2.41\|880366\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880366-880395	30	NC_007111	Rickettsia felis URRWXCal2 plasmid pRFdelta, complete sequence	26419-26448	7	0.767
NC_018407_2	2.41\|880366\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880366-880395	30	NC_019229	Rickettsia felis plasmid pRF, complete sequence	33606-33635	7	0.767
NC_018407_2	2.41\|880366\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880366-880395	30	NC_019229	Rickettsia felis plasmid pRF, complete sequence	50008-50037	7	0.767
NC_018407_2	2.41\|880366\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880366-880395	30	NC_018878	Bacillus thuringiensis Bt407 plasmid BTB_502p, complete sequence	176897-176926	7	0.767
NC_018407_2	2.41\|880366\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880366-880395	30	NZ_MK715471	Arcobacter cryaerophilus strain M830MA plasmid pM830MA, complete sequence	48316-48345	7	0.767
NC_018407_2	2.41\|880366\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880366-880395	30	NZ_AP018284	Chondrocystis sp. NIES-4102 plasmid plasmid3 DNA, complete genome	15926-15955	7	0.767
NC_018407_2	2.1\|877724\|30\|NC_018407\|CRISPRCasFinder,CRT	877724-877753	30	CP002510	Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB28, complete sequence	13153-13182	8	0.733
NC_018407_2	2.4\|877922\|30\|NC_018407\|CRISPRCasFinder,CRT	877922-877951	30	CP040041	Acinetobacter baumannii strain VB958 plasmid unnamed1, complete sequence	148565-148594	8	0.733
NC_018407_2	2.6\|878054\|30\|NC_018407\|CRISPRCasFinder,CRT	878054-878083	30	AP013545	Uncultured phage_MedDCM-OCT-S46-C10 DNA, complete genome, group G8, isolate: uvMED-CGR-U-MedDCM-OCT-S46-C10	529-558	8	0.733
NC_018407_2	2.9\|878252\|30\|NC_018407\|CRISPRCasFinder,CRT	878252-878281	30	MG592434	Vibrio phage 1.054.O._10N.261.52.A1, partial genome	4372-4401	8	0.733
NC_018407_2	2.9\|878252\|30\|NC_018407\|CRISPRCasFinder,CRT	878252-878281	30	NC_049975	Bacillus phage vB_BsuP-Goe1, complete genome	1515-1544	8	0.733
NC_018407_2	2.11\|878384\|30\|NC_018407\|CRISPRCasFinder,CRT	878384-878413	30	NC_031055	Bacillus phage PfEFR-5, complete genome	3437-3466	8	0.733
NC_018407_2	2.11\|878384\|30\|NC_018407\|CRISPRCasFinder,CRT	878384-878413	30	KT725776	Bacillus phage vB_BceS-MY192, partial genome	18554-18583	8	0.733
NC_018407_2	2.11\|878384\|30\|NC_018407\|CRISPRCasFinder,CRT	878384-878413	30	NC_048641	Bacillus phage PfEFR-4, complete genome	3491-3520	8	0.733
NC_018407_2	2.11\|878384\|30\|NC_018407\|CRISPRCasFinder,CRT	878384-878413	30	NZ_CP032411	Brevibacillus laterosporus strain E7593-50 plasmid pAZOBL1, complete sequence	36717-36746	8	0.733
NC_018407_2	2.11\|878384\|30\|NC_018407\|CRISPRCasFinder,CRT	878384-878413	30	MK064565	Sulfolobales Beppu rod-shaped virus 1 clone D, complete genome	30440-30469	8	0.733
NC_018407_2	2.13\|878516\|30\|NC_018407\|CRISPRCasFinder,CRT	878516-878545	30	NZ_CP031139	Escherichia coli strain CFSAN064035 plasmid pGMI17-003, complete sequence	15332-15361	8	0.733
NC_018407_2	2.14\|878582\|30\|NC_018407\|CRISPRCasFinder,CRT	878582-878611	30	NZ_AP014579	Burkholderia sp. RPE67 plasmid p1, complete sequence	974015-974044	8	0.733
NC_018407_2	2.15\|878648\|30\|NC_018407\|CRISPRCasFinder,CRT	878648-878677	30	NC_042061	Salmonella phage STML-13-1, partial genome	110831-110860	8	0.733
NC_018407_2	2.17\|878780\|30\|NC_018407\|CRISPRCasFinder,CRT	878780-878809	30	NZ_CP042572	Enterobacter hormaechei strain E5 plasmid pE5_001, complete sequence	27075-27104	8	0.733
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	MH617505	Microviridae sp. isolate ctbi747, complete genome	3345-3374	8	0.733
NC_018407_2	2.20\|878978\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	878978-879007	30	NC_014633	Ilyobacter polytropus DSM 2926 plasmid pILYOP01, complete sequence	432325-432354	8	0.733
NC_018407_2	2.20\|878978\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	878978-879007	30	NZ_CP032091	Pseudoalteromonas donghaensis strain HJ51 plasmid unnamed1, complete sequence	450551-450580	8	0.733
NC_018407_2	2.23\|879176\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	879176-879205	30	MT023084	Citrobacter phage IME-JL8, complete genome	1026-1055	8	0.733
NC_018407_2	2.23\|879176\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	879176-879205	30	MK213796	Escherichia phage T1, complete genome	36799-36828	8	0.733
NC_018407_2	2.23\|879176\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	879176-879205	30	MN393473	Shigella phage Sfin-6, complete genome	49501-49530	8	0.733
NC_018407_2	2.23\|879176\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	879176-879205	30	MF468274	Shigella phage Sfin-1, complete genome	29150-29179	8	0.733
NC_018407_2	2.23\|879176\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	879176-879205	30	NC_047785	Shigella phage SH6, complete genome	36819-36848	8	0.733
NC_018407_2	2.23\|879176\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	879176-879205	30	MN153797	Escherichia virus T1 isolate 22, complete genome	36785-36814	8	0.733
NC_018407_2	2.23\|879176\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	879176-879205	30	MN337573	Shigella phage Sfin-4, complete genome	41310-41339	8	0.733
NC_018407_2	2.23\|879176\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	879176-879205	30	KU194206	Escherichia phage JMPW1, complete genome	37161-37190	8	0.733
NC_018407_2	2.23\|879176\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	879176-879205	30	MK972831	Shigella phage Sfin-2, partial genome	43001-43030	8	0.733
NC_018407_2	2.23\|879176\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	879176-879205	30	MN342247	Shigella phage Sfin-5, complete genome	32361-32390	8	0.733
NC_018407_2	2.23\|879176\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	879176-879205	30	NC_049831	Shigella virus Sfin-3, complete genome	33390-33419	8	0.733
NC_018407_2	2.23\|879176\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	879176-879205	30	NC_048150	Shigella phage vB_SsoS_008, complete genome	39991-40020	8	0.733
NC_018407_2	2.23\|879176\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	879176-879205	30	HM035024	Shigella phage Shfl1, complete genome	37571-37600	8	0.733
NC_018407_2	2.23\|879176\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	879176-879205	30	MH917278	Shigella phage phi2457T, complete genome	37341-37370	8	0.733
NC_018407_2	2.23\|879176\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	879176-879205	30	MH051912	Enterobacteria phage vB_EcoS_IME167, complete genome	12528-12557	8	0.733
NC_018407_2	2.23\|879176\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	879176-879205	30	NC_049832	Escherichia phage vB_EcoS-DELF2 DNA, complete genome	29576-29605	8	0.733
NC_018407_2	2.23\|879176\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	879176-879205	30	MF996376	Escherichia phage SRT8, complete genome	49074-49103	8	0.733
NC_018407_2	2.23\|879176\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	879176-879205	30	MT682715	Escherichia phage vB_EcoS_Chapo, complete genome	37613-37642	8	0.733
NC_018407_2	2.23\|879176\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	879176-879205	30	NC_005833	Enterobacteria phage T1, complete genome	36799-36828	8	0.733
NC_018407_2	2.24\|879242\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	879242-879271	30	NZ_CP011009	Bacillus simplex strain SH-B26 plasmid pSHB26, complete sequence	112316-112345	8	0.733
NC_018407_2	2.29\|879573\|31\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	879573-879603	31	NZ_CP039285	Leptospira interrogans strain FMAS_AW1 plasmid pLiSL2, complete sequence	94812-94842	8	0.742
NC_018407_2	2.29\|879573\|31\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	879573-879603	31	CP015514	Vibrio vulnificus strain FORC_036 plasmid unnamed, complete sequence	6212-6242	8	0.742
NC_018407_2	2.33\|879838\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	879838-879867	30	NC_013391	Staphylococcus epidermidis plasmid SAP108C, complete sequence	1118-1147	8	0.733
NC_018407_2	2.37\|880102\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880102-880131	30	NC_021800	Cellulophaga phage phi46:1, complete genome	4686-4715	8	0.733
NC_018407_2	2.38\|880168\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880168-880197	30	JX238501	Bacillus phage phiAGATE, complete genome	46009-46038	8	0.733
NC_018407_2	2.39\|880234\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880234-880263	30	NZ_CP023413	Clostridium perfringens strain LLY_N11 plasmid pLLY_N11_3, complete sequence	40503-40532	8	0.733
NC_018407_2	2.39\|880234\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880234-880263	30	AY939844	Prochlorococcus phage P-SSM2, complete genome	47731-47760	8	0.733
NC_018407_2	2.40\|880300\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880300-880329	30	JX238501	Bacillus phage phiAGATE, complete genome	46009-46038	8	0.733
NC_018407_2	2.41\|880366\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880366-880395	30	NZ_CP023413	Clostridium perfringens strain LLY_N11 plasmid pLLY_N11_3, complete sequence	40503-40532	8	0.733
NC_018407_2	2.41\|880366\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880366-880395	30	AY939844	Prochlorococcus phage P-SSM2, complete genome	47731-47760	8	0.733
NC_018407_2	2.42\|880432\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880432-880461	30	MN693430	Marine virus AFVG_25M565, complete genome	12081-12110	8	0.733
NC_018407_2	2.42\|880432\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880432-880461	30	MN693356	Marine virus AFVG_25M564, complete genome	29196-29225	8	0.733
NC_018407_2	2.42\|880432\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880432-880461	30	MT774384	CrAssphage cr8_1, complete genome	15518-15547	8	0.733
NC_018407_2	2.6\|878054\|30\|NC_018407\|CRISPRCasFinder,CRT	878054-878083	30	NZ_CP010582	Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB51, complete sequence	27311-27340	9	0.7
NC_018407_2	2.7\|878120\|30\|NC_018407\|CRISPRCasFinder,CRT	878120-878149	30	MT074466	Salmonella phage atrejo, complete genome	4690-4719	9	0.7
NC_018407_2	2.7\|878120\|30\|NC_018407\|CRISPRCasFinder,CRT	878120-878149	30	NZ_CP039694	Agrobacterium larrymoorei strain CFBP5473 plasmid pTiCFBP5473, complete sequence	312016-312045	9	0.7
NC_018407_2	2.10\|878318\|30\|NC_018407\|CRISPRCasFinder,CRT	878318-878347	30	NZ_CP013104	Paraburkholderia caribensis strain MWAP64 plasmid 1, complete sequence	863194-863223	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_KX518743	Escherichia coli strain HYEC7 plasmid pHYEC7-IncHI2, complete sequence	155991-156020	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_KY401053	Salmonella enterica subsp. enterica serovar Enteritidis strain SE380 plasmid unnamed, complete sequence	201725-201754	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_KY689633	Escherichia coli strain 100R plasmid p100R, complete sequence	80770-80799	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_KY689632	Escherichia coli strain 19-M12 plasmid p19M12, complete sequence	84022-84051	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_KY019259	Escherichia coli strain YJMC8 plasmid pHNYJC8, complete sequence	180383-180412	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_KY421937	Escherichia coli strain FS13Z2S plasmid pFS13Z2S, complete sequence	167585-167614	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP033256	Salmonella enterica subsp. enterica strain CFSA12 plasmid pCFSA12, complete sequence	21775-21804	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP026492	Escherichia coli strain HS13-1 plasmid pHS13-1-IncHI2, complete sequence	116077-116106	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP034785	Escherichia coli strain ECZP248 plasmid pTBMCR401, complete sequence	147778-147807	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_KX421096	Salmonella enterica subsp. enterica serovar Indiana strain A3 plasmid pA3T, complete sequence	184322-184351	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_KX434879	Klebsiella pneumoniae strain KP2442 plasmid pKP2442_1c330, complete sequence	43880-43909	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_KU341381	Escherichia coli strain SHP45 plasmid pHNSHP45-2, complete sequence	182723-182752	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_KY019258	Escherichia coli strain LDHF400 plasmid pHNLDF400, complete sequence	180382-180411	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_KX721511	Salmonella enterica subsp. enterica serovar Typhimurium strain SC523 plasmid pSC523, complete sequence	55619-55648	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_KU254578	Escherichia coli strain YD786 plasmid pYD786-1, complete sequence	155532-155561	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_KU994859	Escherichia coli strain KP81 plasmid pKP81-BE, complete sequence	8329-8358	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_KX810825	Salmonella enterica subsp. enterica serovar Typhimurium strain MU1 plasmid pIMP4-SEM1, complete sequence	271489-271518	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_KX276657	Escherichia coli strain MRSN388634 plasmid pMR0516mcr, complete sequence	53606-53635	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_KX246266	Escherichia coli strain AHCH67 plasmid pHNAH67, complete sequence	165047-165076	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_KX254341	Escherichia coli strain JS-B60 plasmid pECJS-B60-267, complete sequence	198730-198759	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_KM396300	Salmonella enterica subsp. enterica serovar Enteritidis strain SEN110055 plasmid pSEN110055, complete sequence	161897-161926	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_KM396298	Salmonella enterica subsp. enterica serovar Enteritidis strain KUSR18 plasmid pKUSR18, complete sequence	161868-161897	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_KM396299	Salmonella enterica subsp. enterica serovar Enteritidis strain SEN112499 plasmid pSEN112499, complete sequence	161871-161900	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_KR653209	Escherichia coli strain GDZ13 plasmid pGD0503Z13, complete sequence	247603-247632	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_KT334335	Salmonella enterica subsp. enterica serovar Typhimurium strain ST06-53 plasmid pHK0653, complete sequence	176080-176109	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_KT347600	Escherichia coli strain EC5207 plasmid pEC5207, complete sequence	203989-204018	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_KP975077	Enterobacter cloacae strain MRSN17626 plasmid pMRVIM0813, complete sequence	154517-154546	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	LT221036	Yersinia pseudotuberculosis strain Yps.F1, plasmid pYps.F1 complete sequence	32468-32497	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP028197	Salmonella enterica subsp. enterica serovar Concord strain CFSAN018747 plasmid pGMI14-002_1, complete sequence	69349-69378	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP042628	Escherichia coli strain NCYU-25-82 plasmid pNCYU-25-82-1_MCR3, complete sequence	137765-137794	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP011601	Phytobacter ursingii strain CAV1151 plasmid pCAV1151-296, complete sequence	68418-68447	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	CP019195	Salmonella enterica subsp. enterica serovar Senftenberg str. ATCC 43845 plasmid pATCC43845, complete sequence	89093-89122	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP028975	Cronobacter sakazakii strain GZcsf-1 plasmid pGW1, complete sequence	240045-240074	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP043951	Escherichia coli strain ST95-32 plasmid pST95-32-1, complete sequence	57383-57412	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP040457	Salmonella enterica subsp. enterica serovar Typhimurium strain TJWQ005 plasmid pTJWQ005, complete sequence	46983-47012	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	KY075659	Escherichia coli strain GD80 plasmid pGD80-2, complete sequence	173607-173636	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	MN539018	Salmonella sp. strain OYZ4 plasmid pOYZ4, complete sequence	111895-111924	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	MN732922	Escherichia coli strain 49K plasmid unnamed, complete sequence	61454-61483	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP019559	Escherichia coli strain KSC207 plasmid pMRGN207, complete sequence	5299-5328	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP019559	Escherichia coli strain KSC207 plasmid pMRGN207, complete sequence	274083-274112	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	KX023262	Escherichia coli plasmid pSCE516-1, complete sequence	169171-169200	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP048293	Escherichia coli strain CVM N18EC0432 plasmid pN18EC0432-1, complete sequence	212386-212415	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	MK574666	Escherichia coli strain DJB-3 plasmid pDJB-3, complete sequence	51625-51654	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	MN915010	Escherichia coli strain TJ-33 plasmid pNDM-TJ33, complete sequence	298865-298894	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	MN915011	Escherichia coli strain GD-33 plasmid pNDM33-1, complete sequence	199343-199372	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP019260	Escherichia coli strain 13C1065T plasmid p13C1065T-1, complete sequence	721-750	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP019260	Escherichia coli strain 13C1065T plasmid p13C1065T-1, complete sequence	234986-235015	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP020529	Enterobacter cloacae strain 174 plasmid unnamed1, complete sequence	106232-106261	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	MN232189	Escherichia coli plasmid pGD27-124, complete sequence	58617-58646	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	MN232191	Escherichia coli plasmid pGD27-37, complete sequence	56886-56915	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	MN232195	Escherichia coli plasmid pGD27-70, complete sequence	57750-57779	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	CP042639	Escherichia coli strain NCYU-24-74 plasmid pNCYU-24-74-1, complete sequence	210668-210697	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP031567	Enterobacter hormaechei strain 2013_1a plasmid pIncHI2-1301491, complete sequence	64767-64796	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	MN200941	Escherichia coli strain E648 plasmid pE648CTX-M-65, complete sequence	170744-170773	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP040888	Leclercia adecarboxylata strain Z96-1 plasmid pZ96-1_1, complete sequence	19867-19896	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP044306	Escherichia coli strain C27A plasmid pC27A-CTX-M-55, complete sequence	121552-121581	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP038139	Escherichia coli strain G3X16-2 plasmid pG3X16-2-2, complete sequence	11380-11409	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP034820	Salmonella sp. SSDFZ54 plasmid pTB501, complete sequence	38944-38973	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	CP031284	Escherichia fergusonii strain 40A plasmid p280_40A, complete sequence	51522-51551	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	MK461930	Escherichia coli strain 2009_36 plasmid p2009_36_HI2, complete sequence	229089-229118	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP029037	Salmonella enterica subsp. enterica serovar Senftenberg str. 361154004 plasmid unnamed, complete sequence	196005-196034	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	CP042895	Escherichia coli strain CFSAN061772 plasmid pCFSAN061772_02, complete sequence	96810-96839	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP021177	Escherichia coli strain 5CRE51 plasmid p5CRE51-NDM-9 sequence	153200-153229	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP021209	Escherichia coli strain strain Z247 plasmid p2474-MCR1, complete sequence	172462-172491	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP022735	Escherichia coli strain SA186 plasmid pSA186_MCR1, complete sequence	52217-52246	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	CP042898	Escherichia coli strain CFSAN061771 plasmid pCFSAN061771_02, complete sequence	116275-116304	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	CP049307	Salmonella enterica subsp. enterica serovar Heidelberg strain CVM N58631 plasmid p58631, complete sequence	111010-111039	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP040806	Escherichia fergusonii strain EFCF056 plasmid pEF01, complete sequence	88466-88495	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP041180	Salmonella enterica subsp. enterica serovar Indiana strain SJTUF87912v2 isolate food plasmid p87912, complete sequence	55674-55703	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP019443	Salmonella enterica subsp. enterica serovar Typhimurium strain 81741 plasmid unnamed1, complete sequence	192707-192736	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP031575	Enterobacter hormaechei strain A1 plasmid pIncHI2-1502264, complete sequence	278105-278134	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_LT795115	Salmonella enterica subsp. enterica serovar Typhimurium isolate VNB151-sc-2315230 plasmid p1	147507-147536	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP017632	Escherichia coli strain SLK172 plasmid pSLK172-1, complete sequence	238863-238892	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP023570	Enterobacter hormaechei strain BW plasmid unnamed2, complete sequence	222761-222790	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	LC532224	Enterobacter hormaechei subsp. xiangfangensis A2483 plasmid pA2483mcr-9 DNA, complete sequence	117550-117579	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	LC532226	Enterobacter hormaechei subsp. xiangfangensis A2504 plasmid pA2504mcr-9 DNA, complete sequence	117550-117579	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP026642	Escherichia coli strain FORC_082 plasmid pFORC82_1, complete sequence	122245-122274	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	MN816370	Escherichia coli strain A102 plasmid pA102-CTX-M-65, complete sequence	191909-191938	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP043767	Enterobacter hormaechei strain EB_P9_L5_03.19 plasmid pIMPIncH12_331kb, complete sequence	263457-263486	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP047668	Klebsiella aerogenes strain HNHF1 plasmid pHNHF1_NDM-9, complete sequence	52716-52745	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP027144	Enterobacter hormaechei subsp. hoffmannii strain AR_0365 plasmid unnamed1, complete sequence	241854-241883	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP034788	Escherichia coli strain ECCNB20-2 plasmid pTBMCR421, complete sequence	172818-172847	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP033636	Escherichia coli isolate ECCNB12-2 plasmid pTB-nb4, complete sequence	191041-191070	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP050778	Salmonella enterica subsp. enterica serovar Indiana strain SI96 plasmid pSI96-1, complete sequence	183798-183827	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP049189	Enterobacter hormaechei strain Y323 plasmid pIHI2-323, complete sequence	201910-201939	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_AP018352	Enterobacter hormaechei strain TUM11043 plasmid pMTY11043_IncHI2, complete sequence	300449-300478	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP038654	Citrobacter freundii strain 154 plasmid p154_1, complete sequence	40786-40815	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP038657	Citrobacter freundii strain 565 plasmid p565_1, complete sequence	42903-42932	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP027411	Salmonella enterica strain FDAARGOS_319 plasmid unnamed, complete sequence	63768-63797	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP044051	Klebsiella variicola strain FDAARGOS_627 plasmid unnamed2, complete sequence	239097-239126	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP025402	Escherichia coli strain MS8345 plasmid pMS8345A, complete sequence	173221-173250	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_MK477605	Salmonella enterica strain SH15G1428 plasmid pSH15G1428, complete sequence	182835-182864	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_MK477609	Salmonella enterica strain SH15G1598 plasmid pSH15G1598, complete sequence	106190-106219	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_MK477614	Salmonella enterica strain SH16G1394 plasmid pSH16G1394, complete sequence	181850-181879	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_MK477619	Salmonella enterica strain SH16G4918 plasmid pSH16G4918, complete sequence	147613-147642	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_MK673548	Salmonella enterica subsp. enterica serovar Typhimurium strain GDP37-4 plasmid pGDP37-4, complete sequence	180857-180886	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_MK477606	Salmonella enterica strain SH15G1450 plasmid pSH15G1450, complete sequence	184372-184401	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_MK477620	Salmonella enterica strain SH16G4926 plasmid pSH16G4926, complete sequence	147176-147205	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_MK673549	Salmonella enterica subsp. enterica serovar Typhimurium strain JXP9 plasmid pJXP9, complete sequence	176030-176059	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_MK477602	Salmonella enterica strain SH15G1169 plasmid pSH15G1169, complete sequence	147176-147205	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_MK477607	Salmonella enterica strain SH15G1452 plasmid pSH15G1452, complete sequence	154279-154308	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_MK477611	Salmonella enterica strain SH15G2194 plasmid pSH15G2194, complete sequence	191305-191334	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_MK477616	Salmonella enterica strain SH16G2456 plasmid pSH16G2456, complete sequence	181036-181065	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_MK477603	Salmonella enterica strain SH15G1219 plasmid pSH15G1219, complete sequence	154279-154308	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_MK477608	Salmonella enterica strain SH15G1571 plasmid pSH15G1571, complete sequence	105189-105218	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_MK477612	Salmonella enterica strain SH16G0600 plasmid pSH16G0600, complete sequence	179379-179408	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_MK477617	Salmonella enterica strain SH16G4466 plasmid pSH16G4466, complete sequence	179054-179083	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_MK477618	Salmonella enterica strain SH16G4511 plasmid pSH16G4511, complete sequence	149124-149153	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_MK673547	Salmonella enterica subsp. enterica serovar Typhimurium strain GDP25-25 plasmid pGDP25-25, complete sequence	187476-187505	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_MH179305	Salmonella enterica subsp. enterica serovar Indiana strain JT01 plasmid pJT01, complete sequence	56698-56727	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_MH105051	Salmonella enterica subsp. enterica serovar Lomita strain SL131 plasmid pSL131_IncHI2, complete sequence	259568-259597	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_MH208235	Escherichia coli strain APECA2 plasmid pJMA2, complete sequence	157438-157467	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_MH522413	Salmonella enterica subsp. enterica serovar Typhimurium strain SH14G1670 plasmid pSH14G1670, complete sequence	58505-58534	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_MH459020	Escherichia coli strain GZ6DS2 plasmid pHN6DS2, complete sequence	185013-185042	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_MH491004	Escherichia coli strain RJ749 plasmid pRJ749, complete sequence	47410-47439	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_MF174859	Escherichia coli strain 6/14/6b plasmid pIncHI2-MU3, complete sequence	187669-187698	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_MG014722	Escherichia coli strain P2-3 plasmid pP2-3T, complete sequence	322058-322087	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_MG014720	Escherichia coli strain A74 plasmid pA74T, complete sequence	251781-251810	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_MG014721	Escherichia coli strain FS11Y5C plasmid pFS11Y5CT, complete sequence	170662-170691	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_MG773376	Escherichia coli strain LSB54 plasmid pLSB54-mcr-1, complete sequence	182884-182913	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_MG385063	Escherichia coli strain WF5-29 plasmid pWF5-29, complete sequence	326988-327017	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_MG656414	Escherichia coli strain 15-50 plasmid pEC15-MCR-50, complete sequence	281460-281489	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_MH522418	Salmonella enterica subsp. enterica serovar Typhimurium strain SH16G0648 plasmid pSH16G0648, complete sequence	59398-59427	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_MH128771	Escherichia coli strain 803DBmcr plasmid 803-DB-mcr, complete sequence	71527-71556	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_MH522420	Salmonella enterica subsp. enterica serovar Typhimurium strain SH16G1508 plasmid pSH16G1508, complete sequence	60350-60379	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_MH522421	Salmonella enterica subsp. enterica serovar Typhimurium strain SH16G2457 plasmid pSH16G2457, complete sequence	258195-258224	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_MH522423	Salmonella enterica subsp. enterica serovar Typhimurium strain SH16G4498 plasmid pSH16G4498, complete sequence	60350-60379	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP049047	Enterobacter hormaechei strain Y233 plasmid pIHI2-233, complete sequence	137927-137956	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP015725	Salmonella enterica strain C629 plasmid pC629, complete sequence	85885-85914	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_KY990887	Escherichia coli strain XG-E1 plasmid pXGE1mcr, complete sequence	185632-185661	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_MF083142	Citrobacter freundii strain D36-1 plasmid pD36-1, complete sequence	41026-41055	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_MF135534	Raoultella ornithinolytica strain TS48CTX plasmid pHNTS48-1, complete sequence	184251-184280	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_MG372114	Salmonella enterica subsp. enterica serovar Typhimurium strain JZ26 plasmid pJZ26, complete sequence	176191-176220	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_MG878867	Escherichia coli strain Ec21617 plasmid pEc21617-310, complete sequence	255672-255701	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP022169	Salmonella enterica subsp. enterica serovar Typhimurium strain WW012 plasmid pWW012, complete sequence	53461-53490	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	KM877269	Salmonella enterica subsp. enterica serovar Typhimurium strain GDS147 plasmid pHXY0908, complete sequence	180375-180404	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP032993	Escherichia coli strain W5-6 plasmid pMCR_W5-6, complete sequence	29046-29075	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_KX710093	Leclercia adecarboxylata strain pP10164 plasmid pP10164-2, complete sequence	54801-54830	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_KY270852	Enterobacter cloacae strain T5282 plasmid pT5282-mphA, complete sequence	57029-57058	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_KY270851	Citrobacter freundii strain 112298 plasmid p112298-catA, complete sequence	54804-54833	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP045446	Salmonella enterica subsp. enterica serovar Schwarzengrund strain 9355 plasmid p280_9355, complete sequence	56866-56895	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP016764	Citrobacter freundii strain B38 plasmid pOZ181, complete sequence	155746-155775	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_KU743384	Escherichia coli strain SA26 plasmid pSA26-MCR-1, complete sequence	165659-165688	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_KX084394	Escherichia coli strain 59 plasmid pECJS-59-244, complete sequence	11497-11526	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_KX129782	Escherichia coli strain S38 plasmid pS38, complete sequence	55853-55882	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_LN830952	Enterobacter sp. 247 strain 247 BMC plasmid pEB247, complete sequence	55069-55098	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP028537	Enterobacter hormaechei strain SCEH020042 plasmid pQnrB4_020042, complete sequence	55063-55092	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP015833	Escherichia coli O157 strain 180-PT54 plasmid unnamed, complete sequence	54504-54533	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_AP023191	Escherichia coli strain TUM18530 plasmid pMTY18530-1_lncHI2, complete sequence	56453-56482	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP019647	Salmonella enterica subsp. enterica serovar Typhimurium strain TW-Stm6 plasmid pSTM6-275, complete sequence	54811-54840	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP048350	Raoultella ornithinolytica strain 23 plasmid p23_A-OXA140, complete sequence	56122-56151	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP044256	Salmonella enterica strain CFSAN096147 plasmid pCFSAN096147, complete sequence	74743-74772	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP045449	Salmonella enterica subsp. enterica serovar Schwarzengrund strain 12888 plasmid p280_12888, complete sequence	56865-56894	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP027678	Salmonella enterica subsp. enterica serovar Corvallis strain 12-01738 plasmid pSE12-01738-1, complete sequence	176567-176596	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP035634	Enterobacter cloacae strain EN3600 plasmid unnamed2, complete sequence	57499-57528	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	MN539017	Salmonella sp. strain PJM1 plasmid pPJM1, complete sequence	81056-81085	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP042506	Leclercia adecarboxylata strain E1 plasmid pE1_001, complete sequence	55055-55084	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP020493	Salmonella enterica subsp. enterica strain 08-00436 plasmid pSE08-00436-1, complete sequence	57420-57449	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	MT077884	Escherichia coli plasmid p33, complete sequence	55832-55861	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	MT077886	Escherichia coli plasmid p39, complete sequence	55055-55084	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP051431	Escherichia sp. SCLE84 plasmid pSCLE1, complete sequence	55685-55714	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NC_009838	Escherichia coli APEC O1 plasmid pAPEC-O1-R, complete sequence	55952-55981	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP021727	Escherichia coli strain Combat11I9 plasmid pCombat11I9-1, complete sequence	8925-8954	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP021727	Escherichia coli strain Combat11I9 plasmid pCombat11I9-1, complete sequence	223338-223367	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	MN423361	Leclercia sp. strain 1106151 plasmid p1106151-mcr, complete sequence	55054-55083	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP031547	Escherichia coli strain cq9 plasmid unnamed1, complete sequence	241161-241190	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP029748	Escherichia coli strain 2016C-3878 plasmid pMCR1-PA, complete sequence	78363-78392	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP025277	Salmonella enterica subsp. enterica strain USDA-ARS-USMARC-60984 plasmid pSJO-60984, complete sequence	53990-54019	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	MN577015	Salmonella enterica plasmid p0085-NDM, complete sequence	55333-55362	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP045844	Kluyvera intermedia strain HR2 plasmid pHR2-1, complete sequence	55345-55374	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP047379	Escherichia coli strain CAU16175 plasmid pCAU16175_1, complete sequence	55346-55375	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	MH909331	Leclercia adecarboxylata plasmid p707804-NDM, complete sequence	55874-55903	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP033382	Salmonella enterica subsp. enterica strain CFSA300 plasmid pCFSA300-1, complete sequence	33210-33239	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP035916	Salmonella enterica strain S61394 plasmid pLS61394-MCR, complete sequence	55332-55361	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP019019	Escherichia coli strain Ecol_244 plasmid pEC244_1, complete sequence	10229-10258	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP030080	Enterobacter hormaechei strain 20710 plasmid pIMP-20710, complete sequence	65474-65503	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP042616	Escherichia coli strain NCYU-26-73 plasmid pNCYU-26-73-1, complete sequence	165635-165664	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	KU353730	Escherichia coli plasmid pKH457-3-BE, complete sequence	2566-2595	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP008825	UNVERIFIED_ORG: Enterobacter cloacae ECNIH2 plasmid pKPC-272, complete sequence	59319-59348	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP022696	Citrobacter farmeri strain AUSMDU00008141 plasmid pAUSMDU8141-1, complete sequence	55105-55134	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP052871	Enterobacter cloacae strain 3849 plasmid p3846_IncHI2_mcr, complete sequence	174971-175000	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP012141	Shigella flexneri 4c strain 1205 plasmid 1205p1, complete sequence	53996-54025	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP033385	Salmonella enterica subsp. enterica strain CFSA1007 plasmid pCFSA1007-1, complete sequence	82189-82218	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP047877	Escherichia coli strain LD22-1 plasmid pLD22-1-MCR1, complete sequence	53996-54025	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP035918	Salmonella enterica strain S44712 plasmid pLS44712-MCR, complete sequence	55309-55338	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	CP049311	Salmonella enterica subsp. enterica serovar Heidelberg strain CVM N53023 plasmid pN53023, complete sequence	276067-276096	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_LT991958	Enterobacter cloacae complex sp. isolate C45 plasmid pC45-VIM4	55055-55084	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	LC511657	Escherichia coli 2017.02.01CC plasmid p2017.02.01CC DNA, complete genome	53996-54025	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	LC511658	Escherichia coli 2017.03.03CC plasmid p2017_03_03CC DNA, complete genome	56684-56713	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP043855	Enterobacter hormaechei strain EB_P6_L3_02.19 plasmid unnamed2, complete sequence	180218-180247	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP044215	Klebsiella aerogenes strain KA_P10_L5_03.19 plasmid pIMPIncH12_334kb, complete sequence	86577-86606	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP039857	Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014876 plasmid p15-0756.1, complete sequence	3754-3783	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP031850	Klebsiella pneumoniae strain 121 plasmid pKP121-1-mcr, complete sequence	53996-54025	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	CP049309	Salmonella enterica subsp. enterica serovar Johannesburg strain CVM N58011 plasmid p58011, complete sequence	164179-164208	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NC_010870	Klebsiella pneumoniae plasmid pK29, complete sequence	53886-53915	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP024813	Enterobacter sp. CRENT-193 plasmid pCRENT-193_1, complete sequence	76650-76679	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP019214	Escherichia coli strain WCHEC050613 plasmid pMCR_WCHEC050613, complete sequence	55955-55984	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP041182	Salmonella enterica subsp. enterica serovar Indiana strain SJTUF13520v2 isolate food plasmid p13520, complete sequence	103440-103469	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	CP043545	Escherichia coli strain F2_81 plasmid pF2_18C_HI2, complete sequence	53498-53527	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP030940	Escherichia coli strain AMSHJX01 plasmid pAMSH1, complete sequence	152947-152976	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP036178	Escherichia coli strain WCHEC025970 plasmid pCTXM199_025970, complete sequence	55345-55374	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP022451	Salmonella enterica subsp. enterica serovar Indiana strain D90 plasmid pD90-1, complete sequence	173627-173656	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP030186	Salmonella enterica strain SA20094620 plasmid pSA20094620.1, complete sequence	109404-109433	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP042494	Leclercia adecarboxylata strain E61 plasmid pE61_001, complete sequence	55055-55084	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP033353	Salmonella enterica subsp. enterica strain CFSA664 plasmid pCFSA664-1, complete sequence	168893-168922	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP040696	Citrobacter freundii strain R47 plasmid pR47-309, complete sequence	7077-7106	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP024143	Escherichia coli strain 14EC029 plasmid p14EC029b, complete sequence	54028-54057	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP047116	Salmonella enterica subsp. enterica strain SCSM4.1 plasmid plas4.1.1, complete sequence	53996-54025	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP008899	Enterobacter hormaechei subsp. hoffmannii ECNIH3 plasmid pENT-8a4, complete sequence	55055-55084	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP008906	Enterobacter hormaechei subsp. hoffmannii ECR091 plasmid pENT-08e, complete sequence	55055-55084	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP042552	Enterobacter hormaechei strain C45 plasmid pC45_001, complete sequence	55055-55084	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP039271	Salmonella enterica subsp. enterica serovar Senftenberg str. CFSAN004025 plasmid pCFSAN004025.1, complete sequence	56405-56434	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP016526	Salmonella enterica subsp. enterica serovar Heidelberg strain 09-036813-1A plasmid p09-036813-1A_261, complete sequence	247405-247434	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	CP050163	Escherichia coli plasmid Carbapenemase(KPC-2)_IncHI2, complete sequence	55055-55084	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	KX856066	Salmonella Typhimurium strain HSHLJ1 plasmid pHSHLJ1-MCR1, complete sequence	172579-172608	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP041174	Salmonella enterica subsp. enterica serovar Enteritidis strain SJTUF12519v2 plasmid p12519A, complete sequence	141535-141564	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP039170	Salmonella enterica subsp. enterica serovar Goldcoast strain Sal-5364 plasmid pSal-5364, complete sequence	79039-79068	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP041734	Enterobacter hormaechei subsp. steigerwaltii strain ME-1 plasmid pME-1a, complete sequence	55055-55084	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP022165	Escherichia coli strain M160133 plasmid pM160133_p1, complete sequence	54503-54532	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	MK933279	Enterobacter hormaechei strain SCNJ07 plasmid pMCR-SCNJ07, complete sequence	150453-150482	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP012931	Salmonella enterica subsp. enterica serovar Heidelberg strain N13-01290 plasmid pN13-01290_23, complete sequence	129044-129073	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	CP048299	Salmonella enterica subsp. enterica serovar Schwarzengrund strain WAPHL_SAL-A00527 plasmid pN1566-2, complete sequence	205396-205425	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NC_005211	Serratia marcescens plasmid R478, complete sequence	53990-54019	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP026661	Salmonella enterica subsp. enterica strain 15-SA01028 plasmid pSE15-SA01028, complete sequence	55056-55085	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP042587	Escherichia coli strain LD91-1 plasmid pLD91-1-MCR1, complete sequence	53996-54025	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	LN794248	Salmonella enterica subsp. enterica serovar Typhimurium plasmid incHI2, complete sequence	171782-171811	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP029248	Enterobacter hormaechei subsp. xiangfangensis strain OSUVMCKPC4-2 plasmid pOSUEC_D, complete sequence	60068-60097	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP017451	Klebsiella sp. LTGPAF-6F plasmid unnamed1, complete sequence	379934-379963	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP043927	Klebsiella quasipneumoniae subsp. quasipneumoniae strain M17277 plasmid p17277A_477, complete sequence	55056-55085	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP031102	Leclercia sp. W17 plasmid pW17-1, complete sequence	142160-142189	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP012170	Enterobacter hormaechei subsp. steigerwaltii strain 34977 plasmid p34977-263.138kb, complete sequence	261236-261265	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	LC542971	Escherichia coli IOMTU413 plasmid pIOMTU413 DNA, complete sequence	50749-50778	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	LC542972	Escherichia coli IOMTU792 plasmid pIOMTU792 DNA, complete sequence	55870-55899	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	CP048303	Salmonella enterica subsp. enterica serovar Schwarzengrund strain WAPHL-SAL-A00375 plasmid p28945-2, complete sequence	50684-50713	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	CP051274	Salmonella enterica subsp. enterica serovar Worthington strain OLF-FSR1_WB_Partridge_SW-37 plasmid pSW37-267109, complete sequence	187611-187640	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP033347	Salmonella enterica subsp. enterica strain CFSA1096 plasmid pCFSA1096, complete sequence	77486-77515	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP043034	Escherichia coli strain XDL plasmid pXDL-CTX-M-14, complete sequence	55062-55091	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NC_024983	Salmonella enterica subsp. enterica serovar Typhimurium plasmid pSTm-A54650, strain A54560, complete sequence	55056-55085	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP037959	Salmonella enterica subsp. enterica serovar Goldcoast strain R18.0877 plasmid pR18.0877_278k, complete sequence	54495-54524	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	CP051271	Salmonella enterica subsp. enterica serovar Worthington strain OLF-FSR1_WB_Quail_SW-70 plasmid pSW37-267106, complete sequence	171009-171038	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP033224	Salmonella enterica subsp. enterica strain CFSA122 plasmid pCFSA122-1, complete sequence	148657-148686	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP033253	Salmonella enterica subsp. enterica strain CFSA244 plasmid pCFSA244-1, complete sequence	54125-54154	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP047659	Escherichia coli strain LD39-1 plasmid pLD39-1-MCR1, complete sequence	53996-54025	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP047666	Escherichia coli strain LD26-1 plasmid pLD26-1-MCR1, complete sequence	53996-54025	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP039861	Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014880 plasmid p16-6773.1, complete sequence	3754-3783	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP034390	Escherichia coli strain RS571 plasmid pRS571-MCR-1.1, complete sequence	53999-54028	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	KX856065	Salmonella enterica subsp. enterica serovar Typhimurium plasmid pASSD2-MCR1, complete sequence	125325-125354	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP013215	Klebsiella pneumoniae subsp. pneumoniae strain H11 plasmid pH11, complete sequence	92556-92585	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP021463	Salmonella enterica subsp. enterica serovar Typhimurium strain UGA14 plasmid pUGA14_1, complete sequence	210479-210508	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NC_012556	Enterobacter cloacae plasmid pEC-IMPQ, complete sequence	55055-55084	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NC_012555	Enterobacter cloacae plasmid pEC-IMP, complete sequence	55055-55084	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP042579	Enterobacter kobei strain C16 plasmid pC16_001, complete sequence	55434-55463	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP050780	Salmonella enterica subsp. enterica serovar Indiana strain SI85 plasmid pSI85-1, complete sequence	56668-56697	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP048776	Salmonella enterica subsp. enterica serovar Agona strain SG17-135 plasmid pSG17-135-HI2, complete sequence	54495-54524	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP033351	Salmonella enterica subsp. enterica strain CFSA629 plasmid pCFSA629, complete sequence	122373-122402	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NC_019114	Salmonella enterica subsp. enterica serovar Heidelberg plasmid pSH111_227, complete sequence	52746-52775	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP023143	Escherichia coli strain CFSAN061770 plasmid pEGY1-MCR-1, complete sequence	145866-145895	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_AP023198	Escherichia coli strain TUM18780 plasmid pMTY18780-1_lncHI2, complete sequence	56453-56482	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP043223	Salmonella enterica subsp. enterica serovar Bredeney strain SA20114778WT plasmid pET1.1-IncH, complete sequence	15343-15372	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP043223	Salmonella enterica subsp. enterica serovar Bredeney strain SA20114778WT plasmid pET1.1-IncH, complete sequence	249563-249592	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP049193	Enterobacter hormaechei strain Y2152 plasmid pIHI2-2152, complete sequence	28853-28882	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP050751	Salmonella enterica subsp. enterica serovar Typhimurium strain ST46 plasmid pST46-1, complete sequence	53996-54025	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP050729	Salmonella enterica subsp. enterica serovar Typhimurium strain ST106 plasmid pST106-1, complete sequence	53996-54025	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP050772	Salmonella enterica subsp. enterica serovar Indiana strain SI102 plasmid pSI102-1, complete sequence	53996-54025	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP050761	Salmonella enterica subsp. enterica serovar Indiana strain SI170 plasmid pSI170-1, complete sequence	55313-55342	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP051135	Enterobacter hormaechei strain AMS-38 plasmid pAMS-38c, complete sequence	125433-125462	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP032842	Enterobacter hormaechei strain C15117 plasmid pSPRC-Echo1, complete sequence	55055-55084	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP025340	Salmonella enterica subsp. enterica serovar Typhimurium strain BL10 plasmid p220k, complete sequence	61771-61800	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP038454	Escherichia coli strain EC-129 plasmid pEC129_1, complete sequence	56536-56565	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP041997	Escherichia coli strain AR Bank #0349 plasmid pAR349, complete sequence	95768-95797	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP042525	Citrobacter freundii strain E11 plasmid pE11_001, complete sequence	55055-55084	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP050754	Salmonella enterica subsp. enterica serovar Typhimurium strain ST45 plasmid pST45-1, complete sequence	53996-54025	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP050784	Salmonella enterica subsp. enterica serovar Indiana strain SI67 plasmid pSI67-1, complete sequence	53996-54025	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_LT991955	Enterobacter hormaechei subsp. steigerwaltii isolate C309 plasmid pC309-VIM4	55055-55084	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP050763	Salmonella enterica subsp. enterica serovar Indiana strain SI115 plasmid pSI115-1, complete sequence	86025-86054	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	MH884652	Salmonella sp. strain Sa27 plasmid pSa27-CIP, complete sequence	38962-38991	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	MH884653	Salmonella sp. strain Sa27 plasmid pSa27-TC-CIP, complete sequence	39273-39302	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP022533	Enterobacter hormaechei strain MS7884A plasmid pMS7884A, complete sequence	286766-286795	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP038659	Citrobacter freundii strain 680 plasmid p680_1, complete sequence	278194-278223	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	MH114596	Salmonella enterica strain 13-1681 plasmid p131681, complete sequence	53996-54025	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP026936	Escherichia coli strain CFS3292 plasmid pCFS3292-1, complete sequence	55851-55880	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP029717	UNVERIFIED_ORG: Enterobacter cloacae strain AR_0154 plasmid unnamed4, complete sequence	146833-146862	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP024910	Enterobacter hormaechei subsp. xiangfangensis strain OSUKPC4_L plasmid pOSUKPC4, complete sequence	60068-60097	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	MK962305	Escherichia coli strain YZUC2624 plasmid pYZUC2624.1, complete sequence	28033-28062	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	MN937241	Enterobacter cloacae strain BSI034 plasmid pBSI034-MCR9, complete sequence	55055-55084	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP042489	Enterobacter hormaechei strain C15 plasmid pC15_001, complete sequence	53920-53949	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_LT985297	Escherichia coli strain B4-25 plasmid RCS77_p, complete sequence	156288-156317	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP026933	Escherichia coli strain CFS3273 plasmid pCFS3273-1, complete sequence	55702-55731	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_MK461931	Escherichia coli strain F2_14D plasmid pF2_14D_HI2, complete sequence	55340-55369	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_MK355502	Klebsiella pneumoniae strain CRE plasmid pAN65-1, complete sequence	56269-56298	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_MN540571	Escherichia coli strain E.coli4feg plasmid pIV_IncHI2_CTX_M_15, complete sequence	132517-132546	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP033103	Enterobacter hormaechei strain L51 plasmid pEHZJ1, complete sequence	55055-55084	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_MH829594	Enterobacter cloacae strain EC62 plasmid pIMP-4-EC62, complete sequence	55053-55082	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_MH522426	Salmonella enterica subsp. enterica serovar Typhimurium strain SH16G4928 plasmid pSH16G4928, complete sequence	140810-140839	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_MH924589	Escherichia coli strain RDB9 plasmid pRDB9, complete sequence	206450-206479	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_MH287085	Escherichia coli strain F2_12B plasmid pSDC-F2_12BHI2, complete sequence	54834-54863	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_MH287084	Escherichia coli O157 strain SvETEC plasmid pSDE-SvHI2, complete sequence	54834-54863	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_MK169211	Escherichia coli strain DUK14-2 plasmid pMOO-32, complete sequence	55516-55545	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_MK413720	Enterobacter cloacae strain 12949 plasmid p12949-HI2, complete sequence	67566-67595	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_MK736669	Enterobacter cloacae strain EclC2185 plasmid pEclC2185CTXM15, complete sequence	182118-182147	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_MG825373	Escherichia coli strain 1106 plasmid p1106-IncHI2, complete sequence	261079-261108	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_LC511997	Enterobacter hormaechei subsp. xiangfangensis strain MY460 plasmid pMY460-rmtE, complete sequence	53990-54019	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_MF344580	Enterobacter cloacae strain 30860 plasmid p30860-HI2, complete sequence	55055-55084	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_MF344581	Enterobacter cloacae strain 13E573 plasmid p13E573-HI2, complete sequence	56712-56741	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_MF344583	Enterobacter cloacae strain N1863 plasmid pN1863-HI2, complete sequence	58858-58887	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_MG662415	Escherichia coli strain EC1107 plasmid EC1107-IncHI2-226K, complete sequence	55334-55363	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_MH522419	Salmonella enterica subsp. enterica serovar Typhimurium strain SH16G1369 plasmid pSH16G1369, complete sequence	170558-170587	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_MH329870	Escherichia coli strain 92944 plasmid p92944-MCR, complete sequence	53996-54025	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_MH522425	Salmonella enterica subsp. enterica serovar Typhimurium strain SH16G4909 plasmid pSH16G4909, complete sequence	37313-37342	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_MH399264	Enterobacter cloacae strain RJ702 plasmid pIMP26, complete sequence	102110-102139	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_MH077952	Escherichia coli strain EC17S-208 plasmid p17S-208, complete sequence	239120-239149	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_MH522424	Salmonella enterica subsp. enterica serovar Typhimurium strain SH16G4525 plasmid pSH16G4525, complete sequence	139368-139397	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_KY863418	Enterobacter asburiae strain AMA 497 plasmid pOXA436, complete sequence	55832-55861	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_KY978628	Cronobacter sakazakii strain 505108 plasmid p505108-MDR, complete sequence	55343-55372	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_MG288680	Klebsiella pneumoniae strain D610 plasmid pD610-HI2, complete sequence	67873-67902	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_MF344582	Citrobacter freundii strain 525011 plasmid p525011-HI2, complete sequence	65470-65499	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_MF788071	Raoultella ornithinolytica strain 23141 plasmid p23141-3, complete sequence	55055-55084	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP031724	Enterobacter hormaechei strain WCHEH020038 plasmid pCTXM9_020038, complete sequence	55055-55084	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP011062	Escherichia coli str. Sanji plasmid pSJ_255, complete sequence	53996-54025	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP027202	Escherichia coli strain WCHEC025943 plasmid pMCR1_025943, complete sequence	53996-54025	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP053191	Enterobacter hormaechei strain EGYMCRVIM plasmid pMS-37a, complete sequence	55055-55084	9	0.7
NC_018407_2	2.18\|878846\|30\|NC_018407\|CRISPRCasFinder,CRT	878846-878875	30	NZ_CP016838	Salmonella enterica subsp. enterica serovar Senftenberg strain 775W (ATCC 43845) plasmid pSSE-ATCC-43845, complete sequence	56246-56275	9	0.7
NC_018407_2	2.21\|879044\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	879044-879073	30	NZ_CP015043	Rhodovulum sp. P5 plasmid pRGUI04, complete sequence	18973-19002	9	0.7
NC_018407_2	2.29\|879573\|31\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	879573-879603	31	NZ_CP038614	Arsenophonus nasoniae strain FIN plasmid pArsFIN2, complete sequence	126354-126384	9	0.71
NC_018407_2	2.29\|879573\|31\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	879573-879603	31	NZ_CP026601	Clostridiaceae bacterium 14S0207 plasmid unnamed1, complete sequence	103794-103824	9	0.71
NC_018407_2	2.29\|879573\|31\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	879573-879603	31	MN694315	Marine virus AFVG_250M710, complete genome	10783-10813	9	0.71
NC_018407_2	2.32\|879772\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	879772-879801	30	NZ_LR134403	Listeria monocytogenes strain NCTC7974 plasmid 6, complete sequence	105801-105830	9	0.7
NC_018407_2	2.33\|879838\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	879838-879867	30	NZ_CP037428	Myroides odoratimimus strain G13 plasmid pFM-G13, complete sequence	24370-24399	9	0.7
NC_018407_2	2.33\|879838\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	879838-879867	30	MN694380	Marine virus AFVG_250M409, complete genome	9425-9454	9	0.7
NC_018407_2	2.39\|880234\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880234-880263	30	MN693324	Marine virus AFVG_25M101, complete genome	13396-13425	9	0.7
NC_018407_2	2.41\|880366\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880366-880395	30	MN693324	Marine virus AFVG_25M101, complete genome	13396-13425	9	0.7
NC_018407_2	2.43\|880498\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880498-880527	30	NZ_CP015043	Rhodovulum sp. P5 plasmid pRGUI04, complete sequence	18973-19002	9	0.7
NC_018407_2	2.45\|880630\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880630-880659	30	NC_018990	Borrelia burgdorferi 297 plasmid 297_lp28-3, complete sequence	5811-5840	9	0.7
NC_018407_2	2.45\|880630\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880630-880659	30	NC_011781	Borreliella burgdorferi ZS7 plasmid ZS7_lp28-3, complete sequence	20707-20736	9	0.7
NC_018407_2	2.45\|880630\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880630-880659	30	NC_017405	Borreliella burgdorferi JD1 plasmid JD1 lp28-3, complete sequence	7786-7815	9	0.7
NC_018407_2	2.45\|880630\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880630-880659	30	NC_001853	Borreliella burgdorferi B31 plasmid lp28-3, complete sequence	7782-7811	9	0.7
NC_018407_2	2.45\|880630\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	880630-880659	30	MH616728	Myoviridae sp. isolate ctge_1, complete genome	6200-6229	10	0.667
NC_018407_2	2.33\|879838\|30\|NC_018407\|CRISPRCasFinder,CRT,PILER-CR	879838-879867	30	NC_014533	Gloeothece verrucosa PCC 7822 plasmid Cy782201, complete sequence	484818-484847	11	0.633

1. spacer 2.39|880234|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP004866 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB7921, complete sequence) position: , mismatch: 3, identity: 0.9

gaattaaattatctttataagtaaaataaa	CRISPR spacer
gcataaaattatctttataagtaaaataga	Protospacer
* ** ***********************.*

2. spacer 2.39|880234|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to CP045775 (Bacillus paranthracis strain CFSAN068816 plasmid p2CFSAN068816, complete sequence) position: , mismatch: 3, identity: 0.9

gaattaaattatctttataagtaaaataaa	CRISPR spacer
gcataaaattatctttataagtaaaataga	Protospacer
* ** ***********************.*

3. spacer 2.41|880366|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP004866 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB7921, complete sequence) position: , mismatch: 3, identity: 0.9

gaattaaattatctttataagtaaaataaa	CRISPR spacer
gcataaaattatctttataagtaaaataga	Protospacer
* ** ***********************.*

4. spacer 2.41|880366|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to CP045775 (Bacillus paranthracis strain CFSAN068816 plasmid p2CFSAN068816, complete sequence) position: , mismatch: 3, identity: 0.9

gaattaaattatctttataagtaaaataaa	CRISPR spacer
gcataaaattatctttataagtaaaataga	Protospacer
* ** ***********************.*

5. spacer 2.11|878384|30|NC_018407|CRISPRCasFinder,CRT matches to MN694034 (Marine virus AFVG_250M807, complete genome) position: , mismatch: 5, identity: 0.833

attcattaacaaaaaagatgttaaataaac	CRISPR spacer
aatgtttaacaaaaaaaatgttcaataaac	Protospacer
* *  ***********.***** *******

6. spacer 2.12|878450|30|NC_018407|CRISPRCasFinder,CRT matches to MH616963 (CrAssphage sp. isolate ctbg_1, complete genome) position: , mismatch: 5, identity: 0.833

ttttttcaaaattatacaataacgatttaa	CRISPR spacer
agatttaaaaattatacaattacgatttaa	Protospacer
   *** ************* *********

7. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to MT939241 (Enterococcus phage 9183, complete genome) position: , mismatch: 5, identity: 0.833

aggttgt-tcatgattgacattaaaattaaa	CRISPR spacer
-tattatatcatgattgacattaaaattaca	Protospacer
  .**.* ********************* *

8. spacer 2.37|880102|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.833

tagttaaattaatttttaaaggatggttta	CRISPR spacer
ttgataattaaatttttaaaggatggtttt	Protospacer
* * *** * *******************

9. spacer 2.39|880234|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP022446 (Bacillus cereus C1L plasmid pC1L1, complete sequence) position: , mismatch: 5, identity: 0.833

gaattaaattatctttataagtaaaataaa	CRISPR spacer
gaattaaattatctttataaataaggttat	Protospacer
********************.***..* *

10. spacer 2.39|880234|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NC_014557 (Bacillus sp. BS-02 plasmid pBS-02, complete sequence) position: , mismatch: 5, identity: 0.833

gaattaaattatctttataagtaaaataaa	CRISPR spacer
taattaaattatcttgatcagtaaaatcat	Protospacer
 ************** ** ******** *

11. spacer 2.39|880234|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP024656 (Bacillus cereus strain MLY1 plasmid pMLY1.2, complete sequence) position: , mismatch: 5, identity: 0.833

gaattaaattatctttataagtaaaataaa	CRISPR spacer
gaattaaattatctttataattatatttat	Protospacer
******************** ** * * *

12. spacer 2.39|880234|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP024656 (Bacillus cereus strain MLY1 plasmid pMLY1.2, complete sequence) position: , mismatch: 5, identity: 0.833

gaattaaattatctttataagtaaaataaa	CRISPR spacer
gaattaaattatctttataattatatttat	Protospacer
******************** ** * * *

13. spacer 2.39|880234|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013669 (Piscirickettsia salmonis LF-89 = ATCC VR-1361 plasmid pPSLF89-4, complete sequence) position: , mismatch: 5, identity: 0.833

gaatta-aattatctttataagtaaaataaa	CRISPR spacer
-aataataattatctttatcagtaaaatatt	Protospacer
 *** * ************ *********

14. spacer 2.39|880234|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013789 (Piscirickettsia salmonis strain PM58386B plasmid p3PS7, complete sequence) position: , mismatch: 5, identity: 0.833

gaatta-aattatctttataagtaaaataaa	CRISPR spacer
-aataataattatctttatcagtaaaatatt	Protospacer
 *** * ************ *********

15. spacer 2.39|880234|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013817 (Piscirickettsia salmonis strain AY3800B plasmid p1PS10, complete sequence) position: , mismatch: 5, identity: 0.833

gaatta-aattatctttataagtaaaataaa	CRISPR spacer
-aataataattatctttatcagtaaaatatt	Protospacer
 *** * ************ *********

16. spacer 2.39|880234|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013793 (Piscirickettsia salmonis strain AY6297B plasmid p2PS8, complete sequence) position: , mismatch: 5, identity: 0.833

gaatta-aattatctttataagtaaaataaa	CRISPR spacer
-aataataattatctttatcagtaaaatatt	Protospacer
 *** * ************ *********

17. spacer 2.39|880234|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013809 (Piscirickettsia salmonis strain PM31429B plasmid p3PS12, complete sequence) position: , mismatch: 5, identity: 0.833

gaatta-aattatctttataagtaaaataaa	CRISPR spacer
-aataataattatctttatcagtaaaatatt	Protospacer
 *** * ************ *********

18. spacer 2.39|880234|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013784 (Piscirickettsia salmonis strain PM49811B plasmid p3PS6, complete sequence) position: , mismatch: 5, identity: 0.833

gaatta-aattatctttataagtaaaataaa	CRISPR spacer
-aataataattatctttatcagtaaaatatt	Protospacer
 *** * ************ *********

19. spacer 2.39|880234|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP039089 (Piscirickettsia salmonis strain Psal-111 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.833

gaatta-aattatctttataagtaaaataaa	CRISPR spacer
-aataataattatctttatcagtaaaatatt	Protospacer
 *** * ************ *********

20. spacer 2.39|880234|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013798 (Piscirickettsia salmonis strain AY6532B plasmid p2PS9, complete sequence) position: , mismatch: 5, identity: 0.833

gaatta-aattatctttataagtaaaataaa	CRISPR spacer
-aataataattatctttatcagtaaaatatt	Protospacer
 *** * ************ *********

21. spacer 2.39|880234|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013978 (Piscirickettsia salmonis strain CGR02 plasmid pPSCRG02-4, complete sequence) position: , mismatch: 5, identity: 0.833

gaatta-aattatctttataagtaaaataaa	CRISPR spacer
-aataataattatctttatcagtaaaatatt	Protospacer
 *** * ************ *********

22. spacer 2.39|880234|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013978 (Piscirickettsia salmonis strain CGR02 plasmid pPSCRG02-4, complete sequence) position: , mismatch: 5, identity: 0.833

gaatta-aattatctttataagtaaaataaa	CRISPR spacer
-aataataattatctttatcagtaaaatatt	Protospacer
 *** * ************ *********

23. spacer 2.39|880234|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP012509 (Piscirickettsia salmonis strain PM32597B1 plasmid pPSB1-1, complete sequence) position: , mismatch: 5, identity: 0.833

gaatta-aattatctttataagtaaaataaa	CRISPR spacer
-aataataattatctttatcagtaaaatatt	Protospacer
 *** * ************ *********

24. spacer 2.39|880234|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NC_014633 (Ilyobacter polytropus DSM 2926 plasmid pILYOP01, complete sequence) position: , mismatch: 5, identity: 0.833

gaatta-aattatctttataagtaaaataaa	CRISPR spacer
-aatcatgattatctttataagaaaaataat	Protospacer
 ***.* .************** *******

25. spacer 2.39|880234|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013822 (Piscirickettsia salmonis strain PM25344B plasmid p1PS14, complete sequence) position: , mismatch: 5, identity: 0.833

gaatta-aattatctttataagtaaaataaa	CRISPR spacer
-aataataattatctttatcagtaaaatatt	Protospacer
 *** * ************ *********

26. spacer 2.39|880234|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP039052 (Piscirickettsia salmonis strain Psal-081 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.833

gaatta-aattatctttataagtaaaataaa	CRISPR spacer
-aataataattatctttatcagtaaaatatt	Protospacer
 *** * ************ *********

27. spacer 2.39|880234|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013945 (Piscirickettsia salmonis strain PSCGR01 plasmid pPSCRG01-4, complete sequence) position: , mismatch: 5, identity: 0.833

gaatta-aattatctttataagtaaaataaa	CRISPR spacer
-aataataattatctttatcagtaaaatatt	Protospacer
 *** * ************ *********

28. spacer 2.39|880234|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP039057 (Piscirickettsia salmonis strain Psal-098 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.833

gaatta-aattatctttataagtaaaataaa	CRISPR spacer
-aataataattatctttatcagtaaaatatt	Protospacer
 *** * ************ *********

29. spacer 2.39|880234|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP038933 (Piscirickettsia salmonis strain Psal-025 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

gaatta-aattatctttataagtaaaataaa	CRISPR spacer
-aataataattatctttatcagtaaaatatt	Protospacer
 *** * ************ *********

30. spacer 2.39|880234|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP038901 (Piscirickettsia salmonis strain Psal-006b plasmid unnamed3, complete sequence) position: , mismatch: 5, identity: 0.833

gaatta-aattatctttataagtaaaataaa	CRISPR spacer
-aataataattatctttatcagtaaaatatt	Protospacer
 *** * ************ *********

31. spacer 2.41|880366|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP022446 (Bacillus cereus C1L plasmid pC1L1, complete sequence) position: , mismatch: 5, identity: 0.833

gaattaaattatctttataagtaaaataaa	CRISPR spacer
gaattaaattatctttataaataaggttat	Protospacer
********************.***..* *

32. spacer 2.41|880366|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NC_014557 (Bacillus sp. BS-02 plasmid pBS-02, complete sequence) position: , mismatch: 5, identity: 0.833

gaattaaattatctttataagtaaaataaa	CRISPR spacer
taattaaattatcttgatcagtaaaatcat	Protospacer
 ************** ** ******** *

33. spacer 2.41|880366|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP024656 (Bacillus cereus strain MLY1 plasmid pMLY1.2, complete sequence) position: , mismatch: 5, identity: 0.833

gaattaaattatctttataagtaaaataaa	CRISPR spacer
gaattaaattatctttataattatatttat	Protospacer
******************** ** * * *

34. spacer 2.41|880366|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP024656 (Bacillus cereus strain MLY1 plasmid pMLY1.2, complete sequence) position: , mismatch: 5, identity: 0.833

gaattaaattatctttataagtaaaataaa	CRISPR spacer
gaattaaattatctttataattatatttat	Protospacer
******************** ** * * *

35. spacer 2.41|880366|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013669 (Piscirickettsia salmonis LF-89 = ATCC VR-1361 plasmid pPSLF89-4, complete sequence) position: , mismatch: 5, identity: 0.833

gaatta-aattatctttataagtaaaataaa	CRISPR spacer
-aataataattatctttatcagtaaaatatt	Protospacer
 *** * ************ *********

36. spacer 2.41|880366|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013789 (Piscirickettsia salmonis strain PM58386B plasmid p3PS7, complete sequence) position: , mismatch: 5, identity: 0.833

gaatta-aattatctttataagtaaaataaa	CRISPR spacer
-aataataattatctttatcagtaaaatatt	Protospacer
 *** * ************ *********

37. spacer 2.41|880366|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013817 (Piscirickettsia salmonis strain AY3800B plasmid p1PS10, complete sequence) position: , mismatch: 5, identity: 0.833

gaatta-aattatctttataagtaaaataaa	CRISPR spacer
-aataataattatctttatcagtaaaatatt	Protospacer
 *** * ************ *********

38. spacer 2.41|880366|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013793 (Piscirickettsia salmonis strain AY6297B plasmid p2PS8, complete sequence) position: , mismatch: 5, identity: 0.833

gaatta-aattatctttataagtaaaataaa	CRISPR spacer
-aataataattatctttatcagtaaaatatt	Protospacer
 *** * ************ *********

39. spacer 2.41|880366|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013809 (Piscirickettsia salmonis strain PM31429B plasmid p3PS12, complete sequence) position: , mismatch: 5, identity: 0.833

gaatta-aattatctttataagtaaaataaa	CRISPR spacer
-aataataattatctttatcagtaaaatatt	Protospacer
 *** * ************ *********

40. spacer 2.41|880366|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013784 (Piscirickettsia salmonis strain PM49811B plasmid p3PS6, complete sequence) position: , mismatch: 5, identity: 0.833

gaatta-aattatctttataagtaaaataaa	CRISPR spacer
-aataataattatctttatcagtaaaatatt	Protospacer
 *** * ************ *********

41. spacer 2.41|880366|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP039089 (Piscirickettsia salmonis strain Psal-111 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.833

gaatta-aattatctttataagtaaaataaa	CRISPR spacer
-aataataattatctttatcagtaaaatatt	Protospacer
 *** * ************ *********

42. spacer 2.41|880366|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013798 (Piscirickettsia salmonis strain AY6532B plasmid p2PS9, complete sequence) position: , mismatch: 5, identity: 0.833

gaatta-aattatctttataagtaaaataaa	CRISPR spacer
-aataataattatctttatcagtaaaatatt	Protospacer
 *** * ************ *********

43. spacer 2.41|880366|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013978 (Piscirickettsia salmonis strain CGR02 plasmid pPSCRG02-4, complete sequence) position: , mismatch: 5, identity: 0.833

gaatta-aattatctttataagtaaaataaa	CRISPR spacer
-aataataattatctttatcagtaaaatatt	Protospacer
 *** * ************ *********

44. spacer 2.41|880366|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013978 (Piscirickettsia salmonis strain CGR02 plasmid pPSCRG02-4, complete sequence) position: , mismatch: 5, identity: 0.833

gaatta-aattatctttataagtaaaataaa	CRISPR spacer
-aataataattatctttatcagtaaaatatt	Protospacer
 *** * ************ *********

45. spacer 2.41|880366|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP012509 (Piscirickettsia salmonis strain PM32597B1 plasmid pPSB1-1, complete sequence) position: , mismatch: 5, identity: 0.833

gaatta-aattatctttataagtaaaataaa	CRISPR spacer
-aataataattatctttatcagtaaaatatt	Protospacer
 *** * ************ *********

46. spacer 2.41|880366|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NC_014633 (Ilyobacter polytropus DSM 2926 plasmid pILYOP01, complete sequence) position: , mismatch: 5, identity: 0.833

gaatta-aattatctttataagtaaaataaa	CRISPR spacer
-aatcatgattatctttataagaaaaataat	Protospacer
 ***.* .************** *******

47. spacer 2.41|880366|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013822 (Piscirickettsia salmonis strain PM25344B plasmid p1PS14, complete sequence) position: , mismatch: 5, identity: 0.833

gaatta-aattatctttataagtaaaataaa	CRISPR spacer
-aataataattatctttatcagtaaaatatt	Protospacer
 *** * ************ *********

48. spacer 2.41|880366|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP039052 (Piscirickettsia salmonis strain Psal-081 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.833

gaatta-aattatctttataagtaaaataaa	CRISPR spacer
-aataataattatctttatcagtaaaatatt	Protospacer
 *** * ************ *********

49. spacer 2.41|880366|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013945 (Piscirickettsia salmonis strain PSCGR01 plasmid pPSCRG01-4, complete sequence) position: , mismatch: 5, identity: 0.833

gaatta-aattatctttataagtaaaataaa	CRISPR spacer
-aataataattatctttatcagtaaaatatt	Protospacer
 *** * ************ *********

50. spacer 2.41|880366|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP039057 (Piscirickettsia salmonis strain Psal-098 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.833

gaatta-aattatctttataagtaaaataaa	CRISPR spacer
-aataataattatctttatcagtaaaatatt	Protospacer
 *** * ************ *********

51. spacer 2.41|880366|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP038933 (Piscirickettsia salmonis strain Psal-025 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

gaatta-aattatctttataagtaaaataaa	CRISPR spacer
-aataataattatctttatcagtaaaatatt	Protospacer
 *** * ************ *********

52. spacer 2.41|880366|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP038901 (Piscirickettsia salmonis strain Psal-006b plasmid unnamed3, complete sequence) position: , mismatch: 5, identity: 0.833

gaatta-aattatctttataagtaaaataaa	CRISPR spacer
-aataataattatctttatcagtaaaatatt	Protospacer
 *** * ************ *********

53. spacer 2.4|877922|30|NC_018407|CRISPRCasFinder,CRT matches to NC_009929 (Acaryochloris marina MBIC11017 plasmid pREB4, complete sequence) position: , mismatch: 6, identity: 0.8

aataaatttaaaattgccgattgtgttcaa	CRISPR spacer
aataaatttaaaaatgccgattatacataa	Protospacer
************* ********.*.. .**

54. spacer 2.8|878186|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP045370 (Microbulbifer sp. THAF38 plasmid pTHAF38_a, complete sequence) position: , mismatch: 6, identity: 0.8

ttatttattaaacgacgaacaaagacgttt	CRISPR spacer
ttatttattgaacgaagaacaaagaacaat	Protospacer
*********.***** *********    *

55. spacer 2.11|878384|30|NC_018407|CRISPRCasFinder,CRT matches to NC_018878 (Bacillus thuringiensis Bt407 plasmid BTB_502p, complete sequence) position: , mismatch: 6, identity: 0.8

attcattaacaaaaaagatgttaaataaac	CRISPR spacer
ttcgattaacaaaaaagattttaaatcaat	Protospacer
 *. *************** ****** **.

56. spacer 2.11|878384|30|NC_018407|CRISPRCasFinder,CRT matches to MK448960 (Streptococcus phage Javan492, complete genome) position: , mismatch: 6, identity: 0.8

attcattaacaaaaaagatgttaaataaac	CRISPR spacer
agtttgtaacaaaaaagatgttaattaaat	Protospacer
* *.  ****************** ****.

57. spacer 2.11|878384|30|NC_018407|CRISPRCasFinder,CRT matches to MK448762 (Streptococcus phage Javan447, complete genome) position: , mismatch: 6, identity: 0.8

attcattaacaaaaaagatgttaaataaac	CRISPR spacer
agtttgtaacaaaaaagatgttaattaaat	Protospacer
* *.  ****************** ****.

58. spacer 2.11|878384|30|NC_018407|CRISPRCasFinder,CRT matches to MK448795 (Streptococcus phage Javan527, complete genome) position: , mismatch: 6, identity: 0.8

attcattaacaaaaaagatgttaaataaac	CRISPR spacer
agtttgtaacaaaaaagatgttaattaaat	Protospacer
* *.  ****************** ****.

59. spacer 2.11|878384|30|NC_018407|CRISPRCasFinder,CRT matches to MK448774 (Streptococcus phage Javan487, complete genome) position: , mismatch: 6, identity: 0.8

attcattaacaaaaaagatgttaaataaac	CRISPR spacer
agtttgtaacaaaaaagatgttaattaaat	Protospacer
* *.  ****************** ****.

60. spacer 2.11|878384|30|NC_018407|CRISPRCasFinder,CRT matches to MK448773 (Streptococcus phage Javan485, complete genome) position: , mismatch: 6, identity: 0.8

attcattaacaaaaaagatgttaaataaac	CRISPR spacer
agtttgtaacaaaaaagatgttaattaaat	Protospacer
* *.  ****************** ****.

61. spacer 2.11|878384|30|NC_018407|CRISPRCasFinder,CRT matches to MK448958 (Streptococcus phage Javan486, complete genome) position: , mismatch: 6, identity: 0.8

attcattaacaaaaaagatgttaaataaac	CRISPR spacer
agtttgtaacaaaaaagatgttaattaaat	Protospacer
* *.  ****************** ****.

62. spacer 2.11|878384|30|NC_018407|CRISPRCasFinder,CRT matches to MK448783 (Streptococcus phage Javan503, complete genome) position: , mismatch: 6, identity: 0.8

attcattaacaaaaaagatgttaaataaac	CRISPR spacer
agtttgtaacaaaaaagatgttaattaaat	Protospacer
* *.  ****************** ****.

63. spacer 2.11|878384|30|NC_018407|CRISPRCasFinder,CRT matches to MK448954 (Streptococcus phage Javan476, complete genome) position: , mismatch: 6, identity: 0.8

attcattaacaaaaaagatgttaaataaac	CRISPR spacer
agtttgtaacaaaaaagatgttaattaaat	Protospacer
* *.  ****************** ****.

64. spacer 2.12|878450|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_LR215018 (Mycoplasma canis strain NCTC10146 plasmid 9) position: , mismatch: 6, identity: 0.8

ttttttcaaaattatacaataacgatttaa	CRISPR spacer
acattttaaaattatacaaaaacgatttta	Protospacer
 . ***.************ ******** *

65. spacer 2.19|878912|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LR214939 (Mycoplasma salivarium strain NCTC10113 plasmid 2) position: , mismatch: 6, identity: 0.8

attcaattgcgttttttaaacgtacaaata	CRISPR spacer
gggcaattgcgtttttgatacgtacaaaca	Protospacer
.  ************* * *********.*

66. spacer 2.25|879308|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NC_049490 (Acinetobacter phage vB_AbaP_Berthold, complete genome) position: , mismatch: 6, identity: 0.8

ttgaaatttgaatgtttggaaatcttcacg	CRISPR spacer
aagaacttttaatgtttggaaatcttgaag	Protospacer
  *** *** **************** * *

67. spacer 2.25|879308|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to MN709128 (Acinetobacter phage Berthold, complete genome) position: , mismatch: 6, identity: 0.8

ttgaaatttgaatgtttggaaatcttcacg	CRISPR spacer
aagaacttttaatgtttggaaatcttgaag	Protospacer
  *** *** **************** * *

68. spacer 2.29|879573|31|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP009639 (Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence) position: , mismatch: 6, identity: 0.806

ttttttgttaatgaattaaaaatcttatcag	CRISPR spacer
ttttttattaatgaaataaaaatcaaatgac	Protospacer
******.******** ********  ** *

69. spacer 2.29|879573|31|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP053963 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence) position: , mismatch: 6, identity: 0.806

ttttttgttaatgaattaaaaatcttatcag	CRISPR spacer
ttttttattaatgaaataaaaatcaaatgac	Protospacer
******.******** ********  ** *

70. spacer 2.33|879838|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NC_010631 (Nostoc punctiforme PCC 73102 plasmid pNPUN01, complete sequence) position: , mismatch: 6, identity: 0.8

aagttgatcatttaaatgagcttttaaaaa	CRISPR spacer
gtactgagcatttaaatgagcatttaaaaa	Protospacer
. ..*** ************* ********

71. spacer 2.33|879838|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to JX145342 (Clostridium phage phiMMP04, complete genome) position: , mismatch: 6, identity: 0.8

aagttgatcatttaaatgagcttttaaaaa	CRISPR spacer
ctagtgataatttaaatgagtttttaaaaa	Protospacer
  . **** ***********.*********

72. spacer 2.33|879838|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to KY197768 (Bacillus phage phi105 N-acetylmuramoyl-L-alanine amidase CwlH gene, complete cds) position: , mismatch: 6, identity: 0.8

aagttgatcatttaaatgagcttttaaaaa	CRISPR spacer
ataaagatcatttatatgaccttttaaaaa	Protospacer
* .  ********* **** **********

73. spacer 2.33|879838|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_AP014952 (Klebsiella oxytoca strain JKo3 plasmid pKO_JKo3_1, complete sequence) position: , mismatch: 6, identity: 0.8

aagttgatcatttaaatgagcttttaaaaa	CRISPR spacer
aagttgattatttaattgagcttgtggata	Protospacer
********.****** ******* *..* *

74. spacer 2.37|880102|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to MH552532 (Siphoviridae sp. isolate ctbf3, complete genome) position: , mismatch: 6, identity: 0.8

tagttaaattaatttttaaaggatggttta	CRISPR spacer
tatacaaattaatttttaaacgatgatttg	Protospacer
**  .*************** ****.***.

75. spacer 2.38|880168|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to AP019522 (Staphylococcal phage MR003 DNA, complete genome) position: , mismatch: 6, identity: 0.8

taataatcttaattttagtgtgtttgtcgt	CRISPR spacer
taataatcttaattttagtttcttcattga	Protospacer
******************* * **..*.*

76. spacer 2.39|880234|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP044979 (Bacillus thuringiensis strain BT62 plasmid pBT62A, complete sequence) position: , mismatch: 6, identity: 0.8

gaattaaattatctttataagtaaaataaa	CRISPR spacer
gaattaaattatctttattaataaggttat	Protospacer
****************** *.***..* *

77. spacer 2.39|880234|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP020859 (Lactobacillus salivarius strain ZLS006 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

--gaattaaattatctttataagtaaaataaa	CRISPR spacer
ttcgat--aattatcttaataattaaaataaa	Protospacer
   .**  ********* **** *********

78. spacer 2.39|880234|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP023312 (Vibrio anguillarum strain VIB12 isolate Sea bass plasmid p292, complete sequence) position: , mismatch: 6, identity: 0.8

gaattaaattatctttataagtaaaataaa	CRISPR spacer
cagtcaaattatctttataattaaagtaga	Protospacer
 *.*.*************** ****.**.*

79. spacer 2.40|880300|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to AP019522 (Staphylococcal phage MR003 DNA, complete genome) position: , mismatch: 6, identity: 0.8

taataatcttaattttagtgtgtttgtcgt	CRISPR spacer
taataatcttaattttagtttcttcattga	Protospacer
******************* * **..*.*

80. spacer 2.41|880366|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP044979 (Bacillus thuringiensis strain BT62 plasmid pBT62A, complete sequence) position: , mismatch: 6, identity: 0.8

gaattaaattatctttataagtaaaataaa	CRISPR spacer
gaattaaattatctttattaataaggttat	Protospacer
****************** *.***..* *

81. spacer 2.41|880366|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP020859 (Lactobacillus salivarius strain ZLS006 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

--gaattaaattatctttataagtaaaataaa	CRISPR spacer
ttcgat--aattatcttaataattaaaataaa	Protospacer
   .**  ********* **** *********

82. spacer 2.41|880366|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP023312 (Vibrio anguillarum strain VIB12 isolate Sea bass plasmid p292, complete sequence) position: , mismatch: 6, identity: 0.8

gaattaaattatctttataagtaaaataaa	CRISPR spacer
cagtcaaattatctttataattaaagtaga	Protospacer
 *.*.*************** ****.**.*

83. spacer 2.45|880630|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NC_011720 (Borreliella burgdorferi ZS7 plasmid ZS7_cp32-3+10, complete sequence) position: , mismatch: 6, identity: 0.8

caacagccgttgttaaaattaaaaaaacta	CRISPR spacer
gaaccagcgttgtttaaattaaaaaaatta	Protospacer
 *** . ******* ************.**

84. spacer 2.45|880630|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NC_011720 (Borreliella burgdorferi ZS7 plasmid ZS7_cp32-3+10, complete sequence) position: , mismatch: 6, identity: 0.8

caacagccgttgttaaaattaaaaaaacta	CRISPR spacer
gaaccagcgttgtttaaattaaaaaaatta	Protospacer
 *** . ******* ************.**

85. spacer 2.45|880630|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP031402 (Borreliella burgdorferi strain MM1 plasmid plsm_lp28-3, complete sequence) position: , mismatch: 6, identity: 0.8

caacagccg-ttgttaaaattaaaaaaacta	CRISPR spacer
-aagattagttttttaaaattaaaaaaacta	Protospacer
 ** * . * ** ******************

86. spacer 2.3|877856|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP013139 (Pseudoalteromonas sp. Bsw20308 plasmid pPBSW1, complete sequence) position: , mismatch: 7, identity: 0.767

tttgcatatttagatcgttactttgacaaa	CRISPR spacer
atagttgatttagattggtactttgacaaa	Protospacer
 * *.  ********.* ************

87. spacer 2.6|878054|30|NC_018407|CRISPRCasFinder,CRT matches to MN693734 (Marine virus AFVG_250M835, complete genome) position: , mismatch: 7, identity: 0.767

tcagataattcttcaactgcaacaacgtta	CRISPR spacer
agaaataattctgcaactgtaacaacgtcg	Protospacer
  *.******** ******.********..

88. spacer 2.6|878054|30|NC_018407|CRISPRCasFinder,CRT matches to MN694626 (Marine virus AFVG_250M967, complete genome) position: , mismatch: 7, identity: 0.767

tcagataattcttcaactgcaacaacgtta	CRISPR spacer
agaaataattctgcaactgtaacaacgtcg	Protospacer
  *.******** ******.********..

89. spacer 2.11|878384|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_KY940428 (UNVERIFIED: Bacillus sp. (in: Bacteria) strain PUMK-07 plasmid pMK-07, complete sequence) position: , mismatch: 7, identity: 0.767

attcattaacaaaaaagatgttaaataaac	CRISPR spacer
aaccattaacaaaaaagatgttaacgacta	Protospacer
* .*********************  *

90. spacer 2.11|878384|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP047086 (Bacillus paranthracis strain BC307 plasmid pCE1, complete sequence) position: , mismatch: 7, identity: 0.767

attcattaacaaaaaagatgttaaataaac	CRISPR spacer
aaccattaacaaaaaagatgttaacgacta	Protospacer
* .*********************  *

91. spacer 2.11|878384|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP041978 (Bacillus pacificus strain NCCP 15909 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

attcattaacaaaaaagatgttaaataaac	CRISPR spacer
aaccattaacaaaaaagatgttaacgacta	Protospacer
* .*********************  *

92. spacer 2.11|878384|30|NC_018407|CRISPRCasFinder,CRT matches to NC_011655 (Bacillus cereus AH187 plasmid pAH187_270, complete sequence) position: , mismatch: 7, identity: 0.767

attcattaacaaaaaagatgttaaataaac	CRISPR spacer
aaccattaacaaaaaagatgttaacgacta	Protospacer
* .*********************  *

93. spacer 2.11|878384|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP045534 (Bacillaceae bacterium C02 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

attcattaacaaaaaagatgttaaataaac	CRISPR spacer
aaccattaacaaaaaagatgttaacgacta	Protospacer
* .*********************  *

94. spacer 2.11|878384|30|NC_018407|CRISPRCasFinder,CRT matches to NC_010924 (Bacillus cereus strain AH187 plasmid pCER270, complete sequence) position: , mismatch: 7, identity: 0.767

attcattaacaaaaaagatgttaaataaac	CRISPR spacer
aaccattaacaaaaaagatgttaacgacta	Protospacer
* .*********************  *

95. spacer 2.11|878384|30|NC_018407|CRISPRCasFinder,CRT matches to CP045776 (Bacillus paranthracis strain CFSAN068816 plasmid p1CFSAN068816, complete sequence) position: , mismatch: 7, identity: 0.767

attcattaacaaaaaagatgttaaataaac	CRISPR spacer
aaccattaacaaaaaagatgttaacgacta	Protospacer
* .*********************  *

96. spacer 2.11|878384|30|NC_018407|CRISPRCasFinder,CRT matches to CP041980 (Bacillus paranthracis strain NCCP 15910 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

attcattaacaaaaaagatgttaaataaac	CRISPR spacer
aaccattaacaaaaaagatgttaacgacta	Protospacer
* .*********************  *

97. spacer 2.11|878384|30|NC_018407|CRISPRCasFinder,CRT matches to NC_016792 (Bacillus cereus NC7401 plasmid pNCcld, complete sequence) position: , mismatch: 7, identity: 0.767

attcattaacaaaaaagatgttaaataaac	CRISPR spacer
aaccattaacaaaaaagatgttaacgacta	Protospacer
* .*********************  *

98. spacer 2.11|878384|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP040343 (Bacillus cereus strain DLOU-Weihai plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

attcattaacaaaaaagatgttaaataaac	CRISPR spacer
aaccattaacaaaaaagatgttaacgacta	Protospacer
* .*********************  *

99. spacer 2.11|878384|30|NC_018407|CRISPRCasFinder,CRT matches to LT603679 (Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 2) position: , mismatch: 7, identity: 0.767

attcattaacaaaaaagatgttaaataaac	CRISPR spacer
tatcaataacaaaaaagatggtaaatattt	Protospacer
  *** ************** ******  .

100. spacer 2.11|878384|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_AP022342 (Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence) position: , mismatch: 7, identity: 0.767

attcattaacaaaaaagatgttaaataaac	CRISPR spacer
tatcaataacaaaaaagatggtaaatattt	Protospacer
  *** ************** ******  .

101. spacer 2.11|878384|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP033789 (Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.767

attcattaacaaaaaagatgttaaataaac	CRISPR spacer
aaccattaacaaaaaagatgttaacgacta	Protospacer
* .*********************  *

102. spacer 2.11|878384|30|NC_018407|CRISPRCasFinder,CRT matches to MK448952 (Streptococcus phage Javan472, complete genome) position: , mismatch: 7, identity: 0.767

attcattaacaaaaaagatgttaaataaac	CRISPR spacer
agtttgtaacaaaaaagatgttaattagat	Protospacer
* *.  ****************** **.*.

103. spacer 2.12|878450|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP010910 (Candidatus Pantoea carbekii strain US plasmid pBMSBPS3, complete sequence) position: , mismatch: 7, identity: 0.767

ttttttcaaaattatacaataacgatttaa	CRISPR spacer
ttttctcaaaaatatacaataacaaaaaac	Protospacer
****.****** ***********.*   *

104. spacer 2.15|878648|30|NC_018407|CRISPRCasFinder,CRT matches to NC_014633 (Ilyobacter polytropus DSM 2926 plasmid pILYOP01, complete sequence) position: , mismatch: 7, identity: 0.767

atcttgttattattagcgtttatttggcca	CRISPR spacer
ttcttcttattattagtgtttatttttctc	Protospacer
 **** **********.********  *.

105. spacer 2.19|878912|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NC_019728 (Calothrix sp. PCC 6303 plasmid pCAL6303.02, complete sequence) position: , mismatch: 7, identity: 0.767

attcaattgcgttttttaaac-----gtacaaata	CRISPR spacer
attcaattgcgtttttgaaactttctttac-----	Protospacer
**************** ****      ***

106. spacer 2.22|879110|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to MT774410 (CrAssphage cr272_1, complete genome) position: , mismatch: 7, identity: 0.767

ataagaacaagaactatctaacgctttttt	CRISPR spacer
tacagaacaagatctatataacgctttatc	Protospacer
   ********* **** ********* *.

107. spacer 2.22|879110|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to MT774411 (CrAssphage cr273_1, complete genome) position: , mismatch: 7, identity: 0.767

ataagaacaagaactatctaacgctttttt	CRISPR spacer
tacagaacaagatctatataacgctttatc	Protospacer
   ********* **** ********* *.

108. spacer 2.27|879441|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP050314 (Shewanella aestuarii strain PN3F2 plasmid pPN3F2_1, complete sequence) position: , mismatch: 7, identity: 0.767

aattaaaagttaagaacgttgttgctgacg	CRISPR spacer
aattaaaagttaataaggttgttcatccct	Protospacer
************* ** ******  *  *

109. spacer 2.27|879441|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to MK373771 (Escherichia phage vB_EcoP_R4596, complete genome) position: , mismatch: 7, identity: 0.767

aattaaaagttaagaacgttgttgctgacg	CRISPR spacer
tctgcaaagttaaaaccgttgttgctgatg	Protospacer
  *  ********.* ************.*

110. spacer 2.29|879573|31|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP015632 (Borrelia turicatae strain BTE5EL plasmid lp30) position: , mismatch: 7, identity: 0.774

ttttttgttaatgaattaaaaatcttatcag	CRISPR spacer
ttttttgttaatgcattaaaaaatgaattat	Protospacer
************* ******** .  **.*

111. spacer 2.29|879573|31|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP015634 (Borrelia turicatae strain BTE5EL plasmid lp40) position: , mismatch: 7, identity: 0.774

ttttttgttaatgaattaaaaatcttatcag	CRISPR spacer
ttttttgttaatgcattaaaaaatgaattat	Protospacer
************* ******** .  **.*

112. spacer 2.29|879573|31|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LR214986 (Mycoplasma cynos strain NCTC10142 plasmid 13) position: , mismatch: 7, identity: 0.774

ttttttgttaatgaattaaaaatcttatcag	CRISPR spacer
tttaagaataatgaattagtaatcttatcag	Protospacer
***   . **********. ***********

113. spacer 2.29|879573|31|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP040048 (Acinetobacter baumannii strain VB1190 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

ttttttgttaatgaattaaaaat--cttatcag	CRISPR spacer
ttttatattaatgaattaaaaataaactatt--	Protospacer
**** *.****************   .***.

114. spacer 2.32|879772|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to MN693021 (Marine virus AFVG_117M32, complete genome) position: , mismatch: 7, identity: 0.767

aacttatctgcataacccttttgaatctct	CRISPR spacer
actttatctgcataacctttttcaatagat	Protospacer
* .**************.**** ***   *

115. spacer 2.33|879838|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to AP013481 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G18, isolate: uvMED-CGR-U-MedDCM-OCT-S44-C29) position: , mismatch: 7, identity: 0.767

aagttgatcatttaaatgagcttttaaaaa	CRISPR spacer
tttctgatgatttaaatgagcttttaacta	Protospacer
   .**** ******************  *

116. spacer 2.33|879838|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP053838 (Aliiarcobacter faecis strain CCUG 66484 plasmid pAFAEC, complete sequence) position: , mismatch: 7, identity: 0.767

aagttgatcatttaaatgagcttttaaaaa	CRISPR spacer
tgatcgttcatttatatcagcttttaaaaa	Protospacer
 ..*.* ******* ** ************

117. spacer 2.33|879838|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NC_015426 (Clostridium botulinum BKT015925 plasmid p2BKT015925, complete sequence) position: , mismatch: 7, identity: 0.767

aagttgatcatttaaatgagcttttaaaaa	CRISPR spacer
ttcttcatcatttatatgagcttttattaa	Protospacer
   ** ******** ***********  **

118. spacer 2.34|879904|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to MG676466 (Pseudomonas phage TC6, complete genome) position: , mismatch: 7, identity: 0.767

acgtttgaggttcagctaattctggggtta	CRISPR spacer
acgtttgaagttcagataattctgagtggc	Protospacer
********.****** ********.*

119. spacer 2.34|879904|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to DQ163915 (Bacteriophage PA11, complete genome) position: , mismatch: 7, identity: 0.767

acgtttgaggttcagctaattctggggtta	CRISPR spacer
acgtttgaagttcagataattctgagtggc	Protospacer
********.****** ********.*

120. spacer 2.34|879904|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NC_007808 (Pseudomonas phage PA11, complete genome) position: , mismatch: 7, identity: 0.767

acgtttgaggttcagctaattctggggtta	CRISPR spacer
acgtttgaagttcagataattctgagtggc	Protospacer
********.****** ********.*

121. spacer 2.37|880102|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP042928 (Bacillus cereus strain G1-1 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

tagttaaattaatttttaaagg---atggttta	CRISPR spacer
aagttaaattactttttaaaggtaaaaagt---	Protospacer
 ********** **********   * .**

122. spacer 2.37|880102|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to MG945221 (UNVERIFIED: Microviridae sp. isolate 1196-1602, partial genome) position: , mismatch: 7, identity: 0.767

tagttaaattaatttttaaaggatggttta	CRISPR spacer
catatgcattaatttttagagaatggttta	Protospacer
.*  *. ***********.**.********

123. spacer 2.37|880102|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NC_047948 (Staphylococcus phage phiSA_BS2, complete genome) position: , mismatch: 7, identity: 0.767

tagttaaattaatttttaaaggatggttta	CRISPR spacer
tagttaaattaatttctaaagaaaacgtaa	Protospacer
***************.*****.* .  * *

124. spacer 2.37|880102|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to MH078572 (Staphylococcus phage phiSA_BS1, complete genome) position: , mismatch: 7, identity: 0.767

tagttaaattaatttttaaaggatggttta	CRISPR spacer
tagttaaattaatttctaaagaaaacgtaa	Protospacer
***************.*****.* .  * *

125. spacer 2.37|880102|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP040341 (Bacillus cereus strain DLOU-Tangshan plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

tagttaaattaatttttaaagg---atggttta	CRISPR spacer
aagttaaattactttttaaaggtaaaaagt---	Protospacer
 ********** **********   * .**

126. spacer 2.37|880102|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to LC557520 (Staphylococcus phage vB_SsapH-Golestan101-M DNA, complete genome) position: , mismatch: 7, identity: 0.767

tagttaaattaatttttaaaggatggttta	CRISPR spacer
tagttaaattaatttctaaagaaaacgtaa	Protospacer
***************.*****.* .  * *

127. spacer 2.37|880102|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to AP014380 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S43-C70, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 7, identity: 0.767

tagttaaattaatttttaaaggatggttta	CRISPR spacer
aaccttcattaccttttaaaggatggttta	Protospacer
 * .*  **** .*****************

128. spacer 2.38|880168|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP022446 (Bacillus cereus C1L plasmid pC1L1, complete sequence) position: , mismatch: 7, identity: 0.767

taataatcttaattttagtgtgtttgtcgt	CRISPR spacer
tgctaatattaattttagtgggtttgcaga	Protospacer
*. **** ************ *****. *

129. spacer 2.39|880234|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP004877 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence) position: , mismatch: 7, identity: 0.767

gaattaaattatctttataagtaaaataaa	CRISPR spacer
atatttaattgtctttataagtaaaaaacc	Protospacer
. *** ****.*************** *

130. spacer 2.39|880234|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 7, identity: 0.767

gaattaaattatctttataagtaaaataaa	CRISPR spacer
atatttaattgtctttataagtaaaaaacc	Protospacer
. *** ****.*************** *

131. spacer 2.39|880234|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP011358 (Bacillus thuringiensis strain YC-10 plasmid pYC2226, complete sequence) position: , mismatch: 7, identity: 0.767

gaattaaattatctttataagtaaaataaa	CRISPR spacer
atatttaattgtctttataagtaaaaaacc	Protospacer
. *** ****.*************** *

132. spacer 2.39|880234|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 7, identity: 0.767

gaattaaattatctttataagtaaaataaa	CRISPR spacer
atatttaattgtctttataagtaaaaaacc	Protospacer
. *** ****.*************** *

133. spacer 2.39|880234|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013057 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-2, complete sequence) position: , mismatch: 7, identity: 0.767

gaattaaattatctttataagtaaaataaa	CRISPR spacer
atatttaattgtctttataagtaaaaaacc	Protospacer
. *** ****.*************** *

134. spacer 2.39|880234|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013058 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-3, complete sequence) position: , mismatch: 7, identity: 0.767

gaattaaattatctttataagtaaaataaa	CRISPR spacer
atatttaattgtctttataagtaaaaaacc	Protospacer
. *** ****.*************** *

135. spacer 2.39|880234|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP004860 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence) position: , mismatch: 7, identity: 0.767

gaattaaattatctttataagtaaaataaa	CRISPR spacer
atatttaattgtctttataagtaaaaaacc	Protospacer
. *** ****.*************** *

136. spacer 2.39|880234|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP004875 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB95, complete sequence) position: , mismatch: 7, identity: 0.767

gaattaaattatctttataagtaaaataaa	CRISPR spacer
atatttaattgtctttataagtaaaaaacc	Protospacer
. *** ****.*************** *

137. spacer 2.39|880234|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP011357 (Bacillus thuringiensis strain YC-10 plasmid pYC20, complete sequence) position: , mismatch: 7, identity: 0.767

gaattaaattatctttataagtaaaataaa	CRISPR spacer
atatttaattgtctttataagtaaaaaacc	Protospacer
. *** ****.*************** *

138. spacer 2.39|880234|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP011357 (Bacillus thuringiensis strain YC-10 plasmid pYC20, complete sequence) position: , mismatch: 7, identity: 0.767

gaattaaattatctttataagtaaaataaa	CRISPR spacer
atatttaattgtctttataagtaaaaaacc	Protospacer
. *** ****.*************** *

139. spacer 2.39|880234|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP015155 (Bacillus thuringiensis strain Bc601 plasmid pBTBC5, complete sequence) position: , mismatch: 7, identity: 0.767

gaattaaattatctttataagtaaaataaa	CRISPR spacer
atatttaattgtctttataagtaaaaaacc	Protospacer
. *** ****.*************** *

140. spacer 2.39|880234|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP015156 (Bacillus thuringiensis strain Bc601 plasmid pBTBC6, complete sequence) position: , mismatch: 7, identity: 0.767

gaattaaattatctttataagtaaaataaa	CRISPR spacer
atatttaattgtctttataagtaaaaaacc	Protospacer
. *** ****.*************** *

141. spacer 2.39|880234|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP007616 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence) position: , mismatch: 7, identity: 0.767

gaattaaattatctttataagtaaaataaa	CRISPR spacer
atatttaattgtctttataagtaaaaaacc	Protospacer
. *** ****.*************** *

142. spacer 2.39|880234|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 7, identity: 0.767

gaattaaattatctttataagtaaaataaa	CRISPR spacer
atatttaattgtctttataagtaaaaaacc	Protospacer
. *** ****.*************** *

143. spacer 2.39|880234|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NC_007110 (Rickettsia felis URRWXCal2 plasmid pRF, complete sequence) position: , mismatch: 7, identity: 0.767

gaattaaattatctttataagtaaaataaa	CRISPR spacer
aaaagaaattatatttataagtaagatatt	Protospacer
.**  ******* ***********.***

144. spacer 2.39|880234|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NC_007111 (Rickettsia felis URRWXCal2 plasmid pRFdelta, complete sequence) position: , mismatch: 7, identity: 0.767

gaattaaattatctttataagtaaaataaa	CRISPR spacer
aaaagaaattatatttataagtaagatatt	Protospacer
.**  ******* ***********.***

145. spacer 2.39|880234|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NC_019229 (Rickettsia felis plasmid pRF, complete sequence) position: , mismatch: 7, identity: 0.767

gaattaaattatctttataagtaaaataaa	CRISPR spacer
aaaagaaattatatttataagtaagatatt	Protospacer
.**  ******* ***********.***

146. spacer 2.39|880234|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NC_019229 (Rickettsia felis plasmid pRF, complete sequence) position: , mismatch: 7, identity: 0.767

gaattaaattatctttataagtaaaataaa	CRISPR spacer
aaaagaaattatatttataagtaagatatt	Protospacer
.**  ******* ***********.***

147. spacer 2.39|880234|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NC_018878 (Bacillus thuringiensis Bt407 plasmid BTB_502p, complete sequence) position: , mismatch: 7, identity: 0.767

gaattaaattatctttataagtaaaataaa	CRISPR spacer
cacctaaattatctttataagcaatattga	Protospacer
 * .*****************.** ** .*

148. spacer 2.39|880234|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_MK715471 (Arcobacter cryaerophilus strain M830MA plasmid pM830MA, complete sequence) position: , mismatch: 7, identity: 0.767

gaattaaattatctttataagtaaaataaa	CRISPR spacer
aaagatatttatctttataagtataataat	Protospacer
.**   * *************** *****

149. spacer 2.39|880234|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_AP018284 (Chondrocystis sp. NIES-4102 plasmid plasmid3 DNA, complete genome) position: , mismatch: 7, identity: 0.767

gaattaaattatctttataagtaaaataaa	CRISPR spacer
aagaaaaattatttttataagtataataca	Protospacer
.*.  *******.********** **** *

150. spacer 2.40|880300|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP022446 (Bacillus cereus C1L plasmid pC1L1, complete sequence) position: , mismatch: 7, identity: 0.767

taataatcttaattttagtgtgtttgtcgt	CRISPR spacer
tgctaatattaattttagtgggtttgcaga	Protospacer
*. **** ************ *****. *

151. spacer 2.41|880366|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP004877 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence) position: , mismatch: 7, identity: 0.767

gaattaaattatctttataagtaaaataaa	CRISPR spacer
atatttaattgtctttataagtaaaaaacc	Protospacer
. *** ****.*************** *

152. spacer 2.41|880366|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 7, identity: 0.767

gaattaaattatctttataagtaaaataaa	CRISPR spacer
atatttaattgtctttataagtaaaaaacc	Protospacer
. *** ****.*************** *

153. spacer 2.41|880366|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP011358 (Bacillus thuringiensis strain YC-10 plasmid pYC2226, complete sequence) position: , mismatch: 7, identity: 0.767

gaattaaattatctttataagtaaaataaa	CRISPR spacer
atatttaattgtctttataagtaaaaaacc	Protospacer
. *** ****.*************** *

154. spacer 2.41|880366|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 7, identity: 0.767

gaattaaattatctttataagtaaaataaa	CRISPR spacer
atatttaattgtctttataagtaaaaaacc	Protospacer
. *** ****.*************** *

155. spacer 2.41|880366|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013057 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-2, complete sequence) position: , mismatch: 7, identity: 0.767

gaattaaattatctttataagtaaaataaa	CRISPR spacer
atatttaattgtctttataagtaaaaaacc	Protospacer
. *** ****.*************** *

156. spacer 2.41|880366|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013058 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-3, complete sequence) position: , mismatch: 7, identity: 0.767

gaattaaattatctttataagtaaaataaa	CRISPR spacer
atatttaattgtctttataagtaaaaaacc	Protospacer
. *** ****.*************** *

157. spacer 2.41|880366|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP004860 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence) position: , mismatch: 7, identity: 0.767

gaattaaattatctttataagtaaaataaa	CRISPR spacer
atatttaattgtctttataagtaaaaaacc	Protospacer
. *** ****.*************** *

158. spacer 2.41|880366|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP004875 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB95, complete sequence) position: , mismatch: 7, identity: 0.767

gaattaaattatctttataagtaaaataaa	CRISPR spacer
atatttaattgtctttataagtaaaaaacc	Protospacer
. *** ****.*************** *

159. spacer 2.41|880366|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP011357 (Bacillus thuringiensis strain YC-10 plasmid pYC20, complete sequence) position: , mismatch: 7, identity: 0.767

gaattaaattatctttataagtaaaataaa	CRISPR spacer
atatttaattgtctttataagtaaaaaacc	Protospacer
. *** ****.*************** *

160. spacer 2.41|880366|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP011357 (Bacillus thuringiensis strain YC-10 plasmid pYC20, complete sequence) position: , mismatch: 7, identity: 0.767

gaattaaattatctttataagtaaaataaa	CRISPR spacer
atatttaattgtctttataagtaaaaaacc	Protospacer
. *** ****.*************** *

161. spacer 2.41|880366|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP015155 (Bacillus thuringiensis strain Bc601 plasmid pBTBC5, complete sequence) position: , mismatch: 7, identity: 0.767

gaattaaattatctttataagtaaaataaa	CRISPR spacer
atatttaattgtctttataagtaaaaaacc	Protospacer
. *** ****.*************** *

162. spacer 2.41|880366|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP015156 (Bacillus thuringiensis strain Bc601 plasmid pBTBC6, complete sequence) position: , mismatch: 7, identity: 0.767

gaattaaattatctttataagtaaaataaa	CRISPR spacer
atatttaattgtctttataagtaaaaaacc	Protospacer
. *** ****.*************** *

163. spacer 2.41|880366|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP007616 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence) position: , mismatch: 7, identity: 0.767

gaattaaattatctttataagtaaaataaa	CRISPR spacer
atatttaattgtctttataagtaaaaaacc	Protospacer
. *** ****.*************** *

164. spacer 2.41|880366|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 7, identity: 0.767

gaattaaattatctttataagtaaaataaa	CRISPR spacer
atatttaattgtctttataagtaaaaaacc	Protospacer
. *** ****.*************** *

165. spacer 2.41|880366|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NC_007110 (Rickettsia felis URRWXCal2 plasmid pRF, complete sequence) position: , mismatch: 7, identity: 0.767

gaattaaattatctttataagtaaaataaa	CRISPR spacer
aaaagaaattatatttataagtaagatatt	Protospacer
.**  ******* ***********.***

166. spacer 2.41|880366|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NC_007111 (Rickettsia felis URRWXCal2 plasmid pRFdelta, complete sequence) position: , mismatch: 7, identity: 0.767

gaattaaattatctttataagtaaaataaa	CRISPR spacer
aaaagaaattatatttataagtaagatatt	Protospacer
.**  ******* ***********.***

167. spacer 2.41|880366|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NC_019229 (Rickettsia felis plasmid pRF, complete sequence) position: , mismatch: 7, identity: 0.767

gaattaaattatctttataagtaaaataaa	CRISPR spacer
aaaagaaattatatttataagtaagatatt	Protospacer
.**  ******* ***********.***

168. spacer 2.41|880366|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NC_019229 (Rickettsia felis plasmid pRF, complete sequence) position: , mismatch: 7, identity: 0.767

gaattaaattatctttataagtaaaataaa	CRISPR spacer
aaaagaaattatatttataagtaagatatt	Protospacer
.**  ******* ***********.***

169. spacer 2.41|880366|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NC_018878 (Bacillus thuringiensis Bt407 plasmid BTB_502p, complete sequence) position: , mismatch: 7, identity: 0.767

gaattaaattatctttataagtaaaataaa	CRISPR spacer
cacctaaattatctttataagcaatattga	Protospacer
 * .*****************.** ** .*

170. spacer 2.41|880366|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_MK715471 (Arcobacter cryaerophilus strain M830MA plasmid pM830MA, complete sequence) position: , mismatch: 7, identity: 0.767

gaattaaattatctttataagtaaaataaa	CRISPR spacer
aaagatatttatctttataagtataataat	Protospacer
.**   * *************** *****

171. spacer 2.41|880366|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_AP018284 (Chondrocystis sp. NIES-4102 plasmid plasmid3 DNA, complete genome) position: , mismatch: 7, identity: 0.767

gaattaaattatctttataagtaaaataaa	CRISPR spacer
aagaaaaattatttttataagtataataca	Protospacer
.*.  *******.********** **** *

172. spacer 2.1|877724|30|NC_018407|CRISPRCasFinder,CRT matches to CP002510 (Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB28, complete sequence) position: , mismatch: 8, identity: 0.733

aatcgaataattatgttcagatgtactttg	CRISPR spacer
taagatataattatgatcagatgcactttt	Protospacer
 *  . ********* *******.*****

173. spacer 2.4|877922|30|NC_018407|CRISPRCasFinder,CRT matches to CP040041 (Acinetobacter baumannii strain VB958 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

aataaatttaaaattgccgattgtgttcaa	CRISPR spacer
cgtaaatttaaaattgccgtttctgcactt	Protospacer
 .***************** ** **. *

174. spacer 2.6|878054|30|NC_018407|CRISPRCasFinder,CRT matches to AP013545 (Uncultured phage_MedDCM-OCT-S46-C10 DNA, complete genome, group G8, isolate: uvMED-CGR-U-MedDCM-OCT-S46-C10) position: , mismatch: 8, identity: 0.733

tcagataattcttcaactgcaacaacgtta	CRISPR spacer
ggagataatgcttcaacagcaacaattgga	Protospacer
  ******* ******* *******.   *

175. spacer 2.9|878252|30|NC_018407|CRISPRCasFinder,CRT matches to MG592434 (Vibrio phage 1.054.O._10N.261.52.A1, partial genome) position: , mismatch: 8, identity: 0.733

ttgggctaatttaccgtataaactattaag	CRISPR spacer
gaagagtaatttaccgcataaactaataac	Protospacer
  .*. **********.******** ***

176. spacer 2.9|878252|30|NC_018407|CRISPRCasFinder,CRT matches to NC_049975 (Bacillus phage vB_BsuP-Goe1, complete genome) position: , mismatch: 8, identity: 0.733

ttgggctaatttaccgtataaactattaag	CRISPR spacer
actagcaaattttccgtataaactatttaa	Protospacer
 . .** ***** ************** *.

177. spacer 2.11|878384|30|NC_018407|CRISPRCasFinder,CRT matches to NC_031055 (Bacillus phage PfEFR-5, complete genome) position: , mismatch: 8, identity: 0.733

attcattaacaaaaaagatgttaaataaac	CRISPR spacer
catcattatcaacaaagatgttaaattgct	Protospacer
  ****** *** ************* . .

178. spacer 2.11|878384|30|NC_018407|CRISPRCasFinder,CRT matches to KT725776 (Bacillus phage vB_BceS-MY192, partial genome) position: , mismatch: 8, identity: 0.733

attcattaacaaaaaagatgttaaataaac	CRISPR spacer
catcattatcaacaaagatgttaaattgct	Protospacer
  ****** *** ************* . .

179. spacer 2.11|878384|30|NC_018407|CRISPRCasFinder,CRT matches to NC_048641 (Bacillus phage PfEFR-4, complete genome) position: , mismatch: 8, identity: 0.733

attcattaacaaaaaagatgttaaataaac	CRISPR spacer
catcattatcaacaaagatgttaaattgct	Protospacer
  ****** *** ************* . .

180. spacer 2.11|878384|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP032411 (Brevibacillus laterosporus strain E7593-50 plasmid pAZOBL1, complete sequence) position: , mismatch: 8, identity: 0.733

attcattaacaaaaaagatgttaaataaac	CRISPR spacer
cggaaccaacaaacaagaagttaaataaac	Protospacer
    *..****** **** ***********

181. spacer 2.11|878384|30|NC_018407|CRISPRCasFinder,CRT matches to MK064565 (Sulfolobales Beppu rod-shaped virus 1 clone D, complete genome) position: , mismatch: 8, identity: 0.733

attcattaacaaaaaagatgttaaataaac	CRISPR spacer
tagaactaaaaaataagatgttaaataaaa	Protospacer
    *.*** *** ***************

182. spacer 2.13|878516|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP031139 (Escherichia coli strain CFSAN064035 plasmid pGMI17-003, complete sequence) position: , mismatch: 8, identity: 0.733

cagattttaagaaagaacgtttaattacaa	CRISPR spacer
atcggttgaagaaagaatgtttaattacga	Protospacer
   . ** *********.**********.*

183. spacer 2.14|878582|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_AP014579 (Burkholderia sp. RPE67 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.733

gtaatactcaagaactgcatcgcgcaagtc	CRISPR spacer
ttcgtactcaagaacttcgtcgcgcaatat	Protospacer
 * .************ *.********  .

184. spacer 2.15|878648|30|NC_018407|CRISPRCasFinder,CRT matches to NC_042061 (Salmonella phage STML-13-1, partial genome) position: , mismatch: 8, identity: 0.733

atcttgttattattagcgtttatttggcca	CRISPR spacer
aacgtgttatcattagcgtttatttttgtg	Protospacer
* * ******.**************   ..

185. spacer 2.17|878780|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP042572 (Enterobacter hormaechei strain E5 plasmid pE5_001, complete sequence) position: , mismatch: 8, identity: 0.733

aaagttgtattgtgtttgaaccatttcact	CRISPR spacer
aaagtggtattgtgtttgaaacagaagaaa	Protospacer
***** ************** **    *

186. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to MH617505 (Microviridae sp. isolate ctbi747, complete genome) position: , mismatch: 8, identity: 0.733

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
tgacgtttcatgattgacctcaaaattaat	Protospacer
 *..  ************ *.********

187. spacer 2.20|878978|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NC_014633 (Ilyobacter polytropus DSM 2926 plasmid pILYOP01, complete sequence) position: , mismatch: 8, identity: 0.733

tttgtttttatcttgattcgaaagacatta	CRISPR spacer
cttgtttttatcttgattagaacttttttt	Protospacer
.***************** ***   . **

188. spacer 2.20|878978|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP032091 (Pseudoalteromonas donghaensis strain HJ51 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

tttgtttttatcttgattcgaaagacatta	CRISPR spacer
tttgcttttatcttgattcgatacaggcac	Protospacer
****.**************** * * ..

189. spacer 2.23|879176|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to MT023084 (Citrobacter phage IME-JL8, complete genome) position: , mismatch: 8, identity: 0.733

gtaagttgtcgatctcttcactaacgacag	CRISPR spacer
cgaaattgtcgatctcttcactatcctgat	Protospacer
  **.****************** *   *

190. spacer 2.23|879176|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to MK213796 (Escherichia phage T1, complete genome) position: , mismatch: 8, identity: 0.733

gtaagttgtcgatctcttcactaacgacag	CRISPR spacer
cgaagttgtcgatctcttcgctatcctgat	Protospacer
  *****************.*** *   *

191. spacer 2.23|879176|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to MN393473 (Shigella phage Sfin-6, complete genome) position: , mismatch: 8, identity: 0.733

gtaagttgtcgatctcttcactaacgacag	CRISPR spacer
cgaaattgtcgatctcttcactatcctgat	Protospacer
  **.****************** *   *

192. spacer 2.23|879176|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to MF468274 (Shigella phage Sfin-1, complete genome) position: , mismatch: 8, identity: 0.733

gtaagttgtcgatctcttcactaacgacag	CRISPR spacer
cgaaattgtcgatctcttcactatcctgat	Protospacer
  **.****************** *   *

193. spacer 2.23|879176|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NC_047785 (Shigella phage SH6, complete genome) position: , mismatch: 8, identity: 0.733

gtaagttgtcgatctcttcactaacgacag	CRISPR spacer
cgaagttgtcgatctcttcgctatcctgat	Protospacer
  *****************.*** *   *

194. spacer 2.23|879176|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to MN153797 (Escherichia virus T1 isolate 22, complete genome) position: , mismatch: 8, identity: 0.733

gtaagttgtcgatctcttcactaacgacag	CRISPR spacer
cgaagttgtcgatctcttcgctatcctgat	Protospacer
  *****************.*** *   *

195. spacer 2.23|879176|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to MN337573 (Shigella phage Sfin-4, complete genome) position: , mismatch: 8, identity: 0.733

gtaagttgtcgatctcttcactaacgacag	CRISPR spacer
cgaaattgtcgatctcttcactatcctgat	Protospacer
  **.****************** *   *

196. spacer 2.23|879176|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to KU194206 (Escherichia phage JMPW1, complete genome) position: , mismatch: 8, identity: 0.733

gtaagttgtcgatctcttcactaacgacag	CRISPR spacer
cgaagttgtcgatctcttcgctatcctgat	Protospacer
  *****************.*** *   *

197. spacer 2.23|879176|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to MK972831 (Shigella phage Sfin-2, partial genome) position: , mismatch: 8, identity: 0.733

gtaagttgtcgatctcttcactaacgacag	CRISPR spacer
cgaaattgtcgatctcttcactatcctgat	Protospacer
  **.****************** *   *

198. spacer 2.23|879176|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to MN342247 (Shigella phage Sfin-5, complete genome) position: , mismatch: 8, identity: 0.733

gtaagttgtcgatctcttcactaacgacag	CRISPR spacer
cgaaattgtcgatctcttcactatcctgat	Protospacer
  **.****************** *   *

199. spacer 2.23|879176|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NC_049831 (Shigella virus Sfin-3, complete genome) position: , mismatch: 8, identity: 0.733

gtaagttgtcgatctcttcactaacgacag	CRISPR spacer
cgaaattgtcgatctcttcactatcctgat	Protospacer
  **.****************** *   *

200. spacer 2.23|879176|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NC_048150 (Shigella phage vB_SsoS_008, complete genome) position: , mismatch: 8, identity: 0.733

gtaagttgtcgatctcttcactaacgacag	CRISPR spacer
cgaaattgtcgatctcttcactatcctgat	Protospacer
  **.****************** *   *

201. spacer 2.23|879176|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to HM035024 (Shigella phage Shfl1, complete genome) position: , mismatch: 8, identity: 0.733

gtaagttgtcgatctcttcactaacgacag	CRISPR spacer
cgaagttgtcgatctcctcactatcctgat	Protospacer
  **************.****** *   *

202. spacer 2.23|879176|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to MH917278 (Shigella phage phi2457T, complete genome) position: , mismatch: 8, identity: 0.733

gtaagttgtcgatctcttcactaacgacag	CRISPR spacer
cgaaattgtcgatctcttcactatcctgat	Protospacer
  **.****************** *   *

203. spacer 2.23|879176|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to MH051912 (Enterobacteria phage vB_EcoS_IME167, complete genome) position: , mismatch: 8, identity: 0.733

gtaagttgtcgatctcttcactaacgacag	CRISPR spacer
cgaagttgtcgatctcttcgctatcctgat	Protospacer
  *****************.*** *   *

204. spacer 2.23|879176|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NC_049832 (Escherichia phage vB_EcoS-DELF2 DNA, complete genome) position: , mismatch: 8, identity: 0.733

gtaagttgtcgatctcttcactaacgacag	CRISPR spacer
cgaagttgtcgatctcttcgctatcctgat	Protospacer
  *****************.*** *   *

205. spacer 2.23|879176|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to MF996376 (Escherichia phage SRT8, complete genome) position: , mismatch: 8, identity: 0.733

gtaagttgtcgatctcttcactaacgacag	CRISPR spacer
cgaaattgtcgatctcttcactatcctgat	Protospacer
  **.****************** *   *

206. spacer 2.23|879176|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to MT682715 (Escherichia phage vB_EcoS_Chapo, complete genome) position: , mismatch: 8, identity: 0.733

gtaagttgtcgatctcttcactaacgacag	CRISPR spacer
cgaaattgtcgatctcttcactatcctgat	Protospacer
  **.****************** *   *

207. spacer 2.23|879176|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NC_005833 (Enterobacteria phage T1, complete genome) position: , mismatch: 8, identity: 0.733

gtaagttgtcgatctcttcactaacgacag	CRISPR spacer
cgaagttgtcgatctcttcgctatcctgat	Protospacer
  *****************.*** *   *

208. spacer 2.24|879242|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP011009 (Bacillus simplex strain SH-B26 plasmid pSHB26, complete sequence) position: , mismatch: 8, identity: 0.733

ttgttgagctaattggacttaaagcaaata	CRISPR spacer
actatgaaccaattggacttaaagcaactg	Protospacer
 .  ***.*.***************** *.

209. spacer 2.29|879573|31|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP039285 (Leptospira interrogans strain FMAS_AW1 plasmid pLiSL2, complete sequence) position: , mismatch: 8, identity: 0.742

ttttttgttaatgaattaaaaatcttatcag	CRISPR spacer
ctatttgttaatgaaaaaaaaatctttgaaa	Protospacer
.* ************  *********   *.

210. spacer 2.29|879573|31|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to CP015514 (Vibrio vulnificus strain FORC_036 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.742

ttttttgttaatgaattaaaaatcttatcag	CRISPR spacer
ttttttattaataaattaaaaatttcggaat	Protospacer
******.*****.**********.*..  *

211. spacer 2.33|879838|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NC_013391 (Staphylococcus epidermidis plasmid SAP108C, complete sequence) position: , mismatch: 8, identity: 0.733

aagttgatcatttaaatgagcttttaaaaa	CRISPR spacer
acttgcctcatttaaattagcttttaaatt	Protospacer
*  *   ********** **********

212. spacer 2.37|880102|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NC_021800 (Cellulophaga phage phi46:1, complete genome) position: , mismatch: 8, identity: 0.733

tagttaaattaatttttaaaggatggttta	CRISPR spacer
agaataaattattttttaaagggtggttct	Protospacer
 .. ******* **********.*****.

213. spacer 2.38|880168|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to JX238501 (Bacillus phage phiAGATE, complete genome) position: , mismatch: 8, identity: 0.733

taataatcttaattttagtgtgtttgtcgt	CRISPR spacer
taataatcttaatttttgtgttcttacata	Protospacer
**************** **** .**..

214. spacer 2.39|880234|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP023413 (Clostridium perfringens strain LLY_N11 plasmid pLLY_N11_3, complete sequence) position: , mismatch: 8, identity: 0.733

gaattaaattatctttataagtaaaataaa	CRISPR spacer
tgcatcttttttctttataagtaaaataaa	Protospacer
 .  *   ** *******************

215. spacer 2.39|880234|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to AY939844 (Prochlorococcus phage P-SSM2, complete genome) position: , mismatch: 8, identity: 0.733

gaattaaattatctttataagtaaaataaa	CRISPR spacer
agcataaattaactttataagtgaaattat	Protospacer
..  ******* **********.**** *

216. spacer 2.40|880300|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to JX238501 (Bacillus phage phiAGATE, complete genome) position: , mismatch: 8, identity: 0.733

taataatcttaattttagtgtgtttgtcgt	CRISPR spacer
taataatcttaatttttgtgttcttacata	Protospacer
**************** **** .**..

217. spacer 2.41|880366|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP023413 (Clostridium perfringens strain LLY_N11 plasmid pLLY_N11_3, complete sequence) position: , mismatch: 8, identity: 0.733

gaattaaattatctttataagtaaaataaa	CRISPR spacer
tgcatcttttttctttataagtaaaataaa	Protospacer
 .  *   ** *******************

218. spacer 2.41|880366|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to AY939844 (Prochlorococcus phage P-SSM2, complete genome) position: , mismatch: 8, identity: 0.733

gaattaaattatctttataagtaaaataaa	CRISPR spacer
agcataaattaactttataagtgaaattat	Protospacer
..  ******* **********.**** *

219. spacer 2.42|880432|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to MN693430 (Marine virus AFVG_25M565, complete genome) position: , mismatch: 8, identity: 0.733

gttttgcttataaattgttacaagacttct	CRISPR spacer
atgttgtttataaatttttacaagacaaga	Protospacer
.* ***.********* *********

220. spacer 2.42|880432|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to MN693356 (Marine virus AFVG_25M564, complete genome) position: , mismatch: 8, identity: 0.733

gttttgcttataaattgttacaagacttct	CRISPR spacer
atgttgtttataaatttttacaagacaaga	Protospacer
.* ***.********* *********

221. spacer 2.42|880432|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to MT774384 (CrAssphage cr8_1, complete genome) position: , mismatch: 8, identity: 0.733

gttttgcttataaattgttacaagacttct	CRISPR spacer
attttgcttataaattatttcaagtttata	Protospacer
.***************.** **** .* .

222. spacer 2.6|878054|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP010582 (Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB51, complete sequence) position: , mismatch: 9, identity: 0.7

tcagataattcttcaactgcaacaacgtta	CRISPR spacer
attaataattcttcaattgcaacaaaaaaa	Protospacer
 . .************.******** .  *

223. spacer 2.7|878120|30|NC_018407|CRISPRCasFinder,CRT matches to MT074466 (Salmonella phage atrejo, complete genome) position: , mismatch: 9, identity: 0.7

tttataacaacagattacgcttttttattc	CRISPR spacer
aaaataacagcagattatgcttttttgaaa	Protospacer
   ******.*******.********.

224. spacer 2.7|878120|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP039694 (Agrobacterium larrymoorei strain CFBP5473 plasmid pTiCFBP5473, complete sequence) position: , mismatch: 9, identity: 0.7

tttataacaacagattacgcttttttattc	CRISPR spacer
atctccacaacagattacgtttttttacct	Protospacer
 *. . *************.*******...

225. spacer 2.10|878318|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP013104 (Paraburkholderia caribensis strain MWAP64 plasmid 1, complete sequence) position: , mismatch: 9, identity: 0.7

aaagccccgaacaactagctttcgaaaaga	CRISPR spacer
tcgtgcccgaacagctcgctttcgaaaatc	Protospacer
  .  ********.** ***********

226. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_KX518743 (Escherichia coli strain HYEC7 plasmid pHYEC7-IncHI2, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

227. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_KY401053 (Salmonella enterica subsp. enterica serovar Enteritidis strain SE380 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

228. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_KY689633 (Escherichia coli strain 100R plasmid p100R, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

229. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_KY689632 (Escherichia coli strain 19-M12 plasmid p19M12, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

230. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_KY019259 (Escherichia coli strain YJMC8 plasmid pHNYJC8, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

231. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_KY421937 (Escherichia coli strain FS13Z2S plasmid pFS13Z2S, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

232. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP033256 (Salmonella enterica subsp. enterica strain CFSA12 plasmid pCFSA12, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

233. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP026492 (Escherichia coli strain HS13-1 plasmid pHS13-1-IncHI2, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

234. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP034785 (Escherichia coli strain ECZP248 plasmid pTBMCR401, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

235. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_KX421096 (Salmonella enterica subsp. enterica serovar Indiana strain A3 plasmid pA3T, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

236. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_KX434879 (Klebsiella pneumoniae strain KP2442 plasmid pKP2442_1c330, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

237. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_KU341381 (Escherichia coli strain SHP45 plasmid pHNSHP45-2, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

238. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_KY019258 (Escherichia coli strain LDHF400 plasmid pHNLDF400, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

239. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_KX721511 (Salmonella enterica subsp. enterica serovar Typhimurium strain SC523 plasmid pSC523, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

240. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_KU254578 (Escherichia coli strain YD786 plasmid pYD786-1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

241. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_KU994859 (Escherichia coli strain KP81 plasmid pKP81-BE, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

242. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_KX810825 (Salmonella enterica subsp. enterica serovar Typhimurium strain MU1 plasmid pIMP4-SEM1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

243. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_KX276657 (Escherichia coli strain MRSN388634 plasmid pMR0516mcr, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

244. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_KX246266 (Escherichia coli strain AHCH67 plasmid pHNAH67, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

245. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_KX254341 (Escherichia coli strain JS-B60 plasmid pECJS-B60-267, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

246. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_KM396300 (Salmonella enterica subsp. enterica serovar Enteritidis strain SEN110055 plasmid pSEN110055, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

247. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_KM396298 (Salmonella enterica subsp. enterica serovar Enteritidis strain KUSR18 plasmid pKUSR18, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

248. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_KM396299 (Salmonella enterica subsp. enterica serovar Enteritidis strain SEN112499 plasmid pSEN112499, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

249. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_KR653209 (Escherichia coli strain GDZ13 plasmid pGD0503Z13, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

250. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_KT334335 (Salmonella enterica subsp. enterica serovar Typhimurium strain ST06-53 plasmid pHK0653, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

251. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_KT347600 (Escherichia coli strain EC5207 plasmid pEC5207, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

252. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_KP975077 (Enterobacter cloacae strain MRSN17626 plasmid pMRVIM0813, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

253. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to LT221036 (Yersinia pseudotuberculosis strain Yps.F1, plasmid pYps.F1 complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

254. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP028197 (Salmonella enterica subsp. enterica serovar Concord strain CFSAN018747 plasmid pGMI14-002_1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

255. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP042628 (Escherichia coli strain NCYU-25-82 plasmid pNCYU-25-82-1_MCR3, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

256. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP011601 (Phytobacter ursingii strain CAV1151 plasmid pCAV1151-296, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

257. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to CP019195 (Salmonella enterica subsp. enterica serovar Senftenberg str. ATCC 43845 plasmid pATCC43845, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

258. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP028975 (Cronobacter sakazakii strain GZcsf-1 plasmid pGW1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

259. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP043951 (Escherichia coli strain ST95-32 plasmid pST95-32-1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

260. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP040457 (Salmonella enterica subsp. enterica serovar Typhimurium strain TJWQ005 plasmid pTJWQ005, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

261. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to KY075659 (Escherichia coli strain GD80 plasmid pGD80-2, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

262. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to MN539018 (Salmonella sp. strain OYZ4 plasmid pOYZ4, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

263. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to MN732922 (Escherichia coli strain 49K plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

264. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP019559 (Escherichia coli strain KSC207 plasmid pMRGN207, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

265. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP019559 (Escherichia coli strain KSC207 plasmid pMRGN207, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

266. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to KX023262 (Escherichia coli plasmid pSCE516-1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

267. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP048293 (Escherichia coli strain CVM N18EC0432 plasmid pN18EC0432-1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

268. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to MK574666 (Escherichia coli strain DJB-3 plasmid pDJB-3, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

269. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to MN915010 (Escherichia coli strain TJ-33 plasmid pNDM-TJ33, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

270. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to MN915011 (Escherichia coli strain GD-33 plasmid pNDM33-1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

271. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP019260 (Escherichia coli strain 13C1065T plasmid p13C1065T-1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

272. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP019260 (Escherichia coli strain 13C1065T plasmid p13C1065T-1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

273. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP020529 (Enterobacter cloacae strain 174 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

274. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to MN232189 (Escherichia coli plasmid pGD27-124, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

275. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to MN232191 (Escherichia coli plasmid pGD27-37, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

276. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to MN232195 (Escherichia coli plasmid pGD27-70, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

277. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to CP042639 (Escherichia coli strain NCYU-24-74 plasmid pNCYU-24-74-1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

278. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP031567 (Enterobacter hormaechei strain 2013_1a plasmid pIncHI2-1301491, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

279. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to MN200941 (Escherichia coli strain E648 plasmid pE648CTX-M-65, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

280. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP040888 (Leclercia adecarboxylata strain Z96-1 plasmid pZ96-1_1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

281. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP044306 (Escherichia coli strain C27A plasmid pC27A-CTX-M-55, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

282. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP038139 (Escherichia coli strain G3X16-2 plasmid pG3X16-2-2, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

283. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP034820 (Salmonella sp. SSDFZ54 plasmid pTB501, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

284. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to CP031284 (Escherichia fergusonii strain 40A plasmid p280_40A, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

285. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to MK461930 (Escherichia coli strain 2009_36 plasmid p2009_36_HI2, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

286. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP029037 (Salmonella enterica subsp. enterica serovar Senftenberg str. 361154004 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

287. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to CP042895 (Escherichia coli strain CFSAN061772 plasmid pCFSAN061772_02, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

288. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP021177 (Escherichia coli strain 5CRE51 plasmid p5CRE51-NDM-9 sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

289. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP021209 (Escherichia coli strain strain Z247 plasmid p2474-MCR1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

290. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP022735 (Escherichia coli strain SA186 plasmid pSA186_MCR1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

291. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to CP042898 (Escherichia coli strain CFSAN061771 plasmid pCFSAN061771_02, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

292. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to CP049307 (Salmonella enterica subsp. enterica serovar Heidelberg strain CVM N58631 plasmid p58631, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

293. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP040806 (Escherichia fergusonii strain EFCF056 plasmid pEF01, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

294. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP041180 (Salmonella enterica subsp. enterica serovar Indiana strain SJTUF87912v2 isolate food plasmid p87912, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

295. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP019443 (Salmonella enterica subsp. enterica serovar Typhimurium strain 81741 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

296. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP031575 (Enterobacter hormaechei strain A1 plasmid pIncHI2-1502264, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

297. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_LT795115 (Salmonella enterica subsp. enterica serovar Typhimurium isolate VNB151-sc-2315230 plasmid p1) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

298. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP017632 (Escherichia coli strain SLK172 plasmid pSLK172-1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

299. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP023570 (Enterobacter hormaechei strain BW plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

300. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to LC532224 (Enterobacter hormaechei subsp. xiangfangensis A2483 plasmid pA2483mcr-9 DNA, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

301. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to LC532226 (Enterobacter hormaechei subsp. xiangfangensis A2504 plasmid pA2504mcr-9 DNA, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

302. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP026642 (Escherichia coli strain FORC_082 plasmid pFORC82_1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

303. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to MN816370 (Escherichia coli strain A102 plasmid pA102-CTX-M-65, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

304. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP043767 (Enterobacter hormaechei strain EB_P9_L5_03.19 plasmid pIMPIncH12_331kb, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

305. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP047668 (Klebsiella aerogenes strain HNHF1 plasmid pHNHF1_NDM-9, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

306. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP027144 (Enterobacter hormaechei subsp. hoffmannii strain AR_0365 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

307. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP034788 (Escherichia coli strain ECCNB20-2 plasmid pTBMCR421, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

308. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP033636 (Escherichia coli isolate ECCNB12-2 plasmid pTB-nb4, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

309. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP050778 (Salmonella enterica subsp. enterica serovar Indiana strain SI96 plasmid pSI96-1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

310. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP049189 (Enterobacter hormaechei strain Y323 plasmid pIHI2-323, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

311. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_AP018352 (Enterobacter hormaechei strain TUM11043 plasmid pMTY11043_IncHI2, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

312. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP038654 (Citrobacter freundii strain 154 plasmid p154_1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

313. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP038657 (Citrobacter freundii strain 565 plasmid p565_1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

314. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP027411 (Salmonella enterica strain FDAARGOS_319 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

315. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP044051 (Klebsiella variicola strain FDAARGOS_627 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

316. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP025402 (Escherichia coli strain MS8345 plasmid pMS8345A, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

317. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_MK477605 (Salmonella enterica strain SH15G1428 plasmid pSH15G1428, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

318. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_MK477609 (Salmonella enterica strain SH15G1598 plasmid pSH15G1598, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

319. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_MK477614 (Salmonella enterica strain SH16G1394 plasmid pSH16G1394, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

320. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_MK477619 (Salmonella enterica strain SH16G4918 plasmid pSH16G4918, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

321. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_MK673548 (Salmonella enterica subsp. enterica serovar Typhimurium strain GDP37-4 plasmid pGDP37-4, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

322. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_MK477606 (Salmonella enterica strain SH15G1450 plasmid pSH15G1450, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

323. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_MK477620 (Salmonella enterica strain SH16G4926 plasmid pSH16G4926, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

324. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_MK673549 (Salmonella enterica subsp. enterica serovar Typhimurium strain JXP9 plasmid pJXP9, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

325. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_MK477602 (Salmonella enterica strain SH15G1169 plasmid pSH15G1169, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

326. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_MK477607 (Salmonella enterica strain SH15G1452 plasmid pSH15G1452, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

327. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_MK477611 (Salmonella enterica strain SH15G2194 plasmid pSH15G2194, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

328. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_MK477616 (Salmonella enterica strain SH16G2456 plasmid pSH16G2456, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

329. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_MK477603 (Salmonella enterica strain SH15G1219 plasmid pSH15G1219, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

330. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_MK477608 (Salmonella enterica strain SH15G1571 plasmid pSH15G1571, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

331. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_MK477612 (Salmonella enterica strain SH16G0600 plasmid pSH16G0600, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

332. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_MK477617 (Salmonella enterica strain SH16G4466 plasmid pSH16G4466, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

333. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_MK477618 (Salmonella enterica strain SH16G4511 plasmid pSH16G4511, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

334. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_MK673547 (Salmonella enterica subsp. enterica serovar Typhimurium strain GDP25-25 plasmid pGDP25-25, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

335. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_MH179305 (Salmonella enterica subsp. enterica serovar Indiana strain JT01 plasmid pJT01, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

336. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_MH105051 (Salmonella enterica subsp. enterica serovar Lomita strain SL131 plasmid pSL131_IncHI2, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

337. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_MH208235 (Escherichia coli strain APECA2 plasmid pJMA2, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

338. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_MH522413 (Salmonella enterica subsp. enterica serovar Typhimurium strain SH14G1670 plasmid pSH14G1670, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

339. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_MH459020 (Escherichia coli strain GZ6DS2 plasmid pHN6DS2, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

340. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_MH491004 (Escherichia coli strain RJ749 plasmid pRJ749, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

341. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_MF174859 (Escherichia coli strain 6/14/6b plasmid pIncHI2-MU3, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

342. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_MG014722 (Escherichia coli strain P2-3 plasmid pP2-3T, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

343. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_MG014720 (Escherichia coli strain A74 plasmid pA74T, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

344. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_MG014721 (Escherichia coli strain FS11Y5C plasmid pFS11Y5CT, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

345. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_MG773376 (Escherichia coli strain LSB54 plasmid pLSB54-mcr-1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

346. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_MG385063 (Escherichia coli strain WF5-29 plasmid pWF5-29, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

347. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_MG656414 (Escherichia coli strain 15-50 plasmid pEC15-MCR-50, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

348. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_MH522418 (Salmonella enterica subsp. enterica serovar Typhimurium strain SH16G0648 plasmid pSH16G0648, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

349. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_MH128771 (Escherichia coli strain 803DBmcr plasmid 803-DB-mcr, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

350. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_MH522420 (Salmonella enterica subsp. enterica serovar Typhimurium strain SH16G1508 plasmid pSH16G1508, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

351. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_MH522421 (Salmonella enterica subsp. enterica serovar Typhimurium strain SH16G2457 plasmid pSH16G2457, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

352. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_MH522423 (Salmonella enterica subsp. enterica serovar Typhimurium strain SH16G4498 plasmid pSH16G4498, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

353. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP049047 (Enterobacter hormaechei strain Y233 plasmid pIHI2-233, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

354. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP015725 (Salmonella enterica strain C629 plasmid pC629, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

355. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_KY990887 (Escherichia coli strain XG-E1 plasmid pXGE1mcr, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

356. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_MF083142 (Citrobacter freundii strain D36-1 plasmid pD36-1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

357. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_MF135534 (Raoultella ornithinolytica strain TS48CTX plasmid pHNTS48-1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

358. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_MG372114 (Salmonella enterica subsp. enterica serovar Typhimurium strain JZ26 plasmid pJZ26, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

359. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_MG878867 (Escherichia coli strain Ec21617 plasmid pEc21617-310, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

360. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP022169 (Salmonella enterica subsp. enterica serovar Typhimurium strain WW012 plasmid pWW012, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

361. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to KM877269 (Salmonella enterica subsp. enterica serovar Typhimurium strain GDS147 plasmid pHXY0908, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

362. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP032993 (Escherichia coli strain W5-6 plasmid pMCR_W5-6, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

363. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_KX710093 (Leclercia adecarboxylata strain pP10164 plasmid pP10164-2, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

364. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_KY270852 (Enterobacter cloacae strain T5282 plasmid pT5282-mphA, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

365. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_KY270851 (Citrobacter freundii strain 112298 plasmid p112298-catA, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

366. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP045446 (Salmonella enterica subsp. enterica serovar Schwarzengrund strain 9355 plasmid p280_9355, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

367. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP016764 (Citrobacter freundii strain B38 plasmid pOZ181, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

368. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_KU743384 (Escherichia coli strain SA26 plasmid pSA26-MCR-1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

369. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_KX084394 (Escherichia coli strain 59 plasmid pECJS-59-244, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

370. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_KX129782 (Escherichia coli strain S38 plasmid pS38, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

371. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_LN830952 (Enterobacter sp. 247 strain 247 BMC plasmid pEB247, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

372. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP028537 (Enterobacter hormaechei strain SCEH020042 plasmid pQnrB4_020042, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

373. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP015833 (Escherichia coli O157 strain 180-PT54 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

374. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_AP023191 (Escherichia coli strain TUM18530 plasmid pMTY18530-1_lncHI2, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

375. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP019647 (Salmonella enterica subsp. enterica serovar Typhimurium strain TW-Stm6 plasmid pSTM6-275, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

376. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP048350 (Raoultella ornithinolytica strain 23 plasmid p23_A-OXA140, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

377. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP044256 (Salmonella enterica strain CFSAN096147 plasmid pCFSAN096147, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

378. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP045449 (Salmonella enterica subsp. enterica serovar Schwarzengrund strain 12888 plasmid p280_12888, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

379. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP027678 (Salmonella enterica subsp. enterica serovar Corvallis strain 12-01738 plasmid pSE12-01738-1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

380. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP035634 (Enterobacter cloacae strain EN3600 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

381. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to MN539017 (Salmonella sp. strain PJM1 plasmid pPJM1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

382. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP042506 (Leclercia adecarboxylata strain E1 plasmid pE1_001, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

383. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP020493 (Salmonella enterica subsp. enterica strain 08-00436 plasmid pSE08-00436-1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

384. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to MT077884 (Escherichia coli plasmid p33, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

385. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to MT077886 (Escherichia coli plasmid p39, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

386. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP051431 (Escherichia sp. SCLE84 plasmid pSCLE1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

387. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NC_009838 (Escherichia coli APEC O1 plasmid pAPEC-O1-R, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

388. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP021727 (Escherichia coli strain Combat11I9 plasmid pCombat11I9-1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

389. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP021727 (Escherichia coli strain Combat11I9 plasmid pCombat11I9-1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

390. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to MN423361 (Leclercia sp. strain 1106151 plasmid p1106151-mcr, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

391. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP031547 (Escherichia coli strain cq9 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

392. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP029748 (Escherichia coli strain 2016C-3878 plasmid pMCR1-PA, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

393. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP025277 (Salmonella enterica subsp. enterica strain USDA-ARS-USMARC-60984 plasmid pSJO-60984, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

394. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to MN577015 (Salmonella enterica plasmid p0085-NDM, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

395. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP045844 (Kluyvera intermedia strain HR2 plasmid pHR2-1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

396. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP047379 (Escherichia coli strain CAU16175 plasmid pCAU16175_1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

397. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to MH909331 (Leclercia adecarboxylata plasmid p707804-NDM, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

398. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP033382 (Salmonella enterica subsp. enterica strain CFSA300 plasmid pCFSA300-1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

399. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP035916 (Salmonella enterica strain S61394 plasmid pLS61394-MCR, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

400. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP019019 (Escherichia coli strain Ecol_244 plasmid pEC244_1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

401. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP030080 (Enterobacter hormaechei strain 20710 plasmid pIMP-20710, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

402. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP042616 (Escherichia coli strain NCYU-26-73 plasmid pNCYU-26-73-1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

403. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to KU353730 (Escherichia coli plasmid pKH457-3-BE, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

404. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP008825 (UNVERIFIED_ORG: Enterobacter cloacae ECNIH2 plasmid pKPC-272, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

405. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP022696 (Citrobacter farmeri strain AUSMDU00008141 plasmid pAUSMDU8141-1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

406. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP052871 (Enterobacter cloacae strain 3849 plasmid p3846_IncHI2_mcr, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

407. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP012141 (Shigella flexneri 4c strain 1205 plasmid 1205p1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

408. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP033385 (Salmonella enterica subsp. enterica strain CFSA1007 plasmid pCFSA1007-1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

409. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP047877 (Escherichia coli strain LD22-1 plasmid pLD22-1-MCR1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

410. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP035918 (Salmonella enterica strain S44712 plasmid pLS44712-MCR, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

411. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to CP049311 (Salmonella enterica subsp. enterica serovar Heidelberg strain CVM N53023 plasmid pN53023, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

412. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_LT991958 (Enterobacter cloacae complex sp. isolate C45 plasmid pC45-VIM4) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

413. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to LC511657 (Escherichia coli 2017.02.01CC plasmid p2017.02.01CC DNA, complete genome) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

414. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to LC511658 (Escherichia coli 2017.03.03CC plasmid p2017_03_03CC DNA, complete genome) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

415. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP043855 (Enterobacter hormaechei strain EB_P6_L3_02.19 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

416. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP044215 (Klebsiella aerogenes strain KA_P10_L5_03.19 plasmid pIMPIncH12_334kb, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

417. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP039857 (Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014876 plasmid p15-0756.1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

418. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP031850 (Klebsiella pneumoniae strain 121 plasmid pKP121-1-mcr, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

419. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to CP049309 (Salmonella enterica subsp. enterica serovar Johannesburg strain CVM N58011 plasmid p58011, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

420. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NC_010870 (Klebsiella pneumoniae plasmid pK29, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

421. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP024813 (Enterobacter sp. CRENT-193 plasmid pCRENT-193_1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

422. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP019214 (Escherichia coli strain WCHEC050613 plasmid pMCR_WCHEC050613, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

423. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP041182 (Salmonella enterica subsp. enterica serovar Indiana strain SJTUF13520v2 isolate food plasmid p13520, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

424. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to CP043545 (Escherichia coli strain F2_81 plasmid pF2_18C_HI2, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

425. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP030940 (Escherichia coli strain AMSHJX01 plasmid pAMSH1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

426. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP036178 (Escherichia coli strain WCHEC025970 plasmid pCTXM199_025970, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

427. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP022451 (Salmonella enterica subsp. enterica serovar Indiana strain D90 plasmid pD90-1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

428. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP030186 (Salmonella enterica strain SA20094620 plasmid pSA20094620.1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

429. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP042494 (Leclercia adecarboxylata strain E61 plasmid pE61_001, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

430. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP033353 (Salmonella enterica subsp. enterica strain CFSA664 plasmid pCFSA664-1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

431. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP040696 (Citrobacter freundii strain R47 plasmid pR47-309, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

432. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP024143 (Escherichia coli strain 14EC029 plasmid p14EC029b, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

433. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP047116 (Salmonella enterica subsp. enterica strain SCSM4.1 plasmid plas4.1.1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

434. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP008899 (Enterobacter hormaechei subsp. hoffmannii ECNIH3 plasmid pENT-8a4, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

435. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP008906 (Enterobacter hormaechei subsp. hoffmannii ECR091 plasmid pENT-08e, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

436. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP042552 (Enterobacter hormaechei strain C45 plasmid pC45_001, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

437. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP039271 (Salmonella enterica subsp. enterica serovar Senftenberg str. CFSAN004025 plasmid pCFSAN004025.1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

438. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP016526 (Salmonella enterica subsp. enterica serovar Heidelberg strain 09-036813-1A plasmid p09-036813-1A_261, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

439. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to CP050163 (Escherichia coli plasmid Carbapenemase(KPC-2)_IncHI2, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

440. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to KX856066 (Salmonella Typhimurium strain HSHLJ1 plasmid pHSHLJ1-MCR1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

441. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP041174 (Salmonella enterica subsp. enterica serovar Enteritidis strain SJTUF12519v2 plasmid p12519A, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

442. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP039170 (Salmonella enterica subsp. enterica serovar Goldcoast strain Sal-5364 plasmid pSal-5364, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

443. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP041734 (Enterobacter hormaechei subsp. steigerwaltii strain ME-1 plasmid pME-1a, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

444. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP022165 (Escherichia coli strain M160133 plasmid pM160133_p1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

445. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to MK933279 (Enterobacter hormaechei strain SCNJ07 plasmid pMCR-SCNJ07, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

446. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP012931 (Salmonella enterica subsp. enterica serovar Heidelberg strain N13-01290 plasmid pN13-01290_23, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

447. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to CP048299 (Salmonella enterica subsp. enterica serovar Schwarzengrund strain WAPHL_SAL-A00527 plasmid pN1566-2, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

448. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NC_005211 (Serratia marcescens plasmid R478, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

449. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP026661 (Salmonella enterica subsp. enterica strain 15-SA01028 plasmid pSE15-SA01028, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

450. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP042587 (Escherichia coli strain LD91-1 plasmid pLD91-1-MCR1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

451. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to LN794248 (Salmonella enterica subsp. enterica serovar Typhimurium plasmid incHI2, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

452. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP029248 (Enterobacter hormaechei subsp. xiangfangensis strain OSUVMCKPC4-2 plasmid pOSUEC_D, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

453. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP017451 (Klebsiella sp. LTGPAF-6F plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

454. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP043927 (Klebsiella quasipneumoniae subsp. quasipneumoniae strain M17277 plasmid p17277A_477, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

455. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP031102 (Leclercia sp. W17 plasmid pW17-1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

456. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP012170 (Enterobacter hormaechei subsp. steigerwaltii strain 34977 plasmid p34977-263.138kb, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

457. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to LC542971 (Escherichia coli IOMTU413 plasmid pIOMTU413 DNA, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

458. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to LC542972 (Escherichia coli IOMTU792 plasmid pIOMTU792 DNA, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

459. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to CP048303 (Salmonella enterica subsp. enterica serovar Schwarzengrund strain WAPHL-SAL-A00375 plasmid p28945-2, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

460. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to CP051274 (Salmonella enterica subsp. enterica serovar Worthington strain OLF-FSR1_WB_Partridge_SW-37 plasmid pSW37-267109, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

461. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP033347 (Salmonella enterica subsp. enterica strain CFSA1096 plasmid pCFSA1096, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

462. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP043034 (Escherichia coli strain XDL plasmid pXDL-CTX-M-14, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

463. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NC_024983 (Salmonella enterica subsp. enterica serovar Typhimurium plasmid pSTm-A54650, strain A54560, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

464. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP037959 (Salmonella enterica subsp. enterica serovar Goldcoast strain R18.0877 plasmid pR18.0877_278k, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

465. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to CP051271 (Salmonella enterica subsp. enterica serovar Worthington strain OLF-FSR1_WB_Quail_SW-70 plasmid pSW37-267106, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

466. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP033224 (Salmonella enterica subsp. enterica strain CFSA122 plasmid pCFSA122-1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

467. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP033253 (Salmonella enterica subsp. enterica strain CFSA244 plasmid pCFSA244-1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

468. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP047659 (Escherichia coli strain LD39-1 plasmid pLD39-1-MCR1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

469. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP047666 (Escherichia coli strain LD26-1 plasmid pLD26-1-MCR1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

470. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP039861 (Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014880 plasmid p16-6773.1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

471. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP034390 (Escherichia coli strain RS571 plasmid pRS571-MCR-1.1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

472. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to KX856065 (Salmonella enterica subsp. enterica serovar Typhimurium plasmid pASSD2-MCR1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

473. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP013215 (Klebsiella pneumoniae subsp. pneumoniae strain H11 plasmid pH11, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

474. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP021463 (Salmonella enterica subsp. enterica serovar Typhimurium strain UGA14 plasmid pUGA14_1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

475. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NC_012556 (Enterobacter cloacae plasmid pEC-IMPQ, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

476. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NC_012555 (Enterobacter cloacae plasmid pEC-IMP, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

477. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP042579 (Enterobacter kobei strain C16 plasmid pC16_001, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

478. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP050780 (Salmonella enterica subsp. enterica serovar Indiana strain SI85 plasmid pSI85-1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

479. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP048776 (Salmonella enterica subsp. enterica serovar Agona strain SG17-135 plasmid pSG17-135-HI2, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

480. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP033351 (Salmonella enterica subsp. enterica strain CFSA629 plasmid pCFSA629, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

481. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NC_019114 (Salmonella enterica subsp. enterica serovar Heidelberg plasmid pSH111_227, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

482. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP023143 (Escherichia coli strain CFSAN061770 plasmid pEGY1-MCR-1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

483. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_AP023198 (Escherichia coli strain TUM18780 plasmid pMTY18780-1_lncHI2, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

484. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP043223 (Salmonella enterica subsp. enterica serovar Bredeney strain SA20114778WT plasmid pET1.1-IncH, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

485. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP043223 (Salmonella enterica subsp. enterica serovar Bredeney strain SA20114778WT plasmid pET1.1-IncH, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

486. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP049193 (Enterobacter hormaechei strain Y2152 plasmid pIHI2-2152, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

487. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP050751 (Salmonella enterica subsp. enterica serovar Typhimurium strain ST46 plasmid pST46-1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

488. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP050729 (Salmonella enterica subsp. enterica serovar Typhimurium strain ST106 plasmid pST106-1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

489. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP050772 (Salmonella enterica subsp. enterica serovar Indiana strain SI102 plasmid pSI102-1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

490. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP050761 (Salmonella enterica subsp. enterica serovar Indiana strain SI170 plasmid pSI170-1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

491. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP051135 (Enterobacter hormaechei strain AMS-38 plasmid pAMS-38c, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

492. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP032842 (Enterobacter hormaechei strain C15117 plasmid pSPRC-Echo1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

493. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP025340 (Salmonella enterica subsp. enterica serovar Typhimurium strain BL10 plasmid p220k, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

494. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP038454 (Escherichia coli strain EC-129 plasmid pEC129_1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

495. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP041997 (Escherichia coli strain AR Bank #0349 plasmid pAR349, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

496. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP042525 (Citrobacter freundii strain E11 plasmid pE11_001, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

497. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP050754 (Salmonella enterica subsp. enterica serovar Typhimurium strain ST45 plasmid pST45-1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

498. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP050784 (Salmonella enterica subsp. enterica serovar Indiana strain SI67 plasmid pSI67-1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

499. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_LT991955 (Enterobacter hormaechei subsp. steigerwaltii isolate C309 plasmid pC309-VIM4) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

500. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP050763 (Salmonella enterica subsp. enterica serovar Indiana strain SI115 plasmid pSI115-1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

501. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to MH884652 (Salmonella sp. strain Sa27 plasmid pSa27-CIP, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

502. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to MH884653 (Salmonella sp. strain Sa27 plasmid pSa27-TC-CIP, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

503. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP022533 (Enterobacter hormaechei strain MS7884A plasmid pMS7884A, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

504. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP038659 (Citrobacter freundii strain 680 plasmid p680_1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

505. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to MH114596 (Salmonella enterica strain 13-1681 plasmid p131681, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

506. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP026936 (Escherichia coli strain CFS3292 plasmid pCFS3292-1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

507. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP029717 (UNVERIFIED_ORG: Enterobacter cloacae strain AR_0154 plasmid unnamed4, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

508. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP024910 (Enterobacter hormaechei subsp. xiangfangensis strain OSUKPC4_L plasmid pOSUKPC4, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

509. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to MK962305 (Escherichia coli strain YZUC2624 plasmid pYZUC2624.1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

510. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to MN937241 (Enterobacter cloacae strain BSI034 plasmid pBSI034-MCR9, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

511. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP042489 (Enterobacter hormaechei strain C15 plasmid pC15_001, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

512. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_LT985297 (Escherichia coli strain B4-25 plasmid RCS77_p, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

513. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP026933 (Escherichia coli strain CFS3273 plasmid pCFS3273-1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

514. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_MK461931 (Escherichia coli strain F2_14D plasmid pF2_14D_HI2, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

515. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_MK355502 (Klebsiella pneumoniae strain CRE plasmid pAN65-1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

516. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_MN540571 (Escherichia coli strain E.coli4feg plasmid pIV_IncHI2_CTX_M_15, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

517. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP033103 (Enterobacter hormaechei strain L51 plasmid pEHZJ1, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

518. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_MH829594 (Enterobacter cloacae strain EC62 plasmid pIMP-4-EC62, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

519. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_MH522426 (Salmonella enterica subsp. enterica serovar Typhimurium strain SH16G4928 plasmid pSH16G4928, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

520. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_MH924589 (Escherichia coli strain RDB9 plasmid pRDB9, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

521. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_MH287085 (Escherichia coli strain F2_12B plasmid pSDC-F2_12BHI2, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

522. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_MH287084 (Escherichia coli O157 strain SvETEC plasmid pSDE-SvHI2, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

523. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_MK169211 (Escherichia coli strain DUK14-2 plasmid pMOO-32, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

524. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_MK413720 (Enterobacter cloacae strain 12949 plasmid p12949-HI2, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

525. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_MK736669 (Enterobacter cloacae strain EclC2185 plasmid pEclC2185CTXM15, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

526. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_MG825373 (Escherichia coli strain 1106 plasmid p1106-IncHI2, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

527. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_LC511997 (Enterobacter hormaechei subsp. xiangfangensis strain MY460 plasmid pMY460-rmtE, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

528. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_MF344580 (Enterobacter cloacae strain 30860 plasmid p30860-HI2, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

529. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_MF344581 (Enterobacter cloacae strain 13E573 plasmid p13E573-HI2, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

530. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_MF344583 (Enterobacter cloacae strain N1863 plasmid pN1863-HI2, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

531. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_MG662415 (Escherichia coli strain EC1107 plasmid EC1107-IncHI2-226K, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

532. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_MH522419 (Salmonella enterica subsp. enterica serovar Typhimurium strain SH16G1369 plasmid pSH16G1369, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

533. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_MH329870 (Escherichia coli strain 92944 plasmid p92944-MCR, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

534. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_MH522425 (Salmonella enterica subsp. enterica serovar Typhimurium strain SH16G4909 plasmid pSH16G4909, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

535. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_MH399264 (Enterobacter cloacae strain RJ702 plasmid pIMP26, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

536. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_MH077952 (Escherichia coli strain EC17S-208 plasmid p17S-208, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

537. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_MH522424 (Salmonella enterica subsp. enterica serovar Typhimurium strain SH16G4525 plasmid pSH16G4525, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

538. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_KY863418 (Enterobacter asburiae strain AMA 497 plasmid pOXA436, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

539. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_KY978628 (Cronobacter sakazakii strain 505108 plasmid p505108-MDR, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

540. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_MG288680 (Klebsiella pneumoniae strain D610 plasmid pD610-HI2, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

541. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_MF344582 (Citrobacter freundii strain 525011 plasmid p525011-HI2, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

542. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_MF788071 (Raoultella ornithinolytica strain 23141 plasmid p23141-3, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

543. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP031724 (Enterobacter hormaechei strain WCHEH020038 plasmid pCTXM9_020038, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

544. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP011062 (Escherichia coli str. Sanji plasmid pSJ_255, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

545. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP027202 (Escherichia coli strain WCHEC025943 plasmid pMCR1_025943, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

546. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP053191 (Enterobacter hormaechei strain EGYMCRVIM plasmid pMS-37a, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

547. spacer 2.18|878846|30|NC_018407|CRISPRCasFinder,CRT matches to NZ_CP016838 (Salmonella enterica subsp. enterica serovar Senftenberg strain 775W (ATCC 43845) plasmid pSSE-ATCC-43845, complete sequence) position: , mismatch: 9, identity: 0.7

aggttgttcatgattgacattaaaattaaa	CRISPR spacer
gcaactatcaggattaacattaaaattaaa	Protospacer
. . .  *** ****.**************

548. spacer 2.21|879044|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP015043 (Rhodovulum sp. P5 plasmid pRGUI04, complete sequence) position: , mismatch: 9, identity: 0.7

attctgccgccacgatatcgatttcagttc	CRISPR spacer
cctctgccgccacgatttcgattatcgaca	Protospacer
 .************** ****** . * .

549. spacer 2.29|879573|31|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP038614 (Arsenophonus nasoniae strain FIN plasmid pArsFIN2, complete sequence) position: , mismatch: 9, identity: 0.71

ttttttgttaatgaattaaaaatcttatcag	CRISPR spacer
aattttgttaattaatcaaaaatctcaaaga	Protospacer
  ********** ***.********.*  ..

550. spacer 2.29|879573|31|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP026601 (Clostridiaceae bacterium 14S0207 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.71

ttttttgttaatgaattaaaaatcttatcag	CRISPR spacer
atttttattaaagaattaaaaatccaaatga	Protospacer
 *****.**** ************. * ...

551. spacer 2.29|879573|31|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to MN694315 (Marine virus AFVG_250M710, complete genome) position: , mismatch: 9, identity: 0.71

ttttttgttaatgaattaaaaatcttatcag	CRISPR spacer
ggtaatgttaatgaattaaaaaactcatgcc	Protospacer
  *  ***************** **.**

552. spacer 2.32|879772|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LR134403 (Listeria monocytogenes strain NCTC7974 plasmid 6, complete sequence) position: , mismatch: 9, identity: 0.7

aacttatctgcataacccttttgaatctct	CRISPR spacer
tttccttctgcataacccatttgaacctca	Protospacer
  ... ************ ******.***

553. spacer 2.33|879838|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP037428 (Myroides odoratimimus strain G13 plasmid pFM-G13, complete sequence) position: , mismatch: 9, identity: 0.7

aagttgatcatttaaatgagcttttaaaaa	CRISPR spacer
tttacgatcatttaaataagcatttaaatc	Protospacer
    .************.*** ******

554. spacer 2.33|879838|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to MN694380 (Marine virus AFVG_250M409, complete genome) position: , mismatch: 9, identity: 0.7

aagttgatcatttaaatgagcttttaaaaa	CRISPR spacer
gtagagatcatttaaatgaacttataaacg	Protospacer
. .  **************.*** **** .

555. spacer 2.39|880234|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to MN693324 (Marine virus AFVG_25M101, complete genome) position: , mismatch: 9, identity: 0.7

gaattaaattatctttataagtaaaataaa	CRISPR spacer
ttaataaattatctttataattaaatactg	Protospacer
  * **************** ****    .

556. spacer 2.41|880366|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to MN693324 (Marine virus AFVG_25M101, complete genome) position: , mismatch: 9, identity: 0.7

gaattaaattatctttataagtaaaataaa	CRISPR spacer
ttaataaattatctttataattaaatactg	Protospacer
  * **************** ****    .

557. spacer 2.43|880498|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP015043 (Rhodovulum sp. P5 plasmid pRGUI04, complete sequence) position: , mismatch: 9, identity: 0.7

attctgccgccacgatatcgatttctgttc	CRISPR spacer
cctctgccgccacgatttcgattatcgaca	Protospacer
 .************** ****** ..* .

558. spacer 2.45|880630|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NC_018990 (Borrelia burgdorferi 297 plasmid 297_lp28-3, complete sequence) position: , mismatch: 9, identity: 0.7

caacagccgttgttaaaattaaaaaaacta	CRISPR spacer
agattagtttttttaaaattaaaaaaacta	Protospacer
 .*. . . ** ******************

559. spacer 2.45|880630|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NC_011781 (Borreliella burgdorferi ZS7 plasmid ZS7_lp28-3, complete sequence) position: , mismatch: 9, identity: 0.7

caacagccgttgttaaaattaaaaaaacta	CRISPR spacer
agattagtttttttaaaattaaaaaaacta	Protospacer
 .*. . . ** ******************

560. spacer 2.45|880630|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NC_017405 (Borreliella burgdorferi JD1 plasmid JD1 lp28-3, complete sequence) position: , mismatch: 9, identity: 0.7

caacagccgttgttaaaattaaaaaaacta	CRISPR spacer
agattagtttttttaaaattaaaaaaacta	Protospacer
 .*. . . ** ******************

561. spacer 2.45|880630|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NC_001853 (Borreliella burgdorferi B31 plasmid lp28-3, complete sequence) position: , mismatch: 9, identity: 0.7

caacagccgttgttaaaattaaaaaaacta	CRISPR spacer
agattagtttttttaaaattaaaaaaacta	Protospacer
 .*. . . ** ******************

562. spacer 2.45|880630|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to MH616728 (Myoviridae sp. isolate ctge_1, complete genome) position: , mismatch: 10, identity: 0.667

caacagccgttgttaaaattaaaaaaacta	CRISPR spacer
gtttcattcttgttaaaattaaaaaatcta	Protospacer
   . ... ***************** ***

563. spacer 2.33|879838|30|NC_018407|CRISPRCasFinder,CRT,PILER-CR matches to NC_014533 (Gloeothece verrucosa PCC 7822 plasmid Cy782201, complete sequence) position: , mismatch: 11, identity: 0.633

----aagttgatcatttaaatgagcttttaaaaa	CRISPR spacer
tttttaaaaactcacttaaatgag----taaaaa	Protospacer
     *.  . ***.*********    ******

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_018407

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection