CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number
NC_018493	Bacillus cereus FRI-35 plasmid p02, complete sequence	1 crisprs	NA	0	1	0
NC_018491	Bacillus cereus FRI-35, complete genome	3 crisprs	DinG,WYL,Cas14u_CAS-V,cas14k,csa3,cas3,DEDDh,cas14j,c2c9_V-U4,RT	15	3	5
NC_018492	Bacillus cereus FRI-35 plasmid p01, complete sequence	2 crisprs	csa3,RT,cas14j,c2c10_CAS-V-U3	0	10	0
NC_018494	Bacillus cereus FRI-35 plasmid p04, complete sequence	0 crisprs	NA	0	0	0
NC_018499	Bacillus cereus FRI-35 plasmid p03, complete sequence	0 crisprs	NA	0	0	3

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_018493_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_018493_1

9407-9513

Orphan

Consensus_repeat	Method
GTGCAAAATTAAGTGTATATCTCCTACTTTA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_018493_1

>merge|NC_018493|1|9407-9513|CRISPRCasFinder
GTGCAAAATTAAGTGTATATCTCCTACTTTAGCTTTATCATGTTGGATCGTTTTGGATAGTAAATAAAATAATAGTGTGCAAAATTAAGTGTATATCTCCTACTTTA

>NC_018493|1|1|9407-9513|CRISPRCasFinder
GTGCAAAATTAAGTGTATATCTCCTACTTTA	GCTTTATCATGTTGGATCGTTTTGGATAGTAAATAAAATAATAGT
GTGCAAAATTAAGTGTATATCTCCTACTTTA

Protein	Signature genes	Signature genes Name	Protein_function
NC_018493.1\|WP_000460637.1\|13748_14180_-\|hypothetical-protein	unknown	unknown	unknown
NC_018493.1\|WP_000228250.1\|11972_12317_+\|hypothetical-protein	unknown	unknown	unknown
NC_018493.1\|WP_000462451.1\|2146_2692_+\|hypothetical-protein	unknown	unknown	unknown
NC_018493.1\|WP_000504303.1\|17847_18606_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|234750
NC_018493.1\|WP_001005145.1\|13212_13722_+\|hypothetical-protein	unknown	unknown	unknown
NC_018493.1\|WP_000715235.1\|3727_5209_-\|type-II-secretion-system-protein	unknown	unknown	gnl\|CDD\|225076
NC_018493.1\|WP_000362837.1\|5815_6340_-\|hypothetical-protein	unknown	unknown	unknown
NC_018493.1\|WP_001071800.1\|15150_15501_-\|hypothetical-protein	unknown	unknown	unknown
NC_018493.1\|WP_000686863.1\|12439_13003_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379492
NC_018493.1\|WP_000251802.1\|3067_3643_-\|hypothetical-protein	unknown	unknown	unknown
NC_018493.1\|WP_154214298.1\|14282_15059_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|371004
NC_018493.1\|WP_001106903.1\|6359_6899_-\|hypothetical-protein	unknown	unknown	unknown
NC_018493.1\|WP_001031933.1\|416_653_+\|hypothetical-protein	unknown	unknown	unknown
NC_018493.1\|WP_001293416.1\|7021_7789_+\|hypothetical-protein	unknown	unknown	unknown
NC_018493.1\|WP_000619730.1\|8225_9239_+\|hypothetical-protein	unknown	unknown	unknown
NC_018493.1\|WP_000005048.1\|15643_16084_-\|hypothetical-protein	unknown	unknown	unknown
NC_018493.1\|WP_000776552.1\|16099_17293_-\|ParM/StbA-family-protein	unknown	unknown	gnl\|CDD\|212669
NC_018493.1\|WP_001080814.1\|10915_11524_+\|hypothetical-protein	unknown	unknown	unknown
NC_018493.1\|WP_000025665.1\|1116_1743_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|376232
NC_018493.1\|WP_000995357.1\|2704_2893_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NC_018493.1\|WP_154214298.1\|14282_15059_-\|hypothetical-protein	gnl\|CDD\|371004	pfam10359, Fmp27_WPPW, RNA pol II promoter Fmp27 protein domain. Fmp27_WPPW is a conserved domain of a family of proteins involved in RNA polymerase II transcription initiation. It contains characteristic HQR and WPPW sequence motifs. and is towards the C-terminal in members which contain Fmp27_SW pfam10305.	0.000568742
NC_018493.1\|WP_000504303.1\|17847_18606_+\|hypothetical-protein	gnl\|CDD\|234750	PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed.	0.00341066
NC_018493.1\|WP_000776552.1\|16099_17293_-\|ParM/StbA-family-protein	gnl\|CDD\|212669	cd10227, ParM_like, Plasmid segregation protein ParM and similar proteins. ParM is a plasmid-encoded bacterial homolog of actin, which polymerizes into filaments similar to F-actin, and plays a vital role in plasmid segregation. ParM filaments segregate plasmids paired at midcell into the individual daughter cells. This subfamily also contains Thermoplasma acidophilum Ta0583, an active ATPase at physiological temperatures, which has a propensity to form filaments.	2.70932e-27
NC_018493.1\|WP_000715235.1\|3727_5209_-\|type-II-secretion-system-protein	gnl\|CDD\|225076	COG2165, PulG, Type II secretory pathway, pseudopilin PulG [Cell motility and secretion / Intracellular trafficking and secretion].	7.83559e-10
NC_018493.1\|WP_000686863.1\|12439_13003_+\|hypothetical-protein	gnl\|CDD\|379492	pfam14163, SieB, Super-infection exclusion protein B. This family includes superinfection exclusion proteins. These proteins prevent the growth of superinfecting phage which are insensitive to repression. It aborts lytic development of superinfecting phage.	1.1156e-31
NC_018493.1\|WP_000025665.1\|1116_1743_-\|hypothetical-protein	gnl\|CDD\|376232	pfam18813, PBECR4, phage-Barnase-EndoU-ColicinE5/D-RelE like nuclease4. A predicted endoRNase of the Barnase-EndoU-ColicinE5/D-RelE like nuclease fold found in polyvalent proteins of phages and conjugative elements. The predicted active site contains a conserved histidine residue.	0.000177436

>NC_018493.1|WP_000619730.1|8225_9239_+|hypothetical-protein
MIRKKRNTAKAEKTKYKFVHAVDLETGEDLGLIPHITEPVIILDPEKEAKKKKAREYRNKNSRTEPFVQCSKEYEKIIEDYNRLTKDCLVKLMPYINFKDTLVKIDDKVLGTKDLYHLWGVSNKTGKMILESFLNDGIIIEEDSGIKNGKQYRATGKIVFRGKNNKKEFTQKIDEEELKKYITAVQKKLTARENVAKKNNRKVSPIYPLALFGSLVPNFSYNTYLLAKNNSEDVILEGETVKEILSSRRKRSRFQFMKNYELWNIYSGQNVTVLSVNEQKELKECLEILLDVGILAQWRSNGKKLFLINPKLIYSSPGFKCDPGWKEVITTLFDLTK
>NC_018493.1|WP_001293416.1|7021_7789_+|hypothetical-protein
MSEMVGYIYIHEEFEELFGVLSQPELHFLAKLLPFIDEDGLVHTPKDNEMEEIELGNTKSIIDYWGVSKPTGTKYLSNLVKNEVLLKVREDRENRYVLTEKYFDLEAKKECYESISCEFLKKCIIKFHEIWEDEFLHEGEHGTHNVYPLSFFLVMLMNVNYDNLLFICEDFERKIVVEKDKKHFIVEKELKLSKPFGELKLWELSSGSKSKVNNRTREKIKLFISSLQQSGLIHVMEFDSIKHFVFKFPPELFRE
>NC_018493.1|WP_001106903.1|6359_6899_-|hypothetical-protein
MNYKIEHVLKITDGEYKDYREVYFVSENTSTKMIYMLLDPNNVCKNFFSLGRTYMEGVMIKREVEGMIRSEGYRLKELFSNTETSTNLVTFQYLQLLNNLIKENQKIVCVQEEEEDPEYHYRMFVQLHNKETMEITEWFKEENIVKGRIESGIGFPKYMREKGYNIHVVRHLEDVSTLF
>NC_018493.1|WP_000362837.1|5815_6340_-|hypothetical-protein
MDLEVYKVTIITYGVCKGFEEVCFTDGSKEWGELMVLLNTEKEIVRYFSEEDSLEEQEQMRAAAEEMIGSGVYRLKTLFMEKEKTKYLYDFHYVFKREELEQRRFLYFEQIPKGYGKYKYIIYQDKEGKGNVTYCFPEFNLQEDYYIISDEHFIEKLEEMGFDLTDIKETKLPF
>NC_018493.1|WP_000715235.1|3727_5209_-|type-II-secretion-system-protein
MKKGFTLIEILIVVSIISVLVLVFMVSTKGYVAKADLQRQKTNSMVLEEAIRQHKLENESLPFSTKITKEMSNETKKIIEQQLRSKGVTFDSVKDSFYELDRQKIKQYIKGQMSNFERYFSSSAKELEGMVFTYDTLKSKKEGVFSGSYLLLEVEEGGNEVKPPEPPAVVCNTSDPSADETIRTPKTGRGISYDPYIITTVGELQSIKLKPSSYYELGNDIEGCVTKSWNNGLGFEPLPLFTGVLFGKEFTVKNLYINRPNQDFVGLFSQTNRPYSALHIKLKDPEVTGRDYVGAVVGSSGTNDSLQYEFTHVENGKVTGRNYIGGLIGKLGNSASLSYSSFTGQIKGAENVGGLVGSIEFKFNMTTSYFIGSVVGENNVGGVSGKADVNNGYIALNKVYVVADLTGGTNVNYLYGVRNLKVGGWYDIQFSDVYFDKEKTKYITQEKQGEVTGLTTEQMKNPANFSEYWHFGRDWEVDPSRNDGYPIVIVTYE
>NC_018493.1|WP_000251802.1|3067_3643_-|hypothetical-protein
MVRKIELKHVNEIVENDTYEGFKELAIQIISGGRPMSLVHVLLNKEGNVEDTHFKGKGTAYTTRDKFNKYERSIKKYIDTEEFETQLSTIETTKINEFELFKRYKKKRSLLENKTEIFYVKEEMRSYYFLSFYKENNGTTKAVTYLFDNFLNGAEKTLRGEEFIEELKEKGYNLTEMNNKDEIEAIIKNQS
>NC_018493.1|WP_000995357.1|2704_2893_-|hypothetical-protein
MNAYTEEQFVYFTGKLKHLETIKEDKETYWTEYNLLQDWLQQNQLSTAFINWVEKKIEQKTR
>NC_018493.1|WP_000462451.1|2146_2692_+|hypothetical-protein
MFELRSYFEVVDGPFKGYKELKFWKQGLFLPVGVLVNEKDEFVRMNRHYKRDRKEFREIKEFVDKKTWRLQLVFSEREENDLLRYFEDYEYRQRLKQEQIPITCIYKESHSGKYEFFFYVRNRKNELIKINDVFEEYTSEISTQLIYQHRTFYKSLRRVGYNIAKVIDYYEKMEQDIKNRK
>NC_018493.1|WP_000025665.1|1116_1743_-|hypothetical-protein
MSILNLSDLENHPTRTKQHEISISLLANYYETYLHPNYYDFKLNNGVTIRIDFHKEHFCHLVGIDQISTAKFKNPNDTRLFMYRGKNGFRRSKNGKYEFNHLRALHQHEFNKQKDKMFFFHFIHTMLDSVNLTLVNYTIISGSTIRCDFMFYDTYDNALLHLGVEKDRKTGYFFPKTFFVRYLTNTQADKYVKPQTVVGITQLTKVPR
>NC_018493.1|WP_001031933.1|416_653_+|hypothetical-protein
MNKFKTVFKLKFKKDKALYVRSSEHEYNFKVVEIHNNVTDASLDLTITKYRMLKLSVLFATGTTVIGAALSWLLKLFV
>NC_018493.1|WP_001080814.1|10915_11524_+|hypothetical-protein
MNRLIELCSVLILSLLLITSCGETKTIPDGFTEQSYKDFTTIYNNYQEKVKKNSFEKESKGFALLFNYQKKNENGKLSKIEQETADKLGELLFIYNGIAAKKENKFPSKDVELLNDMVAADEYKIPKLEEEIESLLQLPKTNKTDIKESNVPNKQEENTNQKTDPVDNNVSAENCPKPYTQEECKQFEEYYKYGDGRFEPRK
>NC_018493.1|WP_000228250.1|11972_12317_+|hypothetical-protein
MVDPGQYVYTKEVSELEQVSFLVKPNQIEEYEVSYRFYCEESSEEILLKHTIKCLKKGDIYVFEHYFCPVLRLSHRNLNTMETLNFIFTHFGEYIEIRTKDFESQIFVQLRKMK
>NC_018493.1|WP_000686863.1|12439_13003_+|hypothetical-protein
MKIDIKEILTLPNNIMAGLTLATGILLFSPDSFLKKLFMFSFREKNGFIIGIVFIVSLSILIINLIYKTTKAIQSRNSKRKFYAEAESRLRKLNTYQKFIIYSLYNEYNRTLPLPLHDGSVLELESKFMIGKATNQYMVADLNNAEFPYLLQPWVSDELTNKPDLLSHFLSVYESKLAETTRNAPFY
>NC_018493.1|WP_001005145.1|13212_13722_+|hypothetical-protein
MNEPKHMLITYSVEKAASGHVDPNFTKLVYGNSKKNGEIIKKHISPGSFIFFNARIGDKRYITSYFYVEKMLYKGKHDHEIAGLGCDAADDQVIIVGSRSFSKVLTIPIVLDRKLIGKIKSIGADEKYFKEKAKVKIGELEAIKDKTLNPNIITEEEKEFLIGLCENRG
>NC_018493.1|WP_000460637.1|13748_14180_-|hypothetical-protein
MFDTVQLDMDNWKYVLETDFFKNEEECATFFRWITKLSEFNFIADKDGNVIETGAVSELGKMDLNTTTEFIERLKEHGFLLEIIMPYYPYYLINPNLAVQKDVCTNWLFMFQNDFKELEKDGVLKDLPNSYWDHTYGDKEDES
>NC_018493.1|WP_154214298.1|14282_15059_-|hypothetical-protein
MKKKLQLITDTLLNGSEDLVYNGKDFEERTRNKSVFSGIRDRLKSVVEIIKTPNSQIDYDSFGFDYIEPKYDFKEPVDYYSSRSLKDNKSQKTFQEELKATNKGDKVIDFMEEFRKRRQDIQDQIQNHQENLLKYEKTSDRKTELSNKIEHLKEQLQTINDMHKPFVKDFSDKTYHGNMVGSAKDRKTEMQHAHNAQKEMKEKGYKPIEVARSLKEGVNRIQGALSESAAFSPELKAELRRDTQQQIKENSTMKEMYF
>NC_018493.1|WP_001071800.1|15150_15501_-|hypothetical-protein
MNQIHTDMIQILWYNVKKSIEDCNDQDYTIENIQFNSKLIDIFPTVTRMDEQANRLGISIQHAIFVAENYFGKSIEIDYEARQEYDIFENAGDILVYLYCKVTGLNKTIEQILQEA
>NC_018493.1|WP_000005048.1|15643_16084_-|hypothetical-protein
MSETKATRPKQKQLRMRKKENPLFVEWLDNQTDFSDSVRKLIELHINRHGTKDLNDPSVVFSMAREMVLLSPEGSSISNVVQAVPTQTTSIPVAQEVPVAEEKKEEVKEEIQAIEKVEETIEEVKKEETEEAPKKVKRRGASASNF
>NC_018493.1|WP_000776552.1|16099_17293_-|ParM/StbA-family-protein
MKLRFEVGNDNGNSEQKMMVNDTLYLSPNVYSVVTNTVSHEDTKPEKMIENLLNHLYVTIQSRHLNQYNQSVTVFSGKRALEEGENVRNMSIRMGEKHKEDIPLINTLANLAGIAVQNAFEKKGEIVKDINLSVDMTTALPASQWNETTAKEFSNRFMEHEHTVIVHVGNTDINVKIDFSYVKTVKEGVIALFALMEDGKDAYRNDDIFDEFIKEYNLEKIDGSYFEDLLILHSDIGDGTNEYAITRGYETNNKTHGEDHGIGHAIESAIKKYEQIRKYKMTRQEFSKLVQTEGARFHTTAVECLRTAKEELANLILREIQETIKSMKFETDVVVVYGGGSIQMRDVLYTPLKEFLDENEMKLLWINKKNATTLNVQGLNIFTKTLLKDEKKEVLQK
>NC_018493.1|WP_000504303.1|17847_18606_+|hypothetical-protein
MGELYKIKTAAEKLNELISKSSFSEEKKKRLYFSTDRLKRWAREDVIRSNFSSNSYYISENEFENILKLNVMIGLDGKTIEQATKELLVGSVLEKEEQMEEDRDKYEHVIQEALVRYSDGLKQPIEDVGKSLTEFETILLGHIKNMSEQIQYLSQEVAQLNGKVDDQKLLLENQAPLLLEEKTEDVSKAREETKKEIAAAVDQKTELFAKEMEELKKTVHQQQLLLEKQENEKTTENKKRKGFFSRMFSKEN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_018493_1	1.1\|9438\|45\|NC_018493\|CRISPRCasFinder	9438-9482	45	NC_018493	Bacillus cereus FRI-35 plasmid p02, complete sequence	9438-9482	0	1.0

1. spacer 1.1|9438|45|NC_018493|CRISPRCasFinder matches to NC_018493 (Bacillus cereus FRI-35 plasmid p02, complete sequence) position: , mismatch: 0, identity: 1.0

gctttatcatgttggatcgttttggatagtaaataaaataatagt	CRISPR spacer
gctttatcatgttggatcgttttggatagtaaataaaataatagt	Protospacer
*********************************************

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_018491_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_018491_1

1757398-1757586

Orphan

Consensus_repeat	Method
GACGAAGANGAAGANGAN	CRT

4 spacers

The CRISPR arrays of NC_018491_1

>merge|NC_018491|1|1757398-1757586|CRT
GACGAAGATGAAGATGACTTTGATGATGTAGACGGAAATGAAGACGAAGATGATGATGTAGAAGATTTGGACAAGGTTCTTGAAGACGAAGACGGAGACGACGATGATCTTGATGATTTAGACGAAGATGAAGATGACTTCGCTGAAGAAGAACTTGAGTATGATGAAACTGAAGAAGAAGAAGAGGAA

>NC_018491|1|1|1757398-1757586|CRT
GACGAAGATGAAGATGAC	TTTGATGATGTAGACGGAAATGAA
GACGAAGATGATGATGTA	GAAGATTTGGACAAGGTTCTTGAA
GACGAAGACGGAGACGAC	GATGATCTTGATGATTTA
GACGAAGATGAAGATGAC	TTCGCTGAAGAAGAACTTGAGTATGATGAAACT
GAAGAAGAAGAAGAGGAA

Protein	Signature genes	Signature genes Name	Protein_function
NC_018491.1\|WP_000116031.1\|1753010_1753862_+\|3-hydroxybutyryl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|180269
NC_018491.1\|WP_000238604.1\|1756290_1756920_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NC_018491.1\|WP_000643437.1\|1766428_1766674_+\|type-B-50S-ribosomal-protein-L31	unknown	unknown	gnl\|CDD\|234969
NC_018491.1\|WP_001011168.1\|1753934_1755065_+\|acyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|173847
NC_018491.1\|WP_000465821.1\|1748058_1749252_-\|cardiolipin-synthase	unknown	unknown	gnl\|CDD\|234967
NC_018491.1\|WP_000609936.1\|1744265_1746944_-\|DUF4084-domain-containing-protein	unknown	unknown	gnl\|CDD\|372562
NC_018491.1\|WP_000542905.1\|1743153_1744011_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|376189
NC_018491.1\|WP_001086785.1\|1749558_1751670_+\|(Fe-S)-binding-protein	unknown	unknown	gnl\|CDD\|223325
NC_018491.1\|WP_000413260.1\|1761984_1763274_+\|UDP-N-acetylglucosamine-1-carboxyvinyltransferase	unknown	unknown	gnl\|CDD\|183779
NC_018491.1\|WP_000912422.1\|1759490_1760015_-\|DUF2529-domain-containing-protein	unknown	unknown	gnl\|CDD\|378487
NC_018491.1\|WP_014893402.1\|1747072_1748026_-\|UV-DNA-damage-repair-endonuclease-UvsE	unknown	unknown	gnl\|CDD\|235029
NC_018491.1\|WP_000280862.1\|1766782_1767370_+\|thymidine-kinase	unknown	unknown	gnl\|CDD\|235272
NC_018491.1\|WP_000887065.1\|1767639_1768707_+\|peptide-chain-release-factor-1	unknown	unknown	gnl\|CDD\|234801
NC_018491.1\|WP_000170453.1\|1757852_1759460_+\|CTP-synthase	unknown	unknown	gnl\|CDD\|235437
NC_018491.1\|WP_000398594.1\|1760216_1760585_+\|sporulation-initiation-phosphotransferase-Spo0F	unknown	unknown	gnl\|CDD\|381105
NC_018491.1\|WP_000734728.1\|1744101_1744248_+\|cell-cell-signaling-protein-PapR	unknown	unknown	gnl\|CDD\|368687
NC_018491.1\|WP_001053898.1\|1764634_1765906_+\|transcription-termination-factor-Rho	unknown	unknown	gnl\|CDD\|236490
NC_018491.1\|WP_000545534.1\|1755086_1756226_+\|acyl-CoA-dehydrogenase-AcdA	unknown	unknown	gnl\|CDD\|173847
NC_018491.1\|WP_001131850.1\|1760795_1761653_+\|fructose-bisphosphate-aldolase	unknown	unknown	gnl\|CDD\|169068
NC_018491.1\|WP_000442334.1\|1763390_1764356_+\|class-II-fructose-bisphosphatase	unknown	unknown	gnl\|CDD\|236536

Protein	Function_ID	Function_description	E-value
NC_018491.1\|WP_000116031.1\|1753010_1753862_+\|3-hydroxybutyryl-CoA-dehydrogenase	gnl\|CDD\|180269	PRK05808, PRK05808, 3-hydroxybutyryl-CoA dehydrogenase; Validated.	0
NC_018491.1\|WP_000238604.1\|1756290_1756920_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	8.86765e-14
NC_018491.1\|WP_000643437.1\|1766428_1766674_+\|type-B-50S-ribosomal-protein-L31	gnl\|CDD\|234969	PRK01678, rpmE2, type B 50S ribosomal protein L31.	3.07711e-51
NC_018491.1\|WP_001011168.1\|1753934_1755065_+\|acyl-CoA-dehydrogenase	gnl\|CDD\|173847	cd01158, SCAD_SBCAD, Short chain acyl-CoA dehydrogenases and eukaryotic short/branched chain acyl-CoA dehydrogenases. Short chain acyl-CoA dehydrogenase (SCAD). SCAD is a mitochondrial beta-oxidation enzyme. It catalyzes the alpha,beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of SCAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. This subgroup also contains the eukaryotic short/branched chain acyl-CoA dehydrogenase(SBCAD), the bacterial butyryl-CoA dehydorgenase(BCAD) and 2-methylbutyryl-CoA dehydrogenase, which is involved in isoleucine catabolism. These enzymes are homotetramers.	0
NC_018491.1\|WP_000465821.1\|1748058_1749252_-\|cardiolipin-synthase	gnl\|CDD\|234967	PRK01642, cls, cardiolipin synthetase; Reviewed.	4.98968e-106
NC_018491.1\|WP_000609936.1\|1744265_1746944_-\|DUF4084-domain-containing-protein	gnl\|CDD\|372562	pfam13321, DUF4084, Domain of unknown function (DUF4084). This family of Firmicute proteins is frequently associated with the EAL, GGDEF and PAS families, pfam00563, pfam00990, and pfam00989. The exact function is not known.	0
NC_018491.1\|WP_000542905.1\|1743153_1744011_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|376189	pfam18768, HTH_Bact, Helix-turn-helix bacterial domain. The bacterial PIcR helix-turn-helix transcription factor includes five TPR units of different lengths. This entry represents the central, medium-sized HTHs repeat.	4.12844e-13
NC_018491.1\|WP_001086785.1\|1749558_1751670_+\|(Fe-S)-binding-protein	gnl\|CDD\|223325	COG0247, GlpC, Fe-S oxidoreductase [Energy production and conversion].	3.90803e-94
NC_018491.1\|WP_000413260.1\|1761984_1763274_+\|UDP-N-acetylglucosamine-1-carboxyvinyltransferase	gnl\|CDD\|183779	PRK12830, PRK12830, UDP-N-acetylglucosamine 1-carboxyvinyltransferase; Reviewed.	0
NC_018491.1\|WP_000912422.1\|1759490_1760015_-\|DUF2529-domain-containing-protein	gnl\|CDD\|378487	pfam10740, DUF2529, Domain of unknown function (DUF2529). This domain is conserved in the Bacillales. The function is not known, but given this domains relationship to the SIS domain it may carry out a sugar isomerase reaction. Several members are annotated as being YWJG, a protein expressed downstream of pyrG, a gene encoding for cytidine triphosphate synthetase.	3.86421e-75
NC_018491.1\|WP_014893402.1\|1747072_1748026_-\|UV-DNA-damage-repair-endonuclease-UvsE	gnl\|CDD\|235029	PRK02308, uvsE, putative UV damage endonuclease; Provisional.	3.46984e-165
NC_018491.1\|WP_000280862.1\|1766782_1767370_+\|thymidine-kinase	gnl\|CDD\|235272	PRK04296, PRK04296, thymidine kinase; Provisional.	2.79483e-104
NC_018491.1\|WP_000887065.1\|1767639_1768707_+\|peptide-chain-release-factor-1	gnl\|CDD\|234801	PRK00591, prfA, peptide chain release factor 1; Validated.	0
NC_018491.1\|WP_000170453.1\|1757852_1759460_+\|CTP-synthase	gnl\|CDD\|235437	PRK05380, pyrG, CTP synthetase; Validated.	0
NC_018491.1\|WP_000398594.1\|1760216_1760585_+\|sporulation-initiation-phosphotransferase-Spo0F	gnl\|CDD\|381105	cd17553, REC_Spo0F-like, phosphoacceptor receiver (REC) domain of Spo0F and similar domains. Spo0F, a stand-alone response regulator containing only a REC domain with no output/effector domain, controls sporulation in Bacillus subtilis through the exchange of a phosphoryl group. Bacillus subtilis forms spores when conditions for growth become unfavorable. The initiation of sporulation is controlled by a phosphorelay (an expanded version of the two-component system) that consists of four main components: a histidine kinase (KinA), a secondary messenger (Spo0F), a phosphotransferase (Spo0B), and a transcription factor (Spo0A). REC domains function as phosphorylation-mediated switches within response regulators, but some also transfer phosphoryl groups in multistep phosphorelays.	2.77706e-64
NC_018491.1\|WP_000734728.1\|1744101_1744248_+\|cell-cell-signaling-protein-PapR	gnl\|CDD\|368687	pfam05968, Bacillus_PapR, Bacillus PapR protein. This family consists of the Bacillus species specific PapR protein. The papR gene belongs to the PlcR regulon and is located 70 bp downstream from plcR. It encodes a 48-amino-acid peptide. Disruption of the papR gene abolishes expression of the PlcR regulon, resulting in a large decrease in haemolysis and virulence in insect larvae. A processed form of PapR activates the PlcR regulon by allowing PlcR to bind to its DNA target. This activating mechanism is strain specific.	9.78729e-07
NC_018491.1\|WP_001053898.1\|1764634_1765906_+\|transcription-termination-factor-Rho	gnl\|CDD\|236490	PRK09376, rho, transcription termination factor Rho; Provisional.	0
NC_018491.1\|WP_000545534.1\|1755086_1756226_+\|acyl-CoA-dehydrogenase-AcdA	gnl\|CDD\|173847	cd01158, SCAD_SBCAD, Short chain acyl-CoA dehydrogenases and eukaryotic short/branched chain acyl-CoA dehydrogenases. Short chain acyl-CoA dehydrogenase (SCAD). SCAD is a mitochondrial beta-oxidation enzyme. It catalyzes the alpha,beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of SCAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. This subgroup also contains the eukaryotic short/branched chain acyl-CoA dehydrogenase(SBCAD), the bacterial butyryl-CoA dehydorgenase(BCAD) and 2-methylbutyryl-CoA dehydrogenase, which is involved in isoleucine catabolism. These enzymes are homotetramers.	0
NC_018491.1\|WP_001131850.1\|1760795_1761653_+\|fructose-bisphosphate-aldolase	gnl\|CDD\|169068	PRK07709, PRK07709, fructose-bisphosphate aldolase; Provisional.	0
NC_018491.1\|WP_000442334.1\|1763390_1764356_+\|class-II-fructose-bisphosphatase	gnl\|CDD\|236536	PRK09479, glpX, fructose 1,6-bisphosphatase II; Reviewed.	0

>NC_018491.1|WP_000238604.1|1756290_1756920_+|TetR/AcrR-family-transcriptional-regulator
MVKHNVHASVKDEKLVALRREQMIKGAVQLFKQKGFPRTTTREIAKAAGFSIGTLYEYIRTKDDVLYLVCDSIYEHVKERLEEVVCTEKGSVESLKIAITNYFKVMDELQEEVLIMYQEVRFLPKESLPYVLEKEFQMVGMFENILEQCTENGTFTLNKKEIQLLAHNIFIQGQMWGFRRWALQKLYTLEEYTDMQIRYVLQGAHMLPK
>NC_018491.1|WP_000545534.1|1755086_1756226_+|acyl-CoA-dehydrogenase-AcdA
MHFKLSEEHEMIRKMVRDFAKNEVAPTAAERDEEERFDRALFDQMAELGLTGIPWPEEYGGIGSDYLAYVIAIEELSRVCASTGVTLSAHTSLAGWPIFKFGTEEQKQTFLRPMAEGKKIGAYGLTEPGSGSDAGGMKTIAKRDGDHYVLNGSKIFITNGGIADIYVVFALTDPESKQRGTSAFIVESDTPGFSVGKKESKLGIRSSPTTEIMFEDCRIPVENLLGEEGQGFKIAMQTLDGGRNGIAAQAVGIAQGALDASVEYARERHQFGKPIAVQQGIGFKLADMATDVEAARLLTYQAAWLESEGLPYGKESAMSKVFAGDAAMKVTTEAVQVFGGYGYTKDYPVERYMRDAKITQIYEGTQEIQRLVISRMLTK
>NC_018491.1|WP_001011168.1|1753934_1755065_+|acyl-CoA-dehydrogenase
MNFRFNEEQQMMRKMVRDFAQKEIAPFVPSMEQGVFPKEILQKMGELGLMGIPAPAKYGGAEMDFISYILAIEEISKVSATVGVILAVHTSVGMNPILYFGTEEQKEKYVSKLATGEYLGAFALTEPNAGSDAGSLKSRAVKKGDHYIINGSKVFITNGGEASTYIVFASTNPEAGKSGISAFIVEKDTPGLIIGKDEHKMGLLGSRTVQLTFEDMKVPAENLLGEEGQGFKVAMANLDVGRIGIGAQALGIAEAALACAIDYAKEREQFGKPIAAQQGIGFKLADMATSVEAARLLVYRAASLRAQGLPCGKEASIAKLFASKTAVEVAIEAVQVFGGYGYTKDYPVERFFRDAKITQIYEGTSEIQKLVISRAL
>NC_018491.1|WP_000116031.1|1753010_1753862_+|3-hydroxybutyryl-CoA-dehydrogenase
MSVQKIVVIGAGQMGSGIAQVCAMAGYDVKVQDLKQEQLDRGLAIITKNLARQVEKGRMKEEEKEATLNRLAVTLDLDCVKEADLIIEAAVEKMDIKKKIFANLDEIAPEHAILATNTSSLPITEIAAVTKRPEKVIGMHFMNPVPVMKLVEIIRGLATDDAVYETIEDITKKIGKVPVEVNDFPGFVSNRILLPMINEAIYTLYEGVATKEAIDEVMKLGMNHPMGPLTLADFIGLDTCLYIMEVLHEGLGDSKYRPCPLLRKYVNAGWLGRKTGRGFYVYE
>NC_018491.1|WP_001086785.1|1749558_1751670_+|(Fe-S)-binding-protein
MNSLLIMNWLAAIAVIAYAGYLFVYLIRTRMAYIQLGKKIEFDRRFKERWDLLKVNVFGQKKLLKDKKSGIIHVMFFYGFILVQFGAIDFVWKGLAPGSHLPLGPLYPAFTFFQEIVTLVILIAVFWAFHRRYVEKLVRLKRNFKSGLVLIFIGGLMISVLLGNGMGIIWHGEELSWSEPIASAIAYVFSGINETAAISLFYFSWWVHLLILLTFLVYVPQSKHAHLIAGPANVFFGRLSNPGKLEKIDFEDETQETFGVGKIEDFRQNQLIDLYACVECGRCTNMCPATGTGKMLSPMDLILKLRDHLTDKGAAVTSKAPWVPVVAFNNTQGNQLAMMAAGKGQQESAATTLAYDPSLIGDVITEEEIWACTTCRNCEDQCPVMNEHVDKIIDLRRYLVLTEGKMDAEAQRAMTNIERQGNPWGLNRKERETWRQGDDEVTVPTVKEKSKAGEEFEYLFWVGSMGSYDNRSQKIAISFAKLMNEAGISFAILGNKEKNSGDTPRRLGNEFVFQEMATKNIEEFEKAGVKKIVTIDPHAYNTFKNEYPDFGLQAEVYHHTELLAQWVKEGRLKPVHAIEETVTYHDSCYLGRYNEVYEAPRDILKAIPGVNLVEMARNRETGMCCGAGGGLMWMEETTGSRINVARTEQALAVQPSIIGTGCPYCLTMISDGTKAKEVEEKVQTLDVTEILERSVIGQKKEAI
>NC_018491.1|WP_000465821.1|1748058_1749252_-|cardiolipin-synthase
MFFLSLLLIGSTLWIVIDLSYGRIVHLKRVRSRSFPLRQSDFHLYTYGKDLYDALFTDIKQAKHHVHVLFFIVKNDKISREFLKLLIDKAKEGIEVRLLLDRLGSHHLSNEAIRSLQKHGVSFSFCHKVKFPFPFFSANQRNHRKITVIDGKIGYIGGFNIGEEYLGHNQKLGLWRDYHLRLTGEGIQDLQRQFLHDWLDDTDQNLLEASLYFPKQQPGTILHRFIPTDGAYLQNTFLYLIESAEKELFIGTPYFIPGRKIMNALLEARKRGVQITILVPEKADHPLVREAKFPYCRKLIQAGCNIYAFQQGFFHAKVIIVDDYICDIGTANFDMRSLYINHEINCLLYDEHFIQTVKNKFHEDLENASLLSLKDVSPNSLINRGKEWIGTILAFFL
>NC_018491.1|WP_014893402.1|1747072_1748026_-|UV-DNA-damage-repair-endonuclease-UvsE
MIMRFGYVSHAMALWDCSPAKTMTFTSFQKLSKQEREDKLYDVTRQNLEHTIRILHYNIAHEIPLYRLSSSIVPLATHPEVEFDYIRLFTPLWRTIGALIKEHNLRVSFHPNQFTLFTSDKPHITTNAITDMTYHYKVLDAIGIADSSYINIHVGGAYGNKEKAVERFHENIKKLPAHIKRQMTLENDDKTYTTAETLSICQKEKIPFVFDYHHHMANLCEEPLEELLPAIFETWAHTNILPKVHISSPKSKKEFRAHAEYIDLEFIKPFLHVAKKINHNFDIMIESKQKDLAMLQFIHELSAIRGIKRINSSTLQW
>NC_018491.1|WP_000609936.1|1744265_1746944_-|DUF4084-domain-containing-protein
MINQKKYVHFVMIYIIIFSLWIFLIPKNLNIKEIGILFLFCFAALFSCYCLYKAIKKMKRGDKLFWVLLLCTCLCGLTMEITLFLHSLSIYDQVIFSYTALPFFIVQYILLFSGFAIKFIKHYSIRGLAQFSFDSIFIIIMNIYFTLTFILDRSSFRMLTTDHWVLIGYFIAQSLVIYAVISLYRREQYSASRISLIIGFTIILVYGYIHLFQLNAGMKTSSEVSYLIHTASILLIGLSSILYILDKPMQHETKTKYYRFDYVRFILPYFSIIITFSFIIFQPWDDKFMLIGLVLSLILLFLRQLYMWKDNQALIDTYEQLTTQLEDKVEEGASALSKSEQRYKSLFEDHPDAVFSLNMYGIFQQSNTACESLFTAYYCEVESYSLLHFIDSKDHDLLKKALQLTKKGRPQTLEVRTKEKEGYYYYLHITLIPTFINKEVVGMFGIARDITTLYEKQKQVEHLAFHDALTGLPNRRKFEKDLKNILNTAQTSANDVAVMFLDLDRFKKINDRLGHDVGDLLLIEVAKRLRSCLRSKDVVARQGGDEFTILLPDMYSEKSAAFIAEQILNILNKPFFIQGEELSITPSIGIAMYPDYGTDVTELMKNADMAMYRAKANGKNRFVFFSKEISIAQNEIQFLEGELAKALQQNEFFLEYQPQVSTKTKQIIGFEALIRWKHPKLGIVSPAQFIPLAEETGFIIELGNWILRTACLEAKRWHNQGFSHLKVGVNLSVVQFNHTNLIPTISKVLEETELKPEALDIEITESIAINQNQSVVAKLEQLQNLGIQISIDDFGTGYSSLAYLTKYPINTLKIAREFICGITTSPLEEAIISSIITLSKELNLEVIAEGVETEEQWKFLYEQNCDNIQGFFISKPVSSKDVWRLLHKKTTV
>NC_018491.1|WP_000734728.1|1744101_1744248_+|cell-cell-signaling-protein-PapR
MKKLLIGSLLTLAMAWGISLGDTALEKNQVISHNDQEVQLASDVPFEY
>NC_018491.1|WP_000542905.1|1743153_1744011_+|helix-turn-helix-transcriptional-regulator
MHAEKLGSEIKKIRMMRGLTQKQLSENICHQSEVSRIESGAVYPSMDILQGIAAKLQVPIIHFYEVLIYSDMERNKQLKDRIIMLCKEKKYKEIYNKVWNELKKEEYHPELQQFLQWQYHVAAYILKKIDYEYCISELKKLLNQQLAGIDVYQNLYIENAIANIYAENGHFKKSIELYENILKQLEVLHDNKEFDVKVRHNHAKALYLDNQYEEALCHANKAIELSCQINSMTLIGQLYYRKVECLEKLECDRAEIEDACEKAYFFFDILGNHTLKESIIKRMKK
>NC_018491.1|WP_000170453.1|1757852_1759460_+|CTP-synthase
MTKYIFVTGGVVSSLGKGITAASLGRLLKNRGLNVTIQKFDPYINVDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKIYSSVLQKERRGEYLGGTVQVIPHITNEIKERVYRSGRETNADVVITEIGGTVGDIESLPFLEAIRQIKSDIGRDNVMYIHCTLIPYLKAAGEMKTKPTQHSVKELRSLGIQPNIIVVRTEMPVSQDMKDKLALFCDIDTKAVIEARDADTLYAVPLSLQEQNMDQIVCDHLKLDNPAADMTEWTALVEKVRNLSKKTKIALVGKYVELQDAYISVVEALRHAGYSFDTDVEVKWVNAEHVTAENVQELVGDTDGILVPGGFGDRGVEGKIVAIQYARENKVPFLGICLGMQLASIEFARNVLGLEGANSSEINPDTPYAIIDLLPEQKDVEDLGGTLRLGLYPCKLAEETNAYNAYNEPVVYERHRHRYEFNNQFRPDMEKAGFVFSGTSPDGRLVEIVELKDHPWFVAAQFHPELVSRPNRPQPLFHDFVRASITNKESK
>NC_018491.1|WP_000912422.1|1759490_1760015_-|DUF2529-domain-containing-protein
MLKIFSTQLSGYFSRVSQKEEMNIEDSARLLAQALVGEGFIYLHGTNEMEGVVAEALFGAEPMKQAKRLFENGKEVEVTSADRVLLISRFSTDEEVVAIAKKLQADGHSIVGISAIQEGNESLEQYTDVHIDTKLLKGLIPDDEGNRYGFPSLMIALFAYHGIKFTIDEMLNEY
>NC_018491.1|WP_000398594.1|1760216_1760585_+|sporulation-initiation-phosphotransferase-Spo0F
MEGKILIVDDQYGIRVLLHEVFQKEGYQTFQAANGFQALDIVKKDNPDLVVLDMKIPGMDGIEILKHVKEIDESIKVILMTAYGELDMIQEAKDLGALMHFAKPFDIDEIRQAVRNELAVEA
>NC_018491.1|WP_001131850.1|1760795_1761653_+|fructose-bisphosphate-aldolase
MPLVSMKEMLNKALEGKYAVGQFNMNNLEWTQAILAAAEEEKSPVILGVSEGAARHMTGFKTVVAMVKALIEEMNITVPVAIHLDHGSSFEKCKEAIDAGFTSVMIDASHHPFEENVETTKKVVEYAHARNVSVEAELGTVGGQEDDVIAEGVIYADPAECKHLVEATGIDCLAPALGSVHGPYKGEPNLGFAEMEQVRDFTGVPLVLHGGTGIPTADIEKAISLGTSKINVNTENQIEFTKAVREVLNKDQEVYDPRKFIGPGRDAIKATVIGKIREFGSNGKA
>NC_018491.1|WP_000413260.1|1761984_1763274_+|UDP-N-acetylglucosamine-1-carboxyvinyltransferase
MEKLLIEGGRALNGTIRVSGAKNSAVALIPATILADTPVTIGGVPNISDVKMLGDLLEEIGGRVTYGQEEEMVVDPSNMVAMPLPNGKVKKLRASYYLMGAMLGRFKKAVIGLPGGCHLGPRPIDQHIKGFEALGAHVTNEQGAIYLRADELRGARIYLDVVSVGATINIMLAAVRAKGRTVIENAAKEPEIIDVATLLTSMGARIKGAGTDVIRIDGVDSLHGCHHTIIPDRIEAGTYMILGAASGGEVTVDNVIPQHLESVTAKLREAGVQVETNDDQITVNGDRRLKVVDIKTLVYPGFPTDLQQPFTTLLTKAHGTGVVTDTIYGARFKHIDELRRMNAQIKVEGRSAIVTGPVLLQGAKVKASDLRAGAALVIAGLMADGITEVTGLEHIDRGYENIVDKLKGLGANIWREQMTKQEIEEMKNA
>NC_018491.1|WP_000442334.1|1763390_1764356_+|class-II-fructose-bisphosphatase
MERSLSMELVRVTEAAALSSARWMGRGKKDEADGAATSAMRDVFDTIPMKGTVVIGEGEMDEAPMLYIGEKLGTGYGPRVDVAVDPLEGTNIVAAGGWNALAVIAIADHGNLLHAPDMYMDKIAVGPEAVGAVDIDAPIIDNLRAVAKAKNKDIEDVVATVLNRPRHQAIIEEIRKAGARIKLINDGDVAGAINTAFDRTGVDILFGSGGAPEGVLAAVALKCLGGEIHGKLLPQNEAELARCKKMGIDDINRILRMEDLVKGDDAIFAATGVTDGELLRGVQFKGSVGTTQSLVMRAKSGTVRFVDGRHSLNKKPNLVIK
>NC_018491.1|WP_001053898.1|1764634_1765906_+|transcription-termination-factor-Rho
MNLSIAALENMKLKELYELAKEFKISYYSKLTKKELIFAILKARAEKEGFFFMEGVLEIIQSEGFGFLRPINYSPSSEDIYISASQIRRFDLRNGDKVSGKVRPPKENERYFGLLQVEAVNGDDPESAKERVHFPALTPLYPDRQMKLETEPKKLPTRIMDLIAPVGFGQRGLIVAPPKAGKTSLLKEIAHSVTTNHPEAELIVLLIDERPEEVTDIERSVKGDVVSSTFDEVPENHIKVAELVLERAMRLVEHKKDVIILMDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGAARNIEEGGSLTILATALVDTGSRMDDVIYEEFKGTGNMELHLDRSLAERRIFPAIDIRRSGTRKEDLLIPKEHLDKLWGIRKTMRDTPDFVEGFLRKLRQTKTNEEFLQNIVADSKRYVTTK
>NC_018491.1|WP_000643437.1|1766428_1766674_+|type-B-50S-ribosomal-protein-L31
MKAGIHPDYKKVVFMDTNTGFKFLSGSTRGSNETVEWEDGNTYPLLKVEISSDSHPFYTGRQKFATADGRVDRFNKKYGLK
>NC_018491.1|WP_000280862.1|1766782_1767370_+|thymidine-kinase
MYLINQNGWIEVICGSMFSGKSEELIRRVRRTQFAKQHAIVFKPCIDNRYSEEDVVSHNGLKVKAVPVSASKDIFEHITEEMDVIAIDEVQFFDGDIVEVVQVLANRGYRVIVAGLDQDFRGLPFGQVPQLMAIAEHVTKLQAVCSACGSPASRTQRLIDGEPAAFDDPIILVGASESYEPRCRHCHAVPTNKDK
>NC_018491.1|WP_000887065.1|1767639_1768707_+|peptide-chain-release-factor-1
MLDRLQAVENRYEKLNELLSDPAIISDSNKLREYSKEQSDIQETVEVYREYKDVREQLKDAKAMLEDKLDAEMREMVKEEVSELESQEKTLSERLKILLVPKDPNDDKNVIVEVRGAAGGDEAALFAGDLYRMYSRYAEVQGWKTEIIEASYTELGGYKEIIFMINGKGAFAKLKFENGAHRVQRVPETESGGRIHTSTATVAVLPEAEEVEIDIHEKDVRVDTFASSGPGGQSVNTTMSAVRLTHLPTGVVVSCQDEKSQIKNKEKAMKVLRARVYDKFRQEAQAEYDQNRKQAVGTGDRSERIRTYNFPQNRVTDHRIGLTIQKLDQILQGKLDDFINALVMEDQAQRMEAAE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_018491_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_018491_2

3281302-3282606

Orphan

Consensus_repeat	Method
CTTGAGGTCCAGTNGCNCCNGTAGCNC	CRT

26 spacers

The CRISPR arrays of NC_018491_2

>merge|NC_018491|2|3281302-3282606|CRT
CTTGAGGTCCAGTGGCACCAGTAGCACCTGTGTTACCTTGAACGCCTTGAGGTCCAGTGGCACCAGTAGCCCCTGTGTTACCTTGAGCACCCTGAGGTCCAGTAGCGCCGGTAGCGCCCGTGTTACCTTGAGCACCCTGAGGTCCAGTAGCGCCCGCTGGCCCTTGAGCACCTTGAGGTCCAGTGGCACCAGTAGCCCCCGTGTTACCTTGAGGTCCAGTGGCACCAGTAGCCCCTGTGTTACCTTGAACGCCTTGAGGTCCAGTGGCACCAGTAGCGCCTGTGTTACCTTGAACGCCTTGAGGTCCAGTAGCGCCAGTAGCCCCTGTGTTACCTTGAACGCCTTGAGGTCCAGTGGCACCGGTAGCGCCCGCCGGCCCTTGAGCACCTTGAGGTCCAGTGGCACCAGTAGCGCCTGTGTTACCTTGAACGCCTTGAGGTCCAGTGGCACCAGTAGCGCCTGTGTTACCTTGAATGCCCTGAGGTCCAGTAGCGCCCGTGTTACCTCGAGGTCCGGTAGCGCCGGTAGCCCCCGCCGGTCCTTGAATACCTTGAGGTCCAGTAGCGCCGGTAGCACCTGTGTTACCTTGAACGCCTTGAGGTCCAGTAGCACCAGTAGCCCCCGCCGGCCCTTGAACGCCTTGAGGTCCAGTAGCGCCGGTAGCCCCCGTGTTACCTTGAGCACCCTGAGGTCCAGTAGCACCGGTAGCCCCCGCCGGTCCTTGAACGCCTTGAGGTCCAGTAGCGCCAGTAGCACCCGCCGGCCCTTGAGCACCTTGAGGTCCAGTAGCGCCGGTAGCGCCCGTGTTACCTTGAACGCCTTGAGGTCCAGTGGCACCGGTAGCCCCCGTGTTACCTTGAGCACCCTGAGGTCCAGTAGCGCCGGTAGCACCTGTGTTACCTTGAACGCCTTGAGGTCCAGTAGCGCCGGTAGCACCTGCTGGTCCTTGAATACCTTGAGGTCCAGTGGCGCCAGTAGCCCCCGTGTTACCTTGAATGCCCTGAGGTCCAGTAGCGCCCGTGTTACCTCGAGGTCCAGTAGCGCCGGTAGCACCTGTGTTACCTTGAACGCCTTGAGGTCCAGTAGCGCCGGTAGCCCCTGCTGGTCCTTGAATACCTTGAGGTCCAGTGGCGCCAGTAGCCCCCGTGTTACCTTGAATGCCCTGAGGTCCAGTAGCGCCCGTGTTACCTCGAGGTCCGGTAGCGCCGGTAGCCCCCGCCGGTCCTTGAATACCTTGAGGTCCAGTAGCGCCAGTAGCACCTGTATTACCTTGAGGTCCTTGAGGTCCAGTAGGTCCAGGAGGCC

>NC_018491|2|2|3281302-3282606|CRT
CTTGAGGTCCAGTGGCACCAGTAGCAC	CTGTGTTACCTTGAACGC
CTTGAGGTCCAGTGGCACCAGTAGCCC	CTGTGTTACCTTGAGCAC
CCTGAGGTCCAGTAGCGCCGGTAGCGC	CCGTGTTACCTTGAGCAC
CCTGAGGTCCAGTAGCGCCCGCTGGCC	CTTGAGCACCTTGAGGTCCAGTGGCACCAGTAGCCCCCGTGTTAC
CTTGAGGTCCAGTGGCACCAGTAGCCC	CTGTGTTACCTTGAACGC
CTTGAGGTCCAGTGGCACCAGTAGCGC	CTGTGTTACCTTGAACGC
CTTGAGGTCCAGTAGCGCCAGTAGCCC	CTGTGTTACCTTGAACGC
CTTGAGGTCCAGTGGCACCGGTAGCGC	CCGCCGGCCCTTGAGCAC
CTTGAGGTCCAGTGGCACCAGTAGCGC	CTGTGTTACCTTGAACGC
CTTGAGGTCCAGTGGCACCAGTAGCGC	CTGTGTTACCTTGAATGCCCTGAGGTCCAGTAGCGCCCGTGTTAC
CTCGAGGTCCGGTAGCGCCGGTAGCCC	CCGCCGGTCCTTGAATAC
CTTGAGGTCCAGTAGCGCCGGTAGCAC	CTGTGTTACCTTGAACGC
CTTGAGGTCCAGTAGCACCAGTAGCCC	CCGCCGGCCCTTGAACGC
CTTGAGGTCCAGTAGCGCCGGTAGCCC	CCGTGTTACCTTGAGCAC
CCTGAGGTCCAGTAGCACCGGTAGCCC	CCGCCGGTCCTTGAACGC
CTTGAGGTCCAGTAGCGCCAGTAGCAC	CCGCCGGCCCTTGAGCAC
CTTGAGGTCCAGTAGCGCCGGTAGCGC	CCGTGTTACCTTGAACGC
CTTGAGGTCCAGTGGCACCGGTAGCCC	CCGTGTTACCTTGAGCAC
CCTGAGGTCCAGTAGCGCCGGTAGCAC	CTGTGTTACCTTGAACGC
CTTGAGGTCCAGTAGCGCCGGTAGCAC	CTGCTGGTCCTTGAATAC
CTTGAGGTCCAGTGGCGCCAGTAGCCC	CCGTGTTACCTTGAATGCCCTGAGGTCCAGTAGCGCCCGTGTTAC
CTCGAGGTCCAGTAGCGCCGGTAGCAC	CTGTGTTACCTTGAACGC
CTTGAGGTCCAGTAGCGCCGGTAGCCC	CTGCTGGTCCTTGAATAC
CTTGAGGTCCAGTGGCGCCAGTAGCCC	CCGTGTTACCTTGAATGCCCTGAGGTCCAGTAGCGCCCGTGTTAC
CTCGAGGTCCGGTAGCGCCGGTAGCCC	CCGCCGGTCCTTGAATAC
CTTGAGGTCCAGTAGCGCCAGTAGCAC	CTGTATTACCTTGAGGTC
CTTGAGGTCCAGTAGGTCCAGGAGGCC

Protein	Signature genes	Signature genes Name	Protein_function
NC_018491.1\|WP_000814415.1\|3278098_3278344_-\|hypothetical-protein	unknown	unknown	unknown
NC_018491.1\|WP_000460299.1\|3287901_3289173_+\|methionine-gamma-lyase-family-protein	unknown	unknown	gnl\|CDD\|311036
NC_018491.1\|WP_000135330.1\|3289786_3291121_+\|type-I-glutamate--ammonia-ligase	unknown	unknown	gnl\|CDD\|273198
NC_018491.1\|WP_001179079.1\|3271902_3273066_+\|iron-containing-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|341466
NC_018491.1\|WP_000813896.1\|3279500_3279725_+\|RNA-chaperone-Hfq	unknown	unknown	gnl\|CDD\|179001
NC_018491.1\|WP_000312265.1\|3285918_3286542_-\|trimeric-intracellular-cation-channel-family-protein	unknown	unknown	gnl\|CDD\|225415
NC_018491.1\|WP_000391386.1\|3286634_3287909_+\|GTPase-HflX	unknown	unknown	gnl\|CDD\|274455
NC_018491.1\|WP_116733334.1\|3270586_3270925_+\|hypothetical-protein	unknown	unknown	unknown
NC_018491.1\|WP_000957276.1\|3273224_3273977_+\|DeoR/GlpR-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224268
NC_018491.1\|WP_000032389.1\|3291814_3292357_+\|DUF1700-domain-containing-protein	unknown	unknown	gnl\|CDD\|285278
NC_018491.1\|WP_000656779.1\|3289348_3289738_+\|transcriptional-repressor-GlnR	unknown	unknown	gnl\|CDD\|133380
NC_018491.1\|WP_000734633.1\|3277106_3278039_+\|SH3-domain-containing-protein	unknown	unknown	gnl\|CDD\|226112
NC_018491.1\|WP_014893549.1\|3292357_3293164_+\|DUF4097-family-beta-strand-repeat-protein	unknown	unknown	gnl\|CDD\|372574
NC_018491.1\|WP_000438184.1\|3284693_3285650_+\|stage-V-sporulation-protein-K	unknown	unknown	gnl\|CDD\|163057
NC_018491.1\|WP_000450316.1\|3283614_3284580_-\|tyrosine-type-recombinase/integrase	unknown	unknown	gnl\|CDD\|227308
NC_018491.1\|WP_000704644.1\|3274898_3276758_+\|PTS-transporter-subunit-EIIA	unknown	unknown	gnl\|CDD\|236740
NC_018491.1\|WP_000228316.1\|3271243_3271786_+\|DUF420-domain-containing-protein	unknown	unknown	gnl\|CDD\|225204
NC_018491.1\|WP_000504938.1\|3278525_3279479_+\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	unknown	unknown	gnl\|CDD\|234626
NC_018491.1\|WP_000640847.1\|3273973_3274885_+\|1-phosphofructokinase	unknown	unknown	gnl\|CDD\|238570
NC_018491.1\|WP_001102620.1\|3291498_3291822_+\|PadR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224609

Protein	Function_ID	Function_description	E-value
NC_018491.1\|WP_000460299.1\|3287901_3289173_+\|methionine-gamma-lyase-family-protein	gnl\|CDD\|311036	pfam06838, Met_gamma_lyase, Methionine gamma-lyase. This is a putative pyridoxal 5'-phosphate-dependent methionine gamma-lyase enzyme involved in methionine catabolism.	0
NC_018491.1\|WP_000135330.1\|3289786_3291121_+\|type-I-glutamate--ammonia-ligase	gnl\|CDD\|273198	TIGR00653, Glutamine_synthetase, glutamine synthetase, type I. Alternate name: glutamate--ammonia ligase. This model represents the dodecameric form, which can be subdivided into 1-alpha and 1-beta forms. The phylogeny of the 1-alpha and 1-beta forms appears polyphyletic. E. coli, Synechocystis PCC6803, Aquifex aeolicus, and the crenarcheon Sulfolobus acidocaldarius have form 1-beta, while Bacillus subtilis, Thermotoga maritima, and various euryarchaea has form 1-alpha. The 1-beta dodecamer from the crenarcheon Sulfolobus acidocaldarius differs from that in E. coli in that it is not regulated by adenylylation. [Amino acid biosynthesis, Glutamate family].	0
NC_018491.1\|WP_001179079.1\|3271902_3273066_+\|iron-containing-alcohol-dehydrogenase	gnl\|CDD\|341466	cd08187, BDH, Butanol dehydrogenase catalyzes the conversion of butyraldehyde to butanol with the cofactor NAD(P)H being oxidized in the process. The butanol dehydrogenase (BDH) is involved in the final step of the butanol formation pathway in anaerobic micro-organism. Butanol dehydrogenase catalyzes the conversion of butyraldehyde to butanol with the cofactor NAD(P)H being oxidized in the process. Activity in the reverse direction is 50-fold lower than that in the forward direction. The NADH-BDH has higher activity with longer chained aldehydes and is inhibited by metabolites containing an adenine moiety. This protein family belongs to the so-called iron-containing alcohol dehydrogenase superfamily. Since members of this superfamily use different divalent ions, preferentially iron or zinc, it has been suggested to be renamed to family III metal-dependent polyol dehydrogenases. This family also includes E. coli YqhD enzyme, an NADP-dependent dehydrogenase whose activity measurements with several alcohols demonstrate preference for alcohols longer than C3. The active site of YqhD contains a Zn metal, and a modified NADPH cofactor bearing OH groups on the saturated C5 and C6 atoms, possibly due to oxygen stress on the enzyme, which would functionally work under anaerobic conditions.	0
NC_018491.1\|WP_000640847.1\|3273973_3274885_+\|1-phosphofructokinase	gnl\|CDD\|238570	cd01164, FruK_PfkB_like, 1-phosphofructokinase (FruK), minor 6-phosphofructokinase (pfkB) and related sugar kinases. FruK plays an important role in the predominant pathway for fructose utilisation.This group also contains tagatose-6-phophate kinase, an enzyme of the tagatose 6-phosphate pathway, which responsible for breakdown of the galactose moiety during lactose metabolism by bacteria such as L. lactis.	1.49313e-142
NC_018491.1\|WP_000228316.1\|3271243_3271786_+\|DUF420-domain-containing-protein	gnl\|CDD\|225204	COG2322, COG2322, Predicted membrane protein [Function unknown].	1.75148e-56
NC_018491.1\|WP_000391386.1\|3286634_3287909_+\|GTPase-HflX	gnl\|CDD\|274455	TIGR03156, GTP_HflX, GTP-binding protein HflX. This protein family is one of a number of homologous small, well-conserved GTP-binding proteins with pleiotropic effects. Bacterial members are designated HflX, following the naming convention in Escherichia coli where HflX is encoded immediately downstream of the RNA chaperone Hfq, and immediately upstream of HflKC, a membrane-associated protease pair with an important housekeeping function. Over large numbers of other bacterial genomes, the pairing with hfq is more significant than with hflK and hlfC. The gene from Homo sapiens in this family has been named PGPL (pseudoautosomal GTP-binding protein-like). [Unknown function, General].	0
NC_018491.1\|WP_000734633.1\|3277106_3278039_+\|SH3-domain-containing-protein	gnl\|CDD\|226112	COG3584, COG3584, Uncharacterized protein conserved in bacteria [Function unknown].	5.33765e-36
NC_018491.1\|WP_000032389.1\|3291814_3292357_+\|DUF1700-domain-containing-protein	gnl\|CDD\|285278	pfam08006, DUF1700, Protein of unknown function (DUF1700). This family contains many hypothetical bacterial proteins and putative membrane proteins.	2.81152e-83
NC_018491.1\|WP_000656779.1\|3289348_3289738_+\|transcriptional-repressor-GlnR	gnl\|CDD\|133380	cd01105, HTH_GlnR-like, Helix-Turn-Helix DNA binding domain of GlnR-like transcription regulators. Helix-turn-helix (HTH) transcription regulator GlnR and related proteins, N-terminal domain. The GlnR and TnrA (also known as ScgR) proteins have been shown to regulate expression of glutamine synthetase as well as several genes involved in nitrogen metabolism. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain predicted winged HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules.	6.89797e-24
NC_018491.1\|WP_000957276.1\|3273224_3273977_+\|DeoR/GlpR-transcriptional-regulator	gnl\|CDD\|224268	COG1349, GlpR, Transcriptional regulators of sugar metabolism [Transcription / Carbohydrate transport and metabolism].	9.45205e-82
NC_018491.1\|WP_014893549.1\|3292357_3293164_+\|DUF4097-family-beta-strand-repeat-protein	gnl\|CDD\|372574	pfam13349, DUF4097, Putative adhesin. This has a putative all-beta structure with a twenty-residue repeat with a highly conserved repeating GD, gly-asp, motif. It may form part of a bacterial adhesin.	2.92269e-17
NC_018491.1\|WP_000438184.1\|3284693_3285650_+\|stage-V-sporulation-protein-K	gnl\|CDD\|163057	TIGR02881, Stage_V_sporulation_protein_K, stage V sporulation protein K. Members of this protein family are the stage V sporulation protein K (SpoVK), a close homolog of the Rubisco expression protein CbbX (TIGR02880) and a members of the ATPase family associated with various cellular activities (pfam00004). Members are strictly limited to bacterial endospore-forming species, but are not universal in this group and are missing from the Clostridium group. [Cellular processes, Sporulation and germination].	9.21003e-156
NC_018491.1\|WP_000450316.1\|3283614_3284580_-\|tyrosine-type-recombinase/integrase	gnl\|CDD\|227308	COG4974, XerD, Site-specific recombinase XerD [DNA replication, recombination, and repair].	2.26543e-13
NC_018491.1\|WP_000704644.1\|3274898_3276758_+\|PTS-transporter-subunit-EIIA	gnl\|CDD\|236740	PRK10712, PRK10712, PTS system fructose-specific transporter subunits IIBC; Provisional.	3.63454e-142
NC_018491.1\|WP_000312265.1\|3285918_3286542_-\|trimeric-intracellular-cation-channel-family-protein	gnl\|CDD\|225415	COG2860, COG2860, Predicted membrane protein [Function unknown].	7.95315e-60
NC_018491.1\|WP_000504938.1\|3278525_3279479_+\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	gnl\|CDD\|234626	PRK00091, miaA, tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed.	7.25072e-168
NC_018491.1\|WP_000813896.1\|3279500_3279725_+\|RNA-chaperone-Hfq	gnl\|CDD\|179001	PRK00395, hfq, RNA-binding protein Hfq; Provisional.	3.4363e-41
NC_018491.1\|WP_001102620.1\|3291498_3291822_+\|PadR-family-transcriptional-regulator	gnl\|CDD\|224609	COG1695, COG1695, Predicted transcriptional regulators [Transcription].	1.56565e-24

>NC_018491.1|WP_000813896.1|3279500_3279725_+|RNA-chaperone-Hfq
MKQSINIQDQFLNQLRKENTFVTLYLLNGFQLRGLIKGFDNFTVLLETEGKQQLIYKHAISTFVPQKNVSIELE
>NC_018491.1|WP_000504938.1|3278525_3279479_+|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA
MGEVQREKVAVIIGPTAVGKTKLSIDLAKALNGEIISGDSMQIYRTMDIGTAKVTKEEMDGIPHYMVDIKNPEESFSVAEFQERVRKHIREITERGKLPIIVGGTGLYIQSVLFDYQFTDDAGDAIYREQMEKLALEHGVEYVHKKLQEVDPESAERIHANNVRRVIRALEIFHTTGEKMSDQLEKQENELLYDVSLIGLTMDREMLYDRINLRVDIMMEQGLLEEVEGLYNRGIRDCQSIQAIGYKEIYDYFEGRVSLEEAVLQLKTNSRRYAKRQLTWFRNKMDVTWFDVTDGEKTSEILRYIEGKLQLKSNNSK
>NC_018491.1|WP_000814415.1|3278098_3278344_-|hypothetical-protein
MKQSTINFSSLTKDLILATATKEHNCSQEELYFALNCLLRSFHSALQETTLHLENKDTEYIQNQFCSAYKIITGKTIYPFQ
>NC_018491.1|WP_000734633.1|3277106_3278039_+|SH3-domain-containing-protein
MKKLLGIATAAVFGLGIFAGSAKAETIVTTDVLNVRENPTVESKLVGKMLSGNKLDVVNTENGWTKIKLNGQEAFVSAEFTKSTYYVTAGVLNVRAGANTDSEILGKLNKNDVIETTNQVQNEWLQFDYNGKTGYVHVPFLTGTAPVIEKKEVATKEEAPERVNTPVKSNKVVKSKESVKNVESSKPVAKQQSTTKQVAKSNETSAPTSGREITVEATAYTADPSENGSYGGRVLTAMGHDLTANPNMKVIAVDPKVIPLGSKVWVEGYGEAIAGDTGGAIKGNRIDVLVGSDGSANSWGRKSVKVKVIE
>NC_018491.1|WP_000704644.1|3274898_3276758_+|PTS-transporter-subunit-EIIA
MKITELLKRDTVIMNLTASNKEAVIDELVEKLNGANRLNSKAKFKEAILKRESQSTTGIGEGIAIPHAKTKAVKQPAICFGRSVSGINYESLDGQPAHLFFMIAASEGANNTHLETLSRLSTLLMDEGFRKQLLEAKDEEELLRLFDEKENEKEEEEVEVAKPEGNEPYVLAVTACPTGIAHTYMAADSLKAKAAELGIAIKVETNGSTGIKNGLTKEDIERATAIIVAADKQVEMNRFAGKHVIQVPVADGIRKTEKLLNRAVKQDAPIFKGVKEDGKAENTEKENGLGIYKHLMNGVSNMLPFVVGGGILIALAFSFGGIKAEGPLAELFMSIGGGGTGAFLFLVPILAGFIASSIADRPGFMPGVVGGFLAAHANAGFLGGLIAGFLAGYVVLGLKKLFSGLPVQLEGIKPVLLYPVFGLLITGVVMQKVVIPPVVALNEMLTGWLNGLNGTNAILLGLILGAMMAIDMGGPINKAAFTFGIAAIEAKNFGVHSAVMAGGMVPPLAIALATTFFKSKFTEAERKSGLTNYIMGASFITEGAIPFAAADPVRVIVSCVVGSSIAGALSMLFQITLPAPHGGLFVIALVNKPVLYIFSILIGAVVSALMMGIWKKKVK
>NC_018491.1|WP_000640847.1|3273973_3274885_+|1-phosphofructokinase
MIYTVTLNPSIDYVVQVNSLDLGAVNRAEKDMKFPGGKGINVSRVLHRLGVENVALGFTGGFTGRFIKDVLQTEGVITNFIQVSEDTRINVKIKGREETELNGQGPSVTKEQFEQLMKQIESMEQGDCVVLAGSVPASIPTTFYESIAAFGAEKGIRVVVDASGSALQHVVKNKPFLIKPNHHELGELFGVEISTVEDVLPYGRKLVEQGVEHVIVSMAGDGALLFTAEGIYEATIPKGVVINSVGAGDSLVAGFVGRYEQTKDIEKAFQYGVATGSATAFSADLCEKEKVEELLSQVIVTKR
>NC_018491.1|WP_000957276.1|3273224_3273977_+|DeoR/GlpR-transcriptional-regulator
MLTPERHQMILQLVKEQKVVKLQQLVERTESSESTIRRDLAQLEKQRLLKRVHGGAAVLTGKGQEPTMVEKSSKNIQIKQQIAKYAANVVEQGDCIYLDAGSTTFEMIPFLINKDVTVVTNGLMHIEALVENNIRAYLLGGMMKSRTKALIGAMAQESMQKYRFDKCFLGANGVHEQLGFTTPDPEEALLKQMALTLANEGYFLIDESKFSEVAFAKIANVEEANIITNHLEIDLEKYKRQTNVIEADKQ
>NC_018491.1|WP_001179079.1|3271902_3273066_+|iron-containing-alcohol-dehydrogenase
MQNFVFRNPTKLIFGKGQLEQLKTEIPQFGKKVLLVYGGGSIKRNGIYDNVISILKDINAEVFELTGVEPNPRVSTVKKGIQICKDNGVEFILAVGGGSVIDCTKAIAAGSKYDGDVWDIVTKKAFASEALPFGTVLTLAATGSEMNAGSVITNWETNEKYGWGSPVTFPQFSILDPVHTASVPRDQTIYGMVDIMSHVLEQYFHHGTNTELQDRYCESVLKTVIETAPKLLSDLESYEHRETILYCGTMALNGILAMGVKGDWATHNIEHAVSAVHDIPHGGGLAILFPNWMKHVVDENVSRFKQFAIRVFDVETDGKTDREIALEGIEALRQFWTSIEAPVTLSDYAIGENEIDVMADKAMAYGEFGNFKKLNKDDVLSIYKASL
>NC_018491.1|WP_000228316.1|3271243_3271786_+|DUF420-domain-containing-protein
MVDQSTNQKSYAPIVITLSVIVNAIILFLFFGPVGYEGEVHFDVTILPMLNAIFNSFTFVFLLAALYSIIKKNVKMHRGFILAAFTTTLLFCVSYLSYHYLAPATHFGGEGFIKYVYFIILITHIILAAIIVPLALFALVFGFTNQLTRHRKIVRWTMPIWLYVSLSGVIVYLMISPYYQ
>NC_018491.1|WP_116733334.1|3270586_3270925_+|hypothetical-protein
MVKKEGGMTMEDYVLELYNLLYTTEWQDIVSFLGIVFCMKIVIVYMEEQGMFYSFSSPFDMQREPLLNYANVNYEQFPFVIFFMIRFITAIVKKKESDDEECHSTCNIANVF
>NC_018491.1|WP_000450316.1|3283614_3284580_-|tyrosine-type-recombinase/integrase
METTEFHDTIQAFSIFLLNKGRKPSTIKRYVYDIEDFGHWLEKNKKLPSSNIWATLCTKDYEDYFSDLKKNRHYSEKTMHRVFIVLNRMHHFLNIPNPLKNMEMSIQPDRTLRNEDFISSDEEKRLKHIVTSLEGLSEKQRPVRPLLMDRNIAILNLLIDYGLSLQELTALTMHHVHFETNTLSIPATAGVERTITLTSEDKKQLYTYYKSIPEPVRPKYHSNDPLFVAFDFNRGTYRWVYENDAPKGLTEIAIQKMIRLEVSRANLRKGISGQHFRNTYILNLIKKETPESEIIKLAGFKSKISLKRYYQYAENRKNALS
>NC_018491.1|WP_000438184.1|3284693_3285650_+|stage-V-sporulation-protein-K
MEQSMRKKNNNQINIVLNHRKKISLPAAENKTVISSETTTKHEMLQRIEEEMGKLVGMDDIKKIIKEIYAWIYVNKKRQEIGLKSEKQVLHMLFKGNPGTGKTTVARMIGKLLFEMNILSKGHLVEAERADLVGEYIGHTAQKTRDLIKKAMGGILFIDEAYSLARGGEKDFGKEAIDTLVKHMEDKQHGFVLILAGYSREMNHFLSLNPGLQSRFPFIIEFADYSVNQLLEIGKRMYEEREYQLSKEAEWKFRDHLHAVKYSSQITSFSNGRYVRNIVEKSIRTQAMRLLQEDAYDKYDLIGISSSDLMLEEETHST
>NC_018491.1|WP_000312265.1|3285918_3286542_-|trimeric-intracellular-cation-channel-family-protein
MAWEIFSIIGTIAFALSGAIVAMEEDYDIFGVYILGMATAFGGGALRNLLIGYPIVAFWQQDMLFQIALLSMTIIFLFPNKLIRHWKKWENITDAIGLSAFAVQGALYAQKLNLPISATIVAAVLTGIGGGIIRDLLARRKPLVLRADVYAFWTILAGFLIGAQIIVSDWALYTLFILIVCFRMVSIHYKWHLPHRRIDTNERSMHK
>NC_018491.1|WP_000391386.1|3286634_3287909_+|GTPase-HflX
MEEKEKVILVGCQLPQDDDEKFMHSMKELASLAKTARAELLVSTTQKRPKFHPATYIGKGKLEELAMLTEELEPDVIVFNNELTPSQIRNLSSVLDARVIDRTQLILDIFAQRAKSREGKLQVELAQLQYTMPRLMGQGLSLSRLGGGIGTRGPGETKLETDRRHIRSRIDEIKKQLAVVVEHRKRYRERRKDNKVFQVSLIGYTNAGKSTLFNRLTEADTFEENLLFATLDPTTRKMPLPSGYTVLLTDTVGFIQDLPTSLIAAFRSTLEEAGEADVILHVVDSADPNYVGHEKTVKQLLSELEINHIPIITLYNKKDELHQNFIPFPKSDFLMTSAFEENDLLHIKEAIETKMKKEMNRYQVEIPPSEGKLLTLLKTETLLTKMEFLEDKFVYDCAGYIFAHSSLNVQLKRFLVEEGENKNV
>NC_018491.1|WP_000460299.1|3287901_3289173_+|methionine-gamma-lyase-family-protein
MFDRLKNGEKIAPIVKEVESQITEVHKRADEVIESNQFRVLESFRKHKISDSHFIPTTGYGYDDIGRDTLEKVYADVFGAEAGLVRPQIISGTHAISTALFGILRPGDELLYITGKPYDTLEEIVGVRGKGVGSFKEYNIGYNAVPLTEEGLVDFRAVAAAIHSNTKMIGIQRSKGYATRPSFTISQIKEMIAFVKEIKSDVVVFVDNCYGEFIEEQEPCHVGADLMAGSLIKNPGGGIVKTGGYIVGKEQYVEACAYRLTSPGIGAEAGASLYSLQEMYQGFFLAPHVAGQALKGAIFTAAFLEKLGMNTSPAWNAPRTDLIQSVQFDDKDRMIAFCQAIQYASPINSHFTPYANYMPGYEDDVIMAAGTFIQGASIELSADGPIRPPYVAYVQGGLTYSHVKIAICSAIDALIEKELLTIS
>NC_018491.1|WP_000656779.1|3289348_3289738_+|transcriptional-repressor-GlnR
MKEDRRSAPLFPIGIVMDLTQLSARQIRYYEEHNLISPTRTKGNRRLFSFNDVDKLLEIKDLLDQGLNMAGIKQVLLMKENQTEAVKVKEETKEISKTELRKILRDELQHTGRFNRTSLRQGDISRFFH
>NC_018491.1|WP_000135330.1|3289786_3291121_+|type-I-glutamate--ammonia-ligase
MARYTKEDIFRLAKEENVKYIRLQFTDLLGVIKNVEIPVSQLTKALDNKMMFDGSSIEGFVRIEESDMYLYPDLDTWVIFPWTAEKGKVARLICDIYNADGTPFEGDPRNNLKRVLKEMEALGFSDFNLGPEPEFFLFKVDEKGNPTLELNDNGGYFDLAPMDLGENCRRDIVLELEEMGFEIEASHHEVAPGQHEIDFKYANAIRSCDDIQTFKLVVKTIARKHGLHATFMPKPLYGVNGSGMHCNLSLFKNGENVFYDQNGDLQLSDDARHFIAGILKHAPAFTAVANPTVNSYKRLVPGYEAPCYVAWSAQNRSPLVRIPASRGISTRVEVRSVDPAANPYLVMATLLAAGLDGIKNKLTPPAAVDRNIYVMTKEEREEAGIVDLPATLAQALVTLQSNEVISNALGDHLLEHFIEAKEIEWDIFRTQVHQWERDQYMSLY
>NC_018491.1|WP_001102620.1|3291498_3291822_+|PadR-family-transcriptional-regulator
MNVQFKKGVLELCVLALVKRKDCYGYELVQQISNKFLISEGSVYPLLRRLTKEGYFQTYLKESTEGPPRKYYQLTEQGETQLNLLVTEWRDFAKGVQEIIEGVEWDE
>NC_018491.1|WP_000032389.1|3291814_3292357_+|DUF1700-domain-containing-protein
MSKEQFLKELSSHLRKLPDEERKDILFDYEEHFQFGIEEEKTESEIIKGLGSPKVIAKELLAMYRFDEMKKDPSTSNVTRAVMAAIGLSLFNFIIVLGPLVAIIAFIFSFWVGGIASVVTPFFVIGKVFMGTFIWLDLFVSVTFVGVGLLLCIIAYYSTKWFKKLCVRYVIWNFKMIKGE
>NC_018491.1|WP_014893549.1|3292357_3293164_+|DUF4097-family-beta-strand-repeat-protein
MMKKILLVAIACIIIGVIGISQTYEKAVQAAEKGNKEDKIKNETLKNIEVKLDVGDIVVQKSPDASFYVKQSGDARKQEIRITEDGDTLKIIGEREKDASFDFSFYDFRFQTSTLTLLVPERSYQDVKVNSSAGQIEISDVKSDRVSARTLTGEVDLKHVTAKNVEGSTKAGEVNFKKVIGKVTAKTTSGEINILDHDSKYNLEASSTAGDINITLSEKPKDAVITGQSAAGDVTIFNEENKDVTIGNGSKKISGKTAAGDVTIETRS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_018491_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_018491_3

3605582-3605682

Orphan

Consensus_repeat	Method
GGTCCACCTGGAGGGCCAACAGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_018491_3

>merge|NC_018491|3|3605582-3605682|CRISPRCasFinder
GGTCCACCTGGAGGGCCAACAGGAGTTACCGGTCCAGTTGGTCCGTCAAGTGGAGTGACTGGTCCAGCTGGTCCACCCGGTCCACCTGGGGGGCCAACAGG

>NC_018491|3|1|3605582-3605682|CRISPRCasFinder
GGTCCACCTGGAGGGCCAACAGG	AGTTACCGGTCCAGTTGGTCCGTCAAGTGGAGTGACTGGTCCAGCTGGTCCACCC
GGTCCACCTGGGGGGCCAACAGG

Protein	Signature genes	Signature genes Name	Protein_function
NC_018491.1\|WP_000615111.1\|3610281_3610743_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NC_018491.1\|WP_014893584.1\|3601416_3601794_-\|hypothetical-protein	unknown	unknown	unknown
NC_018491.1\|WP_000540475.1\|3617530_3617980_-\|NUDIX-hydrolase	unknown	unknown	gnl\|CDD\|240033
NC_018491.1\|WP_014893586.1\|3603260_3603803_+\|PadR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|378696
NC_018491.1\|WP_000241813.1\|3612343_3613501_-\|1-deoxy-D-xylulose-5-phosphate-reductoisomerase	unknown	unknown	gnl\|CDD\|237107
NC_018491.1\|WP_000613881.1\|3599835_3600249_+\|ATP-synthase-subunit-I	unknown	unknown	gnl\|CDD\|377159
NC_018491.1\|WP_000938438.1\|3600446_3600995_+\|DUF2179-domain-containing-protein	unknown	unknown	gnl\|CDD\|235234
NC_018491.1\|WP_000402270.1\|3598454_3599783_+\|HlyC/CorC-family-transporter	unknown	unknown	gnl\|CDD\|224173
NC_018491.1\|WP_000679189.1\|3603844_3604600_+\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|379312
NC_018491.1\|WP_000845612.1\|3615100_3615664_+\|maltose-O-acetyltransferase	unknown	unknown	gnl\|CDD\|100047
NC_018491.1\|WP_000285644.1\|3597927_3598335_+\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133406
NC_018491.1\|WP_000003054.1\|3616000_3617029_+\|ROK-family-protein	unknown	unknown	gnl\|CDD\|224851
NC_018491.1\|WP_041184588.1\|3596857_3597652_-\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|372681
NC_018491.1\|WP_000539717.1\|3610880_3611129_+\|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein	unknown	unknown	gnl\|CDD\|225170
NC_018491.1\|WP_000747688.1\|3601100_3601340_-\|DUF3923-family-protein	unknown	unknown	gnl\|CDD\|289806
NC_018491.1\|WP_000687577.1\|3617090_3617471_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|319905
NC_018491.1\|WP_001280789.1\|3613891_3614890_+\|tryptophan--tRNA-ligase	unknown	unknown	gnl\|CDD\|183592
NC_018491.1\|WP_014893585.1\|3601960_3603148_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340887
NC_018491.1\|WP_041184509.1\|3607275_3609789_+\|collagen-like-protein	unknown	unknown	gnl\|CDD\|367362
NC_018491.1\|WP_000416969.1\|3611192_3612314_+\|AI-2E-family-transporter	unknown	unknown	gnl\|CDD\|223701

Protein	Function_ID	Function_description	E-value
NC_018491.1\|WP_000615111.1\|3610281_3610743_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	3.98391e-13
NC_018491.1\|WP_000540475.1\|3617530_3617980_-\|NUDIX-hydrolase	gnl\|CDD\|240033	cd04677, Nudix_Hydrolase_18, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.	2.70311e-58
NC_018491.1\|WP_014893586.1\|3603260_3603803_+\|PadR-family-transcriptional-regulator	gnl\|CDD\|378696	pfam11706, zf-CGNR, CGNR zinc finger. This family consists of a C-terminal zinc finger domain. It seems likely to be DNA-binding given the conservation of many positively charged residues. The domain is named after a highly conserved motif found in many members of the family.	1.1888e-17
NC_018491.1\|WP_000241813.1\|3612343_3613501_-\|1-deoxy-D-xylulose-5-phosphate-reductoisomerase	gnl\|CDD\|237107	PRK12464, PRK12464, 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provisional.	0
NC_018491.1\|WP_000613881.1\|3599835_3600249_+\|ATP-synthase-subunit-I	gnl\|CDD\|377159	pfam03899, ATP-synt_I, ATP synthase I chain. The atp operon of alkaliphilic Bacillus pseudofirmus OF4, as in most prokaryotes, contains the eight structural genes for the F-ATPase (ATP synthase), which are preceded by an atpI gene that encodes a membrane protein with 2 TMSs. A tenth gene, atpZ, has been found in this operon, which is upstream of and overlapping with atpI. AtpI is a Ca2+/Mg2+ transporter.	2.02374e-07
NC_018491.1\|WP_000938438.1\|3600446_3600995_+\|DUF2179-domain-containing-protein	gnl\|CDD\|235234	PRK04164, PRK04164, hypothetical protein; Provisional.	6.88941e-83
NC_018491.1\|WP_000402270.1\|3598454_3599783_+\|HlyC/CorC-family-transporter	gnl\|CDD\|224173	COG1253, TlyC, Hemolysins and related proteins containing CBS domains [General function prediction only].	1.63691e-160
NC_018491.1\|WP_000679189.1\|3603844_3604600_+\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	2.44858e-23
NC_018491.1\|WP_000845612.1\|3615100_3615664_+\|maltose-O-acetyltransferase	gnl\|CDD\|100047	cd03357, LbH_MAT_GAT, Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates. MAT acetylates maltose and glucose exclusively at the C6 position of the nonreducing end glucosyl moiety. GAT specifically acetylates galactopyranosides. Furthermore, MAT shows higher affinity toward artificial substrates containing an alkyl or hydrophobic chain as well as a glucosyl unit. Active MAT and GAT are homotrimers, with each subunit consisting of an N-terminal alpha-helical region and a C-terminal left-handed parallel alpha-helix (LbH) subdomain with 6 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X).	1.23722e-100
NC_018491.1\|WP_000285644.1\|3597927_3598335_+\|MerR-family-transcriptional-regulator	gnl\|CDD\|133406	cd04779, HTH_MerR-like_sg4, Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily. Putative helix-turn-helix (HTH) MerR-like transcription regulators (subgroup 4). Based on sequence similarity, these proteins are predicted to function as transcription regulators that mediate responses to stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.	7.57424e-62
NC_018491.1\|WP_000003054.1\|3616000_3617029_+\|ROK-family-protein	gnl\|CDD\|224851	COG1940, NagC, Transcriptional regulator/sugar kinase [Transcription / Carbohydrate transport and metabolism].	5.95403e-24
NC_018491.1\|WP_041184588.1\|3596857_3597652_-\|glycosyltransferase-family-2-protein	gnl\|CDD\|372681	pfam13704, Glyco_tranf_2_4, Glycosyl transferase family 2. Members of this family of prokaryotic proteins include putative glucosyltransferases,.	1.15985e-09
NC_018491.1\|WP_000539717.1\|3610880_3611129_+\|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein	gnl\|CDD\|225170	COG2261, COG2261, Predicted membrane protein [Function unknown].	2.66615e-09
NC_018491.1\|WP_000747688.1\|3601100_3601340_-\|DUF3923-family-protein	gnl\|CDD\|289806	pfam13061, DUF3923, Protein of unknown function (DUF3923). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 80 amino acids in length.	6.40735e-12
NC_018491.1\|WP_000687577.1\|3617090_3617471_+\|hypothetical-protein	gnl\|CDD\|319905	cd07241, VOC_BsYyaH, vicinal oxygen chelate (VOC) family protein similar to Bacillus subtilis YyaH. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	3.02997e-64
NC_018491.1\|WP_001280789.1\|3613891_3614890_+\|tryptophan--tRNA-ligase	gnl\|CDD\|183592	PRK12556, PRK12556, tryptophanyl-tRNA synthetase; Provisional.	0
NC_018491.1\|WP_014893585.1\|3601960_3603148_-\|MFS-transporter	gnl\|CDD\|340887	cd17329, MFS_MdtH_MDR_like, Multidrug resistance protein MdtH and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This family is composed of Escherichia coli MdtH and similar multidrug resistance (MDR) transporters from bacteria and archaea, many of which remain uncharacterized. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. MdtH confers resistance to norfloxacin and enoxacin. MdtH-like MDR transporters belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.0102e-70
NC_018491.1\|WP_041184509.1\|3607275_3609789_+\|collagen-like-protein	gnl\|CDD\|367362	pfam03157, Glutenin_hmw, High molecular weight glutenin subunit. Members of this family include high molecular weight subunits of glutenin. This group of gluten proteins is thought to be largely responsible for the elastic properties of gluten, and hence, doughs. Indeed, glutenin high molecular weight subunits are classified as elastomeric proteins, because the glutenin network can withstand significant deformations without breaking, and return to the original conformation when the stress is removed. Elastomeric proteins differ considerably in amino acid sequence, but they are all polymers whose subunits consist of elastomeric domains, composed of repeated motifs, and non-elastic domains that mediate cross-linking between the subunits. The elastomeric domain motifs are all rich in glycine residues in addition to other hydrophobic residues. High molecular weight glutenin subunits have an extensive central elastomeric domain, flanked by two terminal non-elastic domains that form disulphide cross-links. The central elastomeric domain is characterized by the following three repeated motifs: PGQGQQ, GYYPTS[P/L]QQ, GQQ. It possesses overlapping beta-turns within and between the repeated motifs, and assumes a regular helical secondary structure with a diameter of approx. 1.9 nm and a pitch of approx. 1.5 nm.	3.77355e-07
NC_018491.1\|WP_000416969.1\|3611192_3612314_+\|AI-2E-family-transporter	gnl\|CDD\|223701	COG0628, yhhT, Predicted permease, member of the PurR regulon [General function prediction only].	1.80374e-58

>NC_018491.1|WP_000679189.1|3603844_3604600_+|class-I-SAM-dependent-methyltransferase
MKGTQMLALNKKCWDTVAPYFFQVDCLPKYGPYTASEDEIHLFDSIKGKKVLDIGCGSGHSLQYMAEHGAEELWGLDLSSTQIETAHKTLQSWNPKLICGAMEEEVDIPKGYFDIVYSIYALGWTSDLRKTLELIYSYVKPGGSFVFSWEHPVYSNLMYGTEEIAFSSSYHEETPITFETFKGEDVQATLYKRKISTYINELHRAGFTIERIEEPEPSSSFDEELAEPSPKYYSLHKARMVPTTFIIKARK
>NC_018491.1|WP_014893586.1|3603260_3603803_+|PadR-family-transcriptional-regulator
MSQNAPNELEYIREFLNTWRIPNDTREAIDLLQTEEDIKLFMKEYFHEEFTFHTIEELKSFREDIRAAIEGEGSLQKWLEKYPFHVHVMEDMKGITYEPIHEETVYTKVLSIVLIAVQENLWGRLKACPDCRWVFYDNSRNGSKRWCGMYAGEEGGRACGTIAKVKNYRAKRKGRSGYNV
>NC_018491.1|WP_014893585.1|3601960_3603148_-|MFS-transporter
MKSFSIPIRFMLISSFFMSFGYFAVYAFLAIYLLSFLHFSTFQVGTVLTVIIITSRVIPLFSGLIADKIGYIIMMIAGLFLRGIGFIALGICSDFYTVSISSALIGFGTAFYEPAARAIFGSQPAHLRKNLFTYLNLSFNCGAIIGPIAGGFLLLLDPIYAFSLTGSLMLIFALIFYLLKNHFQVTTENTSITLGIQTILQNKSFLLFSLIMIFFYIMFTQLTVALPLHMKNISNSNQLATLVITINAITGVIFMVLFRKLFHKYNTLSFIKYGILLMSISFLLIPLFQHPYWLFICVIFFTIGETLVLPNADIAIANYSNESYTATFFGFYQLSLAFGFIIGNYTGTWFKSKLNGMYTPWLIFGGIGLIGFISLHILNIKKERSKEDIYLLEKY
>NC_018491.1|WP_014893584.1|3601416_3601794_-|hypothetical-protein
MKKKLIVLLFTGIILSGCSAIAENSLETGNGSMALLTPTITTKDNELEIKTEGIDENKVTFIYVANKKVLEQKLKNGESYKLNIKDIEHAHRTDYKPKVQLLQTKDDNDDGEIVTFKQVRYTVKN
>NC_018491.1|WP_000747688.1|3601100_3601340_-|DUF3923-family-protein
MKKRWISWWIGNLFWIIIFGIWAAIIWLREVDGAGVIQTPEIKSISLIVILIAFIIPVFFQVIWLIINLRMSRKNNYTI
>NC_018491.1|WP_000938438.1|3600446_3600995_+|DUF2179-domain-containing-protein
MLQALLIFVLQIIYVPILTIRTILLVKNQTRSAAGVGLLEGAIYIVSLGIVFQDLSNWMNIVAYVIGFSAGLLLGGYIENKLAIGYITYQVSLLDRCNELVDELRHSGFGVTVFEGEGINSIRYRLDIVAKRSREKELLEIINEIAPKAFMSSYEIRSFKGGYLTKAMKKRALMKKKDEHAS
>NC_018491.1|WP_000613881.1|3599835_3600249_+|ATP-synthase-subunit-I
MIQEALRVYRLQLYVIFSGLLLMWTITPFGKQVTGFGIGLAVSAYCLWLLARRVEKLGKSIVMKERAPGLGVLNRFAAAILGAIIMYEIEHEMEMWAFGTGILGGHFLMIANLAYANMQLVKEEEKKRERTSKNIEL
>NC_018491.1|WP_000402270.1|3598454_3599783_+|HlyC/CorC-family-transporter
MEIFNLVMVAILIAFTGFFVAAEFAIVKVRSSRIDQLVAEGKRGALAAKKVTTNLDEYLSACQLGITVTAMGLGWLGEPTIEKLLHPLFEKWNLNPSISSVLTFGLAFMIMTYLHVVVGELAPKTMAIQKAERVTLLLAGPLMMFYKVMYPFIWVLNGSARVVTGLFGLKPASEHEVAHTEEELRLILSDSYESGEINQAEYKYVNNIFEFDNRIAKEIMVPRTEIIGFYLEDSVEEHMKVIQNERYTRYPIFGEDKDDIIGMVNVKDFFIRYMTEDQKDLSSIRSYMRPIIEVMETTPIHDLLLQMQKKRIPMAVLYDEYGGTAGIVTLEDILEEIVGEIRDEYDEDEAPPIQHVNEQHIIVDGKVLISEVKDLFGLHIEEDDVDTIGGWIMMQNHEIEEGQHVEAEGYEFKVLEKDAYQIKRVEIRKMEQEQEEEKAATV
>NC_018491.1|WP_000285644.1|3597927_3598335_+|MerR-family-transcriptional-regulator
MYRIGQLALMAHVSKRTIDYYTNLGILKAERSQSNYRYYDETAVETLQFIEKCKEMHMPLCEIKEKIEEKKKLLGINEHVSKQVNEVTDHIHRLEAELTELKPLLDGLTDSQREKISKSLSGQTTALIQTLALLL
>NC_018491.1|WP_041184588.1|3596857_3597652_-|glycosyltransferase-family-2-protein
MQLEEIKITRTVISHFYNEEYLLPWWLMHHTKIFDHGILINRGSTDRSVEICKLFAPHWEVRDSRFLEFDPTNTDIEVMEIEREVSGWKMVLNTTEFLCCNNVEEFFSSLHTLGQNMYAIRMIVMIDKHDYNYSKLRYSIPLIEQRYHGLFPYKPEIGCAWRFIHNHLDGAYLPGRHFTRHQPIVYNSPSFIVKFYFSPWNEHTKARKLQIIPTLSKKGIQMGLQSHYGQSLEQIETRFLEFSSLTQDLRKHPEYQQLFPKFKP
>NC_018491.1|WP_041184509.1|3607275_3609789_+|collagen-like-protein
MLVKDQDKCSKFQAPIPFLPSGITGPTGPTGPTGSLGGPTGPQGIQGVQGPIGPTGPTGIQGVQGVQGENGPTGPTGLTGPQGSQGNQGPMGERGPQGIQGVQGIQGEIGPTGPTGIQGIQGIPGAIGPTGPTGIQGVQGVQGEIGPTGPTGIQGIQGIQGEVGPTGPTGNTGIQGVQGNLGSGGLQGVTGIQGIQGPIGPTGPTGSQGIQGEQGPMGPTGATGVQGLQGPQGEMGLTGPTGFQGIQGVQGVIGPTGPTGLQGDPGPTGSTGPTGVTGATGSATGPTGATGPTGPPGGPTGPTGPAGSPGGPTGPTGATGATGATGATGATGIQGVQGVQGPTGATGLTGLQGVQGPMGATGPTGDQGIQGPQGVMGVTGPTGLQGLQGIQGPVGATGPTGPQGVQGAQGPIGQAGPQGIQGIQGEQGVRGATGPTGLQGLQGIQGIQGPTGPQGIQGVQGPSGITGPTGPQGIQGIQGPQGNIGPTGPQGIQGVQGPQGPTGPTGATGPQGIQGIQGPQGVTGPQGIQGIQGIQGVIGPTGPTGPQGIQGITGSTGPTGATGATGPTGVTGPQGPQGIQGPQGVTGQAGATGATGATGPQGVQGIQGPQGITGPTGATGVTGITGPQGIQGIQGPQGVTGATGATGATGATGATGPTGIQGIQGITGATGATGVTGPTGATGPTGLTGATGSSAISTGGGYFFSTSTSAIAANANIPINSGSTVYGTGVSLTSATTVTVSTPGIYLVSYYFQGDASGGNETVSVRLLLNGAQLTGSFIQNVTTSTVVIEPAISNTLLVNVTSANSTLILQNGPLGVGHVTTIAGAITASLNVVRIL
>NC_018491.1|WP_000615111.1|3610281_3610743_-|GNAT-family-N-acetyltransferase
MIQKLITTSHKTATSILSIQIPAYEIEAKYINSTAIPRLYDTVADIQSCDEIFYGYFFEDTLAGFISFKMDEEEVDIHRLVVSPDHFHKGIATKLLLYVFDMFSPSKTYIVQTGKENTPALSLYKKHGFIAVKEIILPDGVVLTSLKKSENNK
>NC_018491.1|WP_000539717.1|3610880_3611129_+|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein
MGWIITLIVGAIIGAIAGSITGKDFPAGMFGNIIAGLLGAWLGGKLFGDWGPSLGGIHIVPALLGSIVLVLIVSFVVKAARK
>NC_018491.1|WP_000416969.1|3611192_3612314_+|AI-2E-family-transporter
MEKVSLRKRDKLKKFFREHNYLAVLLGFALLFINILLLTKISFVFTPFIVFLKTIFFPVLLAGVLFYILHPFVSLLEKKGVSRIVSIASIYLIVIGLFVFLVLTVIPIIKDQIDALIDNLPYFGHEIERAARRFGESNLLGKIQENLNIDVASMVKDYTVDFTKSLSSVTGNVTGFLSTITEVVLTFVMVPFILFYLLKDGEQLPNHFLKFISEQRRPAAMRILDDMHYAISSYIRGQIIVSLFIGIMLLIGYLIIGIKYAVLLAILAMIVNIVPYVGPIIAITPALIIAFIDSPGMVLKVIIVMMVVQLAEGKFISPQVMGKKLDIHPITIIFIILTAGNLFGIMGIILAIPGYAILKVLVTHGYRFVKLNT
>NC_018491.1|WP_000241813.1|3612343_3613501_-|1-deoxy-D-xylulose-5-phosphate-reductoisomerase
MVKYISILGSTGSIGTSALDVVSAHPEHFKIVGLTANYNIELLEQQIKTFQPRIVSVATKELADTLRTRISTNVKITYGTDGLIAVATHPDSNLVLSSVVGVSGLLPTIEALKAKKDIAIANKETLVAAGHIVTELAKQNGCRLIPVDSEHSAIFQCLNGENNKEIDKLIVTASGGAFRDKTREEMNTLQAKDALKHPNWLMGAKLTIDSATLMNKGFEVMEARWLFDIPYEKIDVMIHKESIIHSLVEFIDGSVIAQLGAPDMRMPIQYAFHYPTRLPSSYEKLNLLEIGSLHFEKPDLEKFPCLQYAYECGKIGGTTPAVLNAANEIANALFLKNETAFFDIEKTIYKTVEAHHNVKDPSLDAILEADQWARQYAHQLLIKKS
>NC_018491.1|WP_001280789.1|3613891_3614890_+|tryptophan--tRNA-ligase
MSDKIMLTGIKPTGYPHLGNYIGAIKPALQMSKKNEGKALYFIADYHALNAVHDPSQFSSYTKEVAATWLSLGLGEDVIFYRQTEVPEILELAWILACLTPKGLMNRAHAYKAKVEQNKEAGLEVDAGVNMGLYTYPILMAADILLFQATHVPVGKDQIQHIEIARDIATYVNHTFGTTFTLPEYVIQEEGAILPGLDGRKMSKSYGNVIPLFAEKEKLRKLIFKIKTDSSLPNEPKELETLFTIYKEFATEDEMQSMREKYETGIGWGDVKKELFRVVDRELAGPREKYAMYMNEPNLLYESLEEGAEKARAIAKVNLAEIKKRIGFEGGR
>NC_018491.1|WP_000845612.1|3615100_3615664_+|maltose-O-acetyltransferase
MKTEKEKMLAGEMYIADDEELVADRVEAKRLTRLYNEAMETGDERRFTLLNQLLGSSADGKAQINPDFRCDYGYNIHVGKSFFANFNCVILDVCEVRIGDHCMFAPGVHIYTATHPLHPVERNSGKEYGKPVKIGNNVWVGGGAIINPGVSIGDNAVIASGAVVTKDVPNNVVVGGNPAKVIKTIDL
>NC_018491.1|WP_000003054.1|3616000_3617029_+|ROK-family-protein
MSEQFVTQKSIKETILRSIRKVLLERGSATKVELSNTLEISFPTISKFIEKMKQDGEVTLAGLDDSSGGRRAKRYEYNPEYMLGLAIFLERNETNYTIFNCLGEVKEQGSTSSMLIDTGVNVLSKHIEGLITTFPKISSISIGVPGSVDNGRIFYIPGYEKFQNFNLKSHLEEQFSIPVVIENDMNAAVLGYHKNTGNNENSSLVYLYSGQNGPGAGIMVNGDVVRGSTFFSGEISFVPQYDNKNFLQALRSEDSNNPEEYNIDAITRLIATCIAIINPHAFIFCDDEVNQFVIDQIVKTCPQYIPAEHIPKITVSNWKEDYLYGLKSLGLDLMITRTNKEN
>NC_018491.1|WP_000687577.1|3617090_3617471_+|hypothetical-protein
MKIEHVAIWVNDLVGMRDFYKQYFNGEENSLYHNPKKQFKSYFITFEGGARLELMKRVGIEDALQTETIGYAHIAFSVGSKEKVNELTNTLREAGYAVLNGPRTTGDGYYESVVSDPEGNQIEITI
>NC_018491.1|WP_000540475.1|3617530_3617980_-|NUDIX-hydrolase
MGYIEDMRNLVGNHPLILIGSHAIILNENNEILLQLRTDFNRWGIIGGALEYNETLEDALKREVYEETGLIIKNPELFRTYSGPDFFQIYPNGDQVHGVLVVYICREFHGELVCDQTESKELRFFPLDELPSTLHPVIEGILRDFHHSN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NC_018491_2	2.1\|3281329\|18\|NC_018491\|CRT	3281329-3281346	18	NC_018491.1	3280339-3280356	0	1.0
NC_018491_2	2.1\|3281329\|18\|NC_018491\|CRT	3281329-3281346	18	NC_018491.1	3280519-3280536	0	1.0
NC_018491_2	2.1\|3281329\|18\|NC_018491\|CRT	3281329-3281346	18	NC_018491.1	3280564-3280581	0	1.0
NC_018491_2	2.1\|3281329\|18\|NC_018491\|CRT	3281329-3281346	18	NC_018491.1	3280744-3280761	0	1.0
NC_018491_2	2.1\|3281329\|18\|NC_018491\|CRT	3281329-3281346	18	NC_018491.1	3280789-3280806	0	1.0
NC_018491_2	2.1\|3281329\|18\|NC_018491\|CRT	3281329-3281346	18	NC_018491.1	3280924-3280941	0	1.0
NC_018491_2	2.1\|3281329\|18\|NC_018491\|CRT	3281329-3281346	18	NC_018491.1	3280969-3280986	0	1.0
NC_018491_2	2.1\|3281329\|18\|NC_018491\|CRT	3281329-3281346	18	NC_018491.1	3281014-3281031	0	1.0
NC_018491_2	2.1\|3281329\|18\|NC_018491\|CRT	3281329-3281346	18	NC_018491.1	3281149-3281166	0	1.0
NC_018491_2	2.1\|3281329\|18\|NC_018491\|CRT	3281329-3281346	18	NC_018491.1	3280879-3280896	1	0.944
NC_018491_2	2.1\|3281329\|18\|NC_018491\|CRT	3281329-3281346	18	NC_018491.1	3281104-3281121	1	0.944
NC_018491_2	2.5\|3281536\|18\|NC_018491\|CRT	3281536-3281553	18	NC_018491.1	3280339-3280356	0	1.0
NC_018491_2	2.5\|3281536\|18\|NC_018491\|CRT	3281536-3281553	18	NC_018491.1	3280519-3280536	0	1.0
NC_018491_2	2.5\|3281536\|18\|NC_018491\|CRT	3281536-3281553	18	NC_018491.1	3280564-3280581	0	1.0
NC_018491_2	2.5\|3281536\|18\|NC_018491\|CRT	3281536-3281553	18	NC_018491.1	3280744-3280761	0	1.0
NC_018491_2	2.5\|3281536\|18\|NC_018491\|CRT	3281536-3281553	18	NC_018491.1	3280789-3280806	0	1.0
NC_018491_2	2.5\|3281536\|18\|NC_018491\|CRT	3281536-3281553	18	NC_018491.1	3280924-3280941	0	1.0
NC_018491_2	2.5\|3281536\|18\|NC_018491\|CRT	3281536-3281553	18	NC_018491.1	3280969-3280986	0	1.0
NC_018491_2	2.5\|3281536\|18\|NC_018491\|CRT	3281536-3281553	18	NC_018491.1	3281014-3281031	0	1.0
NC_018491_2	2.5\|3281536\|18\|NC_018491\|CRT	3281536-3281553	18	NC_018491.1	3281149-3281166	0	1.0
NC_018491_2	2.5\|3281536\|18\|NC_018491\|CRT	3281536-3281553	18	NC_018491.1	3280879-3280896	1	0.944
NC_018491_2	2.5\|3281536\|18\|NC_018491\|CRT	3281536-3281553	18	NC_018491.1	3281104-3281121	1	0.944
NC_018491_2	2.6\|3281581\|18\|NC_018491\|CRT	3281581-3281598	18	NC_018491.1	3280339-3280356	0	1.0
NC_018491_2	2.6\|3281581\|18\|NC_018491\|CRT	3281581-3281598	18	NC_018491.1	3280519-3280536	0	1.0
NC_018491_2	2.6\|3281581\|18\|NC_018491\|CRT	3281581-3281598	18	NC_018491.1	3280564-3280581	0	1.0
NC_018491_2	2.6\|3281581\|18\|NC_018491\|CRT	3281581-3281598	18	NC_018491.1	3280744-3280761	0	1.0
NC_018491_2	2.6\|3281581\|18\|NC_018491\|CRT	3281581-3281598	18	NC_018491.1	3280789-3280806	0	1.0
NC_018491_2	2.6\|3281581\|18\|NC_018491\|CRT	3281581-3281598	18	NC_018491.1	3280924-3280941	0	1.0
NC_018491_2	2.6\|3281581\|18\|NC_018491\|CRT	3281581-3281598	18	NC_018491.1	3280969-3280986	0	1.0
NC_018491_2	2.6\|3281581\|18\|NC_018491\|CRT	3281581-3281598	18	NC_018491.1	3281014-3281031	0	1.0
NC_018491_2	2.6\|3281581\|18\|NC_018491\|CRT	3281581-3281598	18	NC_018491.1	3281149-3281166	0	1.0
NC_018491_2	2.6\|3281581\|18\|NC_018491\|CRT	3281581-3281598	18	NC_018491.1	3280879-3280896	1	0.944
NC_018491_2	2.6\|3281581\|18\|NC_018491\|CRT	3281581-3281598	18	NC_018491.1	3281104-3281121	1	0.944
NC_018491_2	2.7\|3281626\|18\|NC_018491\|CRT	3281626-3281643	18	NC_018491.1	3280339-3280356	0	1.0
NC_018491_2	2.7\|3281626\|18\|NC_018491\|CRT	3281626-3281643	18	NC_018491.1	3280519-3280536	0	1.0
NC_018491_2	2.7\|3281626\|18\|NC_018491\|CRT	3281626-3281643	18	NC_018491.1	3280564-3280581	0	1.0
NC_018491_2	2.7\|3281626\|18\|NC_018491\|CRT	3281626-3281643	18	NC_018491.1	3280744-3280761	0	1.0
NC_018491_2	2.7\|3281626\|18\|NC_018491\|CRT	3281626-3281643	18	NC_018491.1	3280789-3280806	0	1.0
NC_018491_2	2.7\|3281626\|18\|NC_018491\|CRT	3281626-3281643	18	NC_018491.1	3280924-3280941	0	1.0
NC_018491_2	2.7\|3281626\|18\|NC_018491\|CRT	3281626-3281643	18	NC_018491.1	3280969-3280986	0	1.0
NC_018491_2	2.7\|3281626\|18\|NC_018491\|CRT	3281626-3281643	18	NC_018491.1	3281014-3281031	0	1.0
NC_018491_2	2.7\|3281626\|18\|NC_018491\|CRT	3281626-3281643	18	NC_018491.1	3281149-3281166	0	1.0
NC_018491_2	2.7\|3281626\|18\|NC_018491\|CRT	3281626-3281643	18	NC_018491.1	3280879-3280896	1	0.944
NC_018491_2	2.7\|3281626\|18\|NC_018491\|CRT	3281626-3281643	18	NC_018491.1	3281104-3281121	1	0.944
NC_018491_2	2.9\|3281716\|18\|NC_018491\|CRT	3281716-3281733	18	NC_018491.1	3280339-3280356	0	1.0
NC_018491_2	2.9\|3281716\|18\|NC_018491\|CRT	3281716-3281733	18	NC_018491.1	3280519-3280536	0	1.0
NC_018491_2	2.9\|3281716\|18\|NC_018491\|CRT	3281716-3281733	18	NC_018491.1	3280564-3280581	0	1.0
NC_018491_2	2.9\|3281716\|18\|NC_018491\|CRT	3281716-3281733	18	NC_018491.1	3280744-3280761	0	1.0
NC_018491_2	2.9\|3281716\|18\|NC_018491\|CRT	3281716-3281733	18	NC_018491.1	3280789-3280806	0	1.0
NC_018491_2	2.9\|3281716\|18\|NC_018491\|CRT	3281716-3281733	18	NC_018491.1	3280924-3280941	0	1.0
NC_018491_2	2.9\|3281716\|18\|NC_018491\|CRT	3281716-3281733	18	NC_018491.1	3280969-3280986	0	1.0
NC_018491_2	2.9\|3281716\|18\|NC_018491\|CRT	3281716-3281733	18	NC_018491.1	3281014-3281031	0	1.0
NC_018491_2	2.9\|3281716\|18\|NC_018491\|CRT	3281716-3281733	18	NC_018491.1	3281149-3281166	0	1.0
NC_018491_2	2.9\|3281716\|18\|NC_018491\|CRT	3281716-3281733	18	NC_018491.1	3280879-3280896	1	0.944
NC_018491_2	2.9\|3281716\|18\|NC_018491\|CRT	3281716-3281733	18	NC_018491.1	3281104-3281121	1	0.944
NC_018491_2	2.11\|3281833\|18\|NC_018491\|CRT	3281833-3281850	18	NC_018491.1	3280609-3280626	1	0.944
NC_018491_2	2.11\|3281833\|18\|NC_018491\|CRT	3281833-3281850	18	NC_018491.1	3280834-3280851	1	0.944
NC_018491_2	2.11\|3281833\|18\|NC_018491\|CRT	3281833-3281850	18	NC_018491.1	3281059-3281076	1	0.944
NC_018491_2	2.12\|3281878\|18\|NC_018491\|CRT	3281878-3281895	18	NC_018491.1	3280339-3280356	0	1.0
NC_018491_2	2.12\|3281878\|18\|NC_018491\|CRT	3281878-3281895	18	NC_018491.1	3280519-3280536	0	1.0
NC_018491_2	2.12\|3281878\|18\|NC_018491\|CRT	3281878-3281895	18	NC_018491.1	3280564-3280581	0	1.0
NC_018491_2	2.12\|3281878\|18\|NC_018491\|CRT	3281878-3281895	18	NC_018491.1	3280744-3280761	0	1.0
NC_018491_2	2.12\|3281878\|18\|NC_018491\|CRT	3281878-3281895	18	NC_018491.1	3280789-3280806	0	1.0
NC_018491_2	2.12\|3281878\|18\|NC_018491\|CRT	3281878-3281895	18	NC_018491.1	3280924-3280941	0	1.0
NC_018491_2	2.12\|3281878\|18\|NC_018491\|CRT	3281878-3281895	18	NC_018491.1	3280969-3280986	0	1.0
NC_018491_2	2.12\|3281878\|18\|NC_018491\|CRT	3281878-3281895	18	NC_018491.1	3281014-3281031	0	1.0
NC_018491_2	2.12\|3281878\|18\|NC_018491\|CRT	3281878-3281895	18	NC_018491.1	3281149-3281166	0	1.0
NC_018491_2	2.12\|3281878\|18\|NC_018491\|CRT	3281878-3281895	18	NC_018491.1	3280879-3280896	1	0.944
NC_018491_2	2.12\|3281878\|18\|NC_018491\|CRT	3281878-3281895	18	NC_018491.1	3281104-3281121	1	0.944
NC_018491_2	2.13\|3281923\|18\|NC_018491\|CRT	3281923-3281940	18	NC_018491.1	3280294-3280311	1	0.944
NC_018491_2	2.13\|3281923\|18\|NC_018491\|CRT	3281923-3281940	18	NC_018491.1	3280654-3280671	1	0.944
NC_018491_2	2.15\|3282013\|18\|NC_018491\|CRT	3282013-3282030	18	NC_018491.1	3280294-3280311	0	1.0
NC_018491_2	2.15\|3282013\|18\|NC_018491\|CRT	3282013-3282030	18	NC_018491.1	3280654-3280671	0	1.0
NC_018491_2	2.15\|3282013\|18\|NC_018491\|CRT	3282013-3282030	18	NC_018491.1	192434-192451	1	0.944
NC_018491_2	2.15\|3282013\|18\|NC_018491\|CRT	3282013-3282030	18	NC_018491.1	192695-192712	1	0.944
NC_018491_2	2.19\|3282193\|18\|NC_018491\|CRT	3282193-3282210	18	NC_018491.1	3280339-3280356	0	1.0
NC_018491_2	2.19\|3282193\|18\|NC_018491\|CRT	3282193-3282210	18	NC_018491.1	3280519-3280536	0	1.0
NC_018491_2	2.19\|3282193\|18\|NC_018491\|CRT	3282193-3282210	18	NC_018491.1	3280564-3280581	0	1.0
NC_018491_2	2.19\|3282193\|18\|NC_018491\|CRT	3282193-3282210	18	NC_018491.1	3280744-3280761	0	1.0
NC_018491_2	2.19\|3282193\|18\|NC_018491\|CRT	3282193-3282210	18	NC_018491.1	3280789-3280806	0	1.0
NC_018491_2	2.19\|3282193\|18\|NC_018491\|CRT	3282193-3282210	18	NC_018491.1	3280924-3280941	0	1.0
NC_018491_2	2.19\|3282193\|18\|NC_018491\|CRT	3282193-3282210	18	NC_018491.1	3280969-3280986	0	1.0
NC_018491_2	2.19\|3282193\|18\|NC_018491\|CRT	3282193-3282210	18	NC_018491.1	3281014-3281031	0	1.0
NC_018491_2	2.19\|3282193\|18\|NC_018491\|CRT	3282193-3282210	18	NC_018491.1	3281149-3281166	0	1.0
NC_018491_2	2.19\|3282193\|18\|NC_018491\|CRT	3282193-3282210	18	NC_018491.1	3280879-3280896	1	0.944
NC_018491_2	2.19\|3282193\|18\|NC_018491\|CRT	3282193-3282210	18	NC_018491.1	3281104-3281121	1	0.944
NC_018491_2	2.20\|3282238\|18\|NC_018491\|CRT	3282238-3282255	18	NC_018491.1	192335-192352	1	0.944
NC_018491_2	2.20\|3282238\|18\|NC_018491\|CRT	3282238-3282255	18	NC_018491.1	192542-192559	1	0.944
NC_018491_2	2.22\|3282355\|18\|NC_018491\|CRT	3282355-3282372	18	NC_018491.1	3280339-3280356	0	1.0
NC_018491_2	2.22\|3282355\|18\|NC_018491\|CRT	3282355-3282372	18	NC_018491.1	3280519-3280536	0	1.0
NC_018491_2	2.22\|3282355\|18\|NC_018491\|CRT	3282355-3282372	18	NC_018491.1	3280564-3280581	0	1.0
NC_018491_2	2.22\|3282355\|18\|NC_018491\|CRT	3282355-3282372	18	NC_018491.1	3280744-3280761	0	1.0
NC_018491_2	2.22\|3282355\|18\|NC_018491\|CRT	3282355-3282372	18	NC_018491.1	3280789-3280806	0	1.0
NC_018491_2	2.22\|3282355\|18\|NC_018491\|CRT	3282355-3282372	18	NC_018491.1	3280924-3280941	0	1.0
NC_018491_2	2.22\|3282355\|18\|NC_018491\|CRT	3282355-3282372	18	NC_018491.1	3280969-3280986	0	1.0
NC_018491_2	2.22\|3282355\|18\|NC_018491\|CRT	3282355-3282372	18	NC_018491.1	3281014-3281031	0	1.0
NC_018491_2	2.22\|3282355\|18\|NC_018491\|CRT	3282355-3282372	18	NC_018491.1	3281149-3281166	0	1.0
NC_018491_2	2.22\|3282355\|18\|NC_018491\|CRT	3282355-3282372	18	NC_018491.1	3280879-3280896	1	0.944
NC_018491_2	2.22\|3282355\|18\|NC_018491\|CRT	3282355-3282372	18	NC_018491.1	3281104-3281121	1	0.944
NC_018491_2	2.23\|3282400\|18\|NC_018491\|CRT	3282400-3282417	18	NC_018491.1	192335-192352	1	0.944
NC_018491_2	2.23\|3282400\|18\|NC_018491\|CRT	3282400-3282417	18	NC_018491.1	192542-192559	1	0.944
NC_018491_2	2.25\|3282517\|18\|NC_018491\|CRT	3282517-3282534	18	NC_018491.1	3280609-3280626	1	0.944
NC_018491_2	2.25\|3282517\|18\|NC_018491\|CRT	3282517-3282534	18	NC_018491.1	3280834-3280851	1	0.944
NC_018491_2	2.25\|3282517\|18\|NC_018491\|CRT	3282517-3282534	18	NC_018491.1	3281059-3281076	1	0.944
NC_018491_2	2.26\|3282562\|18\|NC_018491\|CRT	3282562-3282579	18	NC_018491.1	3280384-3280401	1	0.944
NC_018491_2	2.26\|3282562\|18\|NC_018491\|CRT	3282562-3282579	18	NC_018491.1	3281194-3281211	1	0.944

1. spacer 2.1|3281329|18|NC_018491|CRT matches to position: 3280339-3280356, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

2. spacer 2.1|3281329|18|NC_018491|CRT matches to position: 3280519-3280536, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

3. spacer 2.1|3281329|18|NC_018491|CRT matches to position: 3280564-3280581, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

4. spacer 2.1|3281329|18|NC_018491|CRT matches to position: 3280744-3280761, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

5. spacer 2.1|3281329|18|NC_018491|CRT matches to position: 3280789-3280806, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

6. spacer 2.1|3281329|18|NC_018491|CRT matches to position: 3280924-3280941, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

7. spacer 2.1|3281329|18|NC_018491|CRT matches to position: 3280969-3280986, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

8. spacer 2.1|3281329|18|NC_018491|CRT matches to position: 3281014-3281031, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

9. spacer 2.1|3281329|18|NC_018491|CRT matches to position: 3281149-3281166, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

10. spacer 2.1|3281329|18|NC_018491|CRT matches to position: 3280879-3280896, mismatch: 1, identity: 0.944

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgagcgc	Protospacer
**************.***

11. spacer 2.1|3281329|18|NC_018491|CRT matches to position: 3281104-3281121, mismatch: 1, identity: 0.944

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgagcgc	Protospacer
**************.***

12. spacer 2.5|3281536|18|NC_018491|CRT matches to position: 3280339-3280356, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

13. spacer 2.5|3281536|18|NC_018491|CRT matches to position: 3280519-3280536, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

14. spacer 2.5|3281536|18|NC_018491|CRT matches to position: 3280564-3280581, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

15. spacer 2.5|3281536|18|NC_018491|CRT matches to position: 3280744-3280761, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

16. spacer 2.5|3281536|18|NC_018491|CRT matches to position: 3280789-3280806, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

17. spacer 2.5|3281536|18|NC_018491|CRT matches to position: 3280924-3280941, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

18. spacer 2.5|3281536|18|NC_018491|CRT matches to position: 3280969-3280986, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

19. spacer 2.5|3281536|18|NC_018491|CRT matches to position: 3281014-3281031, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

20. spacer 2.5|3281536|18|NC_018491|CRT matches to position: 3281149-3281166, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

21. spacer 2.5|3281536|18|NC_018491|CRT matches to position: 3280879-3280896, mismatch: 1, identity: 0.944

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgagcgc	Protospacer
**************.***

22. spacer 2.5|3281536|18|NC_018491|CRT matches to position: 3281104-3281121, mismatch: 1, identity: 0.944

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgagcgc	Protospacer
**************.***

23. spacer 2.6|3281581|18|NC_018491|CRT matches to position: 3280339-3280356, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

24. spacer 2.6|3281581|18|NC_018491|CRT matches to position: 3280519-3280536, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

25. spacer 2.6|3281581|18|NC_018491|CRT matches to position: 3280564-3280581, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

26. spacer 2.6|3281581|18|NC_018491|CRT matches to position: 3280744-3280761, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

27. spacer 2.6|3281581|18|NC_018491|CRT matches to position: 3280789-3280806, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

28. spacer 2.6|3281581|18|NC_018491|CRT matches to position: 3280924-3280941, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

29. spacer 2.6|3281581|18|NC_018491|CRT matches to position: 3280969-3280986, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

30. spacer 2.6|3281581|18|NC_018491|CRT matches to position: 3281014-3281031, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

31. spacer 2.6|3281581|18|NC_018491|CRT matches to position: 3281149-3281166, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

32. spacer 2.6|3281581|18|NC_018491|CRT matches to position: 3280879-3280896, mismatch: 1, identity: 0.944

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgagcgc	Protospacer
**************.***

33. spacer 2.6|3281581|18|NC_018491|CRT matches to position: 3281104-3281121, mismatch: 1, identity: 0.944

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgagcgc	Protospacer
**************.***

34. spacer 2.7|3281626|18|NC_018491|CRT matches to position: 3280339-3280356, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

35. spacer 2.7|3281626|18|NC_018491|CRT matches to position: 3280519-3280536, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

36. spacer 2.7|3281626|18|NC_018491|CRT matches to position: 3280564-3280581, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

37. spacer 2.7|3281626|18|NC_018491|CRT matches to position: 3280744-3280761, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

38. spacer 2.7|3281626|18|NC_018491|CRT matches to position: 3280789-3280806, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

39. spacer 2.7|3281626|18|NC_018491|CRT matches to position: 3280924-3280941, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

40. spacer 2.7|3281626|18|NC_018491|CRT matches to position: 3280969-3280986, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

41. spacer 2.7|3281626|18|NC_018491|CRT matches to position: 3281014-3281031, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

42. spacer 2.7|3281626|18|NC_018491|CRT matches to position: 3281149-3281166, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

43. spacer 2.7|3281626|18|NC_018491|CRT matches to position: 3280879-3280896, mismatch: 1, identity: 0.944

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgagcgc	Protospacer
**************.***

44. spacer 2.7|3281626|18|NC_018491|CRT matches to position: 3281104-3281121, mismatch: 1, identity: 0.944

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgagcgc	Protospacer
**************.***

45. spacer 2.9|3281716|18|NC_018491|CRT matches to position: 3280339-3280356, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

46. spacer 2.9|3281716|18|NC_018491|CRT matches to position: 3280519-3280536, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

47. spacer 2.9|3281716|18|NC_018491|CRT matches to position: 3280564-3280581, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

48. spacer 2.9|3281716|18|NC_018491|CRT matches to position: 3280744-3280761, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

49. spacer 2.9|3281716|18|NC_018491|CRT matches to position: 3280789-3280806, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

50. spacer 2.9|3281716|18|NC_018491|CRT matches to position: 3280924-3280941, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

51. spacer 2.9|3281716|18|NC_018491|CRT matches to position: 3280969-3280986, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

52. spacer 2.9|3281716|18|NC_018491|CRT matches to position: 3281014-3281031, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

53. spacer 2.9|3281716|18|NC_018491|CRT matches to position: 3281149-3281166, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

54. spacer 2.9|3281716|18|NC_018491|CRT matches to position: 3280879-3280896, mismatch: 1, identity: 0.944

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgagcgc	Protospacer
**************.***

55. spacer 2.9|3281716|18|NC_018491|CRT matches to position: 3281104-3281121, mismatch: 1, identity: 0.944

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgagcgc	Protospacer
**************.***

56. spacer 2.11|3281833|18|NC_018491|CRT matches to position: 3280609-3280626, mismatch: 1, identity: 0.944

ccgccggtccttgaatac	CRISPR spacer
ccgccggtccttgaacac	Protospacer
***************.**

57. spacer 2.11|3281833|18|NC_018491|CRT matches to position: 3280834-3280851, mismatch: 1, identity: 0.944

ccgccggtccttgaatac	CRISPR spacer
ccgccggtccttgaacac	Protospacer
***************.**

58. spacer 2.11|3281833|18|NC_018491|CRT matches to position: 3281059-3281076, mismatch: 1, identity: 0.944

ccgccggtccttgaatac	CRISPR spacer
ccgccggtccttgaacac	Protospacer
***************.**

59. spacer 2.12|3281878|18|NC_018491|CRT matches to position: 3280339-3280356, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

60. spacer 2.12|3281878|18|NC_018491|CRT matches to position: 3280519-3280536, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

61. spacer 2.12|3281878|18|NC_018491|CRT matches to position: 3280564-3280581, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

62. spacer 2.12|3281878|18|NC_018491|CRT matches to position: 3280744-3280761, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

63. spacer 2.12|3281878|18|NC_018491|CRT matches to position: 3280789-3280806, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

64. spacer 2.12|3281878|18|NC_018491|CRT matches to position: 3280924-3280941, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

65. spacer 2.12|3281878|18|NC_018491|CRT matches to position: 3280969-3280986, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

66. spacer 2.12|3281878|18|NC_018491|CRT matches to position: 3281014-3281031, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

67. spacer 2.12|3281878|18|NC_018491|CRT matches to position: 3281149-3281166, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

68. spacer 2.12|3281878|18|NC_018491|CRT matches to position: 3280879-3280896, mismatch: 1, identity: 0.944

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgagcgc	Protospacer
**************.***

69. spacer 2.12|3281878|18|NC_018491|CRT matches to position: 3281104-3281121, mismatch: 1, identity: 0.944

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgagcgc	Protospacer
**************.***

70. spacer 2.13|3281923|18|NC_018491|CRT matches to position: 3280294-3280311, mismatch: 1, identity: 0.944

ccgccggcccttgaacgc	CRISPR spacer
ccgccggtccttgaacgc	Protospacer
*******.**********

71. spacer 2.13|3281923|18|NC_018491|CRT matches to position: 3280654-3280671, mismatch: 1, identity: 0.944

ccgccggcccttgaacgc	CRISPR spacer
ccgccggtccttgaacgc	Protospacer
*******.**********

72. spacer 2.15|3282013|18|NC_018491|CRT matches to position: 3280294-3280311, mismatch: 0, identity: 1.0

ccgccggtccttgaacgc	CRISPR spacer
ccgccggtccttgaacgc	Protospacer
******************

73. spacer 2.15|3282013|18|NC_018491|CRT matches to position: 3280654-3280671, mismatch: 0, identity: 1.0

ccgccggtccttgaacgc	CRISPR spacer
ccgccggtccttgaacgc	Protospacer
******************

74. spacer 2.15|3282013|18|NC_018491|CRT matches to position: 192434-192451, mismatch: 1, identity: 0.944

ccgccggtccttgaacgc	CRISPR spacer
ccgcaggtccttgaacgc	Protospacer
**** *************

75. spacer 2.15|3282013|18|NC_018491|CRT matches to position: 192695-192712, mismatch: 1, identity: 0.944

ccgccggtccttgaacgc	CRISPR spacer
ccgcaggtccttgaacgc	Protospacer
**** *************

76. spacer 2.19|3282193|18|NC_018491|CRT matches to position: 3280339-3280356, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

77. spacer 2.19|3282193|18|NC_018491|CRT matches to position: 3280519-3280536, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

78. spacer 2.19|3282193|18|NC_018491|CRT matches to position: 3280564-3280581, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

79. spacer 2.19|3282193|18|NC_018491|CRT matches to position: 3280744-3280761, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

80. spacer 2.19|3282193|18|NC_018491|CRT matches to position: 3280789-3280806, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

81. spacer 2.19|3282193|18|NC_018491|CRT matches to position: 3280924-3280941, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

82. spacer 2.19|3282193|18|NC_018491|CRT matches to position: 3280969-3280986, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

83. spacer 2.19|3282193|18|NC_018491|CRT matches to position: 3281014-3281031, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

84. spacer 2.19|3282193|18|NC_018491|CRT matches to position: 3281149-3281166, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

85. spacer 2.19|3282193|18|NC_018491|CRT matches to position: 3280879-3280896, mismatch: 1, identity: 0.944

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgagcgc	Protospacer
**************.***

86. spacer 2.19|3282193|18|NC_018491|CRT matches to position: 3281104-3281121, mismatch: 1, identity: 0.944

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgagcgc	Protospacer
**************.***

87. spacer 2.20|3282238|18|NC_018491|CRT matches to position: 192335-192352, mismatch: 1, identity: 0.944

ctgctggtccttgaatac	CRISPR spacer
ctgcaggtccttgaatac	Protospacer
**** *************

88. spacer 2.20|3282238|18|NC_018491|CRT matches to position: 192542-192559, mismatch: 1, identity: 0.944

ctgctggtccttgaatac	CRISPR spacer
ctgcaggtccttgaatac	Protospacer
**** *************

89. spacer 2.22|3282355|18|NC_018491|CRT matches to position: 3280339-3280356, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

90. spacer 2.22|3282355|18|NC_018491|CRT matches to position: 3280519-3280536, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

91. spacer 2.22|3282355|18|NC_018491|CRT matches to position: 3280564-3280581, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

92. spacer 2.22|3282355|18|NC_018491|CRT matches to position: 3280744-3280761, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

93. spacer 2.22|3282355|18|NC_018491|CRT matches to position: 3280789-3280806, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

94. spacer 2.22|3282355|18|NC_018491|CRT matches to position: 3280924-3280941, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

95. spacer 2.22|3282355|18|NC_018491|CRT matches to position: 3280969-3280986, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

96. spacer 2.22|3282355|18|NC_018491|CRT matches to position: 3281014-3281031, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

97. spacer 2.22|3282355|18|NC_018491|CRT matches to position: 3281149-3281166, mismatch: 0, identity: 1.0

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgaacgc	Protospacer
******************

98. spacer 2.22|3282355|18|NC_018491|CRT matches to position: 3280879-3280896, mismatch: 1, identity: 0.944

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgagcgc	Protospacer
**************.***

99. spacer 2.22|3282355|18|NC_018491|CRT matches to position: 3281104-3281121, mismatch: 1, identity: 0.944

ctgtgttaccttgaacgc	CRISPR spacer
ctgtgttaccttgagcgc	Protospacer
**************.***

100. spacer 2.23|3282400|18|NC_018491|CRT matches to position: 192335-192352, mismatch: 1, identity: 0.944

ctgctggtccttgaatac	CRISPR spacer
ctgcaggtccttgaatac	Protospacer
**** *************

101. spacer 2.23|3282400|18|NC_018491|CRT matches to position: 192542-192559, mismatch: 1, identity: 0.944

ctgctggtccttgaatac	CRISPR spacer
ctgcaggtccttgaatac	Protospacer
**** *************

102. spacer 2.25|3282517|18|NC_018491|CRT matches to position: 3280609-3280626, mismatch: 1, identity: 0.944

ccgccggtccttgaatac	CRISPR spacer
ccgccggtccttgaacac	Protospacer
***************.**

103. spacer 2.25|3282517|18|NC_018491|CRT matches to position: 3280834-3280851, mismatch: 1, identity: 0.944

ccgccggtccttgaatac	CRISPR spacer
ccgccggtccttgaacac	Protospacer
***************.**

104. spacer 2.25|3282517|18|NC_018491|CRT matches to position: 3281059-3281076, mismatch: 1, identity: 0.944

ccgccggtccttgaatac	CRISPR spacer
ccgccggtccttgaacac	Protospacer
***************.**

105. spacer 2.26|3282562|18|NC_018491|CRT matches to position: 3280384-3280401, mismatch: 1, identity: 0.944

ctgtattaccttgaggtc	CRISPR spacer
ctgtgttaccttgaggtc	Protospacer
****.*************

106. spacer 2.26|3282562|18|NC_018491|CRT matches to position: 3281194-3281211, mismatch: 1, identity: 0.944

ctgtattaccttgaggtc	CRISPR spacer
ctgtgttaccttgaggtc	Protospacer
****.*************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_018491_1	1.2\|1757458\|24\|NC_018491\|CRT	1757458-1757481	24	NC_018878	Bacillus thuringiensis Bt407 plasmid BTB_502p, complete sequence	270500-270523	2	0.917
NC_018491_1	1.1\|1757416\|24\|NC_018491\|CRT	1757416-1757439	24	NZ_CP009619	Vibrio coralliilyticus strain RE98 plasmid p380, complete sequence	135701-135724	3	0.875
NC_018491_1	1.2\|1757458\|24\|NC_018491\|CRT	1757458-1757481	24	NZ_CP014203	Clostridium baratii strain CDC51267 plasmid pNPD11_1, complete sequence	65428-65451	3	0.875
NC_018491_1	1.1\|1757416\|24\|NC_018491\|CRT	1757416-1757439	24	NZ_CP015733	Arthrobacter sp. U41 plasmid unnamed1, complete sequence	171587-171610	4	0.833
NC_018491_1	1.4\|1757536\|33\|NC_018491\|CRT	1757536-1757568	33	NZ_CP044446	Acinetobacter indicus strain CMG3-2 plasmid pCMG3-2-1, complete sequence	47344-47376	10	0.697
NC_018491_1	1.4\|1757536\|33\|NC_018491\|CRT	1757536-1757568	33	NZ_CP044484	Acinetobacter schindleri strain HZE30-1 plasmid pHZE30-1-1, complete sequence	6717-6749	10	0.697
NC_018491_1	1.4\|1757536\|33\|NC_018491\|CRT	1757536-1757568	33	NZ_CP044457	Acinetobacter indicus strain B18 plasmid pB18-2, complete sequence	4544-4576	10	0.697
NC_018491_1	1.4\|1757536\|33\|NC_018491\|CRT	1757536-1757568	33	NZ_CP044451	Acinetobacter indicus strain MMS9-2 plasmid pMMS9-2-1, complete sequence	95975-96007	10	0.697
NC_018491_1	1.4\|1757536\|33\|NC_018491\|CRT	1757536-1757568	33	NZ_CP039146	Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-3, complete sequence	9110-9142	10	0.697
NC_018491_1	1.4\|1757536\|33\|NC_018491\|CRT	1757536-1757568	33	NZ_CP044464	Acinetobacter schindleri strain HZE23-1 plasmid pHZE23-1-1, complete sequence	109539-109571	10	0.697
NC_018491_1	1.4\|1757536\|33\|NC_018491\|CRT	1757536-1757568	33	NZ_CP044475	Acinetobacter schindleri strain HZE33-1 plasmid pHZE33-1-1, complete sequence	57541-57573	10	0.697

1. spacer 1.2|1757458|24|NC_018491|CRT matches to NC_018878 (Bacillus thuringiensis Bt407 plasmid BTB_502p, complete sequence) position: , mismatch: 2, identity: 0.917

gaagatttggacaaggttcttgaa	CRISPR spacer
gaagagttgaacaaggttcttgaa	Protospacer
***** ***.**************

2. spacer 1.1|1757416|24|NC_018491|CRT matches to NZ_CP009619 (Vibrio coralliilyticus strain RE98 plasmid p380, complete sequence) position: , mismatch: 3, identity: 0.875

tttgatgatgtagacggaaatgaa	CRISPR spacer
tttgatgatgtagacagcaatgat	Protospacer
***************.* *****

3. spacer 1.2|1757458|24|NC_018491|CRT matches to NZ_CP014203 (Clostridium baratii strain CDC51267 plasmid pNPD11_1, complete sequence) position: , mismatch: 3, identity: 0.875

gaagatttggacaaggttcttgaa	CRISPR spacer
gaagatattgacaaggttcttgat	Protospacer
****** * **************

4. spacer 1.1|1757416|24|NC_018491|CRT matches to NZ_CP015733 (Arthrobacter sp. U41 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.833

tttgatgatgtagacggaaatgaa	CRISPR spacer
ggcgatgatgtagacggtaatgaa	Protospacer
  .************** ******

5. spacer 1.4|1757536|33|NC_018491|CRT matches to NZ_CP044446 (Acinetobacter indicus strain CMG3-2 plasmid pCMG3-2-1, complete sequence) position: , mismatch: 10, identity: 0.697

ttcgctgaagaagaacttgagtatgatgaaact	CRISPR spacer
gtactcgaataagtacttgagtatgatgaactc	Protospacer
 *  ..*** *** **************** ..

6. spacer 1.4|1757536|33|NC_018491|CRT matches to NZ_CP044484 (Acinetobacter schindleri strain HZE30-1 plasmid pHZE30-1-1, complete sequence) position: , mismatch: 10, identity: 0.697

ttcgctgaagaagaacttgagtatgatgaaact	CRISPR spacer
gtactcgaataagtacttgagtatgatgaactc	Protospacer
 *  ..*** *** **************** ..

7. spacer 1.4|1757536|33|NC_018491|CRT matches to NZ_CP044457 (Acinetobacter indicus strain B18 plasmid pB18-2, complete sequence) position: , mismatch: 10, identity: 0.697

ttcgctgaagaagaacttgagtatgatgaaact	CRISPR spacer
gtactcgaataagtacttgagtatgatgaactc	Protospacer
 *  ..*** *** **************** ..

8. spacer 1.4|1757536|33|NC_018491|CRT matches to NZ_CP044451 (Acinetobacter indicus strain MMS9-2 plasmid pMMS9-2-1, complete sequence) position: , mismatch: 10, identity: 0.697

ttcgctgaagaagaacttgagtatgatgaaact	CRISPR spacer
gtactcgaataagtacttgagtatgatgaactc	Protospacer
 *  ..*** *** **************** ..

9. spacer 1.4|1757536|33|NC_018491|CRT matches to NZ_CP039146 (Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-3, complete sequence) position: , mismatch: 10, identity: 0.697

ttcgctgaagaagaacttgagtatgatgaaact	CRISPR spacer
gtactcgaataagtacttgagtatgatgaactc	Protospacer
 *  ..*** *** **************** ..

10. spacer 1.4|1757536|33|NC_018491|CRT matches to NZ_CP044464 (Acinetobacter schindleri strain HZE23-1 plasmid pHZE23-1-1, complete sequence) position: , mismatch: 10, identity: 0.697

ttcgctgaagaagaacttgagtatgatgaaact	CRISPR spacer
gtactcgaataagtacttgagtatgatgaactc	Protospacer
 *  ..*** *** **************** ..

11. spacer 1.4|1757536|33|NC_018491|CRT matches to NZ_CP044475 (Acinetobacter schindleri strain HZE33-1 plasmid pHZE33-1-1, complete sequence) position: , mismatch: 10, identity: 0.697

ttcgctgaagaagaacttgagtatgatgaaact	CRISPR spacer
gtactcgaataagtacttgagtatgatgaactc	Protospacer
 *  ..*** *** **************** ..

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1259908 : 1268281

Synechococcus_phage(50.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000088580.1\|1259908_1260496_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	4.5e-27	37.1
WP_001262432.1\|1260492_1261533_-	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	7.2e-68	45.9
WP_000879021.1\|1261635_1263051_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	3.3e-55	35.4
WP_000055585.1\|1263035_1265255_-	phosphoribosylformylglycinamidine synthase II	A6N228	Microbacterium_phage	1.7e-162	41.0
WP_000666779.1\|1265238_1265922_-	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_000278826.1\|1265918_1266173_-	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_001170542.1\|1266165_1266885_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	G8EYA2	Synechococcus_phage	5.2e-49	44.3
WP_000625679.1\|1266973_1268281_-	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	1.1e-20	25.0

DBSCAN-SWA_2

2077781 : 2121273

Streptococcus_phage(12.5%)

transposase,protease,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001002987.1\|2077781_2078030_+\|coat	spore coat protein	NA	NA	NA	NA
WP_001998539.1\|2078190_2079225_+	L-lactate dehydrogenase	NA	NA	NA	NA
WP_000666177.1\|2079247_2080261_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_000713743.1\|2080317_2080965_-	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_000826900.1\|2081108_2081636_+	hypothetical protein	NA	NA	NA	NA
WP_000218967.1\|2082138_2082504_+	arsenate reductase family protein	M1PLC0	Streptococcus_phage	6.7e-21	48.6
WP_000026900.1\|2082545_2082929_+	glycine cleavage system protein GcvH	NA	NA	NA	NA
WP_000263237.1\|2083255_2083600_+	hypothetical protein	NA	NA	NA	NA
WP_000568162.1\|2083612_2083912_+	thioredoxin family protein	NA	NA	NA	NA
WP_000781222.1\|2084066_2084411_+	hypothetical protein	NA	NA	NA	NA
WP_000601777.1\|2084824_2085850_+	methionine ABC transporter ATP-binding protein	NA	NA	NA	NA
WP_000359556.1\|2085842_2086508_+	ABC transporter permease	NA	NA	NA	NA
WP_000735105.1\|2086531_2087344_+	MetQ/NlpA family ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_000722401.1\|2087416_2088223_+	MetQ/NlpA family ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_000929157.1\|2088461_2089247_+	Fe-S cluster assembly ATPase SufC	A0A285PWH2	Cedratvirus	7.5e-09	25.8
WP_000152165.1\|2089262_2090555_+	Fe-S cluster assembly protein SufD	NA	NA	NA	NA
WP_001020761.1\|2090554_2091775_+	cysteine desulfurase SufS	Q2XUY6	environmental_halophage	3.6e-119	48.1
WP_000009523.1\|2091764_2092196_+	iron-sulfur cluster assembly scaffold protein SufU	A0A0K1LS29	Mycobacterium_phage	1.5e-14	37.6
WP_001118823.1\|2092244_2093642_+	Fe-S cluster assembly protein SufB	NA	NA	NA	NA
WP_014893430.1\|2093843_2094590_-	VanZ family protein	NA	NA	NA	NA
WP_000356633.1\|2094589_2094919_-	PadR family transcriptional regulator	NA	NA	NA	NA
WP_074567895.1\|2095498_2096890_+	bifunctional metallophosphatase/5'-nucleotidase	NA	NA	NA	NA
WP_000248463.1\|2096955_2097258_+	DUF1805 domain-containing protein	NA	NA	NA	NA
WP_000021809.1\|2097312_2098044_+	sporulation protein YunB	NA	NA	NA	NA
WP_000944675.1\|2098080_2099064_-	M23 family metallopeptidase	NA	NA	NA	NA
WP_000166370.1\|2099253_2100150_+	lipoyl synthase	NA	NA	NA	NA
WP_000272744.1\|2100170_2100650_-	YbaK/EbsC family protein	NA	NA	NA	NA
WP_000721017.1\|2100724_2101279_-	histidine phosphatase family protein	NA	NA	NA	NA
WP_154214280.1\|2101252_2101426_+	hypothetical protein	NA	NA	NA	NA
WP_000738185.1\|2101531_2101975_+	hypothetical protein	NA	NA	NA	NA
WP_002163480.1\|2101997_2102813_-\|protease	YhfC family intramembrane metalloprotease	NA	NA	NA	NA
WP_001241001.1\|2102898_2103630_+	MerR family transcriptional regulator	NA	NA	NA	NA
WP_014893432.1\|2103667_2104246_-	hypothetical protein	NA	NA	NA	NA
WP_000435941.1\|2104364_2104667_+	YutD family protein	NA	NA	NA	NA
WP_014893433.1\|2104704_2105199_-	hypothetical protein	NA	NA	NA	NA
WP_000392606.1\|2105568_2105835_-	DUF3055 domain-containing protein	NA	NA	NA	NA
WP_000439090.1\|2105852_2106824_-	class II fructose-bisphosphatase	NA	NA	NA	NA
WP_000274011.1\|2106971_2107412_+	DUF86 domain-containing protein	NA	NA	NA	NA
WP_000503352.1\|2107483_2108116_+	transcriptional regulator	NA	NA	NA	NA
WP_000276467.1\|2108225_2108990_+	TIGR01457 family HAD-type hydrolase	NA	NA	NA	NA
WP_088300244.1\|2109059_2110390_-\|transposase	IS3 family transposase	A0A0C5AC89	Paenibacillus_phage	2.7e-35	38.1
WP_000683406.1\|2110716_2111298_-	NAD(P)H-dependent oxidoreductase	NA	NA	NA	NA
WP_014893435.1\|2111842_2112658_-	HAD hydrolase family protein	NA	NA	NA	NA
WP_014893436.1\|2112654_2113767_-\|protease	cysteine protease StiP family protein	A0A172Q0S8	Acinetobacter_phage	4.0e-40	32.0
WP_014893437.1\|2113772_2115119_-	hypothetical protein	NA	NA	NA	NA
WP_001106073.1\|2115063_2116167_-	HpcH/HpaI aldolase/citrate lyase family protein	NA	NA	NA	NA
WP_000402409.1\|2116328_2116808_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_014893438.1\|2116828_2117320_-	phosphatidylglycerophosphatase A	G3MBC5	Bacillus_virus	3.5e-41	53.8
WP_000581269.1\|2117440_2118442_+\|coat	spore coat protein CotS	NA	NA	NA	NA
WP_014893439.1\|2118503_2118719_-	hypothetical protein	NA	NA	NA	NA
WP_000431159.1\|2118913_2119150_-	NifU family protein	Q58MC7	Prochlorococcus_phage	2.0e-10	46.6
WP_000248594.1\|2119356_2119665_+	YuzD family protein	NA	NA	NA	NA
WP_041184567.1\|2119717_2120521_+	nucleotidyltransferase domain-containing protein	NA	NA	NA	NA
WP_000447120.1\|2120595_2121273_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA

DBSCAN-SWA_3

2496066 : 2503751

uncultured_Caudovirales_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001036820.1\|2496066_2497050_+	iron ABC transporter permease	A0A2H4IY97	uncultured_Caudovirales_phage	1.4e-17	26.5
WP_000403751.1\|2497039_2497810_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.9e-13	26.1
WP_001086113.1\|2497842_2498607_+	class B sortase	NA	NA	NA	NA
WP_000587815.1\|2498673_2498997_-	heme oxygenase	NA	NA	NA	NA
WP_001255958.1\|2499295_2500495_+	class I SAM-dependent rRNA methyltransferase	W6LLI2	Streptococcus_phage	6.1e-71	41.2
WP_001014318.1\|2500534_2500729_-	YwbE family protein	NA	NA	NA	NA
WP_000018053.1\|2501072_2501765_+	response regulator transcription factor	B5LWA6	Feldmannia_species_virus	1.4e-06	28.8
WP_014893492.1\|2501766_2502702_+	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	4.1e-22	26.2
WP_000221060.1\|2502827_2503751_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.6e-45	44.7

DBSCAN-SWA_4

4077427 : 4084690

Geobacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000820164.1\|4077427_4077640_-	DUF3006 domain-containing protein	Q0H256	Geobacillus_phage	1.9e-12	54.4
WP_014893649.1\|4077642_4079028_-	MBL fold metallo-hydrolase	Q0H255	Geobacillus_phage	4.2e-79	61.1
WP_000288932.1\|4079281_4079686_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_000562184.1\|4079701_4080055_+	MmcQ/YjbR family DNA-binding protein	NA	NA	NA	NA
WP_000655483.1\|4080076_4080784_+	class I SAM-dependent methyltransferase	A0A1X9I6N4	Streptococcus_phage	1.5e-16	27.8
WP_001093434.1\|4080849_4081245_+	DUF2809 domain-containing protein	NA	NA	NA	NA
WP_000502315.1\|4081260_4082187_+	phosphotransferase	NA	NA	NA	NA
WP_000720549.1\|4082183_4082702_+	DNA topology modulation protein	A0A097BYE2	Leuconostoc_phage	1.4e-43	47.9
WP_000373591.1\|4082734_4083412_+	SUMF1/EgtB/PvdO family nonheme iron enzyme	A0A075BUR2	Microcystis_phage	4.6e-31	39.5
WP_000124906.1\|4083496_4084690_+	glycosyl transferase family 1	G4WEM5	Phthorimaea_operculella_granulovirus	6.4e-12	23.8

DBSCAN-SWA_5

4830359 : 4838423

Bacillus_phage(83.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001258526.1\|4830359_4831232_-	aminoglycoside 6-adenylyltransferase	A0A1X9I6F2	Streptococcus_phage	1.4e-64	44.0
WP_000818985.1\|4831874_4832594_-	3-ketoacyl-ACP reductase	W8CYX9	Bacillus_phage	5.9e-61	100.0
WP_000608416.1\|4833085_4834204_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	S6AND0	Bacillus_phage	3.0e-173	80.6
WP_001254315.1\|4834826_4835900_-	sensor histidine kinase	W8CYF6	Bacillus_phage	1.4e-175	89.6
WP_000937028.1\|4835896_4836574_-	response regulator transcription factor	W8CYM9	Bacillus_phage	1.7e-118	93.8
WP_000453870.1\|4836662_4838423_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.3e-268	96.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NC_018492

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_018492_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_018492_1

178359-178588

TypeV-U3,TypeI-A?

V-U3

Consensus_repeat	Method
GTTAAAACAGAACAATAGATGTATTGAAATT	PILER-CR
GTTAAAACAGAACAATAGATGTATTGAAAT	CRT
TTAAAACATAACAATAGATGTATTGAAAT	CRISPRCasFinder

3 spacers

c2c10_CAS-V-U3,csa3

The CRISPR arrays of NC_018492_1

>merge|NC_018492|1|178359-178588|PILER-CR,CRT,CRISPRCasFinder
GTTAAAACATAACAATAGATGTATTGAAATTGATCCACCTCTACAATGTGATAACGGCCATTATCCGTTAAAACAGAACAATAGATGTATTGAAATTTAAGTCATTATATGACACCGTATGCTATGTGGATTGTTAAAACAGAACGATAGATGTATTGAAATCAAACAAGATTACAACTATTGAACAATGTCGTCAATCGTTAAAACAGAACAATAGATGTATTTAAAAA

>NC_018492|1|1|178359-178521|PILER-CR
GTTAAAACATAACAATAGATGTATTGAAATT	GATCCACCTCTACAATGTGATAACGGCCATTATCC
GTTAAAACAGAACAATAGATGTATTGAAATT	TAAGTCATTATATGACACCGTATGCTATGTGGATT
GTTAAAACAGAACGATAGATGTATTGAAATC

>NC_018492|1|1|178359-178587|CRT
GTTAAAACATAACAATAGATGTATTGAAAT	TGATCCACCTCTACAATGTGATAACGGCCATTATCC
GTTAAAACAGAACAATAGATGTATTGAAAT	TTAAGTCATTATATGACACCGTATGCTATGTGGATT
GTTAAAACAGAACGATAGATGTATTGAAAT	CAAACAAGATTACAACTATTGAACAATGTCGTCAATC
GTTAAAACAGAACAATAGATGTATTTAAAA

>NC_018492|1|1|178360-178588|CRISPRCasFinder
TTAAAACATAACAATAGATGTATTGAAAT	TGATCCACCTCTACAATGTGATAACGGCCATTATCCG
TTAAAACAGAACAATAGATGTATTGAAAT	TTAAGTCATTATATGACACCGTATGCTATGTGGATTG
TTAAAACAGAACGATAGATGTATTGAAAT	CAAACAAGATTACAACTATTGAACAATGTCGTCAATCG
TTAAAACAGAACAATAGATGTATTTAAAAA

Protein	Signature genes	Signature genes Name	Protein_function
NC_018492.1\|WP_000288517.1\|184692_184878_-\|RNA-chaperone-Hfq	unknown	unknown	gnl\|CDD\|274101
NC_018492.1\|WP_000337715.1\|182028_182238_+\|hypothetical-protein	unknown	unknown	unknown
NC_018492.1\|WP_014893882.1\|172417_172996_-\|hypothetical-protein	unknown	unknown	unknown
NC_018492.1\|WP_000344164.1\|182975_183176_+\|hypothetical-protein	unknown	unknown	unknown
NC_018492.1\|WP_001024817.1\|171102_171732_+\|hypothetical-protein	unknown	unknown	unknown
NC_018492.1\|WP_000730713.1\|174983_175403_-\|hypothetical-protein	unknown	unknown	unknown
NC_018492.1\|WP_000817512.1\|171731_172367_+\|hypothetical-protein	unknown	unknown	unknown
NC_018492.1\|WP_000255411.1\|187352_188105_+\|hypothetical-protein	unknown	unknown	unknown
NC_018492.1\|WP_000708127.1\|182282_182924_+\|thermonuclease-family-protein	unknown	unknown	gnl\|CDD\|214615
NC_018492.1\|WP_000637342.1\|185205_186300_-\|tetratricopeptide-repeat-protein	unknown	unknown	gnl\|CDD\|376220
NC_018492.1\|WP_000914415.1\|175998_176427_-\|hypothetical-protein	unknown	unknown	unknown
NC_018492.1\|WP_071713414.1\|173731_174115_+\|hypothetical-protein	unknown	unknown	unknown
NC_018492.1\|WP_080120893.1\|176735_178097_+\|IS200/IS605-family-element-transposase-accessory-protein-TnpB	c2c10_CAS-V-U3	-	gnl\|CDD\|284650
NC_018492.1\|WP_000788722.1\|186854_187172_+\|hypothetical-protein	unknown	unknown	unknown
NC_018492.1\|WP_000207868.1\|184091_184385_+\|winged-helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|238042
NC_018492.1\|WP_000866032.1\|174131_174770_+\|NERD-domain-containing-protein	unknown	unknown	gnl\|CDD\|377990
NC_018492.1\|WP_000022643.1\|183581_184019_+\|disulfide-bond-formation-protein-B	unknown	unknown	gnl\|CDD\|179540
NC_018492.1\|WP_000084558.1\|183252_183540_+\|hypothetical-protein	unknown	unknown	unknown
NC_018492.1\|WP_000494366.1\|170052_170766_+\|hypothetical-protein	unknown	unknown	unknown
NC_018492.1\|WP_000916408.1\|173015_173606_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NC_018492.1\|WP_000288517.1\|184692_184878_-\|RNA-chaperone-Hfq	gnl\|CDD\|274101	TIGR02383, RNA-binding_protein_Hfq, RNA chaperone Hfq. This model represents the RNA-binding pleiotropic regulator Hfq, a small, Sm-like protein of bacteria. It helps pair regulatory noncoding RNAs with complementary mRNA target regions. It enhances the elongation of poly(A) tails on mRNA. It appears also to protect RNase E recognition sites (A/U-rich sequences with adjacent stem-loop structures) from cleavage. Being pleiotropic, it differs in some of its activities in different species. Hfq binds the non-coding regulatory RNA DsrA (see Rfam RF00014) in the few species known to have it: Escherichia coli, Shigella flexneri, Salmonella spp. In Azorhizobium caulinodans, an hfq mutant is unable to express nifA, and Hfq is called NrfA, for nif regulatory factor (see . The name hfq reflects phenomenology as a host factor for phage Q-beta RNA replication. [Regulatory functions, Other].	1.56154e-22
NC_018492.1\|WP_080120893.1\|176735_178097_+\|IS200/IS605-family-element-transposase-accessory-protein-TnpB	gnl\|CDD\|284650	pfam07282, OrfB_Zn_ribbon, Putative transposase DNA-binding domain. This putative domain is found at the C-terminus of a large number of transposase proteins. This domain contains four conserved cysteines suggestive of a zinc binding domain. Given the need for transposases to bind DNA as well as the large number of DNA-binding zinc fingers we hypothesize this domain is DNA-binding.	3.3593e-21
NC_018492.1\|WP_000207868.1\|184091_184385_+\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238042	cd00090, HTH_ARSR, Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to dissociate from DNA in the presence of metal ions.	1.42374e-11
NC_018492.1\|WP_000866032.1\|174131_174770_+\|NERD-domain-containing-protein	gnl\|CDD\|377990	pfam08378, NERD, Nuclease-related domain. The nuclease-related domain (NERD) is found in a range of bacterial as well as archaeal and plant proteins. It has distant similarity to endonucleases (hence its name) and its predicted secondary structure is helix - sheet - sheet - sheet - sheet - weak sheet/long loop - helix - sheet - sheet. The majority of NERD-containing proteins are single-domain, but in several cases proteins containing NERD have additional domains which in 75% of cases are involved in DNA processing.	1.80407e-26
NC_018492.1\|WP_000022643.1\|183581_184019_+\|disulfide-bond-formation-protein-B	gnl\|CDD\|179540	PRK03113, PRK03113, putative disulfide oxidoreductase; Provisional.	6.9737e-37
NC_018492.1\|WP_000708127.1\|182282_182924_+\|thermonuclease-family-protein	gnl\|CDD\|214615	smart00318, SNc, Staphylococcal nuclease homologues.	2.08842e-32
NC_018492.1\|WP_000637342.1\|185205_186300_-\|tetratricopeptide-repeat-protein	gnl\|CDD\|376220	pfam18801, RapH_N, response regulator aspartate phosphatase H, N terminal. Rap proteins consist of a N-terminal 3-helix bundle and a tetratricopeptide domain. This entry represents the conserved region of the C-terminal bundle.	4.93154e-26

>NC_018492.1|WP_080120893.1|176735_178097_+|IS200/IS605-family-element-transposase-accessory-protein-TnpB
MTYLSIAVKVMKYQIVCPVNIEWKTFEIYLRTLSYHFRTIGNRTIQKLWEYDNQSLKHFKDTGQYPSAQQLYGCTQKTISGYIYDQLKEEYQDINKANMSTTLQKTIKTWNSRKKEIWSGEMSIPSFRNNLPIDIHGNSIQIIKEKSGDYIASVSLFSSKFIKENDLPNGKILVKLSTRKQNSMKVILDRIIDSTYAKGSCMLHKHKKKWYLSITYKSNIKEELKFDEDLIMGIDMGKINVLYFAFNKGLVRGAISGEEIEAFRKKIEHRRISLLRQGKYCSGNRIGKGRKKRIKPIEVLNDKIAKFRNATNHKYANYIVQQCLKYNCGTIQLEDLQGISKEQTFLKNWTYFDLQEKIKNQANQYGIKVVKIDPSYTSQRCSECGYIHKNNRQNQSTFECQQCSFKVHADYNAAKNISVYNIEKVIQKQLKLQEKLNLTKYKEQYIEQMENIN
>NC_018492.1|WP_000914415.1|175998_176427_-|hypothetical-protein
MLKKLSVFLIGTLLLFGLAACDSIKSVASDVTVGKVIEEFKTAGLEAEQPSDLPEKEFGNTRKDAKRILVPALGEDSGGRIFEFKNKQDLEQAKKYYDDLGNGNQMLFSHTYAKGNFLLQMNGDMEDAKFNKYKEVMDKIIK
>NC_018492.1|WP_000730713.1|174983_175403_-|hypothetical-protein
MKKKTLVKSILSLALAACVAFPSIAGAEYDDFEGSVSGKKTVESSFNVDPGYGYVKLWFKNKGKNDVTITVKNIDTGKKYLTITLKPGKSYTWRSVNEWKGKAVGAGEYKVTYRDGTGGSVNVDYAGFSSNDEDEGRTA
>NC_018492.1|WP_000866032.1|174131_174770_+|NERD-domain-containing-protein
MKVLIFELVLIAILIPLNIVVKKHVPKWKGKAGEKLVKRILSKLDPKSYYVLHDVTVHTEYGDTTQIDHIVIAETGVFVIETKNYEGWIYGNEKSARWTQGIFRKKSSFQNPFRQNYKHIKAIEWLIEQQLPCISIVAFHPKCSLKRVNVQSKDKHVLYYNDLQKCIESYTETQLTNDEVQHIYQTILRADIMDKDIEKKHVKYLHNKFAKQ
>NC_018492.1|WP_071713414.1|173731_174115_+|hypothetical-protein
MKRNREYIALRNSILIGWLLTCIVIGLSIYFSSVVYLLIGCFILSLKYGLMGTVKNVEKRLPTWANFGVIEKPVNRRVTRPFQFRGGLLVSLALGFVEMVIKGLCISYFILGLETHVYRLMRRNARV
>NC_018492.1|WP_000916408.1|173015_173606_-|hypothetical-protein
MLKLVVDNTVTEPEPKTDSAFSNYFTCKDCVYYLSKSDSCSLQLAADSNSPLIPYECGNFEETYEIGTEDPLNSHIHQRLREEKAQILDESYPAQPAIDPIHKDAIWYGSVNYGCWIINDSKKRFALAEQVPFGDNNVSSKKYVSPFPLHDHGAKEGIRHYMCWYVNEKGIGEYHLLIGGVIMKIAEGVKKLGFNN
>NC_018492.1|WP_014893882.1|172417_172996_-|hypothetical-protein
MLEHTILFSLVQLVPLIISTSIIYMLLELTDTEWITWFSYEGIFAVLFLITRFQVFQNKKSIISLNQYEKWFSKLNIFLVSIFLVLFASIPTLLKIAFILQMTVILFLLEYLCLYINRLPIHNLYRVKEIICDKKQLKIERIIPNNEEHGTHTIKTSDEQYFIYTAVYLSGILSPISEEVFEEYERKNLMGR
>NC_018492.1|WP_000817512.1|171731_172367_+|hypothetical-protein
MKRDKGMIGVLCTLILMILLLVPLQAAQASVKVDFNELKGNDVSSSFKNGLNNRTKTTEKDDSFGSSIIQKIEGLYAPAFKVGVNIFSISFVLGVIVMVMALITKNGQWMKWATGSMIFSFISMMSMRLSVYFLFSSDVFSFMNIFTDFLDLFKATALIFTPFMLIAGIRLRRIHESTKQPEYYRWANRVITGSCLLCMLAVLAPWLFANM
>NC_018492.1|WP_001024817.1|171102_171732_+|hypothetical-protein
MNINSISNNVVEKLEQTVRYEKKQVQVLRVSKSSSNIHAYMIFPEFSEVKISNTELDEYIENLSTSVKYVIDRKLSQQEIEKQNHSFIMTCEVEEDGVIDDETIHFNTTYVKPPTIANKVFKLVCGLGNRLDSLKELHITVLNNNINRIEIEFYNENETYVAVEKEEIANAIMGAYTKANIYYAADLYYAAVGNEIKLKSIKPKLAGDV
>NC_018492.1|WP_000494366.1|170052_170766_+|hypothetical-protein
MFTKIFIGLFCYVFLVVRNSRKKFLIEEAKKKEMENKPVERPVYWCPRENRPIGREQERVTVPTKEITLEKDVANIYDLVATSVHKNLGEDDSDRLKHEDIEEVEYAEDFHHTPTPEAVYDISFPSDEDIPVELLEYEDMYPQQEYVSIPPETEHVFPVQQGVADVEDMDFVRWTAKVIKQEQGFARVINMSNKKRYWIHTEGEVLPKNQLLYMELEVDSPYSYTLVEWSNRQLGNI
>NC_018492.1|WP_000337715.1|182028_182238_+|hypothetical-protein
MCTTSVASTNVSFEKLKSQEENEKSMASICPNCKKRSFKELYNDYPKWIQFCLCCNYREVNTLESPFVY
>NC_018492.1|WP_000708127.1|182282_182924_+|thermonuclease-family-protein
MKIWIKAICITSFLFQMSACSSSTQMNDSKPAQTVQKGMQQHVEGKNIVNIPEAYKGKLKGLETVNGKVIHIKDGDTIDVNVKGEKQTVRLLLLDTPESVSQKIPPQKMGKEASSFLKKELDGKSVTLVYDQGPKEDKYGRKLAYVFCEGIHINELMIKSGYGIVAYISKPNTTLLPQMLESEKEAKASKTGVWNIKGYVDEEKHHYNRNDAA
>NC_018492.1|WP_000344164.1|182975_183176_+|hypothetical-protein
MDENKRNMLLSFIISILFIFASLLPFSNNEYVYVISKIGAAAGVINIVMMSVFLYFQSKKTRHLLN
>NC_018492.1|WP_000084558.1|183252_183540_+|hypothetical-protein
MSQVPGFLKFVLAKERRYVYLAVAEKKNKRVHTHIVYGFGPLEKALETMYEMRDDFENLFPLELKERGYDWEDINDWILSIETGYSKHGNKLVIY
>NC_018492.1|WP_000022643.1|183581_184019_+|disulfide-bond-formation-protein-B
MSIIQKYHIAIAWTIATSAMLISLIFSEWMKLPPCDLCWYQRMAMYPLVLILGIGMYRKDSNVSIYAFPFACIGLIISVYQITIQAFPTSEMKICSVSVSCTEDYLNLFGFISIPMLSFVGFLAIIILLYIKPDKETKEQITQRV
>NC_018492.1|WP_000207868.1|184091_184385_+|winged-helix-turn-helix-transcriptional-regulator
MTTIQASNEMHKIPEADVELLKIMAHPVRLQIVKELEHRKICNVTQLTELLDIPQSTVSQHLSKMRGKILRSERRGLEMYYHIVNSKACQIVSVLGL
>NC_018492.1|WP_000288517.1|184692_184878_-|RNA-chaperone-Hfq
MYTQESFYTKLIEEKRLVTIFLLNGVRVPGIIIAVDKFSVLVSSHGKQQFIYKQAISTVSL
>NC_018492.1|WP_000637342.1|185205_186300_-|tetratricopeptide-repeat-protein
MIVSVKGNEQVTKMLNDWYIEIRARHVGKAHNLKLEIDQKIHNIEEDQNLLLYYALLDFRHQYMLDSLSIGKDSFDKVDSLGVPADQFLQYYYHFFKAIHSNITGDFTCAKEHYNQAELLLKHIPDEIEHAEFYFKLSTFHYHIYKPLAAIKEATKAKDIFKKHAGYETNIGLCDNLIGLACTHLKQFEEAEEHFITAINTFKKSGEEKNITFVRHNLGLMYSGQNLSELAIRYLSEVTQELPKDYKAIFIKAREHMKIGESKETYNLIVKGLEICKELKNEEYEHHFLILEKLNQKVSADELEKTIKTGISYFERENLHEYVQEYAKKLAVLFHQENNRSKASDYFYLSHQAEEQNFEKEALK
>NC_018492.1|WP_000788722.1|186854_187172_+|hypothetical-protein
MKNHTRDSKGQLLQTNKKWSHLKQKQCETISNWLRETYIEKIKVHNRRLKPREHEDVLSQVLFKIREHEIWITEYEVEKYYKGKINKWYNKHISLNLKNDNGGIM
>NC_018492.1|WP_000255411.1|187352_188105_+|hypothetical-protein
MVSVTQRISKIKQPRGGYVKPKDFDVIELNDGIVLYEEENIHSALTGLAVDYLTRFTMGTSLEKAFRISLIGASRVNEDDYAEELLSGINGLDDNSIENACKLVGFDTAHRAGIASYKSVQNIQPDFATISNIRNMVKRSRTFNDNFGPIVKDGFTFEGGYTQLISSGDGDFLTETTLWDFKVSKKDPTNKNTLQLLIYYLMGVHSIHSEFEQIEKLGIFNPRLNKVYLLAISAISDEIINDVNTTVIGY

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_018492_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_018492_2

178884-179043

TypeV-U3,TypeI-A?

V-U3

Consensus_repeat	Method
TTAAAACATAACAATAGATGTATTGAAAT	CRISPRCasFinder

2 spacers

c2c10_CAS-V-U3,csa3

The CRISPR arrays of NC_018492_2

>merge|NC_018492|2|178884-179043|CRISPRCasFinder
TTAAAACATAACAATAGATGTATTGAAATATATAAGCTATAGAAAACACTATACATGCAATATAACTTAAAACATAACGATAGATGTATTGAAATCTAGTTGTTAATTTGAATTGGGTATTTAACATTGTGTTTAAACGAATCGATAGATATTTAGCAAT

>NC_018492|2|2|178884-179043|CRISPRCasFinder
TTAAAACATAACAATAGATGTATTGAAAT	ATATAAGCTATAGAAAACACTATACATGCAATATAAC
TTAAAACATAACGATAGATGTATTGAAAT	CTAGTTGTTAATTTGAATTGGGTATTTAACATTGTG
TTTAAACGAATCGATAGATATTTAGCAAT

Protein	Signature genes	Signature genes Name	Protein_function
NC_018492.1\|WP_000288517.1\|184692_184878_-\|RNA-chaperone-Hfq	unknown	unknown	gnl\|CDD\|274101
NC_018492.1\|WP_000337715.1\|182028_182238_+\|hypothetical-protein	unknown	unknown	unknown
NC_018492.1\|WP_014893882.1\|172417_172996_-\|hypothetical-protein	unknown	unknown	unknown
NC_018492.1\|WP_000344164.1\|182975_183176_+\|hypothetical-protein	unknown	unknown	unknown
NC_018492.1\|WP_001024817.1\|171102_171732_+\|hypothetical-protein	unknown	unknown	unknown
NC_018492.1\|WP_000730713.1\|174983_175403_-\|hypothetical-protein	unknown	unknown	unknown
NC_018492.1\|WP_000817512.1\|171731_172367_+\|hypothetical-protein	unknown	unknown	unknown
NC_018492.1\|WP_000255411.1\|187352_188105_+\|hypothetical-protein	unknown	unknown	unknown
NC_018492.1\|WP_000708127.1\|182282_182924_+\|thermonuclease-family-protein	unknown	unknown	gnl\|CDD\|214615
NC_018492.1\|WP_000637342.1\|185205_186300_-\|tetratricopeptide-repeat-protein	unknown	unknown	gnl\|CDD\|376220
NC_018492.1\|WP_000914415.1\|175998_176427_-\|hypothetical-protein	unknown	unknown	unknown
NC_018492.1\|WP_071713414.1\|173731_174115_+\|hypothetical-protein	unknown	unknown	unknown
NC_018492.1\|WP_080120893.1\|176735_178097_+\|IS200/IS605-family-element-transposase-accessory-protein-TnpB	c2c10_CAS-V-U3	-	gnl\|CDD\|284650
NC_018492.1\|WP_000788722.1\|186854_187172_+\|hypothetical-protein	unknown	unknown	unknown
NC_018492.1\|WP_000207868.1\|184091_184385_+\|winged-helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|238042
NC_018492.1\|WP_000866032.1\|174131_174770_+\|NERD-domain-containing-protein	unknown	unknown	gnl\|CDD\|377990
NC_018492.1\|WP_000022643.1\|183581_184019_+\|disulfide-bond-formation-protein-B	unknown	unknown	gnl\|CDD\|179540
NC_018492.1\|WP_000084558.1\|183252_183540_+\|hypothetical-protein	unknown	unknown	unknown
NC_018492.1\|WP_000494366.1\|170052_170766_+\|hypothetical-protein	unknown	unknown	unknown
NC_018492.1\|WP_000916408.1\|173015_173606_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NC_018492.1\|WP_000288517.1\|184692_184878_-\|RNA-chaperone-Hfq	gnl\|CDD\|274101	TIGR02383, RNA-binding_protein_Hfq, RNA chaperone Hfq. This model represents the RNA-binding pleiotropic regulator Hfq, a small, Sm-like protein of bacteria. It helps pair regulatory noncoding RNAs with complementary mRNA target regions. It enhances the elongation of poly(A) tails on mRNA. It appears also to protect RNase E recognition sites (A/U-rich sequences with adjacent stem-loop structures) from cleavage. Being pleiotropic, it differs in some of its activities in different species. Hfq binds the non-coding regulatory RNA DsrA (see Rfam RF00014) in the few species known to have it: Escherichia coli, Shigella flexneri, Salmonella spp. In Azorhizobium caulinodans, an hfq mutant is unable to express nifA, and Hfq is called NrfA, for nif regulatory factor (see . The name hfq reflects phenomenology as a host factor for phage Q-beta RNA replication. [Regulatory functions, Other].	1.56154e-22
NC_018492.1\|WP_080120893.1\|176735_178097_+\|IS200/IS605-family-element-transposase-accessory-protein-TnpB	gnl\|CDD\|284650	pfam07282, OrfB_Zn_ribbon, Putative transposase DNA-binding domain. This putative domain is found at the C-terminus of a large number of transposase proteins. This domain contains four conserved cysteines suggestive of a zinc binding domain. Given the need for transposases to bind DNA as well as the large number of DNA-binding zinc fingers we hypothesize this domain is DNA-binding.	3.3593e-21
NC_018492.1\|WP_000207868.1\|184091_184385_+\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238042	cd00090, HTH_ARSR, Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to dissociate from DNA in the presence of metal ions.	1.42374e-11
NC_018492.1\|WP_000866032.1\|174131_174770_+\|NERD-domain-containing-protein	gnl\|CDD\|377990	pfam08378, NERD, Nuclease-related domain. The nuclease-related domain (NERD) is found in a range of bacterial as well as archaeal and plant proteins. It has distant similarity to endonucleases (hence its name) and its predicted secondary structure is helix - sheet - sheet - sheet - sheet - weak sheet/long loop - helix - sheet - sheet. The majority of NERD-containing proteins are single-domain, but in several cases proteins containing NERD have additional domains which in 75% of cases are involved in DNA processing.	1.80407e-26
NC_018492.1\|WP_000022643.1\|183581_184019_+\|disulfide-bond-formation-protein-B	gnl\|CDD\|179540	PRK03113, PRK03113, putative disulfide oxidoreductase; Provisional.	6.9737e-37
NC_018492.1\|WP_000708127.1\|182282_182924_+\|thermonuclease-family-protein	gnl\|CDD\|214615	smart00318, SNc, Staphylococcal nuclease homologues.	2.08842e-32
NC_018492.1\|WP_000637342.1\|185205_186300_-\|tetratricopeptide-repeat-protein	gnl\|CDD\|376220	pfam18801, RapH_N, response regulator aspartate phosphatase H, N terminal. Rap proteins consist of a N-terminal 3-helix bundle and a tetratricopeptide domain. This entry represents the conserved region of the C-terminal bundle.	4.93154e-26

>NC_018492.1|WP_080120893.1|176735_178097_+|IS200/IS605-family-element-transposase-accessory-protein-TnpB
MTYLSIAVKVMKYQIVCPVNIEWKTFEIYLRTLSYHFRTIGNRTIQKLWEYDNQSLKHFKDTGQYPSAQQLYGCTQKTISGYIYDQLKEEYQDINKANMSTTLQKTIKTWNSRKKEIWSGEMSIPSFRNNLPIDIHGNSIQIIKEKSGDYIASVSLFSSKFIKENDLPNGKILVKLSTRKQNSMKVILDRIIDSTYAKGSCMLHKHKKKWYLSITYKSNIKEELKFDEDLIMGIDMGKINVLYFAFNKGLVRGAISGEEIEAFRKKIEHRRISLLRQGKYCSGNRIGKGRKKRIKPIEVLNDKIAKFRNATNHKYANYIVQQCLKYNCGTIQLEDLQGISKEQTFLKNWTYFDLQEKIKNQANQYGIKVVKIDPSYTSQRCSECGYIHKNNRQNQSTFECQQCSFKVHADYNAAKNISVYNIEKVIQKQLKLQEKLNLTKYKEQYIEQMENIN
>NC_018492.1|WP_000914415.1|175998_176427_-|hypothetical-protein
MLKKLSVFLIGTLLLFGLAACDSIKSVASDVTVGKVIEEFKTAGLEAEQPSDLPEKEFGNTRKDAKRILVPALGEDSGGRIFEFKNKQDLEQAKKYYDDLGNGNQMLFSHTYAKGNFLLQMNGDMEDAKFNKYKEVMDKIIK
>NC_018492.1|WP_000730713.1|174983_175403_-|hypothetical-protein
MKKKTLVKSILSLALAACVAFPSIAGAEYDDFEGSVSGKKTVESSFNVDPGYGYVKLWFKNKGKNDVTITVKNIDTGKKYLTITLKPGKSYTWRSVNEWKGKAVGAGEYKVTYRDGTGGSVNVDYAGFSSNDEDEGRTA
>NC_018492.1|WP_000866032.1|174131_174770_+|NERD-domain-containing-protein
MKVLIFELVLIAILIPLNIVVKKHVPKWKGKAGEKLVKRILSKLDPKSYYVLHDVTVHTEYGDTTQIDHIVIAETGVFVIETKNYEGWIYGNEKSARWTQGIFRKKSSFQNPFRQNYKHIKAIEWLIEQQLPCISIVAFHPKCSLKRVNVQSKDKHVLYYNDLQKCIESYTETQLTNDEVQHIYQTILRADIMDKDIEKKHVKYLHNKFAKQ
>NC_018492.1|WP_071713414.1|173731_174115_+|hypothetical-protein
MKRNREYIALRNSILIGWLLTCIVIGLSIYFSSVVYLLIGCFILSLKYGLMGTVKNVEKRLPTWANFGVIEKPVNRRVTRPFQFRGGLLVSLALGFVEMVIKGLCISYFILGLETHVYRLMRRNARV
>NC_018492.1|WP_000916408.1|173015_173606_-|hypothetical-protein
MLKLVVDNTVTEPEPKTDSAFSNYFTCKDCVYYLSKSDSCSLQLAADSNSPLIPYECGNFEETYEIGTEDPLNSHIHQRLREEKAQILDESYPAQPAIDPIHKDAIWYGSVNYGCWIINDSKKRFALAEQVPFGDNNVSSKKYVSPFPLHDHGAKEGIRHYMCWYVNEKGIGEYHLLIGGVIMKIAEGVKKLGFNN
>NC_018492.1|WP_014893882.1|172417_172996_-|hypothetical-protein
MLEHTILFSLVQLVPLIISTSIIYMLLELTDTEWITWFSYEGIFAVLFLITRFQVFQNKKSIISLNQYEKWFSKLNIFLVSIFLVLFASIPTLLKIAFILQMTVILFLLEYLCLYINRLPIHNLYRVKEIICDKKQLKIERIIPNNEEHGTHTIKTSDEQYFIYTAVYLSGILSPISEEVFEEYERKNLMGR
>NC_018492.1|WP_000817512.1|171731_172367_+|hypothetical-protein
MKRDKGMIGVLCTLILMILLLVPLQAAQASVKVDFNELKGNDVSSSFKNGLNNRTKTTEKDDSFGSSIIQKIEGLYAPAFKVGVNIFSISFVLGVIVMVMALITKNGQWMKWATGSMIFSFISMMSMRLSVYFLFSSDVFSFMNIFTDFLDLFKATALIFTPFMLIAGIRLRRIHESTKQPEYYRWANRVITGSCLLCMLAVLAPWLFANM
>NC_018492.1|WP_001024817.1|171102_171732_+|hypothetical-protein
MNINSISNNVVEKLEQTVRYEKKQVQVLRVSKSSSNIHAYMIFPEFSEVKISNTELDEYIENLSTSVKYVIDRKLSQQEIEKQNHSFIMTCEVEEDGVIDDETIHFNTTYVKPPTIANKVFKLVCGLGNRLDSLKELHITVLNNNINRIEIEFYNENETYVAVEKEEIANAIMGAYTKANIYYAADLYYAAVGNEIKLKSIKPKLAGDV
>NC_018492.1|WP_000494366.1|170052_170766_+|hypothetical-protein
MFTKIFIGLFCYVFLVVRNSRKKFLIEEAKKKEMENKPVERPVYWCPRENRPIGREQERVTVPTKEITLEKDVANIYDLVATSVHKNLGEDDSDRLKHEDIEEVEYAEDFHHTPTPEAVYDISFPSDEDIPVELLEYEDMYPQQEYVSIPPETEHVFPVQQGVADVEDMDFVRWTAKVIKQEQGFARVINMSNKKRYWIHTEGEVLPKNQLLYMELEVDSPYSYTLVEWSNRQLGNI
>NC_018492.1|WP_000337715.1|182028_182238_+|hypothetical-protein
MCTTSVASTNVSFEKLKSQEENEKSMASICPNCKKRSFKELYNDYPKWIQFCLCCNYREVNTLESPFVY
>NC_018492.1|WP_000708127.1|182282_182924_+|thermonuclease-family-protein
MKIWIKAICITSFLFQMSACSSSTQMNDSKPAQTVQKGMQQHVEGKNIVNIPEAYKGKLKGLETVNGKVIHIKDGDTIDVNVKGEKQTVRLLLLDTPESVSQKIPPQKMGKEASSFLKKELDGKSVTLVYDQGPKEDKYGRKLAYVFCEGIHINELMIKSGYGIVAYISKPNTTLLPQMLESEKEAKASKTGVWNIKGYVDEEKHHYNRNDAA
>NC_018492.1|WP_000344164.1|182975_183176_+|hypothetical-protein
MDENKRNMLLSFIISILFIFASLLPFSNNEYVYVISKIGAAAGVINIVMMSVFLYFQSKKTRHLLN
>NC_018492.1|WP_000084558.1|183252_183540_+|hypothetical-protein
MSQVPGFLKFVLAKERRYVYLAVAEKKNKRVHTHIVYGFGPLEKALETMYEMRDDFENLFPLELKERGYDWEDINDWILSIETGYSKHGNKLVIY
>NC_018492.1|WP_000022643.1|183581_184019_+|disulfide-bond-formation-protein-B
MSIIQKYHIAIAWTIATSAMLISLIFSEWMKLPPCDLCWYQRMAMYPLVLILGIGMYRKDSNVSIYAFPFACIGLIISVYQITIQAFPTSEMKICSVSVSCTEDYLNLFGFISIPMLSFVGFLAIIILLYIKPDKETKEQITQRV
>NC_018492.1|WP_000207868.1|184091_184385_+|winged-helix-turn-helix-transcriptional-regulator
MTTIQASNEMHKIPEADVELLKIMAHPVRLQIVKELEHRKICNVTQLTELLDIPQSTVSQHLSKMRGKILRSERRGLEMYYHIVNSKACQIVSVLGL
>NC_018492.1|WP_000288517.1|184692_184878_-|RNA-chaperone-Hfq
MYTQESFYTKLIEEKRLVTIFLLNGVRVPGIIIAVDKFSVLVSSHGKQQFIYKQAISTVSL
>NC_018492.1|WP_000637342.1|185205_186300_-|tetratricopeptide-repeat-protein
MIVSVKGNEQVTKMLNDWYIEIRARHVGKAHNLKLEIDQKIHNIEEDQNLLLYYALLDFRHQYMLDSLSIGKDSFDKVDSLGVPADQFLQYYYHFFKAIHSNITGDFTCAKEHYNQAELLLKHIPDEIEHAEFYFKLSTFHYHIYKPLAAIKEATKAKDIFKKHAGYETNIGLCDNLIGLACTHLKQFEEAEEHFITAINTFKKSGEEKNITFVRHNLGLMYSGQNLSELAIRYLSEVTQELPKDYKAIFIKAREHMKIGESKETYNLIVKGLEICKELKNEEYEHHFLILEKLNQKVSADELEKTIKTGISYFERENLHEYVQEYAKKLAVLFHQENNRSKASDYFYLSHQAEEQNFEKEALK
>NC_018492.1|WP_000788722.1|186854_187172_+|hypothetical-protein
MKNHTRDSKGQLLQTNKKWSHLKQKQCETISNWLRETYIEKIKVHNRRLKPREHEDVLSQVLFKIREHEIWITEYEVEKYYKGKINKWYNKHISLNLKNDNGGIM
>NC_018492.1|WP_000255411.1|187352_188105_+|hypothetical-protein
MVSVTQRISKIKQPRGGYVKPKDFDVIELNDGIVLYEEENIHSALTGLAVDYLTRFTMGTSLEKAFRISLIGASRVNEDDYAEELLSGINGLDDNSIENACKLVGFDTAHRAGIASYKSVQNIQPDFATISNIRNMVKRSRTFNDNFGPIVKDGFTFEGGYTQLISSGDGDFLTETTLWDFKVSKKDPTNKNTLQLLIYYLMGVHSIHSEFEQIEKLGIFNPRLNKVYLLAISAISDEIINDVNTTVIGY

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_018492_1	1.1\|178390\|35\|NC_018492\|PILER-CR	178390-178424	35	NZ_CP053930	Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence	75785-75819	0	1.0
NC_018492_1	1.1\|178390\|35\|NC_018492\|PILER-CR	178390-178424	35	NZ_CP009299	Bacillus cereus D17 plasmid unnamed, complete sequence	101608-101642	0	1.0
NC_018492_1	1.1\|178390\|35\|NC_018492\|PILER-CR	178390-178424	35	NZ_CP015728	Bacillus cereus strain A1 plasmid pBCA2, complete sequence	28425-28459	0	1.0
NC_018492_1	1.1\|178390\|35\|NC_018492\|PILER-CR	178390-178424	35	NC_018492	Bacillus cereus FRI-35 plasmid p01, complete sequence	178390-178424	0	1.0
NC_018492_1	1.1\|178390\|35\|NC_018492\|PILER-CR	178390-178424	35	NZ_CP033789	Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence	192921-192955	0	1.0
NC_018492_1	1.2\|178456\|35\|NC_018492\|PILER-CR	178456-178490	35	NZ_CP053930	Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence	75851-75885	0	1.0
NC_018492_1	1.2\|178456\|35\|NC_018492\|PILER-CR	178456-178490	35	NZ_CP009299	Bacillus cereus D17 plasmid unnamed, complete sequence	101542-101576	0	1.0
NC_018492_1	1.2\|178456\|35\|NC_018492\|PILER-CR	178456-178490	35	NC_018492	Bacillus cereus FRI-35 plasmid p01, complete sequence	178456-178490	0	1.0
NC_018492_1	1.2\|178456\|35\|NC_018492\|PILER-CR	178456-178490	35	NZ_CP033789	Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence	192987-193021	0	1.0
NC_018492_1	1.3\|178389\|36\|NC_018492\|CRT	178389-178424	36	NZ_CP009299	Bacillus cereus D17 plasmid unnamed, complete sequence	101608-101643	0	1.0
NC_018492_1	1.3\|178389\|36\|NC_018492\|CRT	178389-178424	36	NZ_CP015728	Bacillus cereus strain A1 plasmid pBCA2, complete sequence	28425-28460	0	1.0
NC_018492_1	1.3\|178389\|36\|NC_018492\|CRT	178389-178424	36	NZ_CP053930	Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence	75784-75819	0	1.0
NC_018492_1	1.3\|178389\|36\|NC_018492\|CRT	178389-178424	36	NC_018492	Bacillus cereus FRI-35 plasmid p01, complete sequence	178389-178424	0	1.0
NC_018492_1	1.3\|178389\|36\|NC_018492\|CRT	178389-178424	36	NZ_CP033789	Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence	192920-192955	0	1.0
NC_018492_1	1.4\|178455\|36\|NC_018492\|CRT	178455-178490	36	NZ_CP053930	Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence	75850-75885	0	1.0
NC_018492_1	1.4\|178455\|36\|NC_018492\|CRT	178455-178490	36	NC_018492	Bacillus cereus FRI-35 plasmid p01, complete sequence	178455-178490	0	1.0
NC_018492_1	1.4\|178455\|36\|NC_018492\|CRT	178455-178490	36	NZ_CP033789	Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence	192986-193021	0	1.0
NC_018492_1	1.4\|178455\|36\|NC_018492\|CRT	178455-178490	36	NZ_CP009299	Bacillus cereus D17 plasmid unnamed, complete sequence	101542-101577	0	1.0
NC_018492_1	1.5\|178521\|37\|NC_018492\|CRT	178521-178557	37	NZ_CP018936	Bacillus cereus strain JEM-2 plasmid unnamed1, complete sequence	1861-1897	0	1.0
NC_018492_1	1.5\|178521\|37\|NC_018492\|CRT	178521-178557	37	NZ_CP018936	Bacillus cereus strain JEM-2 plasmid unnamed1, complete sequence	77751-77787	0	1.0
NC_018492_1	1.5\|178521\|37\|NC_018492\|CRT	178521-178557	37	NZ_CP053930	Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence	75916-75952	0	1.0
NC_018492_1	1.5\|178521\|37\|NC_018492\|CRT	178521-178557	37	NZ_CP018932	Bacillus cereus strain ISSFR-3F plasmid unnamed, complete sequence	68459-68495	0	1.0
NC_018492_1	1.5\|178521\|37\|NC_018492\|CRT	178521-178557	37	NC_018492	Bacillus cereus FRI-35 plasmid p01, complete sequence	178521-178557	0	1.0
NC_018492_1	1.5\|178521\|37\|NC_018492\|CRT	178521-178557	37	NZ_CP033789	Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence	193052-193088	0	1.0
NC_018492_1	1.5\|178521\|37\|NC_018492\|CRT	178521-178557	37	NZ_CP018934	Bacillus cereus strain ISSFR-9F plasmid unnamed1, complete sequence	68181-68217	0	1.0
NC_018492_1	1.5\|178521\|37\|NC_018492\|CRT	178521-178557	37	NZ_CP009299	Bacillus cereus D17 plasmid unnamed, complete sequence	101475-101511	0	1.0
NC_018492_1	1.6\|178389\|37\|NC_018492\|CRISPRCasFinder	178389-178425	37	NZ_CP053930	Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence	75784-75820	0	1.0
NC_018492_1	1.6\|178389\|37\|NC_018492\|CRISPRCasFinder	178389-178425	37	NZ_CP009299	Bacillus cereus D17 plasmid unnamed, complete sequence	101607-101643	0	1.0
NC_018492_1	1.6\|178389\|37\|NC_018492\|CRISPRCasFinder	178389-178425	37	NZ_CP015728	Bacillus cereus strain A1 plasmid pBCA2, complete sequence	28424-28460	0	1.0
NC_018492_1	1.6\|178389\|37\|NC_018492\|CRISPRCasFinder	178389-178425	37	NC_018492	Bacillus cereus FRI-35 plasmid p01, complete sequence	178389-178425	0	1.0
NC_018492_1	1.6\|178389\|37\|NC_018492\|CRISPRCasFinder	178389-178425	37	NZ_CP033789	Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence	192920-192956	0	1.0
NC_018492_1	1.7\|178455\|37\|NC_018492\|CRISPRCasFinder	178455-178491	37	NZ_CP053930	Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence	75850-75886	0	1.0
NC_018492_1	1.7\|178455\|37\|NC_018492\|CRISPRCasFinder	178455-178491	37	NC_018492	Bacillus cereus FRI-35 plasmid p01, complete sequence	178455-178491	0	1.0
NC_018492_1	1.7\|178455\|37\|NC_018492\|CRISPRCasFinder	178455-178491	37	NZ_CP033789	Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence	192986-193022	0	1.0
NC_018492_1	1.7\|178455\|37\|NC_018492\|CRISPRCasFinder	178455-178491	37	NZ_CP009299	Bacillus cereus D17 plasmid unnamed, complete sequence	101541-101577	0	1.0
NC_018492_1	1.8\|178521\|38\|NC_018492\|CRISPRCasFinder	178521-178558	38	NZ_CP053930	Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence	75916-75953	0	1.0
NC_018492_1	1.8\|178521\|38\|NC_018492\|CRISPRCasFinder	178521-178558	38	NC_018492	Bacillus cereus FRI-35 plasmid p01, complete sequence	178521-178558	0	1.0
NC_018492_1	1.8\|178521\|38\|NC_018492\|CRISPRCasFinder	178521-178558	38	NZ_CP033789	Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence	193052-193089	0	1.0
NC_018492_1	1.8\|178521\|38\|NC_018492\|CRISPRCasFinder	178521-178558	38	NZ_CP009299	Bacillus cereus D17 plasmid unnamed, complete sequence	101474-101511	0	1.0
NC_018492_2	2.1\|178913\|37\|NC_018492\|CRISPRCasFinder	178913-178949	37	NC_018492	Bacillus cereus FRI-35 plasmid p01, complete sequence	178913-178949	0	1.0
NC_018492_2	2.2\|178979\|36\|NC_018492\|CRISPRCasFinder	178979-179014	36	NC_018492	Bacillus cereus FRI-35 plasmid p01, complete sequence	178979-179014	0	1.0
NC_018492_1	1.1\|178390\|35\|NC_018492\|PILER-CR	178390-178424	35	NZ_CP014285	Bacillus thuringiensis strain Bt185 plasmid pBT1850055, complete sequence	30747-30781	1	0.971
NC_018492_1	1.1\|178390\|35\|NC_018492\|PILER-CR	178390-178424	35	NZ_CP032612	Bacillus thuringiensis strain QZL38 plasmid p.4, complete sequence	31058-31092	1	0.971
NC_018492_1	1.1\|178390\|35\|NC_018492\|PILER-CR	178390-178424	35	NZ_CP040339	Bacillus luti strain FJ plasmid unnamed3, complete sequence	10170-10204	1	0.971
NC_018492_1	1.1\|178390\|35\|NC_018492\|PILER-CR	178390-178424	35	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	229028-229062	1	0.971
NC_018492_1	1.3\|178389\|36\|NC_018492\|CRT	178389-178424	36	NZ_CP014285	Bacillus thuringiensis strain Bt185 plasmid pBT1850055, complete sequence	30747-30782	1	0.972
NC_018492_1	1.3\|178389\|36\|NC_018492\|CRT	178389-178424	36	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	229028-229063	1	0.972
NC_018492_1	1.3\|178389\|36\|NC_018492\|CRT	178389-178424	36	NZ_CP032612	Bacillus thuringiensis strain QZL38 plasmid p.4, complete sequence	31057-31092	1	0.972
NC_018492_1	1.3\|178389\|36\|NC_018492\|CRT	178389-178424	36	NZ_CP040339	Bacillus luti strain FJ plasmid unnamed3, complete sequence	10169-10204	1	0.972
NC_018492_1	1.5\|178521\|37\|NC_018492\|CRT	178521-178557	37	NC_006578	[Bacillus thuringiensis] serovar konkukian str. 97-27 plasmid pBT9727, complete sequence	34288-34324	1	0.973
NC_018492_1	1.5\|178521\|37\|NC_018492\|CRT	178521-178557	37	NZ_CP053978	Bacillus thuringiensis strain FDAARGOS_795 plasmid unnamed2, complete sequence	51694-51730	1	0.973
NC_018492_1	1.5\|178521\|37\|NC_018492\|CRT	178521-178557	37	NZ_CP014852	Bacillus thuringiensis strain HD12 plasmid pHD120161, complete sequence	141211-141247	1	0.973
NC_018492_1	1.5\|178521\|37\|NC_018492\|CRT	178521-178557	37	NZ_CP014852	Bacillus thuringiensis strain HD12 plasmid pHD120161, complete sequence	122405-122441	1	0.973
NC_018492_1	1.5\|178521\|37\|NC_018492\|CRT	178521-178557	37	NZ_CP009333	Bacillus thuringiensis strain HD1011 plasmid 4, complete sequence	65509-65545	1	0.973
NC_018492_1	1.5\|178521\|37\|NC_018492\|CRT	178521-178557	37	NZ_CP019234	Bacillus thuringiensis strain YGd22-03 plasmid pYGD83, complete sequence	4166-4202	1	0.973
NC_018492_1	1.5\|178521\|37\|NC_018492\|CRT	178521-178557	37	NZ_CP053937	Bacillus thuringiensis strain FDAARGOS_792 plasmid unnamed, complete sequence	76378-76414	1	0.973
NC_018492_1	1.5\|178521\|37\|NC_018492\|CRT	178521-178557	37	NZ_CP034684	Bacillus sp. BD59S plasmid pBTBD59S1, complete sequence	87139-87175	1	0.973
NC_018492_1	1.5\|178521\|37\|NC_018492\|CRT	178521-178557	37	NZ_CP010087	Bacillus thuringiensis strain 97-27 plasmid unnamed, complete sequence	61179-61215	1	0.973
NC_018492_1	1.6\|178389\|37\|NC_018492\|CRISPRCasFinder	178389-178425	37	NZ_CP014285	Bacillus thuringiensis strain Bt185 plasmid pBT1850055, complete sequence	30746-30782	1	0.973
NC_018492_1	1.6\|178389\|37\|NC_018492\|CRISPRCasFinder	178389-178425	37	NZ_CP032612	Bacillus thuringiensis strain QZL38 plasmid p.4, complete sequence	31057-31093	1	0.973
NC_018492_1	1.6\|178389\|37\|NC_018492\|CRISPRCasFinder	178389-178425	37	NZ_CP040339	Bacillus luti strain FJ plasmid unnamed3, complete sequence	10169-10205	1	0.973
NC_018492_1	1.6\|178389\|37\|NC_018492\|CRISPRCasFinder	178389-178425	37	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	229027-229063	1	0.973
NC_018492_1	1.8\|178521\|38\|NC_018492\|CRISPRCasFinder	178521-178558	38	NZ_CP018936	Bacillus cereus strain JEM-2 plasmid unnamed1, complete sequence	1861-1898	1	0.974
NC_018492_1	1.8\|178521\|38\|NC_018492\|CRISPRCasFinder	178521-178558	38	NZ_CP018936	Bacillus cereus strain JEM-2 plasmid unnamed1, complete sequence	77751-77788	1	0.974
NC_018492_1	1.8\|178521\|38\|NC_018492\|CRISPRCasFinder	178521-178558	38	NZ_CP018932	Bacillus cereus strain ISSFR-3F plasmid unnamed, complete sequence	68459-68496	1	0.974
NC_018492_1	1.8\|178521\|38\|NC_018492\|CRISPRCasFinder	178521-178558	38	NZ_CP018934	Bacillus cereus strain ISSFR-9F plasmid unnamed1, complete sequence	68180-68217	1	0.974
NC_018492_1	1.1\|178390\|35\|NC_018492\|PILER-CR	178390-178424	35	NZ_CP009594	Bacillus cereus strain 3a plasmid pBFC_2, complete sequence	12853-12887	2	0.943
NC_018492_1	1.1\|178390\|35\|NC_018492\|PILER-CR	178390-178424	35	NZ_CP016597	Bacillus cereus strain K8 plasmid pBCK802, complete sequence	18682-18716	2	0.943
NC_018492_1	1.1\|178390\|35\|NC_018492\|PILER-CR	178390-178424	35	NZ_CP009603	Bacillus cereus strain S2-8 plasmid pBFR_3, complete sequence	36970-37004	2	0.943
NC_018492_1	1.1\|178390\|35\|NC_018492\|PILER-CR	178390-178424	35	NC_007105	Bacillus cereus E33L plasmid pE33L54, complete sequence	6377-6411	2	0.943
NC_018492_1	1.1\|178390\|35\|NC_018492\|PILER-CR	178390-178424	35	NZ_CP010109	Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-3, complete sequence	39234-39268	2	0.943
NC_018492_1	1.1\|178390\|35\|NC_018492\|PILER-CR	178390-178424	35	NZ_CP053996	Bacillus cereus strain FDAARGOS_780 plasmid unnamed3, complete sequence	25999-26033	2	0.943
NC_018492_1	1.1\|178390\|35\|NC_018492\|PILER-CR	178390-178424	35	NZ_CP009966	Bacillus cereus E33L plasmid pBCO_2, complete sequence	6946-6980	2	0.943
NC_018492_1	1.1\|178390\|35\|NC_018492\|PILER-CR	178390-178424	35	NZ_CP053990	Bacillus cereus strain FDAARGOS_781 plasmid unnamed1, complete sequence	40708-40742	2	0.943
NC_018492_1	1.1\|178390\|35\|NC_018492\|PILER-CR	178390-178424	35	NZ_CP029457	Bacillus cereus strain FORC087 plasmid pFORC087.3, complete sequence	11865-11899	2	0.943
NC_018492_1	1.1\|178390\|35\|NC_018492\|PILER-CR	178390-178424	35	NZ_CP033790	Bacillus sp. FDAARGOS_527 plasmid unnamed3, complete sequence	52269-52303	2	0.943
NC_018492_1	1.3\|178389\|36\|NC_018492\|CRT	178389-178424	36	NZ_CP009594	Bacillus cereus strain 3a plasmid pBFC_2, complete sequence	12853-12888	2	0.944
NC_018492_1	1.3\|178389\|36\|NC_018492\|CRT	178389-178424	36	NZ_CP009603	Bacillus cereus strain S2-8 plasmid pBFR_3, complete sequence	36970-37005	2	0.944
NC_018492_1	1.3\|178389\|36\|NC_018492\|CRT	178389-178424	36	NZ_CP010109	Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-3, complete sequence	39234-39269	2	0.944
NC_018492_1	1.3\|178389\|36\|NC_018492\|CRT	178389-178424	36	NZ_CP016597	Bacillus cereus strain K8 plasmid pBCK802, complete sequence	18681-18716	2	0.944
NC_018492_1	1.3\|178389\|36\|NC_018492\|CRT	178389-178424	36	NZ_CP053996	Bacillus cereus strain FDAARGOS_780 plasmid unnamed3, complete sequence	25998-26033	2	0.944
NC_018492_1	1.3\|178389\|36\|NC_018492\|CRT	178389-178424	36	NZ_CP053990	Bacillus cereus strain FDAARGOS_781 plasmid unnamed1, complete sequence	40707-40742	2	0.944
NC_018492_1	1.3\|178389\|36\|NC_018492\|CRT	178389-178424	36	NZ_CP029457	Bacillus cereus strain FORC087 plasmid pFORC087.3, complete sequence	11865-11900	2	0.944
NC_018492_1	1.3\|178389\|36\|NC_018492\|CRT	178389-178424	36	NZ_CP033790	Bacillus sp. FDAARGOS_527 plasmid unnamed3, complete sequence	52269-52304	2	0.944
NC_018492_1	1.3\|178389\|36\|NC_018492\|CRT	178389-178424	36	NC_007105	Bacillus cereus E33L plasmid pE33L54, complete sequence	6376-6411	2	0.944
NC_018492_1	1.3\|178389\|36\|NC_018492\|CRT	178389-178424	36	NZ_CP009966	Bacillus cereus E33L plasmid pBCO_2, complete sequence	6945-6980	2	0.944
NC_018492_1	1.6\|178389\|37\|NC_018492\|CRISPRCasFinder	178389-178425	37	NZ_CP009594	Bacillus cereus strain 3a plasmid pBFC_2, complete sequence	12852-12888	2	0.946
NC_018492_1	1.6\|178389\|37\|NC_018492\|CRISPRCasFinder	178389-178425	37	NZ_CP016597	Bacillus cereus strain K8 plasmid pBCK802, complete sequence	18681-18717	2	0.946
NC_018492_1	1.6\|178389\|37\|NC_018492\|CRISPRCasFinder	178389-178425	37	NZ_CP009603	Bacillus cereus strain S2-8 plasmid pBFR_3, complete sequence	36969-37005	2	0.946
NC_018492_1	1.6\|178389\|37\|NC_018492\|CRISPRCasFinder	178389-178425	37	NC_007105	Bacillus cereus E33L plasmid pE33L54, complete sequence	6376-6412	2	0.946
NC_018492_1	1.6\|178389\|37\|NC_018492\|CRISPRCasFinder	178389-178425	37	NZ_CP029457	Bacillus cereus strain FORC087 plasmid pFORC087.3, complete sequence	11864-11900	2	0.946
NC_018492_1	1.6\|178389\|37\|NC_018492\|CRISPRCasFinder	178389-178425	37	NZ_CP010109	Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-3, complete sequence	39233-39269	2	0.946
NC_018492_1	1.6\|178389\|37\|NC_018492\|CRISPRCasFinder	178389-178425	37	NZ_CP053996	Bacillus cereus strain FDAARGOS_780 plasmid unnamed3, complete sequence	25998-26034	2	0.946
NC_018492_1	1.6\|178389\|37\|NC_018492\|CRISPRCasFinder	178389-178425	37	NZ_CP009966	Bacillus cereus E33L plasmid pBCO_2, complete sequence	6945-6981	2	0.946
NC_018492_1	1.6\|178389\|37\|NC_018492\|CRISPRCasFinder	178389-178425	37	NZ_CP033790	Bacillus sp. FDAARGOS_527 plasmid unnamed3, complete sequence	52268-52304	2	0.946
NC_018492_1	1.6\|178389\|37\|NC_018492\|CRISPRCasFinder	178389-178425	37	NZ_CP053990	Bacillus cereus strain FDAARGOS_781 plasmid unnamed1, complete sequence	40707-40743	2	0.946
NC_018492_1	1.8\|178521\|38\|NC_018492\|CRISPRCasFinder	178521-178558	38	NC_006578	[Bacillus thuringiensis] serovar konkukian str. 97-27 plasmid pBT9727, complete sequence	34288-34325	2	0.947
NC_018492_1	1.8\|178521\|38\|NC_018492\|CRISPRCasFinder	178521-178558	38	NZ_CP053978	Bacillus thuringiensis strain FDAARGOS_795 plasmid unnamed2, complete sequence	51694-51731	2	0.947
NC_018492_1	1.8\|178521\|38\|NC_018492\|CRISPRCasFinder	178521-178558	38	NZ_CP014852	Bacillus thuringiensis strain HD12 plasmid pHD120161, complete sequence	141211-141248	2	0.947
NC_018492_1	1.8\|178521\|38\|NC_018492\|CRISPRCasFinder	178521-178558	38	NZ_CP014852	Bacillus thuringiensis strain HD12 plasmid pHD120161, complete sequence	122404-122441	2	0.947
NC_018492_1	1.8\|178521\|38\|NC_018492\|CRISPRCasFinder	178521-178558	38	NZ_CP009333	Bacillus thuringiensis strain HD1011 plasmid 4, complete sequence	65509-65546	2	0.947
NC_018492_1	1.8\|178521\|38\|NC_018492\|CRISPRCasFinder	178521-178558	38	NZ_CP019234	Bacillus thuringiensis strain YGd22-03 plasmid pYGD83, complete sequence	4165-4202	2	0.947
NC_018492_1	1.8\|178521\|38\|NC_018492\|CRISPRCasFinder	178521-178558	38	NZ_CP053937	Bacillus thuringiensis strain FDAARGOS_792 plasmid unnamed, complete sequence	76377-76414	2	0.947
NC_018492_1	1.8\|178521\|38\|NC_018492\|CRISPRCasFinder	178521-178558	38	NZ_CP034684	Bacillus sp. BD59S plasmid pBTBD59S1, complete sequence	87138-87175	2	0.947
NC_018492_1	1.8\|178521\|38\|NC_018492\|CRISPRCasFinder	178521-178558	38	NZ_CP010087	Bacillus thuringiensis strain 97-27 plasmid unnamed, complete sequence	61178-61215	2	0.947
NC_018492_2	2.1\|178913\|37\|NC_018492\|CRISPRCasFinder	178913-178949	37	NZ_CP019039	Bacillus velezensis strain GH1-13 plasmid unnamed, complete sequence	45064-45100	8	0.784

1. spacer 1.1|178390|35|NC_018492|PILER-CR matches to NZ_CP053930 (Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gatccacctctacaatgtgataacggccattatcc	CRISPR spacer
gatccacctctacaatgtgataacggccattatcc	Protospacer
***********************************

2. spacer 1.1|178390|35|NC_018492|PILER-CR matches to NZ_CP009299 (Bacillus cereus D17 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gatccacctctacaatgtgataacggccattatcc	CRISPR spacer
gatccacctctacaatgtgataacggccattatcc	Protospacer
***********************************

3. spacer 1.1|178390|35|NC_018492|PILER-CR matches to NZ_CP015728 (Bacillus cereus strain A1 plasmid pBCA2, complete sequence) position: , mismatch: 0, identity: 1.0

gatccacctctacaatgtgataacggccattatcc	CRISPR spacer
gatccacctctacaatgtgataacggccattatcc	Protospacer
***********************************

4. spacer 1.1|178390|35|NC_018492|PILER-CR matches to NC_018492 (Bacillus cereus FRI-35 plasmid p01, complete sequence) position: , mismatch: 0, identity: 1.0

gatccacctctacaatgtgataacggccattatcc	CRISPR spacer
gatccacctctacaatgtgataacggccattatcc	Protospacer
***********************************

5. spacer 1.1|178390|35|NC_018492|PILER-CR matches to NZ_CP033789 (Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

gatccacctctacaatgtgataacggccattatcc	CRISPR spacer
gatccacctctacaatgtgataacggccattatcc	Protospacer
***********************************

6. spacer 1.2|178456|35|NC_018492|PILER-CR matches to NZ_CP053930 (Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

taagtcattatatgacaccgtatgctatgtggatt	CRISPR spacer
taagtcattatatgacaccgtatgctatgtggatt	Protospacer
***********************************

7. spacer 1.2|178456|35|NC_018492|PILER-CR matches to NZ_CP009299 (Bacillus cereus D17 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

taagtcattatatgacaccgtatgctatgtggatt	CRISPR spacer
taagtcattatatgacaccgtatgctatgtggatt	Protospacer
***********************************

8. spacer 1.2|178456|35|NC_018492|PILER-CR matches to NC_018492 (Bacillus cereus FRI-35 plasmid p01, complete sequence) position: , mismatch: 0, identity: 1.0

taagtcattatatgacaccgtatgctatgtggatt	CRISPR spacer
taagtcattatatgacaccgtatgctatgtggatt	Protospacer
***********************************

9. spacer 1.2|178456|35|NC_018492|PILER-CR matches to NZ_CP033789 (Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

taagtcattatatgacaccgtatgctatgtggatt	CRISPR spacer
taagtcattatatgacaccgtatgctatgtggatt	Protospacer
***********************************

10. spacer 1.3|178389|36|NC_018492|CRT matches to NZ_CP009299 (Bacillus cereus D17 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

tgatccacctctacaatgtgataacggccattatcc	CRISPR spacer
tgatccacctctacaatgtgataacggccattatcc	Protospacer
************************************

11. spacer 1.3|178389|36|NC_018492|CRT matches to NZ_CP015728 (Bacillus cereus strain A1 plasmid pBCA2, complete sequence) position: , mismatch: 0, identity: 1.0

tgatccacctctacaatgtgataacggccattatcc	CRISPR spacer
tgatccacctctacaatgtgataacggccattatcc	Protospacer
************************************

12. spacer 1.3|178389|36|NC_018492|CRT matches to NZ_CP053930 (Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tgatccacctctacaatgtgataacggccattatcc	CRISPR spacer
tgatccacctctacaatgtgataacggccattatcc	Protospacer
************************************

13. spacer 1.3|178389|36|NC_018492|CRT matches to NC_018492 (Bacillus cereus FRI-35 plasmid p01, complete sequence) position: , mismatch: 0, identity: 1.0

tgatccacctctacaatgtgataacggccattatcc	CRISPR spacer
tgatccacctctacaatgtgataacggccattatcc	Protospacer
************************************

14. spacer 1.3|178389|36|NC_018492|CRT matches to NZ_CP033789 (Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

tgatccacctctacaatgtgataacggccattatcc	CRISPR spacer
tgatccacctctacaatgtgataacggccattatcc	Protospacer
************************************

15. spacer 1.4|178455|36|NC_018492|CRT matches to NZ_CP053930 (Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

ttaagtcattatatgacaccgtatgctatgtggatt	CRISPR spacer
ttaagtcattatatgacaccgtatgctatgtggatt	Protospacer
************************************

16. spacer 1.4|178455|36|NC_018492|CRT matches to NC_018492 (Bacillus cereus FRI-35 plasmid p01, complete sequence) position: , mismatch: 0, identity: 1.0

ttaagtcattatatgacaccgtatgctatgtggatt	CRISPR spacer
ttaagtcattatatgacaccgtatgctatgtggatt	Protospacer
************************************

17. spacer 1.4|178455|36|NC_018492|CRT matches to NZ_CP033789 (Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

ttaagtcattatatgacaccgtatgctatgtggatt	CRISPR spacer
ttaagtcattatatgacaccgtatgctatgtggatt	Protospacer
************************************

18. spacer 1.4|178455|36|NC_018492|CRT matches to NZ_CP009299 (Bacillus cereus D17 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

ttaagtcattatatgacaccgtatgctatgtggatt	CRISPR spacer
ttaagtcattatatgacaccgtatgctatgtggatt	Protospacer
************************************

19. spacer 1.5|178521|37|NC_018492|CRT matches to NZ_CP018936 (Bacillus cereus strain JEM-2 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caaacaagattacaactattgaacaatgtcgtcaatc	CRISPR spacer
caaacaagattacaactattgaacaatgtcgtcaatc	Protospacer
*************************************

20. spacer 1.5|178521|37|NC_018492|CRT matches to NZ_CP018936 (Bacillus cereus strain JEM-2 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caaacaagattacaactattgaacaatgtcgtcaatc	CRISPR spacer
caaacaagattacaactattgaacaatgtcgtcaatc	Protospacer
*************************************

21. spacer 1.5|178521|37|NC_018492|CRT matches to NZ_CP053930 (Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caaacaagattacaactattgaacaatgtcgtcaatc	CRISPR spacer
caaacaagattacaactattgaacaatgtcgtcaatc	Protospacer
*************************************

22. spacer 1.5|178521|37|NC_018492|CRT matches to NZ_CP018932 (Bacillus cereus strain ISSFR-3F plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

caaacaagattacaactattgaacaatgtcgtcaatc	CRISPR spacer
caaacaagattacaactattgaacaatgtcgtcaatc	Protospacer
*************************************

23. spacer 1.5|178521|37|NC_018492|CRT matches to NC_018492 (Bacillus cereus FRI-35 plasmid p01, complete sequence) position: , mismatch: 0, identity: 1.0

caaacaagattacaactattgaacaatgtcgtcaatc	CRISPR spacer
caaacaagattacaactattgaacaatgtcgtcaatc	Protospacer
*************************************

24. spacer 1.5|178521|37|NC_018492|CRT matches to NZ_CP033789 (Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

caaacaagattacaactattgaacaatgtcgtcaatc	CRISPR spacer
caaacaagattacaactattgaacaatgtcgtcaatc	Protospacer
*************************************

25. spacer 1.5|178521|37|NC_018492|CRT matches to NZ_CP018934 (Bacillus cereus strain ISSFR-9F plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caaacaagattacaactattgaacaatgtcgtcaatc	CRISPR spacer
caaacaagattacaactattgaacaatgtcgtcaatc	Protospacer
*************************************

26. spacer 1.5|178521|37|NC_018492|CRT matches to NZ_CP009299 (Bacillus cereus D17 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

caaacaagattacaactattgaacaatgtcgtcaatc	CRISPR spacer
caaacaagattacaactattgaacaatgtcgtcaatc	Protospacer
*************************************

27. spacer 1.6|178389|37|NC_018492|CRISPRCasFinder matches to NZ_CP053930 (Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tgatccacctctacaatgtgataacggccattatccg	CRISPR spacer
tgatccacctctacaatgtgataacggccattatccg	Protospacer
*************************************

28. spacer 1.6|178389|37|NC_018492|CRISPRCasFinder matches to NZ_CP009299 (Bacillus cereus D17 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

tgatccacctctacaatgtgataacggccattatccg	CRISPR spacer
tgatccacctctacaatgtgataacggccattatccg	Protospacer
*************************************

29. spacer 1.6|178389|37|NC_018492|CRISPRCasFinder matches to NZ_CP015728 (Bacillus cereus strain A1 plasmid pBCA2, complete sequence) position: , mismatch: 0, identity: 1.0

tgatccacctctacaatgtgataacggccattatccg	CRISPR spacer
tgatccacctctacaatgtgataacggccattatccg	Protospacer
*************************************

30. spacer 1.6|178389|37|NC_018492|CRISPRCasFinder matches to NC_018492 (Bacillus cereus FRI-35 plasmid p01, complete sequence) position: , mismatch: 0, identity: 1.0

tgatccacctctacaatgtgataacggccattatccg	CRISPR spacer
tgatccacctctacaatgtgataacggccattatccg	Protospacer
*************************************

31. spacer 1.6|178389|37|NC_018492|CRISPRCasFinder matches to NZ_CP033789 (Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

tgatccacctctacaatgtgataacggccattatccg	CRISPR spacer
tgatccacctctacaatgtgataacggccattatccg	Protospacer
*************************************

32. spacer 1.7|178455|37|NC_018492|CRISPRCasFinder matches to NZ_CP053930 (Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

ttaagtcattatatgacaccgtatgctatgtggattg	CRISPR spacer
ttaagtcattatatgacaccgtatgctatgtggattg	Protospacer
*************************************

33. spacer 1.7|178455|37|NC_018492|CRISPRCasFinder matches to NC_018492 (Bacillus cereus FRI-35 plasmid p01, complete sequence) position: , mismatch: 0, identity: 1.0

ttaagtcattatatgacaccgtatgctatgtggattg	CRISPR spacer
ttaagtcattatatgacaccgtatgctatgtggattg	Protospacer
*************************************

34. spacer 1.7|178455|37|NC_018492|CRISPRCasFinder matches to NZ_CP033789 (Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

ttaagtcattatatgacaccgtatgctatgtggattg	CRISPR spacer
ttaagtcattatatgacaccgtatgctatgtggattg	Protospacer
*************************************

35. spacer 1.7|178455|37|NC_018492|CRISPRCasFinder matches to NZ_CP009299 (Bacillus cereus D17 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

ttaagtcattatatgacaccgtatgctatgtggattg	CRISPR spacer
ttaagtcattatatgacaccgtatgctatgtggattg	Protospacer
*************************************

36. spacer 1.8|178521|38|NC_018492|CRISPRCasFinder matches to NZ_CP053930 (Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caaacaagattacaactattgaacaatgtcgtcaatcg	CRISPR spacer
caaacaagattacaactattgaacaatgtcgtcaatcg	Protospacer
**************************************

37. spacer 1.8|178521|38|NC_018492|CRISPRCasFinder matches to NC_018492 (Bacillus cereus FRI-35 plasmid p01, complete sequence) position: , mismatch: 0, identity: 1.0

caaacaagattacaactattgaacaatgtcgtcaatcg	CRISPR spacer
caaacaagattacaactattgaacaatgtcgtcaatcg	Protospacer
**************************************

38. spacer 1.8|178521|38|NC_018492|CRISPRCasFinder matches to NZ_CP033789 (Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

caaacaagattacaactattgaacaatgtcgtcaatcg	CRISPR spacer
caaacaagattacaactattgaacaatgtcgtcaatcg	Protospacer
**************************************

39. spacer 1.8|178521|38|NC_018492|CRISPRCasFinder matches to NZ_CP009299 (Bacillus cereus D17 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

caaacaagattacaactattgaacaatgtcgtcaatcg	CRISPR spacer
caaacaagattacaactattgaacaatgtcgtcaatcg	Protospacer
**************************************

40. spacer 2.1|178913|37|NC_018492|CRISPRCasFinder matches to NC_018492 (Bacillus cereus FRI-35 plasmid p01, complete sequence) position: , mismatch: 0, identity: 1.0

atataagctatagaaaacactatacatgcaatataac	CRISPR spacer
atataagctatagaaaacactatacatgcaatataac	Protospacer
*************************************

41. spacer 2.2|178979|36|NC_018492|CRISPRCasFinder matches to NC_018492 (Bacillus cereus FRI-35 plasmid p01, complete sequence) position: , mismatch: 0, identity: 1.0

ctagttgttaatttgaattgggtatttaacattgtg	CRISPR spacer
ctagttgttaatttgaattgggtatttaacattgtg	Protospacer
************************************

42. spacer 1.1|178390|35|NC_018492|PILER-CR matches to NZ_CP014285 (Bacillus thuringiensis strain Bt185 plasmid pBT1850055, complete sequence) position: , mismatch: 1, identity: 0.971

gatccacctctacaatgtgataacggccattatcc	CRISPR spacer
gatccacctctacaatgtggtaacggccattatcc	Protospacer
*******************.***************

43. spacer 1.1|178390|35|NC_018492|PILER-CR matches to NZ_CP032612 (Bacillus thuringiensis strain QZL38 plasmid p.4, complete sequence) position: , mismatch: 1, identity: 0.971

gatccacctctacaatgtgataacggccattatcc	CRISPR spacer
gatccacctctacaatgtggtaacggccattatcc	Protospacer
*******************.***************

44. spacer 1.1|178390|35|NC_018492|PILER-CR matches to NZ_CP040339 (Bacillus luti strain FJ plasmid unnamed3, complete sequence) position: , mismatch: 1, identity: 0.971

gatccacctctacaatgtgataacggccattatcc	CRISPR spacer
gatccacctctacaatgtaataacggccattatcc	Protospacer
******************.****************

45. spacer 1.1|178390|35|NC_018492|PILER-CR matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 1, identity: 0.971

gatccacctctacaatgtgataacggccattatcc	CRISPR spacer
gatccacctctacaatgtggtaacggccattatcc	Protospacer
*******************.***************

46. spacer 1.3|178389|36|NC_018492|CRT matches to NZ_CP014285 (Bacillus thuringiensis strain Bt185 plasmid pBT1850055, complete sequence) position: , mismatch: 1, identity: 0.972

tgatccacctctacaatgtgataacggccattatcc	CRISPR spacer
tgatccacctctacaatgtggtaacggccattatcc	Protospacer
********************.***************

47. spacer 1.3|178389|36|NC_018492|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 1, identity: 0.972

tgatccacctctacaatgtgataacggccattatcc	CRISPR spacer
tgatccacctctacaatgtggtaacggccattatcc	Protospacer
********************.***************

48. spacer 1.3|178389|36|NC_018492|CRT matches to NZ_CP032612 (Bacillus thuringiensis strain QZL38 plasmid p.4, complete sequence) position: , mismatch: 1, identity: 0.972

tgatccacctctacaatgtgataacggccattatcc	CRISPR spacer
tgatccacctctacaatgtggtaacggccattatcc	Protospacer
********************.***************

49. spacer 1.3|178389|36|NC_018492|CRT matches to NZ_CP040339 (Bacillus luti strain FJ plasmid unnamed3, complete sequence) position: , mismatch: 1, identity: 0.972

tgatccacctctacaatgtgataacggccattatcc	CRISPR spacer
tgatccacctctacaatgtaataacggccattatcc	Protospacer
*******************.****************

50. spacer 1.5|178521|37|NC_018492|CRT matches to NC_006578 ([Bacillus thuringiensis] serovar konkukian str. 97-27 plasmid pBT9727, complete sequence) position: , mismatch: 1, identity: 0.973

caaacaagattacaactattgaacaatgtcgtcaatc	CRISPR spacer
caaacaagattacaactattaaacaatgtcgtcaatc	Protospacer
********************.****************

51. spacer 1.5|178521|37|NC_018492|CRT matches to NZ_CP053978 (Bacillus thuringiensis strain FDAARGOS_795 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.973

caaacaagattacaactattgaacaatgtcgtcaatc	CRISPR spacer
caaacaagattacaactattaaacaatgtcgtcaatc	Protospacer
********************.****************

52. spacer 1.5|178521|37|NC_018492|CRT matches to NZ_CP014852 (Bacillus thuringiensis strain HD12 plasmid pHD120161, complete sequence) position: , mismatch: 1, identity: 0.973

caaacaagattacaactattgaacaatgtcgtcaatc	CRISPR spacer
caaacaagattacaactattgaacaatatcgtcaatc	Protospacer
***************************.*********

53. spacer 1.5|178521|37|NC_018492|CRT matches to NZ_CP014852 (Bacillus thuringiensis strain HD12 plasmid pHD120161, complete sequence) position: , mismatch: 1, identity: 0.973

caaacaagattacaactattgaacaatgtcgtcaatc	CRISPR spacer
caaacaagattacaactattgaacaatatcgtcaatc	Protospacer
***************************.*********

54. spacer 1.5|178521|37|NC_018492|CRT matches to NZ_CP009333 (Bacillus thuringiensis strain HD1011 plasmid 4, complete sequence) position: , mismatch: 1, identity: 0.973

caaacaagattacaactattgaacaatgtcgtcaatc	CRISPR spacer
caaacaagattacaactattaaacaatgtcgtcaatc	Protospacer
********************.****************

55. spacer 1.5|178521|37|NC_018492|CRT matches to NZ_CP019234 (Bacillus thuringiensis strain YGd22-03 plasmid pYGD83, complete sequence) position: , mismatch: 1, identity: 0.973

caaacaagattacaactattgaacaatgtcgtcaatc	CRISPR spacer
caaacaagattacaactattgcacaatgtcgtcaatc	Protospacer
********************* ***************

56. spacer 1.5|178521|37|NC_018492|CRT matches to NZ_CP053937 (Bacillus thuringiensis strain FDAARGOS_792 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.973

caaacaagattacaactattgaacaatgtcgtcaatc	CRISPR spacer
caaacaagattacaactattaaacaatgtcgtcaatc	Protospacer
********************.****************

57. spacer 1.5|178521|37|NC_018492|CRT matches to NZ_CP034684 (Bacillus sp. BD59S plasmid pBTBD59S1, complete sequence) position: , mismatch: 1, identity: 0.973

caaacaagattacaactattgaacaatgtcgtcaatc	CRISPR spacer
caaacaagattacaactattaaacaatgtcgtcaatc	Protospacer
********************.****************

58. spacer 1.5|178521|37|NC_018492|CRT matches to NZ_CP010087 (Bacillus thuringiensis strain 97-27 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.973

caaacaagattacaactattgaacaatgtcgtcaatc	CRISPR spacer
caaacaagattacaactattaaacaatgtcgtcaatc	Protospacer
********************.****************

59. spacer 1.6|178389|37|NC_018492|CRISPRCasFinder matches to NZ_CP014285 (Bacillus thuringiensis strain Bt185 plasmid pBT1850055, complete sequence) position: , mismatch: 1, identity: 0.973

tgatccacctctacaatgtgataacggccattatccg	CRISPR spacer
tgatccacctctacaatgtggtaacggccattatccg	Protospacer
********************.****************

60. spacer 1.6|178389|37|NC_018492|CRISPRCasFinder matches to NZ_CP032612 (Bacillus thuringiensis strain QZL38 plasmid p.4, complete sequence) position: , mismatch: 1, identity: 0.973

tgatccacctctacaatgtgataacggccattatccg	CRISPR spacer
tgatccacctctacaatgtggtaacggccattatccg	Protospacer
********************.****************

61. spacer 1.6|178389|37|NC_018492|CRISPRCasFinder matches to NZ_CP040339 (Bacillus luti strain FJ plasmid unnamed3, complete sequence) position: , mismatch: 1, identity: 0.973

tgatccacctctacaatgtgataacggccattatccg	CRISPR spacer
tgatccacctctacaatgtaataacggccattatccg	Protospacer
*******************.*****************

62. spacer 1.6|178389|37|NC_018492|CRISPRCasFinder matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 1, identity: 0.973

tgatccacctctacaatgtgataacggccattatccg	CRISPR spacer
tgatccacctctacaatgtggtaacggccattatccg	Protospacer
********************.****************

63. spacer 1.8|178521|38|NC_018492|CRISPRCasFinder matches to NZ_CP018936 (Bacillus cereus strain JEM-2 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.974

caaacaagattacaactattgaacaatgtcgtcaatcg	CRISPR spacer
caaacaagattacaactattgaacaatgtcgtcaatcc	Protospacer
*************************************

64. spacer 1.8|178521|38|NC_018492|CRISPRCasFinder matches to NZ_CP018936 (Bacillus cereus strain JEM-2 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.974

caaacaagattacaactattgaacaatgtcgtcaatcg	CRISPR spacer
caaacaagattacaactattgaacaatgtcgtcaatcc	Protospacer
*************************************

65. spacer 1.8|178521|38|NC_018492|CRISPRCasFinder matches to NZ_CP018932 (Bacillus cereus strain ISSFR-3F plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.974

caaacaagattacaactattgaacaatgtcgtcaatcg	CRISPR spacer
caaacaagattacaactattgaacaatgtcgtcaatcc	Protospacer
*************************************

66. spacer 1.8|178521|38|NC_018492|CRISPRCasFinder matches to NZ_CP018934 (Bacillus cereus strain ISSFR-9F plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.974

caaacaagattacaactattgaacaatgtcgtcaatcg	CRISPR spacer
caaacaagattacaactattgaacaatgtcgtcaatcc	Protospacer
*************************************

67. spacer 1.1|178390|35|NC_018492|PILER-CR matches to NZ_CP009594 (Bacillus cereus strain 3a plasmid pBFC_2, complete sequence) position: , mismatch: 2, identity: 0.943

gatccacctctacaatgtgataacggccattatcc	CRISPR spacer
gatcgacctctacaatgtgataacggccattatcg	Protospacer
**** *****************************

68. spacer 1.1|178390|35|NC_018492|PILER-CR matches to NZ_CP016597 (Bacillus cereus strain K8 plasmid pBCK802, complete sequence) position: , mismatch: 2, identity: 0.943

gatccacctctacaatgtgataacggccattatcc	CRISPR spacer
gatccacttctacaatgtgataacggccattatca	Protospacer
*******.**************************

69. spacer 1.1|178390|35|NC_018492|PILER-CR matches to NZ_CP009603 (Bacillus cereus strain S2-8 plasmid pBFR_3, complete sequence) position: , mismatch: 2, identity: 0.943

gatccacctctacaatgtgataacggccattatcc	CRISPR spacer
gatcgacctctacaatgtgataacggccattatcg	Protospacer
**** *****************************

70. spacer 1.1|178390|35|NC_018492|PILER-CR matches to NC_007105 (Bacillus cereus E33L plasmid pE33L54, complete sequence) position: , mismatch: 2, identity: 0.943

gatccacctctacaatgtgataacggccattatcc	CRISPR spacer
aatccacctcaacaatgtgataacggccattatcc	Protospacer
.********* ************************

71. spacer 1.1|178390|35|NC_018492|PILER-CR matches to NZ_CP010109 (Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-3, complete sequence) position: , mismatch: 2, identity: 0.943

gatccacctctacaatgtgataacggccattatcc	CRISPR spacer
gatccacttctacaatgtgataacggccattatca	Protospacer
*******.**************************

72. spacer 1.1|178390|35|NC_018492|PILER-CR matches to NZ_CP053996 (Bacillus cereus strain FDAARGOS_780 plasmid unnamed3, complete sequence) position: , mismatch: 2, identity: 0.943

gatccacctctacaatgtgataacggccattatcc	CRISPR spacer
gatcgacctctacaatgtgataacggccattatcg	Protospacer
**** *****************************

73. spacer 1.1|178390|35|NC_018492|PILER-CR matches to NZ_CP009966 (Bacillus cereus E33L plasmid pBCO_2, complete sequence) position: , mismatch: 2, identity: 0.943

gatccacctctacaatgtgataacggccattatcc	CRISPR spacer
aatccacctcaacaatgtgataacggccattatcc	Protospacer
.********* ************************

74. spacer 1.1|178390|35|NC_018492|PILER-CR matches to NZ_CP053990 (Bacillus cereus strain FDAARGOS_781 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.943

gatccacctctacaatgtgataacggccattatcc	CRISPR spacer
gatcgacctctacaatgtgataacggccattatcg	Protospacer
**** *****************************

75. spacer 1.1|178390|35|NC_018492|PILER-CR matches to NZ_CP029457 (Bacillus cereus strain FORC087 plasmid pFORC087.3, complete sequence) position: , mismatch: 2, identity: 0.943

gatccacctctacaatgtgataacggccattatcc	CRISPR spacer
gatctacctctacaatgtggtaacggccattatcc	Protospacer
****.**************.***************

76. spacer 1.1|178390|35|NC_018492|PILER-CR matches to NZ_CP033790 (Bacillus sp. FDAARGOS_527 plasmid unnamed3, complete sequence) position: , mismatch: 2, identity: 0.943

gatccacctctacaatgtgataacggccattatcc	CRISPR spacer
gatccacctccacgatgtgataacggccattatcc	Protospacer
**********.**.*********************

77. spacer 1.3|178389|36|NC_018492|CRT matches to NZ_CP009594 (Bacillus cereus strain 3a plasmid pBFC_2, complete sequence) position: , mismatch: 2, identity: 0.944

tgatccacctctacaatgtgataacggccattatcc	CRISPR spacer
tgatcgacctctacaatgtgataacggccattatcg	Protospacer
***** *****************************

78. spacer 1.3|178389|36|NC_018492|CRT matches to NZ_CP009603 (Bacillus cereus strain S2-8 plasmid pBFR_3, complete sequence) position: , mismatch: 2, identity: 0.944

tgatccacctctacaatgtgataacggccattatcc	CRISPR spacer
tgatcgacctctacaatgtgataacggccattatcg	Protospacer
***** *****************************

79. spacer 1.3|178389|36|NC_018492|CRT matches to NZ_CP010109 (Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-3, complete sequence) position: , mismatch: 2, identity: 0.944

tgatccacctctacaatgtgataacggccattatcc	CRISPR spacer
tgatccacttctacaatgtgataacggccattatca	Protospacer
********.**************************

80. spacer 1.3|178389|36|NC_018492|CRT matches to NZ_CP016597 (Bacillus cereus strain K8 plasmid pBCK802, complete sequence) position: , mismatch: 2, identity: 0.944

tgatccacctctacaatgtgataacggccattatcc	CRISPR spacer
tgatccacttctacaatgtgataacggccattatca	Protospacer
********.**************************

81. spacer 1.3|178389|36|NC_018492|CRT matches to NZ_CP053996 (Bacillus cereus strain FDAARGOS_780 plasmid unnamed3, complete sequence) position: , mismatch: 2, identity: 0.944

tgatccacctctacaatgtgataacggccattatcc	CRISPR spacer
tgatcgacctctacaatgtgataacggccattatcg	Protospacer
***** *****************************

82. spacer 1.3|178389|36|NC_018492|CRT matches to NZ_CP053990 (Bacillus cereus strain FDAARGOS_781 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.944

tgatccacctctacaatgtgataacggccattatcc	CRISPR spacer
tgatcgacctctacaatgtgataacggccattatcg	Protospacer
***** *****************************

83. spacer 1.3|178389|36|NC_018492|CRT matches to NZ_CP029457 (Bacillus cereus strain FORC087 plasmid pFORC087.3, complete sequence) position: , mismatch: 2, identity: 0.944

tgatccacctctacaatgtgataacggccattatcc	CRISPR spacer
tgatctacctctacaatgtggtaacggccattatcc	Protospacer
*****.**************.***************

84. spacer 1.3|178389|36|NC_018492|CRT matches to NZ_CP033790 (Bacillus sp. FDAARGOS_527 plasmid unnamed3, complete sequence) position: , mismatch: 2, identity: 0.944

tgatccacctctacaatgtgataacggccattatcc	CRISPR spacer
tgatccacctccacgatgtgataacggccattatcc	Protospacer
***********.**.*********************

85. spacer 1.3|178389|36|NC_018492|CRT matches to NC_007105 (Bacillus cereus E33L plasmid pE33L54, complete sequence) position: , mismatch: 2, identity: 0.944

tgatccacctctacaatgtgataacggccattatcc	CRISPR spacer
taatccacctcaacaatgtgataacggccattatcc	Protospacer
*.********* ************************

86. spacer 1.3|178389|36|NC_018492|CRT matches to NZ_CP009966 (Bacillus cereus E33L plasmid pBCO_2, complete sequence) position: , mismatch: 2, identity: 0.944

tgatccacctctacaatgtgataacggccattatcc	CRISPR spacer
taatccacctcaacaatgtgataacggccattatcc	Protospacer
*.********* ************************

87. spacer 1.6|178389|37|NC_018492|CRISPRCasFinder matches to NZ_CP009594 (Bacillus cereus strain 3a plasmid pBFC_2, complete sequence) position: , mismatch: 2, identity: 0.946

tgatccacctctacaatgtgataacggccattatccg	CRISPR spacer
tgatcgacctctacaatgtgataacggccattatcgg	Protospacer
***** ***************************** *

88. spacer 1.6|178389|37|NC_018492|CRISPRCasFinder matches to NZ_CP016597 (Bacillus cereus strain K8 plasmid pBCK802, complete sequence) position: , mismatch: 2, identity: 0.946

tgatccacctctacaatgtgataacggccattatccg	CRISPR spacer
tgatccacttctacaatgtgataacggccattatcag	Protospacer
********.************************** *

89. spacer 1.6|178389|37|NC_018492|CRISPRCasFinder matches to NZ_CP009603 (Bacillus cereus strain S2-8 plasmid pBFR_3, complete sequence) position: , mismatch: 2, identity: 0.946

tgatccacctctacaatgtgataacggccattatccg	CRISPR spacer
tgatcgacctctacaatgtgataacggccattatcgg	Protospacer
***** ***************************** *

90. spacer 1.6|178389|37|NC_018492|CRISPRCasFinder matches to NC_007105 (Bacillus cereus E33L plasmid pE33L54, complete sequence) position: , mismatch: 2, identity: 0.946

tgatccacctctacaatgtgataacggccattatccg	CRISPR spacer
taatccacctcaacaatgtgataacggccattatccg	Protospacer
*.********* *************************

91. spacer 1.6|178389|37|NC_018492|CRISPRCasFinder matches to NZ_CP029457 (Bacillus cereus strain FORC087 plasmid pFORC087.3, complete sequence) position: , mismatch: 2, identity: 0.946

tgatccacctctacaatgtgataacggccattatccg	CRISPR spacer
tgatctacctctacaatgtggtaacggccattatccg	Protospacer
*****.**************.****************

92. spacer 1.6|178389|37|NC_018492|CRISPRCasFinder matches to NZ_CP010109 (Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-3, complete sequence) position: , mismatch: 2, identity: 0.946

tgatccacctctacaatgtgataacggccattatccg	CRISPR spacer
tgatccacttctacaatgtgataacggccattatcag	Protospacer
********.************************** *

93. spacer 1.6|178389|37|NC_018492|CRISPRCasFinder matches to NZ_CP053996 (Bacillus cereus strain FDAARGOS_780 plasmid unnamed3, complete sequence) position: , mismatch: 2, identity: 0.946

tgatccacctctacaatgtgataacggccattatccg	CRISPR spacer
tgatcgacctctacaatgtgataacggccattatcgg	Protospacer
***** ***************************** *

94. spacer 1.6|178389|37|NC_018492|CRISPRCasFinder matches to NZ_CP009966 (Bacillus cereus E33L plasmid pBCO_2, complete sequence) position: , mismatch: 2, identity: 0.946

tgatccacctctacaatgtgataacggccattatccg	CRISPR spacer
taatccacctcaacaatgtgataacggccattatccg	Protospacer
*.********* *************************

95. spacer 1.6|178389|37|NC_018492|CRISPRCasFinder matches to NZ_CP033790 (Bacillus sp. FDAARGOS_527 plasmid unnamed3, complete sequence) position: , mismatch: 2, identity: 0.946

tgatccacctctacaatgtgataacggccattatccg	CRISPR spacer
tgatccacctccacgatgtgataacggccattatccg	Protospacer
***********.**.**********************

96. spacer 1.6|178389|37|NC_018492|CRISPRCasFinder matches to NZ_CP053990 (Bacillus cereus strain FDAARGOS_781 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.946

tgatccacctctacaatgtgataacggccattatccg	CRISPR spacer
tgatcgacctctacaatgtgataacggccattatcgg	Protospacer
***** ***************************** *

97. spacer 1.8|178521|38|NC_018492|CRISPRCasFinder matches to NC_006578 ([Bacillus thuringiensis] serovar konkukian str. 97-27 plasmid pBT9727, complete sequence) position: , mismatch: 2, identity: 0.947

caaacaagattacaactattgaacaatgtcgtcaatcg	CRISPR spacer
caaacaagattacaactattaaacaatgtcgtcaatcc	Protospacer
********************.****************

98. spacer 1.8|178521|38|NC_018492|CRISPRCasFinder matches to NZ_CP053978 (Bacillus thuringiensis strain FDAARGOS_795 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.947

caaacaagattacaactattgaacaatgtcgtcaatcg	CRISPR spacer
caaacaagattacaactattaaacaatgtcgtcaatcc	Protospacer
********************.****************

99. spacer 1.8|178521|38|NC_018492|CRISPRCasFinder matches to NZ_CP014852 (Bacillus thuringiensis strain HD12 plasmid pHD120161, complete sequence) position: , mismatch: 2, identity: 0.947

caaacaagattacaactattgaacaatgtcgtcaatcg	CRISPR spacer
caaacaagattacaactattgaacaatatcgtcaatcc	Protospacer
***************************.*********

100. spacer 1.8|178521|38|NC_018492|CRISPRCasFinder matches to NZ_CP014852 (Bacillus thuringiensis strain HD12 plasmid pHD120161, complete sequence) position: , mismatch: 2, identity: 0.947

caaacaagattacaactattgaacaatgtcgtcaatcg	CRISPR spacer
caaacaagattacaactattgaacaatatcgtcaatcc	Protospacer
***************************.*********

101. spacer 1.8|178521|38|NC_018492|CRISPRCasFinder matches to NZ_CP009333 (Bacillus thuringiensis strain HD1011 plasmid 4, complete sequence) position: , mismatch: 2, identity: 0.947

caaacaagattacaactattgaacaatgtcgtcaatcg	CRISPR spacer
caaacaagattacaactattaaacaatgtcgtcaatcc	Protospacer
********************.****************

102. spacer 1.8|178521|38|NC_018492|CRISPRCasFinder matches to NZ_CP019234 (Bacillus thuringiensis strain YGd22-03 plasmid pYGD83, complete sequence) position: , mismatch: 2, identity: 0.947

caaacaagattacaactattgaacaatgtcgtcaatcg	CRISPR spacer
caaacaagattacaactattgcacaatgtcgtcaatcc	Protospacer
********************* ***************

103. spacer 1.8|178521|38|NC_018492|CRISPRCasFinder matches to NZ_CP053937 (Bacillus thuringiensis strain FDAARGOS_792 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.947

caaacaagattacaactattgaacaatgtcgtcaatcg	CRISPR spacer
caaacaagattacaactattaaacaatgtcgtcaatcc	Protospacer
********************.****************

104. spacer 1.8|178521|38|NC_018492|CRISPRCasFinder matches to NZ_CP034684 (Bacillus sp. BD59S plasmid pBTBD59S1, complete sequence) position: , mismatch: 2, identity: 0.947

caaacaagattacaactattgaacaatgtcgtcaatcg	CRISPR spacer
caaacaagattacaactattaaacaatgtcgtcaatcc	Protospacer
********************.****************

105. spacer 1.8|178521|38|NC_018492|CRISPRCasFinder matches to NZ_CP010087 (Bacillus thuringiensis strain 97-27 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.947

caaacaagattacaactattgaacaatgtcgtcaatcg	CRISPR spacer
caaacaagattacaactattaaacaatgtcgtcaatcc	Protospacer
********************.****************

106. spacer 2.1|178913|37|NC_018492|CRISPRCasFinder matches to NZ_CP019039 (Bacillus velezensis strain GH1-13 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.784

atata-agctatagaaaacactatacatgcaatataac	CRISPR spacer
-tatatttttatagaaatcactatacattcaatatata	Protospacer
 ****   .******** ********** *******

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NC_018499

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 2598

Enterococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000483803.1\|448_745_+	hypothetical protein	NA	NA	NA	NA
WP_000912304.1\|879_1092_+	hypothetical protein	NA	NA	NA	NA
WP_001140762.1\|1400_1775_-	hypothetical protein	NA	NA	NA	NA
WP_000156430.1\|1776_2598_-	ParA family protein	F0PIG8	Enterococcus_phage	6.3e-51	44.3

DBSCAN-SWA_2

7275 : 8037

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001040065.1\|7275_8037_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.7e-34	37.9

DBSCAN-SWA_3

21897 : 29160

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000825743.1\|21897_23346_+	S8 family serine peptidase	A0A218KC60	Bacillus_phage	1.2e-20	28.1
WP_049825656.1\|23619_24555_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	9.7e-48	46.0
WP_001246719.1\|24551_25295_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_000609085.1\|25310_26048_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_000473624.1\|27003_29160_+	peptidase domain-containing ABC transporter	W8CYL7	Bacillus_phage	2.1e-37	29.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_018493

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NC_018491

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NC_018492

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

4. NC_018499

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection