CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NC_018513	Burkholderia cepacia GG4 chromosome 1, complete sequence	1 crisprs	DinG,DEDDh,csa3,cas3,WYL	0	0	5	0
NC_018514	Burkholderia cepacia GG4 chromosome 2, complete sequence	1 crisprs	csa3,DinG,cas3,DEDDh	0	1	1	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_018513_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_018513_1

79614-79686

Orphan

Consensus_repeat	Method
GCTAAAGCAATAACTCGGGTCGAC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_018513_1

>merge|NC_018513|1|79614-79686|CRISPRCasFinder
GCTAAAGCAATAACTCGGGTCGACCGCGAAGCATGGGACCCGAGTAAGTGCTAAAGCACTAACTCGGGTCGAC

>NC_018513|1|1|79614-79686|CRISPRCasFinder
GCTAAAGCAATAACTCGGGTCGAC	CGCGAAGCATGGGACCCGAGTAAGT
GCTAAAGCACTAACTCGGGTCGAC

Protein	Signature genes	Signature genes Name	Protein_function
NC_018513.1\|WP_014895486.1\|87810_88968_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|380556
NC_018513.1\|WP_014895480.1\|81885_82665_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213186
NC_018513.1\|WP_014895483.1\|84808_85693_+\|branched-chain-amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223633
NC_018513.1\|WP_014895479.1\|79698_81384_+\|GMC-family-oxidoreductase-N-terminal-domain-containing-protein	unknown	unknown	gnl\|CDD\|235000
NC_018513.1\|WP_014895484.1\|85692_86667_+\|branched-chain-amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|119323
NC_018513.1\|WP_014895476.1\|76190_77117_-\|phenylalanine-4-monooxygenase	unknown	unknown	gnl\|CDD\|237020
NC_018513.1\|WP_014895475.1\|75712_76021_-\|4a-hydroxytetrahydrobiopterin-dehydratase	unknown	unknown	gnl\|CDD\|234845
NC_018513.1\|WP_014895488.1\|90229_92014_+\|branched-chain-amino-acid-ABC-transporter-ATP-binding-protein/permease	unknown	unknown	gnl\|CDD\|223488
NC_018513.1\|WP_014895473.1\|72973_74458_-\|sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|182388
NC_018513.1\|WP_006408082.1\|77223_77709_+\|Lrp/AsnC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224439
NC_018513.1\|WP_014895472.1\|72356_72878_+\|SET-domain-containing-protein-lysine-N-methyltransferase	unknown	unknown	gnl\|CDD\|380916
NC_018513.1\|WP_014895471.1\|71064_72177_+\|NADH:flavin-oxidoreductase/NADH-oxidase	unknown	unknown	gnl\|CDD\|239242
NC_018513.1\|WP_006401494.1\|74574_75267_-\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|223816
NC_018513.1\|WP_014895474.1\|75389_75620_+\|DUF3717-domain-containing-protein	unknown	unknown	gnl\|CDD\|378869
NC_018513.1\|WP_014895482.1\|83494_84694_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|380550
NC_018513.1\|WP_014895477.1\|77763_78297_-\|class-IV-adenylate-cyclase	unknown	unknown	gnl\|CDD\|143628
NC_018513.1\|WP_014895481.1\|82661_83417_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|223487
NC_018513.1\|WP_014895478.1\|78535_79435_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223656
NC_018513.1\|WP_014895489.1\|92013_92769_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|223487
NC_018513.1\|WP_014895487.1\|89169_90225_+\|branched-chain-amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223633

Protein	Function_ID	Function_description	E-value
NC_018513.1\|WP_014895486.1\|87810_88968_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|380556	cd06333, PBP1_ABC_RPA1789-like, type 1 periplasmic binding-protein component (CouP) of an ABC system (CouPSTU; RPA1789, RPA1791-1793), involved in active transport of lignin-derived aromatic substrates, and its close homologs. This group includes RPA1789 (CouP) from Rhodopseudomonas palustris and its close homologs in other bacteria. RPA1789 (CouP) is the periplasmic binding-protein component of an ABC system (CouPSTU; RPA1789, RPA1791-1793) that is involved in the active transport of lignin-derived aromatic substrates. Members of this group has high sequence similarity to members of the family of hydrophobic amino acid transporters (HAAT), such as leucine-isoleucine-valine binding protein (LIVBP).	1.97266e-154
NC_018513.1\|WP_014895480.1\|81885_82665_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|213186	cd03219, ABC_Mj1267_LivG_branched, ATP-binding cassette component of branched chain amino acids transport system. The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine. MJ1267 is a branched-chain amino acid transporter with 29% similarity to both the LivF and LivG components of the E. coli branched-chain amino acid transporter. MJ1267 contains an insertion from residues 114 to 123 characteristic of LivG (Leucine-Isoleucine-Valine) homologs. The branched-chain amino acid transporter from E. coli comprises a heterodimer of ABCs (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ).	1.27655e-111
NC_018513.1\|WP_014895483.1\|84808_85693_+\|branched-chain-amino-acid-ABC-transporter-permease	gnl\|CDD\|223633	COG0559, LivH, Branched-chain amino acid ABC-type transport system, permease components [Amino acid transport and metabolism].	2.20507e-72
NC_018513.1\|WP_014895479.1\|79698_81384_+\|GMC-family-oxidoreductase-N-terminal-domain-containing-protein	gnl\|CDD\|235000	PRK02106, PRK02106, choline dehydrogenase; Validated.	0
NC_018513.1\|WP_014895484.1\|85692_86667_+\|branched-chain-amino-acid-ABC-transporter-permease	gnl\|CDD\|119323	cd06581, TM_PBP1_LivM_like, Transmembrane subunit (TM) of Escherichia coli LivM and related proteins. LivM is one of two TMs of the E. coli LIV-1/LS transporter, a Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporter involved in the uptake of branched-chain amino acids (AAs). These types of transporters generally bind type 1 PBPs. PBP-dependent ABC transporters consist of a PBP, two TMs, and two cytoplasmic ABCs, and are mainly involved in importing solutes from the environment. The solute is captured by the PBP, which delivers it to a gated translocation pathway formed by the two TMs. The two ABCs bind and hydrolyze ATP and drive the transport reaction. E. coli LivM forms a heterodimer with another TM, LivH, to generate the transmembrane pore. LivH is not included in this subgroup. The LIV-1/LS transporter is comprised of two TMs (LivM and LivH), two ABCs (LivG and LivF), and one of two alternative PBPs, LivJ (LIV-BP) or LivK (LS-BP). In addition to transporting branched-chain AAs including leucine, isoleucine and valine, the E. coli LIV-1/LS transporter is involved in the uptake of the aromatic AA, phenylalanine.	1.4206e-64
NC_018513.1\|WP_014895476.1\|76190_77117_-\|phenylalanine-4-monooxygenase	gnl\|CDD\|237020	PRK11913, phhA, phenylalanine 4-monooxygenase; Reviewed.	1.01415e-162
NC_018513.1\|WP_014895475.1\|75712_76021_-\|4a-hydroxytetrahydrobiopterin-dehydratase	gnl\|CDD\|234845	PRK00823, phhB, pterin-4-alpha-carbinolamine dehydratase; Validated.	2.29369e-51
NC_018513.1\|WP_014895488.1\|90229_92014_+\|branched-chain-amino-acid-ABC-transporter-ATP-binding-protein/permease	gnl\|CDD\|223488	COG0411, LivG, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism].	4.23665e-115
NC_018513.1\|WP_014895473.1\|72973_74458_-\|sensor-histidine-kinase	gnl\|CDD\|182388	PRK10337, PRK10337, sensor protein QseC; Provisional.	1.08398e-48
NC_018513.1\|WP_006408082.1\|77223_77709_+\|Lrp/AsnC-family-transcriptional-regulator	gnl\|CDD\|224439	COG1522, Lrp, Transcriptional regulators [Transcription].	4.05934e-42
NC_018513.1\|WP_014895472.1\|72356_72878_+\|SET-domain-containing-protein-lysine-N-methyltransferase	gnl\|CDD\|380916	cd10518, SET_SETD1-like, SET domain (including post-SET domain) found in SET domain-containing proteins (SETD1A/SETD1B), histone-lysine N-methyltransferases (KMT2A/KMT2B/KMT2C/KMT2D) and similar proteins. This family includes SET domain-containing protein 1A (SETD1A), 1B (SETD1B), as well as histone-lysine N-methyltransferase 2A (KMT2A), 2B (KMT2B), 2C (KMT2C), 2D (KMT2D). These proteins are histone-lysine N-methyltransferases (EC 2.1.1.43) that specifically methylate 'Lys-4' of histone H3 (H3K4me).	3.07846e-34
NC_018513.1\|WP_014895471.1\|71064_72177_+\|NADH:flavin-oxidoreductase/NADH-oxidase	gnl\|CDD\|239242	cd02932, OYE_YqiM_FMN, Old yellow enzyme (OYE) YqjM-like FMN binding domain. YqjM is involved in the oxidative stress response of Bacillus subtilis. Like the other OYE members, each monomer of YqjM contains FMN as a non-covalently bound cofactor and uses NADPH as a reducing agent. The YqjM enzyme exists as a homotetramer that is assembled as a dimer of catalytically dependent dimers, while other OYE members exist only as monomers or dimers. Moreover, the protein displays a shared active site architecture where an arginine finger at the COOH terminus of one monomer extends into the active site of the adjacent monomer and is directly involved in substrate recognition. Another remarkable difference in the binding of the ligand in YqjM is represented by the contribution of the NH2-terminal tyrosine instead of a COOH-terminal tyrosine in OYE and its homologs.	0
NC_018513.1\|WP_006401494.1\|74574_75267_-\|response-regulator-transcription-factor	gnl\|CDD\|223816	COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription].	1.18094e-72
NC_018513.1\|WP_014895474.1\|75389_75620_+\|DUF3717-domain-containing-protein	gnl\|CDD\|378869	pfam12512, DUF3717, Protein of unknown function (DUF3717). This family of proteins is found in bacteria. Proteins in this family are typically between 75 and 117 amino acids in length. There is a conserved AIN sequence motif. There are two completely conserved residues (L and Y) that may be functionally important.	4.40779e-28
NC_018513.1\|WP_014895482.1\|83494_84694_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|380550	cd06327, PBP1_SBP-like, periplasmic substrate-binding domain of active transport proteins (substrate binding proteins or SBPs). Periplasmic substrate-binding domain of active transport proteins found in gram-negative, gram-positive bacteria, and archaea. Members of this group are initial receptors in the process of active transport across cellular membrane, but their substrate specificities are not known in detail. However, they closely resemble the group of AmiC and active transport systems for short-chain amides and urea (FmdDEF), and thus are likely to exhibit a ligand-binding mode similar to that of the amide sensor protein AmiC from Pseudomonas aeruginosa. Moreover, this binding domain has high sequence identity to the family of hydrophobic amino acid transporters (HAAT), and thus it may also be involved in transport of amino acids.	0
NC_018513.1\|WP_014895477.1\|77763_78297_-\|class-IV-adenylate-cyclase	gnl\|CDD\|143628	cd07890, CYTH-like_AC_IV-like, Adenylyl cyclase (AC) class IV-like, a subgroup of the CYTH-like superfamily. This subgroup contains class IV ACs and similar proteins. AC catalyzes the conversion of ATP to 3',5'-cyclic AMP (cAMP) and PPi. cAMP is a key signaling molecule which conveys a variety of signals in different cell types. In prokaryotes, cAMP is a catabolite derepression signal which triggers the expression of metabolic pathways including the lactose operon. Six non-homologous classes of ACs have been identified (I-VI). Class IV ACs are found in this group. In bacteria, the gene encoding Class IV AC has been designated cyaB and the protein as AC2. AC-IV occurs in addition to AC-I in bacterial pathogens such as Yersinia pestis (plague disease). The role of AC-IV is unknown but it has been speculated that it may be a factor in pathogenesis, perhaps providing cAMP for a secondary internal signaling function, or for secretion and uptake into host cells, where it may disrupt normal cellular processes. This subgroup belongs to the CYTH/triphosphate tunnel metalloenzyme (TTM)-like superfamily, whose enzymes have a unique active site located within an eight-stranded beta barrel.	1.07648e-43
NC_018513.1\|WP_014895481.1\|82661_83417_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|223487	COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism].	9.06838e-105
NC_018513.1\|WP_014895478.1\|78535_79435_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|223656	COG0583, LysR, Transcriptional regulator [Transcription].	1.97107e-36
NC_018513.1\|WP_014895489.1\|92013_92769_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|223487	COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism].	2.5738e-117
NC_018513.1\|WP_014895487.1\|89169_90225_+\|branched-chain-amino-acid-ABC-transporter-permease	gnl\|CDD\|223633	COG0559, LivH, Branched-chain amino acid ABC-type transport system, permease components [Amino acid transport and metabolism].	3.92524e-44

>NC_018513.1|WP_014895478.1|78535_79435_-|LysR-family-transcriptional-regulator
MDLTLLRAFATVAREGNLTRAAAQLHLTQPAVSLQIKHLQETLGVRLFTRMSRGLALTRDGQTLLPHAERALAAAADVQRAAAALRHEVRGRLRIGTILDPGFLRLGGFLRALVETHPQIETALRHGMSGWVLEQVRAQALDVGYYIGRPDDDDPRDDALFHTVTLTHFQYRVLAPAGWKERVQRAHDWRALAALPWIWTPPASAHHRLLSRLFAAAGAQPVKVAEVDQEQSMLDLVKSGIGLTLARDSTALAEAHAHALTIVERVTVPTELTFVTLAERRDEPAIAAALRLIETQWAI
>NC_018513.1|WP_014895477.1|77763_78297_-|class-IV-adenylate-cyclase
MARNIEIKARAREFDQLRERAATLATEAPLFYRQQDFFYDVPRGRLKLRRFEDGTPAELIFYQRDDRDGPKASYYTRSPVTNPDAMHSLLATALTTRGIVTKERHVYLVGRTRIHLDRVDGLGDFIELEVVLGPDDDEAGGEAEAHDVFAKLGVAQEDLVAVAYVDLLNADTQHVAT
>NC_018513.1|WP_006408082.1|77223_77709_+|Lrp/AsnC-family-transcriptional-regulator
MLELDHFDLALLDVLQRFGRATHQQLGEEVPLSPSQIGRRLQRLEAAGVIEGYRVMLRPEKLGLGVTAFTSLKLKHHGDSIIEQFQQQIDVLPEVLECHAVVGDADYLLRIVAPDLNALSQFVMKKLMRVPGVDSVRSNIVLTTFKRNGALPLAHLAPGAA
>NC_018513.1|WP_014895476.1|76190_77117_-|phenylalanine-4-monooxygenase
MVPNHSVQSLIMSTVVTAKLQEQFDAGLETRADFTIDQPLERYGQVDHAVWQQLYARQSALLRGRACDAFVTGLGKIDLPADRVPSFADVNRQLKPATGWEIVAVPGLVPDRVFFEHLANRRFPVTWWMRRPDQLDYLQEPDCFHDLFGHVPLLIEPVFADYMQAYGRTALAVADDEAALARLARLYWYTVEFGLIRDPNGTNGLSIYGAGIVSSKGESLYSLESAAPNRLGFDLERVMRTKYRIDTFQKTYFVIDDFAQLFALADVDGRALADRLARLPEFPAGAVVDSDRVLHRGTGEGWTDDADA
>NC_018513.1|WP_014895475.1|75712_76021_-|4a-hydroxytetrahydrobiopterin-dehydratase
MIHKLTSEERKTRLEGLPHWTAVPGRDAIQRSLRFADFNEAFGFMTRVAIKAQEMNHHPEWFNVYNRVDVTLSTHDADGLTERDIALAQFIDQVCTHTQPAA
>NC_018513.1|WP_014895474.1|75389_75620_+|DUF3717-domain-containing-protein
MSDISIHDLEAAINFWRARSPSSGDELKLCEEASALSKPYALLIVQRGSALQLEGLDPKARKAYETYARLKDGLES
>NC_018513.1|WP_006401494.1|74574_75267_-|response-regulator-transcription-factor
MRLLLIEDDRPIARGIQSSLEQAGFTVDMVHDGIFAEQALAQNRHELVILDLGLPGIDGMTLLTRFRQTNRHTPVIVLTARDELNDRIQGLNSGADDYMLKPFEPAELEARIRAVMRRSGPHSDMPRPEVSLGGVRLSGVDRRIFNDDKPLELSPREFAVLEMLLLRHGRVVSKAQLQDHLTHFGGDLGDTAIEVYVHRVRKKLEQCRVEIVTVRGFGYLLQEIRQTASV
>NC_018513.1|WP_014895473.1|72973_74458_-|sensor-histidine-kinase
MSPDPAVTTSLRRSLLRRLAAPLSMLALMSGLIAYWLAWQYTQHVIDRSLADLATAISKQIQIAGPDAPFTVPPLAQAMFSDPAEALIYRISDGEQELAGDPKLPLRGINVRRMHHAYVFEAEYDNRAVRVAQVRVDEVEGGRPMVVEVAQPVRHRYRIAAEFLVAIMMPLLLLLLAGWGIVWRVVNQQLGPLTHLADSLNRQTHTSLEPVDETDVPLEIRPLTSAMNALLGRLKTALDAQRKFIADAAHQLRTPLTAVKLHAEQAAVARDPQQTYTAVRELRAAADRAVRLSNQLLSLARAEPGEQAARFVDVDLAAMAFETGAEWVPRALASHVDLGFQRSDDPGEDETLNVRGNPVLLREVIANLLDNALKYVPLARPDGARITVNVARGMLEDGLPAAEIVVEDNGPGVPANQQADLFKRFFRGDAQSGNGVETGAGLGLAIVHDIIAMHGGTVSYEDASEGGSRFVVRVPLAERTQKPVSETPAAAPTH
>NC_018513.1|WP_014895472.1|72356_72878_+|SET-domain-containing-protein-lysine-N-methyltransferase
MSSRRIAVRRSGVHGKGVFAVEPIKAGERVVEYKGERISWKEALRRHPHDPNEPNHTFYFALEEGGVIDGKIDGNSARWINHSCAPNCEAEEVKGRVFIHALRDIGPEEELFYDYGLVIDEKLTKKLKREYACHCGAAACRGTLLATPDDDGKKKKKKDGKSEAGAKDKKKQK
>NC_018513.1|WP_014895471.1|71064_72177_+|NADH:flavin-oxidoreductase/NADH-oxidase
MTALFSPFTLRGVTLPNRIVISPMCQYSAERGEATDWHMIHLGHLALSGAGLLCIEATAVEPDGRITAGDLGLWDDVTEAALKPVLASIRKHSPVRIAMQVSHAGRKASSEVPWKGGQLVSVADGGWLPHAPSALPHKDGETPPLALDATGLNRIREAFAAAAKRAARLGIDALEVHAAHGYLLHQFLSPLANQRTDEYGGSRENRMRFPLEIFEIVRAAFPEDRPVGVRVSATDWVEGGWELDDTIAFAHELKRRGCDWIDVSSGGVSPLQKIPLSPGYQVPFAQAVKRAVGMPTIAVGLINDPAHANRLIEAGDADFVAMARAMLYDPRWPWHAAAELGAEVAAPPQYWRSQPREHKALFGDIAFGQR
>NC_018513.1|WP_014895479.1|79698_81384_+|GMC-family-oxidoreductase-N-terminal-domain-containing-protein
MTTQRTLEGEFDYVIVGAGTAGCVLANRLTEDPDIRVLLLEAGGKDDYHWIHIPVGYLYCIGNPRTDWLYKTQPEAALNGRVLSYPRGRVLGGCSSINGMIYMRGQREDYDSWAQETGDAGWSWDSVLPIFKRSEDHHAGASDAHGAGGEWRVEQQRLRWEILESFAQAAQQTGIPATDDFNRGDNSGVGYFEVNQKRGVRWNTSKAFLRPAMTRPNLTVITGAQAQRVIFDGRRAVGVEYHGGGTDYVARARAEVLLTSGAVNSPQLLELSGIGAGARLQALGIDVVQDLPGVGENLQDHLQLRMAFRVEGVRTLNTLSAHWWGKLMIGAEYALLQRGPMSMAPSQLGAFAKSDPDDPALTRPDLEYHVQPLSLERFGEPLHDFNAFTASVCHLRPSSRGSVHIASPDTGAAPAIAPNYLSTDHDRQVAANALRLTRRIASAPALARYRPEEILPGTQYRTEAELIEAAGAVGTTIFHPVGTCRMGRADDERAVVDSRLRVRGIAGLRIVDASVMPFITSGNTNSPTLMIAERASDMIRADRRAAHEATQVRTEAAVTSA
>NC_018513.1|WP_014895480.1|81885_82665_+|ABC-transporter-ATP-binding-protein
MILGDTILETRGLTKEFRGFTAVNGVNLRVRRGSIHALIGPNGAGKTTCFNLLTKFLTPTAGQIVFNGIDITDERPAQVARRGIIRSFQISAVFPHLTALQNVRIGLQRSLGTEFHFWRSERTLQRLDDRAMDLLTQVGLTDFAHVPTVELAYGRKRALEIATTLAMEPELMLLDEPTQGMGHEDVDRVTALIKKVAAGRTILMVEHNMNVIAGISDTITVLQRGEVLAEGSYAEVSKNPLVIEAYMGSADAALAGAHA
>NC_018513.1|WP_014895481.1|82661_83417_+|ABC-transporter-ATP-binding-protein
MRHSEREERELSGVESGTPALEITGLEAWYGESHILHGVDLSVHRGEVVTLLGRNGAGRTTTLRAIMGLTGRRSGSIKVAGNETVGLATHRIAHFGVGYCPEERGIFSSLSCEENLMLPPPIGPREHAMSLDEIYAMFPNLASRRQSQGTRLSGGEQQMLAVARILRTGANLLLLDEISEGLAPVIVQALARMIIALKARGYTVVMVEQNFRFAAPLADRFYVMEHGRIVEHFRSSELEGKMPILHDLLGV
>NC_018513.1|WP_014895482.1|83494_84694_+|ABC-transporter-substrate-binding-protein
MKMKTLAHACLAVATAAFTAGAAHAADSVKIGFITDMSGLYADIDGQGGLEAIRMAVADFGGKVLGKPIEVVYADHQNKADIAASKAREWMDRGGLDLLVGGTNSATALSMNQVAAEKKKVYINIGAGADTLTNEQCTPYTVHYAYDTMALAKGTGSAVVKQGGKSWFFLTADYAFGKALEKNTSDVVKANGGQVLGTVRHPLSASDFSSFLLQAQSSKAQILGLANAGGDTINSIKAAKEFGITKSMKIAALLMFIDDVHSLGLETTQGLVLTDSWYWNRDAASRQWAQRYFGKMKKMPSSLQAADYSSVTTYLKAVQAAGTTDSDKVMAELKKMKINDFYAKGAIRQDGSMIHDMYLMEVKKPSESKEPWDYYKVLATIPGDQAFGTKQESRCALWK
>NC_018513.1|WP_014895483.1|84808_85693_+|branched-chain-amino-acid-ABC-transporter-permease
MEIFGIPLPAMLSQLLLGLVNGSFYAILSLGLAVIFGLLNVINFAHGALFMLGAMLAWMGLSYFGLPYWAMLVLAPLIVGAFGIVIERSMLRWLYKLDHLYGLLLTFGLTLVVEGVFRSIYGSSGQPYDVPSQLSGATNLGFMFLPNYRAWVVVASLAVCLVTWFVIEKTRLGAYLRAGTENPKLVEAFGVNVPMMITLTYGFGVALAAFAGVLAAPVIQVSPLMGQPMIITVFAVVVIGGMGSILGSIITGLMLGVIEGFTRVFYPEASATVVFVIMAIVLLIRPAGLFGKEK
>NC_018513.1|WP_014895484.1|85692_86667_+|branched-chain-amino-acid-ABC-transporter-permease
MQRKVLYGVLLAALLAAPFIGAYPVFVMKVLTFALFAAAFNLLIGYTGLLSFGHAMFLATAGYAAGYAIQTLGFTPELGVLVGTFAATLLGLVVGLFAIRRQGIYFAMITLAFAQMVYFIYLQAPFTHGEDGLQGVPRGHLFGLVDLSNDVALYYVVLAVIVAACAFIVRIVHSPFGQVLVAIKENEARAISLGYDTDRFKLLAFILSAGLAGLAGSLKVLVLGFETLSDAYWTMSGLVVLMTLVGGMGTLFGPLLGAALIVALEDRLGDIGESLASITGVGWFRSLGESATIVTGLIFIACVLAFRRGIVGEMVARVKTLRPS
>NC_018513.1|WP_014895486.1|87810_88968_+|ABC-transporter-substrate-binding-protein
MKMNRWMEAVLAAGLVCAAATASAQVKIGVTLSATGPAASLGIPEKNTIALLPKEIAGKSVQYIVLDDASDTSRAVQNVRKLIDEDHVDAIIGSSVTPNSLAMLDPVSQGKTPTISLAASAQIISPMDAKRAWMFKVPQNDQLMADAIAGYMAKHGVKTVGFIGFADAYGDSWYNTFNAAAAKNGLKVVSNERYNRTDASVMGQVLKLMGSNPDAVLIAGSGTPAALPAKTLKERGYKGKVYQTHGVANNDFLRVCGKDCEGEILPAGPVLVTDQLPDTNPVKKPALGYKAAYEKANGAGSLSTFGGHAWDAGLLLQHAIPDALKKGQPGTEAFREALRASLESVKDLPVSHGVINMTSTDHNGFDTRARVMVQIVDGKWKLQAE
>NC_018513.1|WP_014895487.1|89169_90225_+|branched-chain-amino-acid-ABC-transporter-permease
MDLSIAAILAQDGITTGAIYALLSLALVLVFSVTRVIFIPQGEFVAYGALTLAALQAQKFPATCWLLFVMGIACFLLEVGGLIRHRERRHQLGRTLTTLTSRYVLLPLAVFAVTRGVAAQPLPMLAQIALTLAIVVPMGPFVYRLVYQPIAEGTTLLLLIVSVAVHFAMVGLGLVMFGAEGSRTNGFTDASLAIGGMTVSVQSILVVVTALVLIGALYVYFGRTIAGKALRATSVNRLGARLVGIGTTEAGRLAFTLAAGLGVLSGILVGPLTTIYYDSGFLIGLKGFVGAIIGGLVSYPLAAAGSLLVGVLESYSSFWASAYKEVIVFTLIIPVLLWRSFATPHAEEEEE
>NC_018513.1|WP_014895488.1|90229_92014_+|branched-chain-amino-acid-ABC-transporter-ATP-binding-protein/permease
MKTMVRNKTFWMFLVVLFALPVLPGALQVPEYWITLLNYIGLYAIVAIGLVLLTGVGGMTSFGQAAFVGIGAYATALLTTRYGVSPWLALIVGVVLTALVALVLGAVTMRLSGHFLPLGTIAWGLALFYLFGNLELLGKYDGINGIPALNLFGIVLESGRSLYFLIWAVVLAAIVSVQNLLNSRPGRAIRALRGGGVMAEAMGINTAWMRVVIFVYAAVLAAVSGFLYAHLQRAVNPTPFGLNHGIEFLFMAVVGGVSHVWGAVLGAAILTVLQDYLQTLLPKLLGSEGNFEIIVFGVLMVLLLQYARQGVWPFVAKLFPRGPRAHVPDHADPLPQRAKPTAGEPLLVVDNARKQFGGLVAVNDVSFDVKAGQIIGLIGPNGAGKSTTFNLVTGVLQPTGGTITFRGERIDGLTSRQIVRRGIGRTFQHVKLLPTMTVLENVAIGAHLRGHTGVWRSIARLNAHEETQLLAEAAQQIRRVGLEKHMYDEAGSLALGQQRILEIARALCCDPTLLLLDEPAAGLRYQEKQQLADLLRRLKAEGMSVLLVEHDMDFVMNLTDRLVVMEFGTRIAEGLPQDVQQDPAVLEAYLGGVE
>NC_018513.1|WP_014895489.1|92013_92769_+|ABC-transporter-ATP-binding-protein
MTDTTMPILEVRGLAVRYGKVEALHGAAIKVGAGQIVSVIGPNGAGKSTLLNAIMGALPVTGHASGAVLYRGSDVGALPVEQRVARGMCLVPEKRELFSTMTVEDNLVLGAYRRKLAGESNFLDQLDHVFVLFPRLKERRKQAAGTLSGGERQMLAVGRALMGKPDLLMLDEPSLGLAPLIVKEIFHIISALRGTGVATLLIEQNARAALQISDYGYVLETGEFALEGPAAELAQNPRVIETYLGLAKKTA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

2693885 : 2702190

Yaba_monkey_tumor_virus(16.67%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_041490682.1\|2693885_2694806_+	alpha/beta hydrolase	Q6TUZ7	Yaba_monkey_tumor_virus	5.7e-16	27.2
WP_014897718.1\|2694837_2695761_-	histone deacetylase family protein	A0A2K9KZC4	Tupanvirus	6.7e-41	34.6
WP_041490683.1\|2695929_2697153_+	lytic murein transglycosylase B	NA	NA	NA	NA
WP_014897720.1\|2697234_2698137_-	cysteine synthase CysM	A0A1X9I5F1	Streptococcus_phage	1.2e-50	39.5
WP_014897721.1\|2698356_2698701_-	helix-hairpin-helix domain-containing protein	NA	NA	NA	NA
WP_014897722.1\|2698774_2699767_-	ADP-glyceromanno-heptose 6-epimerase	R9S880	Prochlorococcus_phage	2.0e-27	31.5
WP_148283823.1\|2699831_2700782_-	D-glycero-beta-D-manno-heptose-7-phosphate kinase	A0A2H4N7X4	Lake_Baikal_phage	1.1e-17	28.5
WP_014897724.1\|2700789_2702190_-	UDP-glucose/GDP-mannose dehydrogenase family protein	A0A127AXI2	Bacillus_phage	5.7e-76	37.8

DBSCAN-SWA_2

2783884 : 2794380

Bacillus_virus(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014897795.1\|2783884_2785186_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	1.6e-93	51.1
WP_014897796.1\|2785436_2785709_+	DUF2164 domain-containing protein	NA	NA	NA	NA
WP_014897797.1\|2785751_2787062_-	replication-associated recombination protein A	G3MBE0	Bacillus_virus	1.9e-81	40.5
WP_014897798.1\|2787223_2787913_-	outer membrane lipoprotein chaperone LolA	NA	NA	NA	NA
WP_014897799.1\|2787959_2790269_-	DNA translocase FtsK	G1FGP1	Mycobacterium_phage	1.2e-83	49.7
WP_014897800.1\|2790676_2791639_+	thioredoxin-disulfide reductase	G3MA85	Bacillus_virus	3.0e-60	42.6
WP_014897801.1\|2791774_2792554_+	Smr/MutS family protein	A0A0P0IDT4	Acinetobacter_phage	5.0e-13	29.8
WP_014897802.1\|2792513_2793164_+	trimeric intracellular cation channel family protein	NA	NA	NA	NA
WP_014897803.1\|2793261_2794380_-	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	G9BWD6	Planktothrix_phage	1.8e-24	35.5

DBSCAN-SWA_3

2887794 : 2894791

Escherichia_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014897887.1\|2887794_2889015_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.9e-11	26.4
WP_014897888.1\|2889014_2889809_-	ABC transporter permease	NA	NA	NA	NA
WP_041490689.1\|2889808_2891254_-	mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase	A0A1V0SH58	Hokovirus	5.7e-55	29.1
WP_014897890.1\|2891393_2892296_-	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	1.2e-26	35.3
WP_014897891.1\|2892288_2892840_-	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	2.6e-48	51.9
WP_014897892.1\|2892824_2893718_-	glucose-1-phosphate thymidylyltransferase RfbA	A0A291LA53	Escherichia_phage	9.8e-98	59.6
WP_014897893.1\|2893729_2894791_-	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	6.0e-86	47.9

DBSCAN-SWA_4

3025062 : 3034095

unidentified_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014898001.1\|3025062_3026598_+	polynucleotide adenylyltransferase PcnB	H7BUW3	unidentified_phage	1.8e-22	30.7
WP_014898002.1\|3026633_3027176_+	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
WP_014898003.1\|3027172_3027859_+	deoxynucleoside kinase	A0A0M3UL55	Enterococcus_phage	1.2e-07	26.4
WP_014898004.1\|3027903_3028719_+	3-methyl-2-oxobutanoate hydroxymethyltransferase	A0A0N7HVJ8	Ostreococcus_lucimarinus_virus	1.5e-36	33.3
WP_014898005.1\|3028840_3030757_-	aminodeoxychorismate synthase component I	S4VNU7	Pandoravirus	5.6e-58	38.0
WP_014898006.1\|3030761_3031898_-	molecular chaperone DnaJ	E3T4P7	Cafeteria_roenbergensis_virus	1.7e-22	38.4
WP_014898007.1\|3032151_3034095_-	molecular chaperone DnaK	A0A0N9QXN8	Chrysochromulina_ericina_virus	3.2e-146	49.7

DBSCAN-SWA_5

3292854 : 3348770

Stx2-converting_phage(33.33%)

transposase,plate,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014898230.1\|3292854_3294153_+\|tRNA	glutamyl-tRNA reductase	NA	NA	NA	NA
WP_014898231.1\|3294234_3295317_+	peptide chain release factor 1	A0A0S4KWG0	Pseudomonas_phage	6.7e-08	46.6
WP_014898232.1\|3295324_3296167_+	peptide chain release factor N(5)-glutamine methyltransferase	NA	NA	NA	NA
WP_006477066.1\|3296234_3296546_+	Grx4 family monothiol glutaredoxin	NA	NA	NA	NA
WP_014898233.1\|3296559_3297156_+	UbiX family flavin prenyltransferase	NA	NA	NA	NA
WP_014898234.1\|3297378_3298170_+	dioxygenase	NA	NA	NA	NA
WP_014898235.1\|3298277_3299876_-	APC family permease	NA	NA	NA	NA
WP_006477070.1\|3300296_3300500_+	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	1.4e-20	71.6
WP_041490562.1\|3300608_3301859_-	Hsp70 family protein	NA	NA	NA	NA
WP_014898237.1\|3302052_3302658_-	nitroreductase family protein	NA	NA	NA	NA
WP_014898238.1\|3302815_3304099_-	MFS transporter	NA	NA	NA	NA
WP_014898239.1\|3304318_3304942_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_014898240.1\|3305018_3305591_+	DUF1415 domain-containing protein	NA	NA	NA	NA
WP_014898241.1\|3305646_3306537_-	SAM-dependent methyltransferase	NA	NA	NA	NA
WP_014898242.1\|3306626_3307760_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_014898243.1\|3307895_3308390_-	LEA type 2 family protein	NA	NA	NA	NA
WP_014898244.1\|3309031_3311215_+	peptidase M1	A0A0P0IY26	Acinetobacter_phage	7.5e-51	26.4
WP_014898245.1\|3311400_3312429_-	transporter	NA	NA	NA	NA
WP_014898246.1\|3312637_3313591_-	hypothetical protein	NA	NA	NA	NA
WP_014898247.1\|3313712_3314558_+	M15 family metallopeptidase	NA	NA	NA	NA
WP_014898248.1\|3314858_3318800_+	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
WP_014898249.1\|3318796_3319786_+	type VI secretion system-associated protein TagF	NA	NA	NA	NA
WP_014898250.1\|3319790_3320747_+	OmpA family protein	NA	NA	NA	NA
WP_014898251.1\|3320824_3321946_-	type VI secretion system protein TssA	NA	NA	NA	NA
WP_014898252.1\|3321985_3324655_-	type VI secretion system ATPase TssH	A0A223W0B1	Agrobacterium_phage	2.2e-89	31.6
WP_014898253.1\|3324699_3325800_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_014898254.1\|3325763_3327599_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_014898255.1\|3327676_3328162_-\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_006477093.1\|3328224_3328728_-	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_014898256.1\|3328798_3330289_-	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_014898257.1\|3330304_3330820_-	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_014898258.1\|3330864_3331503_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_039320279.1\|3331881_3332493_+	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_014898260.1\|3332595_3333942_+\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_014898261.1\|3333938_3334721_+	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_014898262.1\|3334807_3335125_-	hypothetical protein	NA	NA	NA	NA
WP_014898263.1\|3335464_3336265_+	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_014898264.1\|3336346_3336550_-	hypothetical protein	NA	NA	NA	NA
WP_014898266.1\|3337699_3340015_-	PriCT-2 domain-containing protein	A0A0M7RDT6	Lactobacillus_phage	1.0e-50	39.0
WP_014898267.1\|3340196_3340391_-	AlpA family phage regulatory protein	NA	NA	NA	NA
WP_014898268.1\|3340801_3343042_+	hypothetical protein	NA	NA	NA	NA
WP_014898269.1\|3343162_3343984_+	DUF2971 domain-containing protein	NA	NA	NA	NA
WP_014898271.1\|3344344_3345352_-	hypothetical protein	NA	NA	NA	NA
WP_187293234.1\|3345417_3345588_+	hypothetical protein	NA	NA	NA	NA
WP_014898272.1\|3345891_3346377_+	recombinase family protein	A0A1S6L009	Salmonella_phage	6.0e-17	39.9
WP_041490564.1\|3346426_3346813_+\|transposase	transposase	A0A0P0ZBP6	Stx2-converting_phage	2.9e-14	35.3
WP_014898274.1\|3346809_3347157_+	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	5.6e-41	71.0
WP_014898275.1\|3347186_3348770_+\|transposase	IS66 family transposase	A0A0P0ZBS5	Stx2-converting_phage	2.6e-146	60.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NC_018514

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_018514_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_018514_1

142098-142170

Orphan

Consensus_repeat	Method
AGTTCCTGAAATATCAGAACGATG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_018514_1

>merge|NC_018514|1|142098-142170|CRISPRCasFinder
AGTTCCTGAAATATCAGAACGATGGCCGGTCACGAACCATTGCCGTCTGTATTCCTGAAATATCAGAACGATG

>NC_018514|1|1|142098-142170|CRISPRCasFinder
AGTTCCTGAAATATCAGAACGATG	GCCGGTCACGAACCATTGCCGTCTG
TATTCCTGAAATATCAGAACGATG

Protein	Signature genes	Signature genes Name	Protein_function
NC_018514.1\|WP_006480591.1\|136368_137613_+\|sarcosine-oxidase-subunit-beta-family-protein	unknown	unknown	gnl\|CDD\|273585
NC_018514.1\|WP_006489139.1\|141577_142018_+\|dihydroneopterin-aldolase	unknown	unknown	gnl\|CDD\|224456
NC_018514.1\|WP_014898473.1\|132732_133437_-\|FadR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225097
NC_018514.1\|WP_014898474.1\|133637_134705_-\|GlxA-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|227311
NC_018514.1\|WP_014898485.1\|147495_148674_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224095
NC_018514.1\|WP_014898475.1\|134966_136352_+\|L-serine-ammonia-lyase	unknown	unknown	gnl\|CDD\|273233
NC_018514.1\|WP_041490712.1\|144448_144835_-\|DUF1311-domain-containing-protein	unknown	unknown	gnl\|CDD\|226278
NC_018514.1\|WP_014898479.1\|142264_143377_-\|alkene-reductase	unknown	unknown	gnl\|CDD\|239243
NC_018514.1\|WP_014898482.1\|144877_145543_-\|lytic-transglycosylase-domain-containing-protein	unknown	unknown	gnl\|CDD\|381594
NC_018514.1\|WP_014898477.1\|137950_140962_+\|sarcosine-oxidase-subunit-alpha-family-protein	unknown	unknown	gnl\|CDD\|273584
NC_018514.1\|WP_014898488.1\|150739_151330_+\|APC-family-permease	unknown	unknown	gnl\|CDD\|223605
NC_018514.1\|WP_014898476.1\|137639_137954_+\|sarcosine-oxidase-subunit-delta	unknown	unknown	gnl\|CDD\|226761
NC_018514.1\|WP_014898478.1\|140951_141581_+\|sarcosine-oxidase-subunit-gamma	unknown	unknown	gnl\|CDD\|226949
NC_018514.1\|WP_014898484.1\|146554_147499_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224050
NC_018514.1\|WP_014898487.1\|149761_150691_+\|2-hydroxyacid-dehydrogenase	unknown	unknown	gnl\|CDD\|240633
NC_018514.1\|WP_014898480.1\|143547_144423_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
NC_018514.1\|WP_014898486.1\|148670_149594_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270334
NC_018514.1\|WP_014898472.1\|131761_132652_-\|NAD-binding-protein	unknown	unknown	gnl\|CDD\|215463
NC_018514.1\|WP_014898483.1\|145790_146558_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224095
NC_018514.1\|WP_014898471.1\|130455_131742_-\|four-carbon-acid-sugar-kinase-family-protein	unknown	unknown	gnl\|CDD\|225930

Protein	Function_ID	Function_description	E-value
NC_018514.1\|WP_006480591.1\|136368_137613_+\|sarcosine-oxidase-subunit-beta-family-protein	gnl\|CDD\|273585	TIGR01373, Sarcosine_oxidase_subunit_beta, sarcosine oxidase, beta subunit family, heterotetrameric form. This model describes the beta subunit of a family of known and putative heterotetrameric sarcosine oxidases. Five operons of such oxidases are found in Mesorhizobium loti and three in Agrobacterium tumefaciens, a high enough copy number to suggest that not all members are share the same function. The model is designated as subfamily rather than equivalog for this reason. Sarcosine oxidase catalyzes the oxidative demethylation of sarcosine to glycine. The reaction converts tetrahydrofolate to 5,10-methylene-tetrahydrofolate. The enzyme is known in monomeric and heterotetrameric (alpha,beta,gamma,delta) forms. [Energy metabolism, Amino acids and amines].	0
NC_018514.1\|WP_006489139.1\|141577_142018_+\|dihydroneopterin-aldolase	gnl\|CDD\|224456	COG1539, FolB, Dihydroneopterin aldolase [Coenzyme metabolism].	4.52007e-27
NC_018514.1\|WP_014898473.1\|132732_133437_-\|FadR-family-transcriptional-regulator	gnl\|CDD\|225097	COG2186, FadR, Transcriptional regulators [Transcription].	6.69348e-56
NC_018514.1\|WP_014898474.1\|133637_134705_-\|GlxA-family-transcriptional-regulator	gnl\|CDD\|227311	COG4977, COG4977, Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain [Transcription].	2.0057e-128
NC_018514.1\|WP_014898485.1\|147495_148674_-\|ABC-transporter-permease	gnl\|CDD\|224095	COG1174, OpuBB, ABC-type proline/glycine betaine transport systems, permease component [Amino acid transport and metabolism].	1.97984e-60
NC_018514.1\|WP_014898475.1\|134966_136352_+\|L-serine-ammonia-lyase	gnl\|CDD\|273233	TIGR00720, hypothetical_protein_NEICINOT_00681, L-serine dehydratase, iron-sulfur-dependent, single chain form. This enzyme is also called serine deaminase and L-serine dehydratase 1. L-serine ammonia-lyase converts serine into pyruvate in the gluconeogenesis pathway from serine. This enzyme is comprised of a single chain in Escherichia coli, Mycobacterium tuberculosis, and several other species, but has separate alpha and beta chains in Bacillus subtilis and related species. The beta and alpha chains are homologous to the N-terminal and C-terminal regions, respectively, but are rather deeply branched in a UPGMA tree. This enzyme requires iron and dithiothreitol for activation in vitro, and is a predicted 4Fe-4S protein. Escherichia coli Pseudomonas aeruginosa have two copies of this protein. [Energy metabolism, Amino acids and amines, Energy metabolism, Glycolysis/gluconeogenesis].	0
NC_018514.1\|WP_041490712.1\|144448_144835_-\|DUF1311-domain-containing-protein	gnl\|CDD\|226278	COG3755, COG3755, Uncharacterized protein conserved in bacteria [Function unknown].	1.8319e-05
NC_018514.1\|WP_014898479.1\|142264_143377_-\|alkene-reductase	gnl\|CDD\|239243	cd02933, OYE_like_FMN, Old yellow enzyme (OYE)-like FMN binding domain. OYE was the first flavin-dependent enzyme identified, however its true physiological role remains elusive to this day. Each monomer of OYE contains FMN as a non-covalently bound cofactor, uses NADPH as a reducing agent with oxygens, quinones, and alpha,beta-unsaturated aldehydes and ketones, and can act as electron acceptors in the catalytic reaction. Members of OYE family include 12-oxophytodienoate reductase, pentaerythritol tetranitrate reductase, morphinone reductase, and related enzymes.	4.95705e-172
NC_018514.1\|WP_014898482.1\|144877_145543_-\|lytic-transglycosylase-domain-containing-protein	gnl\|CDD\|381594	cd00254, LT-like, lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.	4.40972e-16
NC_018514.1\|WP_014898477.1\|137950_140962_+\|sarcosine-oxidase-subunit-alpha-family-protein	gnl\|CDD\|273584	TIGR01372, sarcosine_oxidase_alpha_subunit, sarcosine oxidase, alpha subunit family, heterotetrameric form. This model describes the alpha subunit of a family of known and putative heterotetrameric sarcosine oxidases. Five operons of such oxidases are found in Mesorhizobium loti and three in Agrobacterium tumefaciens, a high enough copy number to suggest that not all members are share the same function. The model is designated as subfamily rather than equivalog for this reason.Sarcosine oxidase catalyzes the oxidative demethylation of sarcosine to glycine. The reaction converts tetrahydrofolate to 5,10-methylene-tetrahydrofolate. The enzyme is known in monomeric and heterotetrameric (alpha,beta,gamma,delta) forms [Energy metabolism, Amino acids and amines].	0
NC_018514.1\|WP_014898488.1\|150739_151330_+\|APC-family-permease	gnl\|CDD\|223605	COG0531, PotE, Amino acid transporters [Amino acid transport and metabolism].	0.00148599
NC_018514.1\|WP_014898476.1\|137639_137954_+\|sarcosine-oxidase-subunit-delta	gnl\|CDD\|226761	COG4311, SoxD, Sarcosine oxidase delta subunit [Amino acid transport and metabolism].	3.25933e-50
NC_018514.1\|WP_014898478.1\|140951_141581_+\|sarcosine-oxidase-subunit-gamma	gnl\|CDD\|226949	COG4583, COG4583, Sarcosine oxidase gamma subunit [Amino acid transport and metabolism].	4.11983e-64
NC_018514.1\|WP_014898484.1\|146554_147499_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224050	COG1125, OpuBA, ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism].	1.26789e-148
NC_018514.1\|WP_014898487.1\|149761_150691_+\|2-hydroxyacid-dehydrogenase	gnl\|CDD\|240633	cd12156, HPPR, Hydroxy(phenyl)pyruvate Reductase, D-isomer-specific 2-hydroxyacid-related dehydrogenase. Hydroxy(phenyl)pyruvate reductase (HPPR) catalyzes the NADP-dependent reduction of hydroxyphenylpyruvates, hydroxypyruvate, or pyruvate to its respective lactate. HPPR acts as a dimer and is related to D-isomer-specific 2-hydroxyacid dehydrogenases, a superfamily that includes groups such as formate dehydrogenase, glycerate dehydrogenase, L-alanine dehydrogenase, and S-Adenosylhomocysteine Hydrolase. Despite often low sequence identity, these proteins typically have a characteristic arrangement of 2 similar subdomains of the alpha/beta Rossmann fold NAD+ binding form. The NAD+ binding domain is inserted within the linear sequence of the mostly N-terminal catalytic domain, which has a similar domain structure to the internal NAD binding domain. Structurally, these domains are connected by extended alpha helices and create a cleft in which NAD is bound, primarily to the C-terminal portion of the 2nd (internal) domain. Some related proteins have similar structural subdomain but with a tandem arrangement of the catalytic and NAD-binding subdomains in the linear sequence. While many members of this family are dimeric, alanine DH is hexameric and phosphoglycerate DH is tetrameric.	1.37883e-133
NC_018514.1\|WP_014898480.1\|143547_144423_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	5.68688e-77
NC_018514.1\|WP_014898486.1\|148670_149594_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|270334	cd13616, PBP2_OsmF, Substrate-binding domain OsmF of an osmoregulated ABC-type transporter; the type 2 periplasmic-binding protein fold. Osmoprotectant binding lipoprotein OsmF of an ABC transporter (YehZYXW) from Escherichia coli is predicted to be involved in uptake of compatible solutes such as choline, L-proline and glycine betaine, but the relative substrate preference is not known. To counteract the efflux of water, microorganisms accumulate the compatible solutes for a sustained adjustment to high osmolarity surroundings. OsmF belongs to the type 2 periplasmic binding fold protein superfamily (PBP2). The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	7.08473e-156
NC_018514.1\|WP_014898472.1\|131761_132652_-\|NAD-binding-protein	gnl\|CDD\|215463	PLN02858, PLN02858, fructose-bisphosphate aldolase.	2.86448e-95
NC_018514.1\|WP_014898483.1\|145790_146558_-\|ABC-transporter-permease	gnl\|CDD\|224095	COG1174, OpuBB, ABC-type proline/glycine betaine transport systems, permease component [Amino acid transport and metabolism].	4.14665e-66
NC_018514.1\|WP_014898471.1\|130455_131742_-\|four-carbon-acid-sugar-kinase-family-protein	gnl\|CDD\|225930	COG3395, COG3395, Uncharacterized protein conserved in bacteria [Function unknown].	1.12636e-117

>NC_018514.1|WP_006489139.1|141577_142018_+|dihydroneopterin-aldolase
MKPFDEPFVAIDAPRLRGRGWSVFVDELKVPARIGIHAHEHEAPQPIVIDARLGYRCEPSEQGEWIDYDGYCARVASFLAHKPHTRLLETLVADLAVLSFREWPALESLTLSMYKPKIRPGTKRVGVSLDWTRGDYLRWTGAAGQL
>NC_018514.1|WP_014898478.1|140951_141581_+|sarcosine-oxidase-subunit-gamma
MWNETRNQTPVAGAGVTLESPFVGAADVLKPHQARASKKFMLRERPFLDLVNVRGELSDPAFVSAFERVVGCRPPSAPNTVARGAEYDVLWLGPDEWLVRSNGPVQAGVLEAQLAEAVQGSYAAAVDVGSGYTVVEVSGERVRDVIARGCPLDLHPRVLKLGQCAQSHYFKSPITLIPTGDDTFEIVLRRSFADYFVRIMLDAAAPLAS
>NC_018514.1|WP_014898477.1|137950_140962_+|sarcosine-oxidase-subunit-alpha-family-protein
MSQKDRLGTGGRINRAIPLTFTFNGRTYQGFQGDTLASALLANGVHFVARSFKYHRPRGIVTADVAEPNAVVQLESGPYTVPNARATEIELYQGLVATSVNAEPSLENDKYAINQKFSRFMPAGFYYKTFMWPRNMWPKYEEKIREAAGLGKAPEVLDADRYDKCYAHCDVLVVGGGPSGLAAAHAAATAGARVILVDDQRELGGSLLSCRAEIDAKPALQWVEKIEAELRKLPDVTILSRSTAFGYQDHNLVTVTQRLTDHQPVSMRKGTRELLWKVRAKRVILATGAHERPIVFGNNDLPGVMLAGAVSTYVHRYGVLPGRNVVVFTNNDRAYQTALDLKACGAKVTIVDSRASSNGALPAAAKRQGVTVMSGAVVTAASGKWRVSSVDVASYSNGQTGGKLQSLPCDLVAMSGGFSPVLHLFAQSGGKACWNDEKACFLPGKPVQAEASIGAAAGEFGLARALRLAVDAGAEAAKAAGFTAAQRPVAPQVAETVEGALQPLWLVGSREAAARGPKQFVDFQNDVAAADILLAAREGFESVEHVKRYTAMGFGTDQGKLGNINGMAILAQALGKTIPETGTTTFRPNYTPVSFGTFAGRETGDFLDPIRKTAVHEWHVEHGAMFEDVGNWKRPWYFPKNGEDLHAAVKRECLAVRNSVGILDASTLGKIDIQGPDAVKLLNWMYTNPWNKLEIGKCRYGLMLDENGMVFDDGVTVRLADQHFMMTTTTGGAARVLTWLERWLQTEWPDMKVRLASVTDHWATFAVVGPKSRKVVQKVCQDIDFGNEAFPFMSYRNGTVAGAKARVMRISFSGELAYEVNVPANAGRAVWEALMAAGAEFDITPYGTETMHVLRAEKGYIIVGQDTDGSITPYDLGMGGVVAKSKDFLGKRSLTRSDTAKEGRKQFVGLLTEDEQFVLPEGAQIIAKDTQVSAVDPTPMIGHVTSSYYSPILKRSIALAVVKGGLNKMGESVVIPLANGKRITAKISSPVFYDTEGVRQHVE
>NC_018514.1|WP_014898476.1|137639_137954_+|sarcosine-oxidase-subunit-delta
MLLIECPWCGPRAESEFTCGGEADIARPVASENMTDREWGEYVFMRENKRGLHREQWLHTQGCRRWFKVTRDTVTYDIKGYEKFGGAAISGAAAGNAHEEGTSK
>NC_018514.1|WP_006480591.1|136368_137613_+|sarcosine-oxidase-subunit-beta-family-protein
MSRYSIFSLFRNGLSYHENWEKQWKSPEPKKEYDVVIVGGGGHGLATAYYLAKEHGITNVAILEKGWIGGGNTARNTTIVRSNYLWDESAALYEKAMKLWEGLSQDLNYNVMFSQRGVMNLAHTLQDVRDTERRVNANRLNGVDAEFLTPAQIKEIEPTINLNSRYPVLGASIQRRAGVARHDAVAWGFARGADRAGVDIIQNCQVTGIRREGGAVVGVDTVKGFIKAKKVAVVAAGNTTTLADMAGVRLPIESHPLQALVSEPIKPVVNSVIMSNAVHAYISQSDKGDLVIGAGIDQYTGFGQRGSFHIIESTLQAIVEMFPVFSRVRMNRQWGGIVDVSPDACPIITKTDVKGLYFNCGWGTGGFKATPGSGWVFAHTIARDEPHPLNAPFALDRFYTGHLIDEHGAAAVAH
>NC_018514.1|WP_014898475.1|134966_136352_+|L-serine-ammonia-lyase
MNVSAFDLFKIGIGPSSSHTVGPMIAACRFASHIEDANLLGFVRRVRVELYGSLGATGKGHGTDKAVLLGLEGHLPDTIDPDLIEPRLAEIRAEKSLSLLGKQAIRFEEKENIGFYRKLMSGTSIVHPNGMRFQAFDEHGQLLVEKEYYSVGGGFVVNRDGDRVNGVRAAAEVPYPFRTGDDLMRQCREHGLSIAELMLRNESALRPADEVRAGLLAIWRTMAACVERGCKVEGDLPGPMRVKRRAAELNGRLRARSEESLRDPLSMLDWVNLYAMAVNEENAAGGRVVTAPTNGAAGVIPAVLHYYVKFVPGSNEAGIVEFLLTAAAIGIIYKETASISGAEVGCQGEVGVACSMAAAALAAVMGGTPDQVENAAEIGMEHNLGMTCDPVGGLVQIPCIERNAMGAIKALNASRMALKGNGQHYVSLDSVIKTMRETGADMKTKYKETSRGGLAVNVIEC
>NC_018514.1|WP_014898474.1|133637_134705_-|GlxA-family-transcriptional-regulator
MTPDVPASPLAEPAPQRIRFGIVLLPNFTLTAFSGFVDMLRLSADDGDYSKPVRCAWSVIGETLAPVRASCGIQITPWETFDGAEPFDYVVVVGGLLHSGPQAGPETLEFIRRAAAGGATVVGICTGVFTLMRANVLDGYRTCVSWFHYWDFIERFPSADPDLLIADRLFVIDRRRITCSGGRASIDVAAAILLRHFDHATVQKALRILLVGEMQKGNAPQPHPPGLEPATHPKVKRAILLMEQHVGRALPLEELACKLDMSTRQLERLFKAETGKSPQAFAKQVRLRTAAWLLTSSDRTVADIASSCGFADASHLGREFRKQFGVPPATYRERGGDAAEAGAPMVADPVEDIAD
>NC_018514.1|WP_014898473.1|132732_133437_-|FadR-family-transcriptional-regulator
MFEKIPARAMSDHVAQQLLKQIEAGSFSASGKLPTEAVLAQEFGVSRTVIREAISRLKNEGVVEPRQGSGVYVNQHGAIRPLRIDYAEAVEASSLPHLLAVRRAIEAEVAAEAALHHTADDMADIDDALRKIDDAVAEGRDGVAEDVAFHRTIAAVTGNPYFLKTLQFLNQYLEAGVKVTRRNEATREDFSRQVREEHAAIADAIRARDPMAARNAARTHMYNAARRLAEAGIC
>NC_018514.1|WP_014898472.1|131761_132652_-|NAD-binding-protein
MSRNIGVIGLGAMGLGVARSLLRAGFRVHACDVRDTVVQAFAAEGGVPCASPAELGARCDVVVTLVVNAAQTETVLFGEHGAVPAMKPGGVVIASATVAPDFAVALGARIEAAGLQMLDAPVSGGAARAASGEMTMMTSGPAAAYAACDDVLAAIAGKVYRLGDTHGIGSKVKIINQLLAGVHIAAAAEAMALGLREGVDADALYDVITHSAGNSWMFENRVPHILNGDYTPLSAVDIFVKDLGLVLDTARRSKFPLPLSATAHQMFMSASSAGHGGEDDSAVIKTFPGITLPPAR
>NC_018514.1|WP_014898471.1|130455_131742_-|four-carbon-acid-sugar-kinase-family-protein
MTASASRPLLGCIADDFTGATDLANMLVKSGMRTVQTIGVPAGGAPIDADAIVVALKSRTIPAADAVAQSLAAYAWLRAQGCRQFFFKYCSTFDSTDAGNLGPVADALLDATGGGFAIACPAFPENGRTIFRGHLFVGDALLNESGMENHPLTPMKDANLVRVLQRQTRSQVGLIRYDTIAQGAVAVRARIDALRAEGARFAIADALSDHDLHVLGEACASLPLVTGGSGVALGLPENFRRAGLLPQRDNAASLPRIDGLSAVLAGSASKATNAQVAAWHDSRPSFRIDPLAAARGEPVVDAALVFARTHLPQPVLIYATATPDEVKAVQQALGVEAAGHLVESTLAAIARGLRELGVRKFVVAGGETSGAVVQALDVKSLQIGAQIDPGVPATATIDAQPLGLALKSGNFGTVDFFDKALRALDGAA
>NC_018514.1|WP_014898479.1|142264_143377_-|alkene-reductase
MKQLFVPARAGQDTPQLFAPVRVGRYTLHNRLVMAPMTRSRAAFDGTPGAWTAEYYAQRAGLGLIVTEGTQPSDDGQGYLMTPGIYTDAHVAGWKAISDAVHARGGRLFIQLMHVGRMSHPDNTPHHRQGVAPSAIAPGVPMFTATGMQDIPAPRALTTAEVRDTVNDFRVAARRAIEAGADGVEIHGANGYLVQQFFAPNANTRTDEYGGSIENRARFAVEVATAITDEIGADRTAIRLSPGTTLWGINEGPESADLYRHLATQLDPLGLAYLHVMHQGDESLLADLRAGWRGTLILNRPGRARDAIGADVTSGLADLEAYGQMVLANPDFVTRVKTGAPMNDAQRDTFFGGDARGYVDYPALSGAAAV
>NC_018514.1|WP_014898480.1|143547_144423_+|LysR-family-transcriptional-regulator
MELLNDMALFVEVVKAHGFRSAAQALGMPNSTLSRRIGALEKAIGLRLLHRTTRRIELTEAGQLYFERCKRIVDEARLAHEQLGGLLAEPAGVLRASFPVDFAVIYLTPLLVEFANRYPKLTFDFELTSRRVDLVSEPFDVAIRIGESADSQLVARRLATFRNYLYASPRYLERSGEPLEPDDLTRHQCLSVQRLTAWTLRRGERAVEVPVGGRFVVNSVGMNRQLAVNDAGIIQLPEEVVADDLAAGRLRRVLPEWEGAPVPVYAMTETRLLPAKTQHFIEFLRAHFARE
>NC_018514.1|WP_041490712.1|144448_144835_-|DUF1311-domain-containing-protein
MRHAAGLLAVAALSAGPLPACAAVDCEQQGPTMEAVRRCVLDDHQQQVDNAYRSLERKLAQRNPDAASRLAKSQASWARFAGDTCDYVKAANPQQMMPGDAWMNCWIDFSQARVRILKKWAAQADAPH
>NC_018514.1|WP_014898482.1|144877_145543_-|lytic-transglycosylase-domain-containing-protein
MRRRFFWLIVLSLGIAQQASAQQAPALPASAPEAIASAPSEASAPLANDQPNEANRRITSYLTKKFGVAKERAAKLADIVSITATKYSLPPALVYAIISIESRFQEKARGQHGATGLMQVVPAAHRGMLRDVKDLTEPNANVEAGSRILSGYVRAAGGNVQAGLRNYGGSNAYAAKVMQRVDTFRFVLEPDDDAHAVNDGKAHMMPVSDPSPAPSANRNTK
>NC_018514.1|WP_014898483.1|145790_146558_-|ABC-transporter-permease
MTKRPARSTRSRRLPAYAARTAALALLLVLLLRPAWLQDVFAPFADNGAPVIYDRASLLDLTLAHLGTVALSSLIGTLVAVAAGIAVTRPAGADFLPVARSVVDIGQTFPPVAVLALAVPAVGFGLKPVLIALVLYGLLPIFESTIAGLEDVPRDVVEAARGMGMSGWQQLVSVELPLALPVIVNGIRLAVVINLGTATIGSTVAARGLGDVIIAGLQTSNTAFVLQGGVIVGLLAVLVSDAIGALARVASARRV
>NC_018514.1|WP_014898484.1|146554_147499_-|ABC-transporter-ATP-binding-protein
MIEIERIGKRFGDIAAVDDVSLTMQQGTITALVGASGSGKSTLLRMINRLIAPTSGTIRIDGVDTASVPPEQLRRRIGYVIQGHGLFPHWSVARNIATVPRLLGWPAARIDARVRELLELFHLAPSEFADKLPHELSGGQQQRVGVARALAAEPAMLLMDEPFGALDPIIRNKAQDDLYALQRRLGITVVIVTHDIEEALKLGDTIAVMDGGRLLQVASPAEILGKPAAGVVEQLVAGVDRPLRLLALTPIDAVAEPGHADGEPIAATRTLRDAVSELLWRGADALPVDDGNGRGRGPRRITLDAIRAHARKPA
>NC_018514.1|WP_014898485.1|147495_148674_-|ABC-transporter-permease
MTGRAAASARRMTLDKVGILIGILTIVAVFGLPFMVLRPNRIAAGTGLSVFAALPAAQGAALAALWIVGALWAMTASRPAWRLAAGCAWLATLAYAVGAAATHVVAPDDMLARVSPAAGIWLLLFAWAVLVADALARLAFGPWRRLVALVVAIAAISMPLAGGWWDGLSVMREYAVRSDDFWREAIRHVSLAGGSVAAALVAGLPLGIACARVAPVRTVVMPVLNIVQTIPSIAMYGLMMAPLGLLAAHVPLAAALGIRGIGVAPAVLALFLYSLLPIASSVVVGLAQVPPHVTEAARAMGMTRAQRLLRVDLVLALPVILSGVRIVLVQNIGLTAVAALIGGGGFGTFIFQGIGQSAADLVLLGAIPTIALALAAAVVFEAATSLAKGPAA
>NC_018514.1|WP_014898486.1|148670_149594_-|ABC-transporter-substrate-binding-protein
MKLALPARILGLALAAVVVAPGAHADTPVVVSSKIDTEGNLLGNVIAQVLKAHGIPVTEKIALGTTPIVRKALTSGEIDIYPEYTGNAAFFFNKADDPVWKNASQGYDTAKKLDYAANHLVWLAPAPANNTWGVAVLAPVAQAQHLKTFSDFGKWVAGGGKLKLAASAEFVNSASALPSFEKAYGFKLKPEQLVVLSGGDTAATIKAAANQTDGVNAAMVYGTDGGIASSGLAVLDDDKHVQPVYAPTPVIREAVLKAHPQIADYLKPVFASLDLKTLQTLNARIQINGEPAAGVATSYLKSKGFVK
>NC_018514.1|WP_014898487.1|149761_150691_+|2-hydroxyacid-dehydrogenase
MKPELLVLIALRGDAHHQIAASYDVHYAPTAEERVRAIAEHGRTIRAVLTNGSTGLTAAEIDHLPQLTFVSALGAGYEHIDVAHAQARGITVVTGAGTNDDCVADHAFALLLAAVRNVVQLDAKTRAGVWRDALQMPPNVSGKKLGIVGLGKIGEKCARRAAGFDIETGYHNRAAKDVPYRYFERVDALAHWADFLIVATPGGAGTRHLIDRTVLDALGPGGFLVNVSRGSVVDTAALADALRERRIAGAALDVYEGEPEPPRALTALDNVVLTPHMGGWSPEALDRSVQQFLDNAARHFAGEPVLTPV
>NC_018514.1|WP_014898488.1|150739_151330_+|APC-family-permease
MWFNLGVSFVFMFFFRGWGTLAAVISVATVISFLTGPVSVMALRTHAADLPRPLRIAGMPIVAPFAFVCASLVLYWACWPLTGQIILLIVAALPIYLYYQSKSGWADFRAELRSAWWLLAYLPVMALLSLCGEQAFGGYGIIPDGWDLFAVVIVALAFYRRGVASGRRTTYLREYATVQRAGSAEDDTPLPVTHAG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_018514_1	1.1\|142122\|25\|NC_018514\|CRISPRCasFinder	142122-142146	25	MN694460	Marine virus AFVG_250M188, complete genome	31630-31654	3	0.88
NC_018514_1	1.1\|142122\|25\|NC_018514\|CRISPRCasFinder	142122-142146	25	EU409559	Lactobacillus phage JCL1032, complete genome	12817-12841	4	0.84

1. spacer 1.1|142122|25|NC_018514|CRISPRCasFinder matches to MN694460 (Marine virus AFVG_250M188, complete genome) position: , mismatch: 3, identity: 0.88

gccggtcacgaaccattgccgtctg	CRISPR spacer
gccggtcacgacccagtgccgtctc	Protospacer
*********** *** ********

2. spacer 1.1|142122|25|NC_018514|CRISPRCasFinder matches to EU409559 (Lactobacillus phage JCL1032, complete genome) position: , mismatch: 4, identity: 0.84

gccggtcacgaaccattgccgtctg	CRISPR spacer
atcggtcacgaactattgccgactg	Protospacer
..***********.******* ***

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

903600 : 971191

Burkholderia_phage(52.27%)

portal,integrase,head,capsid,tail,terminase,holin

attL 913699:913716|attR 980498:980515

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_041490941.1\|903600_904794_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_014899162.1\|905262_906438_-	LuxR family transcriptional regulator	NA	NA	NA	NA
WP_014899163.1\|906675_907056_+	DUF4377 domain-containing protein	NA	NA	NA	NA
WP_014899164.1\|907078_908467_-	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
WP_014899165.1\|908631_909492_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_014899166.1\|909603_909954_-	VOC family protein	NA	NA	NA	NA
WP_014899167.1\|910213_911353_+	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_014899168.1\|911522_912716_+	acyl-CoA dehydrogenase family protein	NA	NA	NA	NA
WP_014899169.1\|912726_914487_+	FAD-binding protein	NA	NA	NA	NA
913699:913716	attL	NA	NA	NA	NA
WP_014899170.1\|914483_915002_+	flavin reductase family protein	NA	NA	NA	NA
WP_014899171.1\|915041_915233_+	hypothetical protein	NA	NA	NA	NA
WP_041490943.1\|915255_916299_+	ferredoxin--NADP reductase	NA	NA	NA	NA
WP_187293272.1\|916351_917932_+	fatty acid--CoA ligase family protein	A0A1V0SBX8	Catovirus	2.3e-09	26.0
WP_014899174.1\|917964_918738_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_014899175.1\|919528_920206_+	hypothetical protein	NA	NA	NA	NA
WP_014899176.1\|920483_920720_+	DNA-binding protein	NA	NA	NA	NA
WP_014899177.1\|920783_921863_-\|integrase	phage integrase Arm DNA-binding domain-containing protein	K7P6P6	Enterobacteria_phage	1.6e-38	32.1
WP_041490754.1\|921862_922054_-	excisionase	NA	NA	NA	NA
WP_014899179.1\|922112_922751_-	hypothetical protein	A0A059VF56	Pseudomonas_phage	4.8e-30	39.6
WP_148283870.1\|922749_923286_+	hypothetical protein	NA	NA	NA	NA
WP_014899181.1\|923319_924018_-	hypothetical protein	NA	NA	NA	NA
WP_014899182.1\|924036_924894_-	hypothetical protein	A0A2H4J418	uncultured_Caudovirales_phage	4.4e-71	48.3
WP_014899183.1\|925090_925735_+	hypothetical protein	Q8W6Q5	Burkholderia_virus	4.1e-13	38.5
WP_014899185.1\|925996_926290_-	hypothetical protein	NA	NA	NA	NA
WP_041490755.1\|927463_931351_+	hypothetical protein	NA	NA	NA	NA
WP_014899188.1\|931517_932666_+	restriction endonuclease	NA	NA	NA	NA
WP_041490756.1\|933265_933646_-	helix-turn-helix domain-containing protein	G3EN81	Psychrobacter_phage	1.7e-06	42.0
WP_014899190.1\|934005_934257_-	hypothetical protein	NA	NA	NA	NA
WP_041490947.1\|934418_934700_+	hypothetical protein	A0A1S5NNI6	Burkholderia_phage	1.0e-16	53.6
WP_014899193.1\|934957_935254_+	hypothetical protein	A1YZR1	Burkholderia_virus	4.2e-21	51.1
WP_014899194.1\|935274_936129_+	hypothetical protein	Q8W6P2	Burkholderia_virus	2.3e-104	73.7
WP_014899195.1\|936125_937133_+	helix-turn-helix domain-containing protein	Q8W6P0	Burkholderia_virus	1.1e-97	62.3
WP_014899196.1\|937302_937866_+	hypothetical protein	Q3HQZ9	Burkholderia_phage	5.8e-88	85.6
WP_148283872.1\|937880_938198_+	hypothetical protein	NA	NA	NA	NA
WP_014899198.1\|938194_938638_+	DUF1364 family protein	Q3HR02	Burkholderia_phage	8.1e-69	81.0
WP_041490758.1\|938640_938973_+	hypothetical protein	Q3HR03	Burkholderia_phage	8.2e-34	63.9
WP_014899200.1\|938969_939218_+	hypothetical protein	Q3HR04	Burkholderia_phage	7.0e-38	87.8
WP_014899201.1\|939261_939687_+	hypothetical protein	NA	NA	NA	NA
WP_080599505.1\|939902_940742_-	two pore domain potassium channel family protein	NA	NA	NA	NA
WP_014899203.1\|941275_942211_+	hypothetical protein	NA	NA	NA	NA
WP_014899204.1\|942504_942861_+	HNH endonuclease	Q8W6N0	Burkholderia_virus	4.8e-56	84.7
WP_014899205.1\|943007_943493_+\|terminase	phage terminase small subunit P27 family	Q8W6V0	Burkholderia_virus	1.6e-86	96.9
WP_014899206.1\|943502_945215_+\|terminase	terminase large subunit	Q8W6U9	Burkholderia_virus	0.0e+00	96.5
WP_014899207.1\|945211_945397_+	hypothetical protein	A4JWZ8	Burkholderia_virus	1.9e-16	85.2
WP_014899208.1\|945401_946661_+\|portal	phage portal protein	A4JWZ9	Burkholderia_virus	6.6e-225	92.8
WP_014899209.1\|946657_947626_+	S49 family peptidase	A4JX00	Burkholderia_virus	1.6e-154	90.7
WP_014899210.1\|947728_949036_+\|capsid	phage major capsid protein	A4JX01	Burkholderia_virus	7.6e-200	85.1
WP_014899211.1\|949095_949281_+	hypothetical protein	Q8W6U4	Burkholderia_virus	9.9e-13	62.3
WP_014899212.1\|949287_949854_+	hypothetical protein	A4JX03	Burkholderia_virus	1.9e-75	73.9
WP_014899213.1\|949853_950180_+\|head	phage head closure protein	A4JX04	Burkholderia_virus	4.3e-51	87.0
WP_014899214.1\|950172_950595_+	HK97 gp10 family phage protein	C7BGH3	Burkholderia_phage	1.6e-58	89.9
WP_014899215.1\|950591_950933_+	DUF3168 domain-containing protein	Q3HQT5	Burkholderia_phage	7.4e-38	74.6
WP_014899216.1\|950990_951455_+	hypothetical protein	Q3HQT6	Burkholderia_phage	4.2e-68	87.0
WP_014899217.1\|951486_951951_+\|tail	tail assembly protein	Q3HQT7	Burkholderia_phage	1.1e-57	70.6
WP_041490762.1\|951947_952226_+	DUF4035 domain-containing protein	Q3HQT8	Burkholderia_phage	2.3e-37	87.0
WP_014899219.1\|952239_956340_+\|tail	phage tail tape measure protein	C7BGC8	Burkholderia_phage	0.0e+00	90.2
WP_014899220.1\|956339_956678_+\|tail	phage tail protein	C7BGC9	Burkholderia_phage	7.1e-49	82.1
WP_014899221.1\|956686_958189_+	hypothetical protein	C7BGD0	Burkholderia_phage	8.6e-38	36.2
WP_014899222.1\|958188_958872_+\|tail	phage minor tail protein L	C7BGD1	Burkholderia_phage	9.4e-117	87.7
WP_014899223.1\|958920_959673_+	C40 family peptidase	C7BGD2	Burkholderia_phage	1.5e-136	89.2
WP_014899224.1\|959669_960233_+\|tail	tail assembly protein	C7BGD3	Burkholderia_phage	6.2e-90	92.0
WP_080599506.1\|963724_965467_+	DUF1983 domain-containing protein	Q3HQU5	Burkholderia_phage	1.1e-73	91.2
WP_014899226.1\|965466_965775_+	hypothetical protein	Q3HQU6	Burkholderia_phage	1.1e-45	84.3
WP_014899227.1\|965774_966491_+	hypothetical protein	C7BGD6	Burkholderia_phage	1.1e-107	76.9
WP_014899228.1\|966549_966843_+\|holin	phage holin family protein	C7BGD7	Burkholderia_phage	4.1e-37	89.2
WP_014899229.1\|966835_967255_+	glycoside hydrolase family protein	A0A1Q1PW74	Pseudoalteromonas_phage	2.8e-23	43.2
WP_041490765.1\|967251_967734_+	DUF2514 family protein	C7BGD9	Burkholderia_phage	1.7e-35	53.8
WP_014899231.1\|967880_969035_+	HNH endonuclease	NA	NA	NA	NA
WP_148283924.1\|969117_969366_-	hypothetical protein	C7BGE3	Burkholderia_phage	4.9e-15	46.3
WP_014899233.1\|969493_969898_+	SOS response-associated peptidase family protein	C7BGE4	Burkholderia_phage	1.9e-64	84.5
WP_014899234.1\|970270_971191_+	trypsin-like peptidase domain-containing protein	A0A2H4JE36	uncultured_Caudovirales_phage	1.5e-32	40.0
980498:980515	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_018513

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NC_018514

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection