CRISPRimmunity

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NC_018524	Nocardiopsis alba ATCC BAA-2165, complete sequence	35 crisprs	DinG,csa3,c2c9_V-U4,WYL,cas3,DEDDh,cas6e,cas4,cas5,cas7,cse2gr11,csx1,csm3gr7,csx25	1	180	0	0

1. NC_018524

CRISPR-Cas detection and classification

Crispr_ID: NC_018524_2

• CRISPR_ID: NC_018524_2
• CRISPR_location: 313187-313460
• CRISPR_type: Orphan
• Repeat_type: I-E:I-E,II-B
• Spacer_info: 4 spacers

Consensus repeat of NC_018524_2

Consensus_repeat	Method
CGGTCCATCCCCACGTGCGTGGGGCTCAC	CRISPRCasFinder
GGTCCATCCCCGCGTGCGCGGGGAGCAG	CRT
CGGGTCCATCCCCGCGTGCGCGGGGAGCAGC	PILER-CR

spacers of NC_018524_2

>2.1|313216|32|NC_018524|CRISPRCasFinder
GGGTCGTCACCGGACTGGAGATTCTGGGCTTC
>2.2|313277|32|NC_018524|CRISPRCasFinder
GCCCTGCATCATGTTGACCCCTCTGACTAGGA
>2.3|313338|32|NC_018524|CRISPRCasFinder
GAGGAGTACTGCCCGTTCCTGGTGAGGGTGAC
>2.4|313399|32|NC_018524|CRISPRCasFinder
CACACCACCCCGGCCTGGCCACGGCCGGCGTC
>2.5|313216|33|NC_018524|CRT
GGGTCGTCACCGGACTGGAGATTCTGGGCTTCC
>2.6|313277|33|NC_018524|CRT
GCCCTGCATCATGTTGACCCCTCTGACTAGGAG
>2.7|313338|33|NC_018524|CRT
GAGGAGTACTGCCCGTTCCTGGTGAGGGTGACG
>2.8|313399|33|NC_018524|CRT
CACACCACCCCGGCCTGGCCACGGCCGGCGTCG
>2.9|313340|30|NC_018524|PILER-CR
AGGAGTACTGCCCGTTCCTGGTGAGGGTGA
>2.10|313401|30|NC_018524|PILER-CR
ACACCACCCCGGCCTGGCCACGGCCGGCGT

CRISPR arrays and Neighbor proteins around NC_018524_2

CRISPR arrays

The CRISPR arrays of NC_018524_2

>merge|NC_018524|2|313187-313460|CRISPRCasFinder,CRT,PILER-CR
CGGCCCATCCCCACGTACGTGGGGCTCAGGGGTCGTCACCGGACTGGAGATTCTGGGCTTCCGGTCCATCCCCGCGTGCGCGGGGAGCAGGCCCTGCATCATGTTGACCCCTCTGACTAGGAGGGTCCATCCCCGCGTGCGCGGGGAGCAGGAGGAGTACTGCCCGTTCCTGGTGAGGGTGACGGGTCCATCCCCGCGTGCGCGGGGAGCAGCACACCACCCCGGCCTGGCCACGGCCGGCGTCGGGTCCATCCCCGCGTGCGCGGGGAGCAGC

>NC_018524|2|2|313187-313459|CRISPRCasFinder
CGGCCCATCCCCACGTACGTGGGGCTCAG	GGGTCGTCACCGGACTGGAGATTCTGGGCTTC
CGGTCCATCCCCGCGTGCGCGGGGAGCAG	GCCCTGCATCATGTTGACCCCTCTGACTAGGA
GGGTCCATCCCCGCGTGCGCGGGGAGCAG	GAGGAGTACTGCCCGTTCCTGGTGAGGGTGAC
GGGTCCATCCCCGCGTGCGCGGGGAGCAG	CACACCACCCCGGCCTGGCCACGGCCGGCGTC
GGGTCCATCCCCGCGTGCGCGGGGAGCAG

>NC_018524|2|2|313188-313459|CRT
GGCCCATCCCCACGTACGTGGGGCTCAG	GGGTCGTCACCGGACTGGAGATTCTGGGCTTCC
GGTCCATCCCCGCGTGCGCGGGGAGCAG	GCCCTGCATCATGTTGACCCCTCTGACTAGGAG
GGTCCATCCCCGCGTGCGCGGGGAGCAG	GAGGAGTACTGCCCGTTCCTGGTGAGGGTGACG
GGTCCATCCCCGCGTGCGCGGGGAGCAG	CACACCACCCCGGCCTGGCCACGGCCGGCGTCG
GGTCCATCCCCGCGTGCGCGGGGAGCAG

>NC_018524|2|2|313309-313460|PILER-CR
GGGTCCATCCCCGCGTGCGCGGGGAGCAGGA	GGAGTACTGCCCGTTCCTGGTGAGGGTGAC
GGGTCCATCCCCGCGTGCGCGGGGAGCAGCA	CACCACCCCGGCCTGGCCACGGCCGGCGTC
GGGTCCATCCCCGCGTGCGCGGGGAGCAGC

Neighbor Proteins Overview

Protein	Signature genes	Signature genes Name	Protein_function
NC_018524.1|WP_014908173.1|312847_312988_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014909084.1|310030_310204_+|DUF397-domain-containing-protein	unknown	unknown	gnl|CDD|377231
NC_018524.1|WP_014911377.1|313567_314176_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014910426.1|306147_307248_-|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl|CDD|252734
NC_018524.1|WP_014912727.1|320779_321280_+|DinB-family-protein	unknown	unknown	gnl|CDD|368218
NC_018524.1|WP_014909153.1|305802_306009_-|DUF397-domain-containing-protein	unknown	unknown	gnl|CDD|377231
NC_018524.1|WP_014909711.1|320121_320739_+|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl|CDD|379312
NC_018524.1|WP_014912591.1|317321_318476_+|ribosomal-RNA-adenine-dimethylase	unknown	unknown	gnl|CDD|275041
NC_018524.1|WP_014911097.1|315608_315815_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_041562078.1|308813_309554_+|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl|CDD|197775
NC_018524.1|WP_014908790.1|316093_316351_+|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014908800.1|314253_315090_-|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl|CDD|238045
NC_018524.1|WP_041561645.1|307232_307493_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014912209.1|310269_311295_-|IS30-family-transposase	unknown	unknown	gnl|CDD|225382
NC_018524.1|WP_014912358.1|319447_320035_-|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl|CDD|238045
NC_018524.1|WP_026125377.1|307879_308188_-|ATP-binding-protein	unknown	unknown	gnl|CDD|340413
NC_018524.1|WP_014908559.1|316365_317325_+|ATP-grasp-ribosomal-peptide-maturase	unknown	unknown	gnl|CDD|275040
NC_018524.1|WP_014909979.1|309550_309727_+|DUF397-domain-containing-protein	unknown	unknown	gnl|CDD|377231
NC_018524.1|WP_014912130.1|305098_305620_-|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl|CDD|238045
NC_018524.1|WP_041561647.1|315096_315612_-|hypothetical-protein	unknown	unknown	unknown

rpsblast for functional proteins

Protein	Function_ID	Function_description	E-value
NC_018524.1|WP_014909084.1|310030_310204_+|DUF397-domain-containing-protein	gnl|CDD|377231	pfam04149, DUF397, Domain of unknown function (DUF397). The function of this family is unknown.	5.16256e-15
NC_018524.1|WP_014910426.1|306147_307248_-|helix-turn-helix-domain-containing-protein	gnl|CDD|252734	pfam04672, Methyltransf_19, S-adenosyl methyltransferase. This family contains a SAM (S-adenosyl methyltransferase) domain, with a central beta sheet with 3 alpha-helices on both sides. Crystal packing analysis of the structure Structure 3giw suggests that a monomer is the solution state oligomeric form. An unidentified ligand (UNL, cyan) was found at the putative active site surrounded by the residues His57, His170, Phe171, Tyr216 and Met22. The UNL is likely to be a phenylalanine or phenylalanine-like molecule. (details derived from TOPSAN).	6.50572e-15
NC_018524.1|WP_014912727.1|320779_321280_+|DinB-family-protein	gnl|CDD|368218	pfam04978, DUF664, Protein of unknown function (DUF664). This family is commonly found in Streptomyces coelicolor and is of unknown function. These proteins contain several conserved histidines at their N-terminus that may form a metal binding site.	2.21309e-43
NC_018524.1|WP_014909979.1|309550_309727_+|DUF397-domain-containing-protein	gnl|CDD|377231	pfam04149, DUF397, Domain of unknown function (DUF397). The function of this family is unknown.	3.52786e-17
NC_018524.1|WP_014909711.1|320121_320739_+|class-I-SAM-dependent-methyltransferase	gnl|CDD|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	1.5345e-16
NC_018524.1|WP_014912591.1|317321_318476_+|ribosomal-RNA-adenine-dimethylase	gnl|CDD|275041	TIGR04188, conserved_hypothetical_protein, methyltransferase, ATP-grasp peptide maturase system. Members of this protein family are predicted SAM-dependent methyltransferases that regularly occur in the context of a putative peptide modification ATP-grasp enzyme (TIGR04187, related to enzymes of microviridin maturation) and a putative ribosomal peptide modification target (TIGR04186).	8.77333e-93
NC_018524.1|WP_041562078.1|308813_309554_+|helix-turn-helix-transcriptional-regulator	gnl|CDD|197775	smart00530, HTH_XRE, Helix-turn-helix XRE-family like proteins.	0.00489888
NC_018524.1|WP_014908800.1|314253_315090_-|helix-turn-helix-transcriptional-regulator	gnl|CDD|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	2.91421e-11
NC_018524.1|WP_014912209.1|310269_311295_-|IS30-family-transposase	gnl|CDD|225382	COG2826, Tra8, Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair].	3.38415e-104
NC_018524.1|WP_014912358.1|319447_320035_-|helix-turn-helix-domain-containing-protein	gnl|CDD|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	1.90666e-16
NC_018524.1|WP_026125377.1|307879_308188_-|ATP-binding-protein	gnl|CDD|340413	cd16936, HATPase_RsbW-like, Histidine kinase-like ATPase domain of RsbW, an anti sigma-B factor and serine-protein kinase involved in regulating sigma-B during stress in Bacilli, and related domains. This family includes histidine kinase-like ATPase (HATPase) domain of RsbW, an anti sigma-B factor as well as a serine-protein kinase involved in regulating sigma-B during stress in Bacilli. The alternative sigma factor sigma-B is an important regulator of the general stress response of Bacillus cereus and B. subtilis. RsbW is an anti-sigma factor while RsbV is an anti-sigma factor antagonist (anti-anti-sigma factor). RsbW can also act as a kinase on RsbV. In a partner-switching mechanism, RsbW, RsbV, and sigma-B participate as follows: in non-stressed cells, sigma-B is present in an inactive form complexed with RsbW; in this form, sigma-B is unable to bind to RNA polymerase. Under stress, RsbV binds to RsbW, forming an RsbV-RsbW complex, and sigma-B is released to bind to RNA polymerase. RsbW may then act as a kinase on RsbV, phosphorylating a serine residue; RsbW is then released to bind to sigma-B, hence blocking its ability to bind RNA polymerase. A phosphatase then dephosphorylates RsbV so that it can again form a complex with RsbW, leading to the release of sigma-B.	4.12566e-06
NC_018524.1|WP_014908559.1|316365_317325_+|ATP-grasp-ribosomal-peptide-maturase	gnl|CDD|275040	TIGR04187, conserved_hypothetical_protein, ATP-grasp ribosomal peptide maturase, SAV_5884 family. Members of this protein family are ATP-grasp ligase family enzymes that regularly occur in a contexts with a methyltransferase and a putative ribosomally translated post-translationally modified peptide precursor. Because of this conserved gene neighborhood and close sequence similarity to ATP-grasp enzymes from microviridin/marinostatin biosynthesis cassettes, this enzyme is suggested also to serve as a peptide maturase.	3.35075e-130
NC_018524.1|WP_014909153.1|305802_306009_-|DUF397-domain-containing-protein	gnl|CDD|377231	pfam04149, DUF397, Domain of unknown function (DUF397). The function of this family is unknown.	2.60706e-05
NC_018524.1|WP_014912130.1|305098_305620_-|helix-turn-helix-transcriptional-regulator	gnl|CDD|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	2.29964e-07

Protein sequences

>NC_018524.1|WP_014908173.1|312847_312988_-|hypothetical-protein
MAIGLALGIALGTAFDNLALGIVVGALLGAAVGAAGGGLKGKRATD
>NC_018524.1|WP_014912209.1|310269_311295_-|IS30-family-transposase
MAPPATERSRYLTGDERIRIADLDREGMGVRTIAAELGRAPSTISRGLRRNATVDQRGRRHYRPYAAQARAQARRPRPKPSKITLDPELRTRVQDLLDERWSPEQISRRLKRDFPDRPELHMCHETVYQALYVQARGGLRRDVTAALRSGRTRRKPRGQARQRRPRFAHPMVMISERPPEVIDRAVPGHWEGDLIIGSGGGSAIGTLVERSTRYTMLVHLPHGRGAEQVAGALAATVTTLPAHLARSVTWDQGSELSRHHEFTTATDIPVYFCDPASPWQRGSNENTNGLLRQYFPKGTDLSVHSREHLEAVAVQLNGRPRKTLGWDTPAERLAKLLEASN
>NC_018524.1|WP_014909084.1|310030_310204_+|DUF397-domain-containing-protein
MTSETPWHKSTYSGNQGHCVEVAEGPTTHIRDTQHRALAELNLPAHEWSAFLTTLTR
>NC_018524.1|WP_014909979.1|309550_309727_+|DUF397-domain-containing-protein
MMTDEWGKSSYSNGTGGNCVEARATGQGAAMRDTQNRELGHLGFDTKEWTALLGTLKK
>NC_018524.1|WP_041562078.1|308813_309554_+|helix-turn-helix-transcriptional-regulator
MTQQELSAASTVGQSTISDLELGKKRTQRDYVVRMDAALAARGVLLGAWDASFGEGGTSAYFREVAEAEQTAIEIREFALGLVPGLLQVEAYVRAVSVLARPKADPESIAKAVQARKNRQELLDKEHPPAFTALLDESVLLREFHSPQVMASQIDHLIAQSYQPRVRVQVIPLKAEGHAGLGGSFTLMEVPDSGTFAYVESQETGFVLKQPEVVGSYDRTFAELRSAALPVSESRTKLKEIRGNIT
>NC_018524.1|WP_026125377.1|307879_308188_-|ATP-binding-protein
MAAVEIANRASLIAWELMDNAHRHSHSGAPDQTLTLMLERSRYLLSITVTDAGPTPGRKKLSFPEQKSHGGGLGRVASLSFYWDWDGCAGLPVTVKARIELP
>NC_018524.1|WP_041561645.1|307232_307493_-|hypothetical-protein
MTEQNAAAELSALRLLGRLSVQQRLARVDHRLSLARLLVDGILDERSRVERQLREAEQAEQDAGTQELGVAVKRYLAMGGRTWTTS
>NC_018524.1|WP_014910426.1|306147_307248_-|helix-turn-helix-domain-containing-protein
MDDLLTPAQAASQWGVSYATAARWAREGTIPALHVGRRYYYLQGTVDQVRRARATGVAPYPNHYANAGVAMTMTWGAARSGTLLDREEWALTNAARTFDYLDYGKDSWSEDRHVAVKMAEASPGLAGQMLVHRKARECVVDAVCRSFSQVIDLGCGLPAMRRAPHERGRVLWGPRARTVYVDHDLAALAAVRAWWEHPAQVRGYNVRVLDLDLRYPENLASALEEHLDLSVPVGVLSTLTLAHLQDEELAGLVEALAARLAPGSGWGITHLSGMVGAAEVYTGQAREQGADTRLVARDPDGLRKVFEASGWGRWRGLSPREPGGGEPPIAALTTLIRPDRASRTASPDRSEYTASPVRPAGSTGVD
>NC_018524.1|WP_014909153.1|305802_306009_-|DUF397-domain-containing-protein
MRIVETQGRKSLTAGVWHKAEASQGATNCAAAKLITGGNVLMGDTQNPDQVRLTLPGSAWDALVRTVA
>NC_018524.1|WP_014912130.1|305098_305620_-|helix-turn-helix-transcriptional-regulator
MSAKSKEAQVDQDADSLCTDSKKALGVHLKRLRKAAGLSGYRLSGVDQSTVSRIETGRIRPSHELMIRLLDAYEADQEGREQAYLLWDQAQLPLQTRRRQVEGTRPAWDQAARPVCSPTLLAGASAAEDAARYLTRAQWAGNSQARRNALLDDAEGRLVQVLAALHSARTRMR
>NC_018524.1|WP_014911377.1|313567_314176_-|hypothetical-protein
MGEVEYDDAAAPPGWRGKGGLRGRGLEARQDELRSLEVSVTEARYFLPAMVTGLLATPEYIRASLADSPGDVSATVAKKIARQEVLREGSCSFTFLLTEQAVRWALLSPEGMVEQAARLVEVSRLERVRLGVIPLGTVLPRGPMNTFTVYDDRFATVEIFTGRLAFRDSRDVETYRELFAMYEEHALFGDQARERIRSWFEA
>NC_018524.1|WP_014908800.1|314253_315090_-|helix-turn-helix-transcriptional-regulator
MSEQVLRAKEAFGTRLREIRKDAGISGRELAAVTGMHFTKISRLENGKQNPSEKDIRAWCAACGADDQHDDLVATLRGIEGMWIEWRRHLKGGLGHLQKTFDRFHEGASVVRSYESIVVPGILQTQDYAHAVLEIANDFYGSDDEVDGAVDVRLGRQRFLHQGKQRFLFVVEFWALKTRFGDVKIMREQLERLLAVTTFPSVSFGVIPPDVVRGMWPGEGVWIFDEKIAVVETTTAELTITQPSEIALFLRSFERLQRHAVYGFEARSLITKAIEELE
>NC_018524.1|WP_041561647.1|315096_315612_-|hypothetical-protein
MRITQSEFDEIFEGFDSECFHMEMRDSYGTQSEIEPFAKWVNGEVDDFEWMNGWCDTLRRGVDKGKVFRRALVVSEPLSEYQKWAHSTTTPLVEAGEDIRWVPRRRVSSMALPGNDFYLIDGKKVIFMHYSGEGVMEDILVSFERSDVELCRSAFESVWPLAIPHAEYRVD
>NC_018524.1|WP_014911097.1|315608_315815_-|hypothetical-protein
MHITLKGKDPESRPNGSPTIYKTDQGSWLVQGWVVEDRSVLDEMDIPEGETVVEIPDRMLRYFSGEGE
>NC_018524.1|WP_014908790.1|316093_316351_+|hypothetical-protein
MANVQSSPTETSPTTLVRPFGLTRCTTPGTNATYDVSGIDYDTDRQISTRDGRPLIEQPILGTAVQCTVTTTEDMQAWTDEVTDA
>NC_018524.1|WP_014908559.1|316365_317325_+|ATP-grasp-ribosomal-peptide-maturase
MTVVVLTQRFDPTADLVIRELHRREVPVFRCDPGDFPEQIALCAHLSSTGTVTGTLRQGVREVSLTEITSVYHRRPSPHRAHRHLNESERRWSEREAAAGFHGALSALDRFWLNHPDDNRIAAHKPRQLAQAARAGLSVPESLITNTTHAAHTFALAQGKTVYKPMTGGPEPDGSGQVRKALYTTVVEPEEIGPGVERTAHLFQVWVDKAYEVRLTVVGEELFAARIDARGEAARTDWRSDYGSLSYAPIEAPCSVRGAVLRLMCALGLTYGALDFVVTPDGEWVFLELNPNGQWGWIELATGLPIASAIATRLSKEHT
>NC_018524.1|WP_014912591.1|317321_318476_+|ribosomal-RNA-adenine-dimethylase
MTRSTTATEAFEPEHAARLARDLAEKGAIRSPEWRRVFARVPRHLFVSSFVVRTSEGTVAYDEQTPGRLETIYSDATLITRFSADGLAISSSTEPSLMALMLEHLRLQDGMKVLEVGTGTGYNAALLSERLCSALVTSIDVDGALVDRARGALEAAGYRPALAAVDGARGYPNNAPYQRILATCGLGRIPVSWLDQLDEGGLILANVGLGMALLRKGSDGHARGRLLPEAAGFMRLRSSSAPGVPTVSEVLSVTGGGPERVRVVEKVAGLDDHASSEFLLSLLLPYGLRVVQHRQEGQVHGVLDGASGSWMRVEVDHQGRTTVSERGDRHLWAAYTALLSDWEEAGRPEIGRYGLTITPAGEHHLWLDHPQNTNTPLDQAETTG
>NC_018524.1|WP_014912358.1|319447_320035_-|helix-turn-helix-domain-containing-protein
MDDETEDVLDVVGSRLRALRRARGITLADLAVTIGVSESTLSRLESGRRRATLELLLPLARAYDVPLGDLVGAPRTGDPRIHLKPIRRFGMVFVPLSRRPGGTQAFKMIIPARSEPLEPTPQTHEGFEWVYVLDGRLRLVLGERDLTLSPGEVAEFDTSLPHWLGSADGGSVELLVLFDLQGVRAHVRTGTASEA
>NC_018524.1|WP_014909711.1|320121_320739_+|class-I-SAM-dependent-methyltransferase
MDTKDATTFWDGVHATRPVATDPQPNDRLVEAVTGLASGRVLDLECGEGGDALWLARQGWHVTAVDLSAVAVARLTALARSHDLQELVTAERHDLHTSFPQGRFDLVSAHYLHSPHDLDRSAVLRAAAHALNPGGLLLVVDHGSAAPSPAPDAHYPTPQEVAADIDLDPATWTVERADTPRRIATGPGGRTAEVTDHILLIRRTA
>NC_018524.1|WP_014912727.1|320779_321280_+|DinB-family-protein
MSTTSRDDRRGDSPPPRTGNSEAEVLRGFLDYLRTSIAAKVENAPEPQARTAGVPSGTNLLGLLHHLTFVEHAMFLGDRVTDWQATFQAAPADSGADVVARYRRTVERANRVLDGCTDLGAPVPRPGPGRPAPSLRWALVHMIEETGRHAGHADILREQIDGAVGR

Crispr_ID: NC_018524_1

• CRISPR_ID: NC_018524_1
• CRISPR_location: 311597-312485
• CRISPR_type: Orphan
• Repeat_type: I-E,II-B
• Spacer_info: 14 spacers

Consensus repeat of NC_018524_1

Consensus_repeat	Method
CGGTCCATCCCCACGTGCGTGGGGCTCAC	PILER-CR
CGGTCCATCCCCACGTGCGTGGGGCTCAC	CRISPRCasFinder
CGGTCCATCCCCACGTGCGTGGGGCTCAC	CRT

spacers of NC_018524_1

>1.1|311626|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT
AGCACCAACAGCAGCGCGGTCCACCCGTCCCG
>1.2|311687|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT
CCGGTTGATCTCGTCGAATACGGCTGCGAGGT
>1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT
GTGCCGCTGGCCATCTCCATCGTCGGCTCCTA
>1.4|311809|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT
CGTTCATCCGGGCGGGTCTGTTCTGGGTGAGC
>1.5|311870|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT
AAGCCACAAAGCCAGCTCCGTACATGCGTCAG
>1.6|311931|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT
ACCATCATGTCGCCGAACGCGGAGCCGGCCCA
>1.7|311992|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT
TTCTTCATCCAGGGGGCGCGGGAGACGATCTC
>1.8|312053|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT
TCTGGTCGGGAGAGCCGAAGTAGTCGGGTTCG
>1.9|312114|37|NC_018524|PILER-CR,CRISPRCasFinder,CRT
TATGACGAGGCGTGCCGTCGCGCGGGCCGGACCTTGG
>1.10|312180|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT
TAGGCGGCCTCGGCGGTAAAGGCGGGGGCGTC
>1.11|312241|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT
ACGGCTGTAGGTGCCTCCGGGGCCGGTGTCGT
>1.12|312302|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT
TAAATGATCTTGTCACTTTTGGTGTCACGCGC
>1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT
TCCTCCGGCGCCTCGTCGGCGACGTCGGCGAC
>1.14|312424|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT
TCGACGAGGTACGCATTCAGGAGCCGGAGCGA

CRISPR arrays and Neighbor proteins around NC_018524_1

CRISPR arrays

The CRISPR arrays of NC_018524_1

>merge|NC_018524|1|311597-312485|PILER-CR,CRISPRCasFinder,CRT
CGGTCCATCCCCACGTGCGTGGGGCTCACAGCACCAACAGCAGCGCGGTCCACCCGTCCCGCGGTCCATCCCCACGTGCGTGGGGCTCACCCGGTTGATCTCGTCGAATACGGCTGCGAGGTCGGTCCATCCCCACGTGCGTGGGGCTCACGTGCCGCTGGCCATCTCCATCGTCGGCTCCTACGGTCCATCCCCACGTGCGTGGGGCTCACCGTTCATCCGGGCGGGTCTGTTCTGGGTGAGCCGGTCCATCCCCACGTGCGTGGGGCTCACAAGCCACAAAGCCAGCTCCGTACATGCGTCAGCGGTCCATCCCCACGTGCGTGGGGCTCACACCATCATGTCGCCGAACGCGGAGCCGGCCCACGGTCCATCCCCACGTGCGTGGGGCTCACTTCTTCATCCAGGGGGCGCGGGAGACGATCTCCGGTCCATCCCCACGTGCGTGGGGCTCACTCTGGTCGGGAGAGCCGAAGTAGTCGGGTTCGCGGTCCATCCCCACGTGCGTGGGGCTCACTATGACGAGGCGTGCCGTCGCGCGGGCCGGACCTTGGCGGTCCATCCCCACGTGCGTGGGGCTCACTAGGCGGCCTCGGCGGTAAAGGCGGGGGCGTCCGGTCCATCCCCACGTGCGTGGGGCTCACACGGCTGTAGGTGCCTCCGGGGCCGGTGTCGTCGGTCCATCCCCACGTGCGTGGGGCTCACTAAATGATCTTGTCACTTTTGGTGTCACGCGCCGGTCCATCCCCACGTGCGTGGGGCTCACTCCTCCGGCGCCTCGTCGGCGACGTCGGCGACCGGTCCATCCCCACGTGCGTGGGGCTCACTCGACGAGGTACGCATTCAGGAGCCGGAGCGACGGTCCATCCCCACGTGCGTGGGGCTCACG

>NC_018524|1|1|311597-312484|PILER-CR
CGGTCCATCCCCACGTGCGTGGGGCTCAC	AGCACCAACAGCAGCGCGGTCCACCCGTCCCG
CGGTCCATCCCCACGTGCGTGGGGCTCAC	CCGGTTGATCTCGTCGAATACGGCTGCGAGGT
CGGTCCATCCCCACGTGCGTGGGGCTCAC	GTGCCGCTGGCCATCTCCATCGTCGGCTCCTA
CGGTCCATCCCCACGTGCGTGGGGCTCAC	CGTTCATCCGGGCGGGTCTGTTCTGGGTGAGC
CGGTCCATCCCCACGTGCGTGGGGCTCAC	AAGCCACAAAGCCAGCTCCGTACATGCGTCAG
CGGTCCATCCCCACGTGCGTGGGGCTCAC	ACCATCATGTCGCCGAACGCGGAGCCGGCCCA
CGGTCCATCCCCACGTGCGTGGGGCTCAC	TTCTTCATCCAGGGGGCGCGGGAGACGATCTC
CGGTCCATCCCCACGTGCGTGGGGCTCAC	TCTGGTCGGGAGAGCCGAAGTAGTCGGGTTCG
CGGTCCATCCCCACGTGCGTGGGGCTCAC	TATGACGAGGCGTGCCGTCGCGCGGGCCGGACCTTGG
CGGTCCATCCCCACGTGCGTGGGGCTCAC	TAGGCGGCCTCGGCGGTAAAGGCGGGGGCGTC
CGGTCCATCCCCACGTGCGTGGGGCTCAC	ACGGCTGTAGGTGCCTCCGGGGCCGGTGTCGT
CGGTCCATCCCCACGTGCGTGGGGCTCAC	TAAATGATCTTGTCACTTTTGGTGTCACGCGC
CGGTCCATCCCCACGTGCGTGGGGCTCAC	TCCTCCGGCGCCTCGTCGGCGACGTCGGCGAC
CGGTCCATCCCCACGTGCGTGGGGCTCAC	TCGACGAGGTACGCATTCAGGAGCCGGAGCGA
CGGTCCATCCCCACGTGCGTGGGGCTCAC

>NC_018524|1|1|311597-312485|CRISPRCasFinder
CGGTCCATCCCCACGTGCGTGGGGCTCAC	AGCACCAACAGCAGCGCGGTCCACCCGTCCCG
CGGTCCATCCCCACGTGCGTGGGGCTCAC	CCGGTTGATCTCGTCGAATACGGCTGCGAGGT
CGGTCCATCCCCACGTGCGTGGGGCTCAC	GTGCCGCTGGCCATCTCCATCGTCGGCTCCTA
CGGTCCATCCCCACGTGCGTGGGGCTCAC	CGTTCATCCGGGCGGGTCTGTTCTGGGTGAGC
CGGTCCATCCCCACGTGCGTGGGGCTCAC	AAGCCACAAAGCCAGCTCCGTACATGCGTCAG
CGGTCCATCCCCACGTGCGTGGGGCTCAC	ACCATCATGTCGCCGAACGCGGAGCCGGCCCA
CGGTCCATCCCCACGTGCGTGGGGCTCAC	TTCTTCATCCAGGGGGCGCGGGAGACGATCTC
CGGTCCATCCCCACGTGCGTGGGGCTCAC	TCTGGTCGGGAGAGCCGAAGTAGTCGGGTTCG
CGGTCCATCCCCACGTGCGTGGGGCTCAC	TATGACGAGGCGTGCCGTCGCGCGGGCCGGACCTTGG
CGGTCCATCCCCACGTGCGTGGGGCTCAC	TAGGCGGCCTCGGCGGTAAAGGCGGGGGCGTC
CGGTCCATCCCCACGTGCGTGGGGCTCAC	ACGGCTGTAGGTGCCTCCGGGGCCGGTGTCGT
CGGTCCATCCCCACGTGCGTGGGGCTCAC	TAAATGATCTTGTCACTTTTGGTGTCACGCGC
CGGTCCATCCCCACGTGCGTGGGGCTCAC	TCCTCCGGCGCCTCGTCGGCGACGTCGGCGAC
CGGTCCATCCCCACGTGCGTGGGGCTCAC	TCGACGAGGTACGCATTCAGGAGCCGGAGCGA
CGGTCCATCCCCACGTGCGTGGGGCTCACG

>NC_018524|1|1|311597-312484|CRT
CGGTCCATCCCCACGTGCGTGGGGCTCAC	AGCACCAACAGCAGCGCGGTCCACCCGTCCCG
CGGTCCATCCCCACGTGCGTGGGGCTCAC	CCGGTTGATCTCGTCGAATACGGCTGCGAGGT
CGGTCCATCCCCACGTGCGTGGGGCTCAC	GTGCCGCTGGCCATCTCCATCGTCGGCTCCTA
CGGTCCATCCCCACGTGCGTGGGGCTCAC	CGTTCATCCGGGCGGGTCTGTTCTGGGTGAGC
CGGTCCATCCCCACGTGCGTGGGGCTCAC	AAGCCACAAAGCCAGCTCCGTACATGCGTCAG
CGGTCCATCCCCACGTGCGTGGGGCTCAC	ACCATCATGTCGCCGAACGCGGAGCCGGCCCA
CGGTCCATCCCCACGTGCGTGGGGCTCAC	TTCTTCATCCAGGGGGCGCGGGAGACGATCTC
CGGTCCATCCCCACGTGCGTGGGGCTCAC	TCTGGTCGGGAGAGCCGAAGTAGTCGGGTTCG
CGGTCCATCCCCACGTGCGTGGGGCTCAC	TATGACGAGGCGTGCCGTCGCGCGGGCCGGACCTTGG
CGGTCCATCCCCACGTGCGTGGGGCTCAC	TAGGCGGCCTCGGCGGTAAAGGCGGGGGCGTC
CGGTCCATCCCCACGTGCGTGGGGCTCAC	ACGGCTGTAGGTGCCTCCGGGGCCGGTGTCGT
CGGTCCATCCCCACGTGCGTGGGGCTCAC	TAAATGATCTTGTCACTTTTGGTGTCACGCGC
CGGTCCATCCCCACGTGCGTGGGGCTCAC	TCCTCCGGCGCCTCGTCGGCGACGTCGGCGAC
CGGTCCATCCCCACGTGCGTGGGGCTCAC	TCGACGAGGTACGCATTCAGGAGCCGGAGCGA
CGGTCCATCCCCACGTGCGTGGGGCTCAC

Neighbor Proteins Overview

Protein	Signature genes	Signature genes Name	Protein_function
NC_018524.1|WP_014908173.1|312847_312988_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014909084.1|310030_310204_+|DUF397-domain-containing-protein	unknown	unknown	gnl|CDD|377231
NC_018524.1|WP_014911377.1|313567_314176_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014910426.1|306147_307248_-|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl|CDD|252734
NC_018524.1|WP_014912358.1|319447_320035_-|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl|CDD|238045
NC_018524.1|WP_014909153.1|305802_306009_-|DUF397-domain-containing-protein	unknown	unknown	gnl|CDD|377231
NC_018524.1|WP_014909711.1|320121_320739_+|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl|CDD|379312
NC_018524.1|WP_014912591.1|317321_318476_+|ribosomal-RNA-adenine-dimethylase	unknown	unknown	gnl|CDD|275041
NC_018524.1|WP_014911097.1|315608_315815_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_041562078.1|308813_309554_+|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl|CDD|197775
NC_018524.1|WP_014908790.1|316093_316351_+|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014908800.1|314253_315090_-|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl|CDD|238045
NC_018524.1|WP_041561645.1|307232_307493_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014912209.1|310269_311295_-|IS30-family-transposase	unknown	unknown	gnl|CDD|225382
NC_018524.1|WP_026124745.1|304856_305048_-|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl|CDD|133390
NC_018524.1|WP_026125377.1|307879_308188_-|ATP-binding-protein	unknown	unknown	gnl|CDD|340413
NC_018524.1|WP_014908559.1|316365_317325_+|ATP-grasp-ribosomal-peptide-maturase	unknown	unknown	gnl|CDD|275040
NC_018524.1|WP_014909979.1|309550_309727_+|DUF397-domain-containing-protein	unknown	unknown	gnl|CDD|377231
NC_018524.1|WP_014912130.1|305098_305620_-|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl|CDD|238045
NC_018524.1|WP_041561647.1|315096_315612_-|hypothetical-protein	unknown	unknown	unknown

rpsblast for functional proteins

Protein	Function_ID	Function_description	E-value
NC_018524.1|WP_014909084.1|310030_310204_+|DUF397-domain-containing-protein	gnl|CDD|377231	pfam04149, DUF397, Domain of unknown function (DUF397). The function of this family is unknown.	5.16256e-15
NC_018524.1|WP_014910426.1|306147_307248_-|helix-turn-helix-domain-containing-protein	gnl|CDD|252734	pfam04672, Methyltransf_19, S-adenosyl methyltransferase. This family contains a SAM (S-adenosyl methyltransferase) domain, with a central beta sheet with 3 alpha-helices on both sides. Crystal packing analysis of the structure Structure 3giw suggests that a monomer is the solution state oligomeric form. An unidentified ligand (UNL, cyan) was found at the putative active site surrounded by the residues His57, His170, Phe171, Tyr216 and Met22. The UNL is likely to be a phenylalanine or phenylalanine-like molecule. (details derived from TOPSAN).	6.50572e-15
NC_018524.1|WP_014912358.1|319447_320035_-|helix-turn-helix-domain-containing-protein	gnl|CDD|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	1.90666e-16
NC_018524.1|WP_014909979.1|309550_309727_+|DUF397-domain-containing-protein	gnl|CDD|377231	pfam04149, DUF397, Domain of unknown function (DUF397). The function of this family is unknown.	3.52786e-17
NC_018524.1|WP_014909711.1|320121_320739_+|class-I-SAM-dependent-methyltransferase	gnl|CDD|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	1.5345e-16
NC_018524.1|WP_014912591.1|317321_318476_+|ribosomal-RNA-adenine-dimethylase	gnl|CDD|275041	TIGR04188, conserved_hypothetical_protein, methyltransferase, ATP-grasp peptide maturase system. Members of this protein family are predicted SAM-dependent methyltransferases that regularly occur in the context of a putative peptide modification ATP-grasp enzyme (TIGR04187, related to enzymes of microviridin maturation) and a putative ribosomal peptide modification target (TIGR04186).	8.77333e-93
NC_018524.1|WP_041562078.1|308813_309554_+|helix-turn-helix-transcriptional-regulator	gnl|CDD|197775	smart00530, HTH_XRE, Helix-turn-helix XRE-family like proteins.	0.00489888
NC_018524.1|WP_014908800.1|314253_315090_-|helix-turn-helix-transcriptional-regulator	gnl|CDD|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	2.91421e-11
NC_018524.1|WP_014912209.1|310269_311295_-|IS30-family-transposase	gnl|CDD|225382	COG2826, Tra8, Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair].	3.38415e-104
NC_018524.1|WP_026124745.1|304856_305048_-|helix-turn-helix-domain-containing-protein	gnl|CDD|133390	cd04762, HTH_MerR-trunc, Helix-Turn-Helix DNA binding domain of truncated MerR-like proteins. Proteins in this family mostly have a truncated helix-turn-helix (HTH) MerR-like domain. They lack a portion of the C-terminal region, called Wing 2 and the long dimerization helix that is typically present in MerR-like proteins. These truncated domains are found in response regulator receiver (REC) domain proteins (i.e., CheY), cytosine-C5 specific DNA methylases, IS607 transposase-like proteins, and RacA, a bacterial protein that anchors chromosomes to cell poles.	4.60188e-14
NC_018524.1|WP_026125377.1|307879_308188_-|ATP-binding-protein	gnl|CDD|340413	cd16936, HATPase_RsbW-like, Histidine kinase-like ATPase domain of RsbW, an anti sigma-B factor and serine-protein kinase involved in regulating sigma-B during stress in Bacilli, and related domains. This family includes histidine kinase-like ATPase (HATPase) domain of RsbW, an anti sigma-B factor as well as a serine-protein kinase involved in regulating sigma-B during stress in Bacilli. The alternative sigma factor sigma-B is an important regulator of the general stress response of Bacillus cereus and B. subtilis. RsbW is an anti-sigma factor while RsbV is an anti-sigma factor antagonist (anti-anti-sigma factor). RsbW can also act as a kinase on RsbV. In a partner-switching mechanism, RsbW, RsbV, and sigma-B participate as follows: in non-stressed cells, sigma-B is present in an inactive form complexed with RsbW; in this form, sigma-B is unable to bind to RNA polymerase. Under stress, RsbV binds to RsbW, forming an RsbV-RsbW complex, and sigma-B is released to bind to RNA polymerase. RsbW may then act as a kinase on RsbV, phosphorylating a serine residue; RsbW is then released to bind to sigma-B, hence blocking its ability to bind RNA polymerase. A phosphatase then dephosphorylates RsbV so that it can again form a complex with RsbW, leading to the release of sigma-B.	4.12566e-06
NC_018524.1|WP_014908559.1|316365_317325_+|ATP-grasp-ribosomal-peptide-maturase	gnl|CDD|275040	TIGR04187, conserved_hypothetical_protein, ATP-grasp ribosomal peptide maturase, SAV_5884 family. Members of this protein family are ATP-grasp ligase family enzymes that regularly occur in a contexts with a methyltransferase and a putative ribosomally translated post-translationally modified peptide precursor. Because of this conserved gene neighborhood and close sequence similarity to ATP-grasp enzymes from microviridin/marinostatin biosynthesis cassettes, this enzyme is suggested also to serve as a peptide maturase.	3.35075e-130
NC_018524.1|WP_014909153.1|305802_306009_-|DUF397-domain-containing-protein	gnl|CDD|377231	pfam04149, DUF397, Domain of unknown function (DUF397). The function of this family is unknown.	2.60706e-05
NC_018524.1|WP_014912130.1|305098_305620_-|helix-turn-helix-transcriptional-regulator	gnl|CDD|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	2.29964e-07

Protein sequences

>NC_018524.1|WP_014912209.1|310269_311295_-|IS30-family-transposase
MAPPATERSRYLTGDERIRIADLDREGMGVRTIAAELGRAPSTISRGLRRNATVDQRGRRHYRPYAAQARAQARRPRPKPSKITLDPELRTRVQDLLDERWSPEQISRRLKRDFPDRPELHMCHETVYQALYVQARGGLRRDVTAALRSGRTRRKPRGQARQRRPRFAHPMVMISERPPEVIDRAVPGHWEGDLIIGSGGGSAIGTLVERSTRYTMLVHLPHGRGAEQVAGALAATVTTLPAHLARSVTWDQGSELSRHHEFTTATDIPVYFCDPASPWQRGSNENTNGLLRQYFPKGTDLSVHSREHLEAVAVQLNGRPRKTLGWDTPAERLAKLLEASN
>NC_018524.1|WP_014909084.1|310030_310204_+|DUF397-domain-containing-protein
MTSETPWHKSTYSGNQGHCVEVAEGPTTHIRDTQHRALAELNLPAHEWSAFLTTLTR
>NC_018524.1|WP_014909979.1|309550_309727_+|DUF397-domain-containing-protein
MMTDEWGKSSYSNGTGGNCVEARATGQGAAMRDTQNRELGHLGFDTKEWTALLGTLKK
>NC_018524.1|WP_041562078.1|308813_309554_+|helix-turn-helix-transcriptional-regulator
MTQQELSAASTVGQSTISDLELGKKRTQRDYVVRMDAALAARGVLLGAWDASFGEGGTSAYFREVAEAEQTAIEIREFALGLVPGLLQVEAYVRAVSVLARPKADPESIAKAVQARKNRQELLDKEHPPAFTALLDESVLLREFHSPQVMASQIDHLIAQSYQPRVRVQVIPLKAEGHAGLGGSFTLMEVPDSGTFAYVESQETGFVLKQPEVVGSYDRTFAELRSAALPVSESRTKLKEIRGNIT
>NC_018524.1|WP_026125377.1|307879_308188_-|ATP-binding-protein
MAAVEIANRASLIAWELMDNAHRHSHSGAPDQTLTLMLERSRYLLSITVTDAGPTPGRKKLSFPEQKSHGGGLGRVASLSFYWDWDGCAGLPVTVKARIELP
>NC_018524.1|WP_041561645.1|307232_307493_-|hypothetical-protein
MTEQNAAAELSALRLLGRLSVQQRLARVDHRLSLARLLVDGILDERSRVERQLREAEQAEQDAGTQELGVAVKRYLAMGGRTWTTS
>NC_018524.1|WP_014910426.1|306147_307248_-|helix-turn-helix-domain-containing-protein
MDDLLTPAQAASQWGVSYATAARWAREGTIPALHVGRRYYYLQGTVDQVRRARATGVAPYPNHYANAGVAMTMTWGAARSGTLLDREEWALTNAARTFDYLDYGKDSWSEDRHVAVKMAEASPGLAGQMLVHRKARECVVDAVCRSFSQVIDLGCGLPAMRRAPHERGRVLWGPRARTVYVDHDLAALAAVRAWWEHPAQVRGYNVRVLDLDLRYPENLASALEEHLDLSVPVGVLSTLTLAHLQDEELAGLVEALAARLAPGSGWGITHLSGMVGAAEVYTGQAREQGADTRLVARDPDGLRKVFEASGWGRWRGLSPREPGGGEPPIAALTTLIRPDRASRTASPDRSEYTASPVRPAGSTGVD
>NC_018524.1|WP_014909153.1|305802_306009_-|DUF397-domain-containing-protein
MRIVETQGRKSLTAGVWHKAEASQGATNCAAAKLITGGNVLMGDTQNPDQVRLTLPGSAWDALVRTVA
>NC_018524.1|WP_014912130.1|305098_305620_-|helix-turn-helix-transcriptional-regulator
MSAKSKEAQVDQDADSLCTDSKKALGVHLKRLRKAAGLSGYRLSGVDQSTVSRIETGRIRPSHELMIRLLDAYEADQEGREQAYLLWDQAQLPLQTRRRQVEGTRPAWDQAARPVCSPTLLAGASAAEDAARYLTRAQWAGNSQARRNALLDDAEGRLVQVLAALHSARTRMR
>NC_018524.1|WP_026124745.1|304856_305048_-|helix-turn-helix-domain-containing-protein
MTQPDVDPMDLLTPQEVAQAFRVDPKTVRLWAQEGRLRWVRTLGGHRRYFKADVQRLLTEPGR
>NC_018524.1|WP_014908173.1|312847_312988_-|hypothetical-protein
MAIGLALGIALGTAFDNLALGIVVGALLGAAVGAAGGGLKGKRATD
>NC_018524.1|WP_014911377.1|313567_314176_-|hypothetical-protein
MGEVEYDDAAAPPGWRGKGGLRGRGLEARQDELRSLEVSVTEARYFLPAMVTGLLATPEYIRASLADSPGDVSATVAKKIARQEVLREGSCSFTFLLTEQAVRWALLSPEGMVEQAARLVEVSRLERVRLGVIPLGTVLPRGPMNTFTVYDDRFATVEIFTGRLAFRDSRDVETYRELFAMYEEHALFGDQARERIRSWFEA
>NC_018524.1|WP_014908800.1|314253_315090_-|helix-turn-helix-transcriptional-regulator
MSEQVLRAKEAFGTRLREIRKDAGISGRELAAVTGMHFTKISRLENGKQNPSEKDIRAWCAACGADDQHDDLVATLRGIEGMWIEWRRHLKGGLGHLQKTFDRFHEGASVVRSYESIVVPGILQTQDYAHAVLEIANDFYGSDDEVDGAVDVRLGRQRFLHQGKQRFLFVVEFWALKTRFGDVKIMREQLERLLAVTTFPSVSFGVIPPDVVRGMWPGEGVWIFDEKIAVVETTTAELTITQPSEIALFLRSFERLQRHAVYGFEARSLITKAIEELE
>NC_018524.1|WP_041561647.1|315096_315612_-|hypothetical-protein
MRITQSEFDEIFEGFDSECFHMEMRDSYGTQSEIEPFAKWVNGEVDDFEWMNGWCDTLRRGVDKGKVFRRALVVSEPLSEYQKWAHSTTTPLVEAGEDIRWVPRRRVSSMALPGNDFYLIDGKKVIFMHYSGEGVMEDILVSFERSDVELCRSAFESVWPLAIPHAEYRVD
>NC_018524.1|WP_014911097.1|315608_315815_-|hypothetical-protein
MHITLKGKDPESRPNGSPTIYKTDQGSWLVQGWVVEDRSVLDEMDIPEGETVVEIPDRMLRYFSGEGE
>NC_018524.1|WP_014908790.1|316093_316351_+|hypothetical-protein
MANVQSSPTETSPTTLVRPFGLTRCTTPGTNATYDVSGIDYDTDRQISTRDGRPLIEQPILGTAVQCTVTTTEDMQAWTDEVTDA
>NC_018524.1|WP_014908559.1|316365_317325_+|ATP-grasp-ribosomal-peptide-maturase
MTVVVLTQRFDPTADLVIRELHRREVPVFRCDPGDFPEQIALCAHLSSTGTVTGTLRQGVREVSLTEITSVYHRRPSPHRAHRHLNESERRWSEREAAAGFHGALSALDRFWLNHPDDNRIAAHKPRQLAQAARAGLSVPESLITNTTHAAHTFALAQGKTVYKPMTGGPEPDGSGQVRKALYTTVVEPEEIGPGVERTAHLFQVWVDKAYEVRLTVVGEELFAARIDARGEAARTDWRSDYGSLSYAPIEAPCSVRGAVLRLMCALGLTYGALDFVVTPDGEWVFLELNPNGQWGWIELATGLPIASAIATRLSKEHT
>NC_018524.1|WP_014912591.1|317321_318476_+|ribosomal-RNA-adenine-dimethylase
MTRSTTATEAFEPEHAARLARDLAEKGAIRSPEWRRVFARVPRHLFVSSFVVRTSEGTVAYDEQTPGRLETIYSDATLITRFSADGLAISSSTEPSLMALMLEHLRLQDGMKVLEVGTGTGYNAALLSERLCSALVTSIDVDGALVDRARGALEAAGYRPALAAVDGARGYPNNAPYQRILATCGLGRIPVSWLDQLDEGGLILANVGLGMALLRKGSDGHARGRLLPEAAGFMRLRSSSAPGVPTVSEVLSVTGGGPERVRVVEKVAGLDDHASSEFLLSLLLPYGLRVVQHRQEGQVHGVLDGASGSWMRVEVDHQGRTTVSERGDRHLWAAYTALLSDWEEAGRPEIGRYGLTITPAGEHHLWLDHPQNTNTPLDQAETTG
>NC_018524.1|WP_014912358.1|319447_320035_-|helix-turn-helix-domain-containing-protein
MDDETEDVLDVVGSRLRALRRARGITLADLAVTIGVSESTLSRLESGRRRATLELLLPLARAYDVPLGDLVGAPRTGDPRIHLKPIRRFGMVFVPLSRRPGGTQAFKMIIPARSEPLEPTPQTHEGFEWVYVLDGRLRLVLGERDLTLSPGEVAEFDTSLPHWLGSADGGSVELLVLFDLQGVRAHVRTGTASEA
>NC_018524.1|WP_014909711.1|320121_320739_+|class-I-SAM-dependent-methyltransferase
MDTKDATTFWDGVHATRPVATDPQPNDRLVEAVTGLASGRVLDLECGEGGDALWLARQGWHVTAVDLSAVAVARLTALARSHDLQELVTAERHDLHTSFPQGRFDLVSAHYLHSPHDLDRSAVLRAAAHALNPGGLLLVVDHGSAAPSPAPDAHYPTPQEVAADIDLDPATWTVERADTPRRIATGPGGRTAEVTDHILLIRRTA

Crispr_ID: NC_018524_4

• CRISPR_ID: NC_018524_4
• CRISPR_location: 321341-322125
• CRISPR_type: Orphan
• Repeat_type: NA:I-E
• Spacer_info: 12 spacers

Consensus repeat of NC_018524_4

Consensus_repeat	Method
GGGTCCATCCCCGCGTGCGCGGGGAGCAG	CRISPRCasFinder
GGGTCCATCCCCGCGTGCNCGGGGAGCAG	CRT
GGTCCATCCCCGCGTGCGCGGGGAGCAG	PILER-CR
GATGGGTCCATCCCCGCGTGCACGGGGAGCAGT	PILER-CR

spacers of NC_018524_4

>4.1|321370|32|NC_018524|CRISPRCasFinder,CRT
ACCGTGTAGACCGGGGAGGCCAACCGGATCCG
>4.2|321431|32|NC_018524|CRISPRCasFinder,CRT
GGAGTCCTGGGCGAGGGTGTACATCATTTCGT
>4.3|321492|32|NC_018524|CRISPRCasFinder,CRT
CGCGGACCGACCTACTCCGACATCGATGACCT
>4.4|321553|32|NC_018524|CRISPRCasFinder,CRT
TGGGCCCGGTCCTGAGCGTAGGCCGCTCGGGT
>4.5|321614|32|NC_018524|CRISPRCasFinder,CRT
TTCGGGACTTCCGAACTTCCGGAGTTGGGAGT
>4.6|321675|32|NC_018524|CRISPRCasFinder,CRT
CGCAGGTGGGACAGGGCGCACAAGGCCGGATG
>4.7|321736|32|NC_018524|CRISPRCasFinder,CRT
TTGTTCGCCGCCGAGGCCACGGCATCCGCCAA
>4.8|321797|32|NC_018524|CRISPRCasFinder,CRT
GAACTTGGTGGTGTTGATGACCACGGTGTTTC
>4.9|321858|32|NC_018524|CRISPRCasFinder,CRT
GGGGTGCGGCCGGGGGTGCCGGTGTCGGGGGT
>4.10|321919|55|NC_018524|CRISPRCasFinder,CRT
TTCGGCGATTTTCCGTGGCTGGAGAACAGAGCGAGATAGAAACCTACACCACGAT
>4.11|322003|32|NC_018524|CRISPRCasFinder,CRT
TTCGGCGATTTTCCGTGGCTGGATCAAGCGTC
>4.12|322064|32|NC_018524|CRISPRCasFinder,CRT
CAGATGTTGGACCCAGGATGCGATTTTCAGAT
>4.13|321370|33|NC_018524|PILER-CR
ACCGTGTAGACCGGGGAGGCCAACCGGATCCGG
>4.14|321431|33|NC_018524|PILER-CR
GGAGTCCTGGGCGAGGGTGTACATCATTTCGTG
>4.15|321492|33|NC_018524|PILER-CR
CGCGGACCGACCTACTCCGACATCGATGACCTG
>4.16|321553|33|NC_018524|PILER-CR
TGGGCCCGGTCCTGAGCGTAGGCCGCTCGGGTG
>4.17|321614|33|NC_018524|PILER-CR
TTCGGGACTTCCGAACTTCCGGAGTTGGGAGTG
>4.18|321675|33|NC_018524|PILER-CR
CGCAGGTGGGACAGGGCGCACAAGGCCGGATGG
>4.19|321736|33|NC_018524|PILER-CR
TTGTTCGCCGCCGAGGCCACGGCATCCGCCAAA
>4.20|321797|33|NC_018524|PILER-CR
GAACTTGGTGGTGTTGATGACCACGGTGTTTCC
>4.21|322004|28|NC_018524|PILER-CR
TCGGCGATTTTCCGTGGCTGGATCAAGC
>4.22|322065|28|NC_018524|PILER-CR
AGATGTTGGACCCAGGATGCGATTTTCA

CRISPR arrays and Neighbor proteins around NC_018524_4

CRISPR arrays

The CRISPR arrays of NC_018524_4

>merge|NC_018524|4|321341-322125|CRISPRCasFinder,CRT,PILER-CR,PILER-CR
GGGACCATCCCCGCGTGCGCGGGGAGCAGACCGTGTAGACCGGGGAGGCCAACCGGATCCGGGGTCCATCCCCGCGTGCGCGGGGAGCAGGGAGTCCTGGGCGAGGGTGTACATCATTTCGTGGGTCCATCCCCGCGTGCGCGGGGAGCAGCGCGGACCGACCTACTCCGACATCGATGACCTGGGTCCATCCCCGCGTGCGCGGGGAGCAGTGGGCCCGGTCCTGAGCGTAGGCCGCTCGGGTGGGTCCATCCCCGCGTGCGCGGGGAGCAGTTCGGGACTTCCGAACTTCCGGAGTTGGGAGTGGGTCCATCCCCGCGTGCACGGGGAGCAGCGCAGGTGGGACAGGGCGCACAAGGCCGGATGGGGTCCATCCCCGCGTGCACGGGGAGCAGTTGTTCGCCGCCGAGGCCACGGCATCCGCCAAAGGTCCATCCCCGCGTGCACGGGGAGCAGGAACTTGGTGGTGTTGATGACCACGGTGTTTCCGGTCCATCCCCGCGTGCACGGGGAGCAGGGGGTGCGGCCGGGGGTGCCGGTGTCGGGGGTGGGTCCATCCCCGCGTGCACGGGGAGCAGTTCGGCGATTTTCCGTGGCTGGAGAACAGAGCGAGATAGAAACCTACACCACGATGGGTCCATCCCCGCGTGCACGGGGAGCAGTTCGGCGATTTTCCGTGGCTGGATCAAGCGTCGGGTCCATCCCCGCGTGCACGGGGAGCAGCAGATGTTGGACCCAGGATGCGATTTTCAGATGGGTCCATCCCCGCGTGCACGGGGAGCAGT

>NC_018524|4|4|321341-322124|CRISPRCasFinder
GGGACCATCCCCGCGTGCGCGGGGAGCAG	ACCGTGTAGACCGGGGAGGCCAACCGGATCCG
GGGTCCATCCCCGCGTGCGCGGGGAGCAG	GGAGTCCTGGGCGAGGGTGTACATCATTTCGT
GGGTCCATCCCCGCGTGCGCGGGGAGCAG	CGCGGACCGACCTACTCCGACATCGATGACCT
GGGTCCATCCCCGCGTGCGCGGGGAGCAG	TGGGCCCGGTCCTGAGCGTAGGCCGCTCGGGT
GGGTCCATCCCCGCGTGCGCGGGGAGCAG	TTCGGGACTTCCGAACTTCCGGAGTTGGGAGT
GGGTCCATCCCCGCGTGCACGGGGAGCAG	CGCAGGTGGGACAGGGCGCACAAGGCCGGATG
GGGTCCATCCCCGCGTGCACGGGGAGCAG	TTGTTCGCCGCCGAGGCCACGGCATCCGCCAA
AGGTCCATCCCCGCGTGCACGGGGAGCAG	GAACTTGGTGGTGTTGATGACCACGGTGTTTC
CGGTCCATCCCCGCGTGCACGGGGAGCAG	GGGGTGCGGCCGGGGGTGCCGGTGTCGGGGGT
GGGTCCATCCCCGCGTGCACGGGGAGCAG	TTCGGCGATTTTCCGTGGCTGGAGAACAGAGCGAGATAGAAACCTACACCACGAT
GGGTCCATCCCCGCGTGCACGGGGAGCAG	TTCGGCGATTTTCCGTGGCTGGATCAAGCGTC
GGGTCCATCCCCGCGTGCACGGGGAGCAG	CAGATGTTGGACCCAGGATGCGATTTTCAGAT
GGGTCCATCCCCGCGTGCACGGGGAGCAG

>NC_018524|4|4|321341-322124|CRT
GGGACCATCCCCGCGTGCGCGGGGAGCAG	ACCGTGTAGACCGGGGAGGCCAACCGGATCCG
GGGTCCATCCCCGCGTGCGCGGGGAGCAG	GGAGTCCTGGGCGAGGGTGTACATCATTTCGT
GGGTCCATCCCCGCGTGCGCGGGGAGCAG	CGCGGACCGACCTACTCCGACATCGATGACCT
GGGTCCATCCCCGCGTGCGCGGGGAGCAG	TGGGCCCGGTCCTGAGCGTAGGCCGCTCGGGT
GGGTCCATCCCCGCGTGCGCGGGGAGCAG	TTCGGGACTTCCGAACTTCCGGAGTTGGGAGT
GGGTCCATCCCCGCGTGCACGGGGAGCAG	CGCAGGTGGGACAGGGCGCACAAGGCCGGATG
GGGTCCATCCCCGCGTGCACGGGGAGCAG	TTGTTCGCCGCCGAGGCCACGGCATCCGCCAA
AGGTCCATCCCCGCGTGCACGGGGAGCAG	GAACTTGGTGGTGTTGATGACCACGGTGTTTC
CGGTCCATCCCCGCGTGCACGGGGAGCAG	GGGGTGCGGCCGGGGGTGCCGGTGTCGGGGGT
GGGTCCATCCCCGCGTGCACGGGGAGCAG	TTCGGCGATTTTCCGTGGCTGGAGAACAGAGCGAGATAGAAACCTACACCACGAT
GGGTCCATCCCCGCGTGCACGGGGAGCAG	TTCGGCGATTTTCCGTGGCTGGATCAAGCGTC
GGGTCCATCCCCGCGTGCACGGGGAGCAG	CAGATGTTGGACCCAGGATGCGATTTTCAGAT
GGGTCCATCCCCGCGTGCACGGGGAGCAG

>NC_018524|4|4|321342-321857|PILER-CR
GGACCATCCCCGCGTGCGCGGGGAGCAG	ACCGTGTAGACCGGGGAGGCCAACCGGATCCGG
GGTCCATCCCCGCGTGCGCGGGGAGCAG	GGAGTCCTGGGCGAGGGTGTACATCATTTCGTG
GGTCCATCCCCGCGTGCGCGGGGAGCAG	CGCGGACCGACCTACTCCGACATCGATGACCTG
GGTCCATCCCCGCGTGCGCGGGGAGCAG	TGGGCCCGGTCCTGAGCGTAGGCCGCTCGGGTG
GGTCCATCCCCGCGTGCGCGGGGAGCAG	TTCGGGACTTCCGAACTTCCGGAGTTGGGAGTG
GGTCCATCCCCGCGTGCACGGGGAGCAG	CGCAGGTGGGACAGGGCGCACAAGGCCGGATGG
GGTCCATCCCCGCGTGCACGGGGAGCAG	TTGTTCGCCGCCGAGGCCACGGCATCCGCCAAA
GGTCCATCCCCGCGTGCACGGGGAGCAG	GAACTTGGTGGTGTTGATGACCACGGTGTTTCC
GGTCCATCCCCGCGTGCACGGGGAGCAGGGGGTGCGGCCGGGGGTGCCGGTGTCGGGGGTGGGTCCATCCCCGCGTGCACGGGGAGCAGTTCGGCGATTTTCCGTGGCTGGAGAACAGAGCGAGATAGAAACCTACACCACGATGGGTCCATCCCCGCGTGCACGGGGAGCAGT	TCGGCGATTTTCCGTGGCTGGATCAAGC
GTCGGGTCCATCCCCGCGTGCACGGGGAGCAGC	AGATGTTGGACCCAGGATGCGATTTTCA


>NC_018524|4|5|321971-322125|PILER-CR
	ACCGTGTAGACCGGGGAGGCCAACCGGATCCGG
GGTCCATCCCCGCGTGCGCGGGGAGCAG	GGAGTCCTGGGCGAGGGTGTACATCATTTCGTG
GGTCCATCCCCGCGTGCGCGGGGAGCAG	CGCGGACCGACCTACTCCGACATCGATGACCTG
GGTCCATCCCCGCGTGCGCGGGGAGCAG	TGGGCCCGGTCCTGAGCGTAGGCCGCTCGGGTG
GGTCCATCCCCGCGTGCGCGGGGAGCAG	TTCGGGACTTCCGAACTTCCGGAGTTGGGAGTG
GGTCCATCCCCGCGTGCACGGGGAGCAG	CGCAGGTGGGACAGGGCGCACAAGGCCGGATGG
GGTCCATCCCCGCGTGCACGGGGAGCAG	TTGTTCGCCGCCGAGGCCACGGCATCCGCCAAA
GGTCCATCCCCGCGTGCACGGGGAGCAG	GAACTTGGTGGTGTTGATGACCACGGTGTTTCC
GGTCCATCCCCGCGTGCACGGGGAGCAGGGGGTGCGGCCGGGGGTGCCGGTGTCGGGGGTGGGTCCATCCCCGCGTGCACGGGGAGCAGTTCGGCGATTTTCCGTGGCTGGAGAACAGAGCGAGATAGAAACCTACACCACGATGGGTCCATCCCCGCGTGCACGGGGAGCAGT	TCGGCGATTTTCCGTGGCTGGATCAAGC
GTCGGGTCCATCCCCGCGTGCACGGGGAGCAGC	AGATGTTGGACCCAGGATGCGATTTTCA
GATGGGTCCATCCCCGCGTGCACGGGGAGCAGT

Neighbor Proteins Overview

Protein	Signature genes	Signature genes Name	Protein_function
NC_018524.1|WP_041561649.1|327775_328237_+|Lrp/AsnC-family-transcriptional-regulator	unknown	unknown	gnl|CDD|224439
NC_018524.1|WP_014909711.1|320121_320739_+|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl|CDD|379312
NC_018524.1|WP_014908189.1|324746_325814_+|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_187294514.1|323417_323969_-|pentapeptide-repeat-containing-protein	unknown	unknown	gnl|CDD|224276
NC_018524.1|WP_014911377.1|313567_314176_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014908483.1|327162_327666_-|DUF2000-domain-containing-protein	unknown	unknown	gnl|CDD|378176
NC_018524.1|WP_014908559.1|316365_317325_+|ATP-grasp-ribosomal-peptide-maturase	unknown	unknown	gnl|CDD|275040
NC_018524.1|WP_014909755.1|328307_329657_-|MFS-transporter	unknown	unknown	gnl|CDD|129794
NC_018524.1|WP_014912231.1|326006_326477_-|NUDIX-hydrolase	unknown	unknown	gnl|CDD|239217
NC_018524.1|WP_014912591.1|317321_318476_+|ribosomal-RNA-adenine-dimethylase	unknown	unknown	gnl|CDD|275041
NC_018524.1|WP_014911097.1|315608_315815_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014908790.1|316093_316351_+|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014908800.1|314253_315090_-|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl|CDD|238045
NC_018524.1|WP_148281572.1|323952_324318_-|hypothetical-protein	unknown	unknown	gnl|CDD|225405
NC_018524.1|WP_014913615.1|330037_331309_+|erythromycin-esterase-family-protein	unknown	unknown	gnl|CDD|350610
NC_018524.1|WP_014912358.1|319447_320035_-|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl|CDD|238045
NC_018524.1|WP_014912727.1|320779_321280_+|DinB-family-protein	unknown	unknown	gnl|CDD|368218
NC_018524.1|WP_014913589.1|324372_324540_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_017536544.1|322372_323122_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_041561647.1|315096_315612_-|hypothetical-protein	unknown	unknown	unknown

rpsblast for functional proteins

Protein	Function_ID	Function_description	E-value
NC_018524.1|WP_041561649.1|327775_328237_+|Lrp/AsnC-family-transcriptional-regulator	gnl|CDD|224439	COG1522, Lrp, Transcriptional regulators [Transcription].	1.05839e-33
NC_018524.1|WP_014909711.1|320121_320739_+|class-I-SAM-dependent-methyltransferase	gnl|CDD|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	1.5345e-16
NC_018524.1|WP_187294514.1|323417_323969_-|pentapeptide-repeat-containing-protein	gnl|CDD|224276	COG1357, COG1357, Pentapeptide repeats containing protein [Function unknown].	8.05949e-13
NC_018524.1|WP_014908559.1|316365_317325_+|ATP-grasp-ribosomal-peptide-maturase	gnl|CDD|275040	TIGR04187, conserved_hypothetical_protein, ATP-grasp ribosomal peptide maturase, SAV_5884 family. Members of this protein family are ATP-grasp ligase family enzymes that regularly occur in a contexts with a methyltransferase and a putative ribosomally translated post-translationally modified peptide precursor. Because of this conserved gene neighborhood and close sequence similarity to ATP-grasp enzymes from microviridin/marinostatin biosynthesis cassettes, this enzyme is suggested also to serve as a peptide maturase.	3.35075e-130
NC_018524.1|WP_014909755.1|328307_329657_-|MFS-transporter	gnl|CDD|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	1.79957e-52
NC_018524.1|WP_014912231.1|326006_326477_-|NUDIX-hydrolase	gnl|CDD|239217	cd02883, Nudix_Hydrolase, Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+ for their activity. Members of this family are recognized by a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which forms a structural motif that functions as a metal binding and catalytic site. Substrates of nudix hydrolase include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance and "house-cleaning" enzymes. Substrate specificity is used to define child families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required. This superfamily consists of at least nine families: IPP (isopentenyl diphosphate) isomerase, ADP ribose pyrophosphatase, mutT pyrophosphohydrolase, coenzyme-A pyrophosphatase, MTH1-7,8-dihydro-8-oxoguanine-triphosphatase, diadenosine tetraphosphate hydrolase, NADH pyrophosphatase, GDP-mannose hydrolase and the c-terminal portion of the mutY adenine glycosylase.	1.32631e-17
NC_018524.1|WP_014912591.1|317321_318476_+|ribosomal-RNA-adenine-dimethylase	gnl|CDD|275041	TIGR04188, conserved_hypothetical_protein, methyltransferase, ATP-grasp peptide maturase system. Members of this protein family are predicted SAM-dependent methyltransferases that regularly occur in the context of a putative peptide modification ATP-grasp enzyme (TIGR04187, related to enzymes of microviridin maturation) and a putative ribosomal peptide modification target (TIGR04186).	8.77333e-93
NC_018524.1|WP_014908800.1|314253_315090_-|helix-turn-helix-transcriptional-regulator	gnl|CDD|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	2.91421e-11
NC_018524.1|WP_148281572.1|323952_324318_-|hypothetical-protein	gnl|CDD|225405	COG2849, COG2849, Uncharacterized protein conserved in bacteria [Function unknown].	7.11191e-06
NC_018524.1|WP_014913615.1|330037_331309_+|erythromycin-esterase-family-protein	gnl|CDD|350610	cd14728, Ere-like, Erythromycin esterase and succinoglycan biosynthesis related proteins. This group contains erythromycin esterase, which shares conserved active site residues of the Tiki/TraB family. Erythromycin esterases (EreA and EreB) disrupt erythromycin via the hydrolysis of the macrolactone ring. A critical catalytic histidine acts as a general base in the activation of a water molecule. Macrolides act by inhibiting bacterial protein synthesis by binding at the exit tunnel of ribosomal subunit 50s, blocking the translation of the polypeptide. Erythromycin esterase, typically found in integrons and transposons, confers antibiotic resistance through the disruption of the drug ring structure. EreB substrate profile is substantially broader than that for EreA, being able to also metabolize semisynthetic derivatives such as azalide azithromycin.	6.11826e-87
NC_018524.1|WP_014912358.1|319447_320035_-|helix-turn-helix-domain-containing-protein	gnl|CDD|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	1.90666e-16
NC_018524.1|WP_014912727.1|320779_321280_+|DinB-family-protein	gnl|CDD|368218	pfam04978, DUF664, Protein of unknown function (DUF664). This family is commonly found in Streptomyces coelicolor and is of unknown function. These proteins contain several conserved histidines at their N-terminus that may form a metal binding site.	2.21309e-43
NC_018524.1|WP_014908483.1|327162_327666_-|DUF2000-domain-containing-protein	gnl|CDD|378176	pfam09391, DUF2000, Protein of unknown function (DUF2000). This is a family of proteins of unknown function. The structure of one of the proteins in this family has been shown to adopt an alpha beta fold.	1.42848e-49

Protein sequences

>NC_018524.1|WP_014912727.1|320779_321280_+|DinB-family-protein
MSTTSRDDRRGDSPPPRTGNSEAEVLRGFLDYLRTSIAAKVENAPEPQARTAGVPSGTNLLGLLHHLTFVEHAMFLGDRVTDWQATFQAAPADSGADVVARYRRTVERANRVLDGCTDLGAPVPRPGPGRPAPSLRWALVHMIEETGRHAGHADILREQIDGAVGR
>NC_018524.1|WP_014909711.1|320121_320739_+|class-I-SAM-dependent-methyltransferase
MDTKDATTFWDGVHATRPVATDPQPNDRLVEAVTGLASGRVLDLECGEGGDALWLARQGWHVTAVDLSAVAVARLTALARSHDLQELVTAERHDLHTSFPQGRFDLVSAHYLHSPHDLDRSAVLRAAAHALNPGGLLLVVDHGSAAPSPAPDAHYPTPQEVAADIDLDPATWTVERADTPRRIATGPGGRTAEVTDHILLIRRTA
>NC_018524.1|WP_014912358.1|319447_320035_-|helix-turn-helix-domain-containing-protein
MDDETEDVLDVVGSRLRALRRARGITLADLAVTIGVSESTLSRLESGRRRATLELLLPLARAYDVPLGDLVGAPRTGDPRIHLKPIRRFGMVFVPLSRRPGGTQAFKMIIPARSEPLEPTPQTHEGFEWVYVLDGRLRLVLGERDLTLSPGEVAEFDTSLPHWLGSADGGSVELLVLFDLQGVRAHVRTGTASEA
>NC_018524.1|WP_014912591.1|317321_318476_+|ribosomal-RNA-adenine-dimethylase
MTRSTTATEAFEPEHAARLARDLAEKGAIRSPEWRRVFARVPRHLFVSSFVVRTSEGTVAYDEQTPGRLETIYSDATLITRFSADGLAISSSTEPSLMALMLEHLRLQDGMKVLEVGTGTGYNAALLSERLCSALVTSIDVDGALVDRARGALEAAGYRPALAAVDGARGYPNNAPYQRILATCGLGRIPVSWLDQLDEGGLILANVGLGMALLRKGSDGHARGRLLPEAAGFMRLRSSSAPGVPTVSEVLSVTGGGPERVRVVEKVAGLDDHASSEFLLSLLLPYGLRVVQHRQEGQVHGVLDGASGSWMRVEVDHQGRTTVSERGDRHLWAAYTALLSDWEEAGRPEIGRYGLTITPAGEHHLWLDHPQNTNTPLDQAETTG
>NC_018524.1|WP_014908559.1|316365_317325_+|ATP-grasp-ribosomal-peptide-maturase
MTVVVLTQRFDPTADLVIRELHRREVPVFRCDPGDFPEQIALCAHLSSTGTVTGTLRQGVREVSLTEITSVYHRRPSPHRAHRHLNESERRWSEREAAAGFHGALSALDRFWLNHPDDNRIAAHKPRQLAQAARAGLSVPESLITNTTHAAHTFALAQGKTVYKPMTGGPEPDGSGQVRKALYTTVVEPEEIGPGVERTAHLFQVWVDKAYEVRLTVVGEELFAARIDARGEAARTDWRSDYGSLSYAPIEAPCSVRGAVLRLMCALGLTYGALDFVVTPDGEWVFLELNPNGQWGWIELATGLPIASAIATRLSKEHT
>NC_018524.1|WP_014908790.1|316093_316351_+|hypothetical-protein
MANVQSSPTETSPTTLVRPFGLTRCTTPGTNATYDVSGIDYDTDRQISTRDGRPLIEQPILGTAVQCTVTTTEDMQAWTDEVTDA
>NC_018524.1|WP_014911097.1|315608_315815_-|hypothetical-protein
MHITLKGKDPESRPNGSPTIYKTDQGSWLVQGWVVEDRSVLDEMDIPEGETVVEIPDRMLRYFSGEGE
>NC_018524.1|WP_041561647.1|315096_315612_-|hypothetical-protein
MRITQSEFDEIFEGFDSECFHMEMRDSYGTQSEIEPFAKWVNGEVDDFEWMNGWCDTLRRGVDKGKVFRRALVVSEPLSEYQKWAHSTTTPLVEAGEDIRWVPRRRVSSMALPGNDFYLIDGKKVIFMHYSGEGVMEDILVSFERSDVELCRSAFESVWPLAIPHAEYRVD
>NC_018524.1|WP_014908800.1|314253_315090_-|helix-turn-helix-transcriptional-regulator
MSEQVLRAKEAFGTRLREIRKDAGISGRELAAVTGMHFTKISRLENGKQNPSEKDIRAWCAACGADDQHDDLVATLRGIEGMWIEWRRHLKGGLGHLQKTFDRFHEGASVVRSYESIVVPGILQTQDYAHAVLEIANDFYGSDDEVDGAVDVRLGRQRFLHQGKQRFLFVVEFWALKTRFGDVKIMREQLERLLAVTTFPSVSFGVIPPDVVRGMWPGEGVWIFDEKIAVVETTTAELTITQPSEIALFLRSFERLQRHAVYGFEARSLITKAIEELE
>NC_018524.1|WP_014911377.1|313567_314176_-|hypothetical-protein
MGEVEYDDAAAPPGWRGKGGLRGRGLEARQDELRSLEVSVTEARYFLPAMVTGLLATPEYIRASLADSPGDVSATVAKKIARQEVLREGSCSFTFLLTEQAVRWALLSPEGMVEQAARLVEVSRLERVRLGVIPLGTVLPRGPMNTFTVYDDRFATVEIFTGRLAFRDSRDVETYRELFAMYEEHALFGDQARERIRSWFEA
>NC_018524.1|WP_017536544.1|322372_323122_-|hypothetical-protein
MIGKDPTPVRYYMIRWEGLPIGALLVQGERNTRFLAVMGATDLETRISSSKAWGSRLSKDAEEGFGPIDSIRRWKGVPSQPGVGGIPQDARLHTCADLGELSRLLNPGHEPEKDTINERLQDPHMLYGRDRGPFVTKRVDTGYRILARGEVLYRPVRMEGTIIGFLWASDAENARGYEPRPVAGPSAWRAESWWIDQAAEAAARGLTPVGALRERIGMPEDPVGGRLDSSDDELIAASTRDLRQIARPT
>NC_018524.1|WP_187294514.1|323417_323969_-|pentapeptide-repeat-containing-protein
MTLCGDPGNGTADLWSCGCRGLSMRYRYLIAEDLRGTVFDGCDFTKAELQGSLIEGARFVEANFYKACLSECSGEGADFTGARLVGAEFYRSELAGSVWSGAWINASWMHETDLRGADLRGVWFGPDDRAGRTRFVSTRIGARTCGARADGSRVRRMSDLPGSLACSSGTNSRPGSPSRARRR
>NC_018524.1|WP_148281572.1|323952_324318_-|hypothetical-protein
MKRVNEEELEYDYDDYGAALLDGEPFTGEAIDKSGDVVVGLTTFVDGREDGPQVEWYESGQIRAEGWASRFGGAAGVWSEWNESGQLVERKELDEKGNLISWRQWGEDGALIKDETYDPLW
>NC_018524.1|WP_014913589.1|324372_324540_-|hypothetical-protein
MSYDTVALVAQEPGLETVARTLERTVPGLWIQAHPGIGLLELRSDDRRCARLQFI
>NC_018524.1|WP_014908189.1|324746_325814_+|hypothetical-protein
MSPALPLSPDGETERVPGALLIRGDCDDTTWNDVLSRMGELPGMVAHSPGQPLPPAQGPIPRRLLISQDPAWRGAAPVDVSEALSGEDVWVPDLVLIADRGTTRDPALRPLTAFLPDDDDLYRFRVTPRQAAMTYLVTHRPGIEDTLEHHKECGAAEVELEPDESYEDWLDGVSEVMGEVLETATHPPHYRPPVAPLPVVTQNNWGLLVRTDFSNDRAWATLAEDVDRLDPRVETPEEYQPYVQIVDDPAFAGATPEQVMAIVRPNEDENEDEETGEEVVVIADHASMSGSDRTVLVVPLEDNVGWSFRLPSDKVRSMAANLFVGNNDLSDWMNQGSPNGPAVITEKERQAWRGW
>NC_018524.1|WP_014912231.1|326006_326477_-|NUDIX-hydrolase
MASDPTESFARPRVAAGALFFDEQGRVMMVVPTYKDYLDIPGGYIEHGETPSQAAAREVKEELGITPPIGRLLVVDWAPNLSEGDKQLFVFDGGVLDRRWLDQIALDPAELAGYEFHEVASIETATIPRLARRIVQGARARREGTTVYLENGEAVQ
>NC_018524.1|WP_014908483.1|327162_327666_-|DUF2000-domain-containing-protein
MKPSMKMIIALREGLEPALAANAAAVLGLAMGGRLEDSVAADGKDASGNVHAGLNPHPVPTLTASADLLRELHEKASAREDIVTVGFNEVARRSRTYEEYETALAATPTSEIDHVGLAFFGPRNAITRLTKRLPCWLESRAIEGRGMAQGRSPRRAGAQPGVVVLPR
>NC_018524.1|WP_041561649.1|327775_328237_+|Lrp/AsnC-family-transcriptional-regulator
MDELDSVIIRELQLNARQTNRELARTVGIAPSTCLERVRSLVERGVIRGYHADIDPAALDRRVEAFVSARLRPLSRSVIDAFKKALIALPEVSAVFVVAGDDDFLIQVSARDLDHLHDFLIDRLSQRREVVSFRSQIIYESSRKHVMEDLSEK
>NC_018524.1|WP_014909755.1|328307_329657_-|MFS-transporter
MSMLQFFIAVDVTVVNIALPSIGDDFGVDGHALTWVVVGYTITGGGLLMLGGRLGDLLGRRRVLLAGTTLFGVASLLAGVAPTFGVLVLARLLQGVGEAIALPAAMATIVLMFPEGRSRSRALSVWAAVASCGLVLGFVLSGVITAHLGWRWVFLISVPFILVVVVAALVLVERDRPVAREAGRLDVSGALLLTASPLLFTYGVVEAGEPGTPSWVSVAALAGAVLAGIGFVRVEARSSEPLLPLSFFADRSRVTANVTTMLISGALSTSFLLFTFYLQDHLGIGPLGAGLMMLPLAVSLIVFSMLVPRLLGRWGARVCVLTGLGFTVAAMTLIATVAVLGAGAPWLVPAMLLIAAGMGFGLVGLQYIAVSGVTEEDAGIASGVQRAADQLGGATGVAVCVGIGFAPALHTADPFLVAALLAGVGLVIGTLVILRTPEPAVPEPSEQAG
>NC_018524.1|WP_014913615.1|330037_331309_+|erythromycin-esterase-family-protein
MTPTSPFSSWSRDHFTPLTHLAPDAPLDDLEPLRGLIGDARVVAVGENSHFIEEFSAVRRRVLRFLVERCGFTVLAFEYGFAEGHVLDTWARGEGTEEDLTDHLASAVPVGVDAPLRWVREHNRRAERPVGFAGVDVPAAGGSLLPALSLVAGYLRRVDPEFLPEVEEAMRIASSFAGPSAAAAAPRWERLDPAERNALGALLSRLAIRFRSVEPLYVSRGGRRDYDVALRTLEVAAHTDYSFRAMADLFAGRGRTADVSARDHAMAASLLWHLERGGAETRIVLAAHNAHILKSPVLFDGRLTGFPMGHYLHDALGGDYFSLALTGVSGNTADMVPEETAPFGFTVHDTELGAPEPGSVEAVFADGDLGPGLVDLRPRRSSLDGSEPDRTRLQSSYLHVPVVDAFDAVLNTETSTVTAEVLG

Crispr_ID: NC_018524_3

• CRISPR_ID: NC_018524_3
• CRISPR_location: 318488-319308
• CRISPR_type: Orphan
• Repeat_type: I-E
• Spacer_info: 13 spacers

Consensus repeat of NC_018524_3

Consensus_repeat	Method
GGGGTCATCCCCGCGTGCGCGGGGAGCAG	CRISPRCasFinder
GGGGTCATCCCCGCGTGCGCGGGGAGCAG	CRT
GGGGTCATCCCCGCGTGCGCGGGGAGCAG	PILER-CR

spacers of NC_018524_3

>3.1|318517|32|NC_018524|CRISPRCasFinder,CRT
GCCCAGGGGGCCGGTCTGGTCGAGTTCTCCAT
>3.2|318578|32|NC_018524|CRISPRCasFinder,CRT
TCGGGCGGCGGTGAGCAGATGCCCAAGGAGTT
>3.3|318639|32|NC_018524|CRISPRCasFinder,CRT
CTCGAAGGTCACTTCGAGCTCACGGCCGGGCA
>3.4|318700|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR
CGGATCAAGTTCTGGGGCGGGATGGTCCCGTT
>3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR
ATGACCGCCCATTTCGCCGACCGGCTCGCCGC
>3.6|318822|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR
TATTTCTCGTGCTTTCCAGCCACCGGCCTGGA
>3.7|318883|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR
GACCCTGCCCCTCCGCGCCGCCCTTCATCAGG
>3.8|318944|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR
GGCTGTGGAGCGCGCGGCGGCTGCGCGGGGTG
>3.9|319005|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR
CAGAGAGAGCTGGTCCGCGCACAGGGCGCAGC
>3.10|319066|31|NC_018524|CRISPRCasFinder,CRT,PILER-CR
ATCGGTTGACATCCGGGGGGTCTCCCTCATA
>3.11|319126|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR
CGCACATTCCTCTAGCCCCATTTCAACCGCGA
>3.12|319187|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR
TGGGGTGGCCACCGGGACCCCCTCCTGGCCGT
>3.13|319248|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR
GCTAGGCAGGGAGATCTCGATGCCGCTGTCGG

CRISPR arrays and Neighbor proteins around NC_018524_3

CRISPR arrays

The CRISPR arrays of NC_018524_3

>merge|NC_018524|3|318488-319308|CRISPRCasFinder,CRT,PILER-CR
CGACCCGTCCCCACGTGCGTGGGGCTCAGGCCCAGGGGGCCGGTCTGGTCGAGTTCTCCATCGGTCCATCCCCACGTGCGTGGGGAGCAGTCGGGCGGCGGTGAGCAGATGCCCAAGGAGTTAGGGTCATCCCCGAGTGCGCGGGGAGCAGCTCGAAGGTCACTTCGAGCTCACGGCCGGGCAGGGGTCATCCCCGCGTGCGCGGGGAGCAGCGGATCAAGTTCTGGGGCGGGATGGTCCCGTTGGGGTCATCCCCGCGTGCGCGGGGAGCAGATGACCGCCCATTTCGCCGACCGGCTCGCCGCGGGGTCATCCCCGCGTGCGCGGGGAGCAGTATTTCTCGTGCTTTCCAGCCACCGGCCTGGAGGGGTCATCCCCGCGTGCGCGGGGAGCAGGACCCTGCCCCTCCGCGCCGCCCTTCATCAGGGGGGTCATCCCCGCGTGCGCGGGGAGCAGGGCTGTGGAGCGCGCGGCGGCTGCGCGGGGTGGGGGTCATCCCCGCGTGCGCGGGGAGCAGCAGAGAGAGCTGGTCCGCGCACAGGGCGCAGCGGGGTCATCCCCGCGTGCGCGGGGAGCAGATCGGTTGACATCCGGGGGGTCTCCCTCATAGGGGTCATCCCCGCGTGCGCGGGGAGCAGCGCACATTCCTCTAGCCCCATTTCAACCGCGAGGGGTCATCCCCGCGTGCGCGGGGAGCAGTGGGGTGGCCACCGGGACCCCCTCCTGGCCGTGGGGTCATCCCCGCGTGCGCGGGGAGCAGGCTAGGCAGGGAGATCTCGATGCCGCTGTCGGGGGGTCATCCCCGCGTGCGCGGGGAGCAG

>NC_018524|3|3|318488-319308|CRISPRCasFinder
CGACCCGTCCCCACGTGCGTGGGGCTCAG	GCCCAGGGGGCCGGTCTGGTCGAGTTCTCCAT
CGGTCCATCCCCACGTGCGTGGGGAGCAG	TCGGGCGGCGGTGAGCAGATGCCCAAGGAGTT
AGGGTCATCCCCGAGTGCGCGGGGAGCAG	CTCGAAGGTCACTTCGAGCTCACGGCCGGGCA
GGGGTCATCCCCGCGTGCGCGGGGAGCAG	CGGATCAAGTTCTGGGGCGGGATGGTCCCGTT
GGGGTCATCCCCGCGTGCGCGGGGAGCAG	ATGACCGCCCATTTCGCCGACCGGCTCGCCGC
GGGGTCATCCCCGCGTGCGCGGGGAGCAG	TATTTCTCGTGCTTTCCAGCCACCGGCCTGGA
GGGGTCATCCCCGCGTGCGCGGGGAGCAG	GACCCTGCCCCTCCGCGCCGCCCTTCATCAGG
GGGGTCATCCCCGCGTGCGCGGGGAGCAG	GGCTGTGGAGCGCGCGGCGGCTGCGCGGGGTG
GGGGTCATCCCCGCGTGCGCGGGGAGCAG	CAGAGAGAGCTGGTCCGCGCACAGGGCGCAGC
GGGGTCATCCCCGCGTGCGCGGGGAGCAG	ATCGGTTGACATCCGGGGGGTCTCCCTCATA
GGGGTCATCCCCGCGTGCGCGGGGAGCAG	CGCACATTCCTCTAGCCCCATTTCAACCGCGA
GGGGTCATCCCCGCGTGCGCGGGGAGCAG	TGGGGTGGCCACCGGGACCCCCTCCTGGCCGT
GGGGTCATCCCCGCGTGCGCGGGGAGCAG	GCTAGGCAGGGAGATCTCGATGCCGCTGTCGG
GGGGTCATCCCCGCGTGCGCGGGGAGCAG

>NC_018524|3|3|318488-319308|CRT
CGACCCGTCCCCACGTGCGTGGGGCTCAG	GCCCAGGGGGCCGGTCTGGTCGAGTTCTCCAT
CGGTCCATCCCCACGTGCGTGGGGAGCAG	TCGGGCGGCGGTGAGCAGATGCCCAAGGAGTT
AGGGTCATCCCCGAGTGCGCGGGGAGCAG	CTCGAAGGTCACTTCGAGCTCACGGCCGGGCA
GGGGTCATCCCCGCGTGCGCGGGGAGCAG	CGGATCAAGTTCTGGGGCGGGATGGTCCCGTT
GGGGTCATCCCCGCGTGCGCGGGGAGCAG	ATGACCGCCCATTTCGCCGACCGGCTCGCCGC
GGGGTCATCCCCGCGTGCGCGGGGAGCAG	TATTTCTCGTGCTTTCCAGCCACCGGCCTGGA
GGGGTCATCCCCGCGTGCGCGGGGAGCAG	GACCCTGCCCCTCCGCGCCGCCCTTCATCAGG
GGGGTCATCCCCGCGTGCGCGGGGAGCAG	GGCTGTGGAGCGCGCGGCGGCTGCGCGGGGTG
GGGGTCATCCCCGCGTGCGCGGGGAGCAG	CAGAGAGAGCTGGTCCGCGCACAGGGCGCAGC
GGGGTCATCCCCGCGTGCGCGGGGAGCAG	ATCGGTTGACATCCGGGGGGTCTCCCTCATA
GGGGTCATCCCCGCGTGCGCGGGGAGCAG	CGCACATTCCTCTAGCCCCATTTCAACCGCGA
GGGGTCATCCCCGCGTGCGCGGGGAGCAG	TGGGGTGGCCACCGGGACCCCCTCCTGGCCGT
GGGGTCATCCCCGCGTGCGCGGGGAGCAG	GCTAGGCAGGGAGATCTCGATGCCGCTGTCGG
GGGGTCATCCCCGCGTGCGCGGGGAGCAG

>NC_018524|3|3|318671-319308|PILER-CR
GGGGTCATCCCCGCGTGCGCGGGGAGCAG	CGGATCAAGTTCTGGGGCGGGATGGTCCCGTT
GGGGTCATCCCCGCGTGCGCGGGGAGCAG	ATGACCGCCCATTTCGCCGACCGGCTCGCCGC
GGGGTCATCCCCGCGTGCGCGGGGAGCAG	TATTTCTCGTGCTTTCCAGCCACCGGCCTGGA
GGGGTCATCCCCGCGTGCGCGGGGAGCAG	GACCCTGCCCCTCCGCGCCGCCCTTCATCAGG
GGGGTCATCCCCGCGTGCGCGGGGAGCAG	GGCTGTGGAGCGCGCGGCGGCTGCGCGGGGTG
GGGGTCATCCCCGCGTGCGCGGGGAGCAG	CAGAGAGAGCTGGTCCGCGCACAGGGCGCAGC
GGGGTCATCCCCGCGTGCGCGGGGAGCAG	ATCGGTTGACATCCGGGGGGTCTCCCTCATA
GGGGTCATCCCCGCGTGCGCGGGGAGCAG	CGCACATTCCTCTAGCCCCATTTCAACCGCGA
GGGGTCATCCCCGCGTGCGCGGGGAGCAG	TGGGGTGGCCACCGGGACCCCCTCCTGGCCGT
GGGGTCATCCCCGCGTGCGCGGGGAGCAG	GCTAGGCAGGGAGATCTCGATGCCGCTGTCGG
GGGGTCATCCCCGCGTGCGCGGGGAGCAG

Neighbor Proteins Overview

Protein	Signature genes	Signature genes Name	Protein_function
NC_018524.1|WP_014908173.1|312847_312988_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014909084.1|310030_310204_+|DUF397-domain-containing-protein	unknown	unknown	gnl|CDD|377231
NC_018524.1|WP_014908189.1|324746_325814_+|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_187294514.1|323417_323969_-|pentapeptide-repeat-containing-protein	unknown	unknown	gnl|CDD|224276
NC_018524.1|WP_014911377.1|313567_314176_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014908483.1|327162_327666_-|DUF2000-domain-containing-protein	unknown	unknown	gnl|CDD|378176
NC_018524.1|WP_014912727.1|320779_321280_+|DinB-family-protein	unknown	unknown	gnl|CDD|368218
NC_018524.1|WP_014912231.1|326006_326477_-|NUDIX-hydrolase	unknown	unknown	gnl|CDD|239217
NC_018524.1|WP_014909711.1|320121_320739_+|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl|CDD|379312
NC_018524.1|WP_014912591.1|317321_318476_+|ribosomal-RNA-adenine-dimethylase	unknown	unknown	gnl|CDD|275041
NC_018524.1|WP_014911097.1|315608_315815_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014908790.1|316093_316351_+|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014908800.1|314253_315090_-|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl|CDD|238045
NC_018524.1|WP_148281572.1|323952_324318_-|hypothetical-protein	unknown	unknown	gnl|CDD|225405
NC_018524.1|WP_014912209.1|310269_311295_-|IS30-family-transposase	unknown	unknown	gnl|CDD|225382
NC_018524.1|WP_014912358.1|319447_320035_-|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl|CDD|238045
NC_018524.1|WP_014908559.1|316365_317325_+|ATP-grasp-ribosomal-peptide-maturase	unknown	unknown	gnl|CDD|275040
NC_018524.1|WP_014913589.1|324372_324540_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_017536544.1|322372_323122_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_041561647.1|315096_315612_-|hypothetical-protein	unknown	unknown	unknown

rpsblast for functional proteins

Protein	Function_ID	Function_description	E-value
NC_018524.1|WP_014909084.1|310030_310204_+|DUF397-domain-containing-protein	gnl|CDD|377231	pfam04149, DUF397, Domain of unknown function (DUF397). The function of this family is unknown.	5.16256e-15
NC_018524.1|WP_187294514.1|323417_323969_-|pentapeptide-repeat-containing-protein	gnl|CDD|224276	COG1357, COG1357, Pentapeptide repeats containing protein [Function unknown].	8.05949e-13
NC_018524.1|WP_014908559.1|316365_317325_+|ATP-grasp-ribosomal-peptide-maturase	gnl|CDD|275040	TIGR04187, conserved_hypothetical_protein, ATP-grasp ribosomal peptide maturase, SAV_5884 family. Members of this protein family are ATP-grasp ligase family enzymes that regularly occur in a contexts with a methyltransferase and a putative ribosomally translated post-translationally modified peptide precursor. Because of this conserved gene neighborhood and close sequence similarity to ATP-grasp enzymes from microviridin/marinostatin biosynthesis cassettes, this enzyme is suggested also to serve as a peptide maturase.	3.35075e-130
NC_018524.1|WP_014912231.1|326006_326477_-|NUDIX-hydrolase	gnl|CDD|239217	cd02883, Nudix_Hydrolase, Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+ for their activity. Members of this family are recognized by a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which forms a structural motif that functions as a metal binding and catalytic site. Substrates of nudix hydrolase include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance and "house-cleaning" enzymes. Substrate specificity is used to define child families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required. This superfamily consists of at least nine families: IPP (isopentenyl diphosphate) isomerase, ADP ribose pyrophosphatase, mutT pyrophosphohydrolase, coenzyme-A pyrophosphatase, MTH1-7,8-dihydro-8-oxoguanine-triphosphatase, diadenosine tetraphosphate hydrolase, NADH pyrophosphatase, GDP-mannose hydrolase and the c-terminal portion of the mutY adenine glycosylase.	1.32631e-17
NC_018524.1|WP_014909711.1|320121_320739_+|class-I-SAM-dependent-methyltransferase	gnl|CDD|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	1.5345e-16
NC_018524.1|WP_014912591.1|317321_318476_+|ribosomal-RNA-adenine-dimethylase	gnl|CDD|275041	TIGR04188, conserved_hypothetical_protein, methyltransferase, ATP-grasp peptide maturase system. Members of this protein family are predicted SAM-dependent methyltransferases that regularly occur in the context of a putative peptide modification ATP-grasp enzyme (TIGR04187, related to enzymes of microviridin maturation) and a putative ribosomal peptide modification target (TIGR04186).	8.77333e-93
NC_018524.1|WP_014908800.1|314253_315090_-|helix-turn-helix-transcriptional-regulator	gnl|CDD|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	2.91421e-11
NC_018524.1|WP_148281572.1|323952_324318_-|hypothetical-protein	gnl|CDD|225405	COG2849, COG2849, Uncharacterized protein conserved in bacteria [Function unknown].	7.11191e-06
NC_018524.1|WP_014912209.1|310269_311295_-|IS30-family-transposase	gnl|CDD|225382	COG2826, Tra8, Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair].	3.38415e-104
NC_018524.1|WP_014912358.1|319447_320035_-|helix-turn-helix-domain-containing-protein	gnl|CDD|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	1.90666e-16
NC_018524.1|WP_014912727.1|320779_321280_+|DinB-family-protein	gnl|CDD|368218	pfam04978, DUF664, Protein of unknown function (DUF664). This family is commonly found in Streptomyces coelicolor and is of unknown function. These proteins contain several conserved histidines at their N-terminus that may form a metal binding site.	2.21309e-43
NC_018524.1|WP_014908483.1|327162_327666_-|DUF2000-domain-containing-protein	gnl|CDD|378176	pfam09391, DUF2000, Protein of unknown function (DUF2000). This is a family of proteins of unknown function. The structure of one of the proteins in this family has been shown to adopt an alpha beta fold.	1.42848e-49

Protein sequences

>NC_018524.1|WP_014912591.1|317321_318476_+|ribosomal-RNA-adenine-dimethylase
MTRSTTATEAFEPEHAARLARDLAEKGAIRSPEWRRVFARVPRHLFVSSFVVRTSEGTVAYDEQTPGRLETIYSDATLITRFSADGLAISSSTEPSLMALMLEHLRLQDGMKVLEVGTGTGYNAALLSERLCSALVTSIDVDGALVDRARGALEAAGYRPALAAVDGARGYPNNAPYQRILATCGLGRIPVSWLDQLDEGGLILANVGLGMALLRKGSDGHARGRLLPEAAGFMRLRSSSAPGVPTVSEVLSVTGGGPERVRVVEKVAGLDDHASSEFLLSLLLPYGLRVVQHRQEGQVHGVLDGASGSWMRVEVDHQGRTTVSERGDRHLWAAYTALLSDWEEAGRPEIGRYGLTITPAGEHHLWLDHPQNTNTPLDQAETTG
>NC_018524.1|WP_014908559.1|316365_317325_+|ATP-grasp-ribosomal-peptide-maturase
MTVVVLTQRFDPTADLVIRELHRREVPVFRCDPGDFPEQIALCAHLSSTGTVTGTLRQGVREVSLTEITSVYHRRPSPHRAHRHLNESERRWSEREAAAGFHGALSALDRFWLNHPDDNRIAAHKPRQLAQAARAGLSVPESLITNTTHAAHTFALAQGKTVYKPMTGGPEPDGSGQVRKALYTTVVEPEEIGPGVERTAHLFQVWVDKAYEVRLTVVGEELFAARIDARGEAARTDWRSDYGSLSYAPIEAPCSVRGAVLRLMCALGLTYGALDFVVTPDGEWVFLELNPNGQWGWIELATGLPIASAIATRLSKEHT
>NC_018524.1|WP_014908790.1|316093_316351_+|hypothetical-protein
MANVQSSPTETSPTTLVRPFGLTRCTTPGTNATYDVSGIDYDTDRQISTRDGRPLIEQPILGTAVQCTVTTTEDMQAWTDEVTDA
>NC_018524.1|WP_014911097.1|315608_315815_-|hypothetical-protein
MHITLKGKDPESRPNGSPTIYKTDQGSWLVQGWVVEDRSVLDEMDIPEGETVVEIPDRMLRYFSGEGE
>NC_018524.1|WP_041561647.1|315096_315612_-|hypothetical-protein
MRITQSEFDEIFEGFDSECFHMEMRDSYGTQSEIEPFAKWVNGEVDDFEWMNGWCDTLRRGVDKGKVFRRALVVSEPLSEYQKWAHSTTTPLVEAGEDIRWVPRRRVSSMALPGNDFYLIDGKKVIFMHYSGEGVMEDILVSFERSDVELCRSAFESVWPLAIPHAEYRVD
>NC_018524.1|WP_014908800.1|314253_315090_-|helix-turn-helix-transcriptional-regulator
MSEQVLRAKEAFGTRLREIRKDAGISGRELAAVTGMHFTKISRLENGKQNPSEKDIRAWCAACGADDQHDDLVATLRGIEGMWIEWRRHLKGGLGHLQKTFDRFHEGASVVRSYESIVVPGILQTQDYAHAVLEIANDFYGSDDEVDGAVDVRLGRQRFLHQGKQRFLFVVEFWALKTRFGDVKIMREQLERLLAVTTFPSVSFGVIPPDVVRGMWPGEGVWIFDEKIAVVETTTAELTITQPSEIALFLRSFERLQRHAVYGFEARSLITKAIEELE
>NC_018524.1|WP_014911377.1|313567_314176_-|hypothetical-protein
MGEVEYDDAAAPPGWRGKGGLRGRGLEARQDELRSLEVSVTEARYFLPAMVTGLLATPEYIRASLADSPGDVSATVAKKIARQEVLREGSCSFTFLLTEQAVRWALLSPEGMVEQAARLVEVSRLERVRLGVIPLGTVLPRGPMNTFTVYDDRFATVEIFTGRLAFRDSRDVETYRELFAMYEEHALFGDQARERIRSWFEA
>NC_018524.1|WP_014908173.1|312847_312988_-|hypothetical-protein
MAIGLALGIALGTAFDNLALGIVVGALLGAAVGAAGGGLKGKRATD
>NC_018524.1|WP_014912209.1|310269_311295_-|IS30-family-transposase
MAPPATERSRYLTGDERIRIADLDREGMGVRTIAAELGRAPSTISRGLRRNATVDQRGRRHYRPYAAQARAQARRPRPKPSKITLDPELRTRVQDLLDERWSPEQISRRLKRDFPDRPELHMCHETVYQALYVQARGGLRRDVTAALRSGRTRRKPRGQARQRRPRFAHPMVMISERPPEVIDRAVPGHWEGDLIIGSGGGSAIGTLVERSTRYTMLVHLPHGRGAEQVAGALAATVTTLPAHLARSVTWDQGSELSRHHEFTTATDIPVYFCDPASPWQRGSNENTNGLLRQYFPKGTDLSVHSREHLEAVAVQLNGRPRKTLGWDTPAERLAKLLEASN
>NC_018524.1|WP_014909084.1|310030_310204_+|DUF397-domain-containing-protein
MTSETPWHKSTYSGNQGHCVEVAEGPTTHIRDTQHRALAELNLPAHEWSAFLTTLTR
>NC_018524.1|WP_014912358.1|319447_320035_-|helix-turn-helix-domain-containing-protein
MDDETEDVLDVVGSRLRALRRARGITLADLAVTIGVSESTLSRLESGRRRATLELLLPLARAYDVPLGDLVGAPRTGDPRIHLKPIRRFGMVFVPLSRRPGGTQAFKMIIPARSEPLEPTPQTHEGFEWVYVLDGRLRLVLGERDLTLSPGEVAEFDTSLPHWLGSADGGSVELLVLFDLQGVRAHVRTGTASEA
>NC_018524.1|WP_014909711.1|320121_320739_+|class-I-SAM-dependent-methyltransferase
MDTKDATTFWDGVHATRPVATDPQPNDRLVEAVTGLASGRVLDLECGEGGDALWLARQGWHVTAVDLSAVAVARLTALARSHDLQELVTAERHDLHTSFPQGRFDLVSAHYLHSPHDLDRSAVLRAAAHALNPGGLLLVVDHGSAAPSPAPDAHYPTPQEVAADIDLDPATWTVERADTPRRIATGPGGRTAEVTDHILLIRRTA
>NC_018524.1|WP_014912727.1|320779_321280_+|DinB-family-protein
MSTTSRDDRRGDSPPPRTGNSEAEVLRGFLDYLRTSIAAKVENAPEPQARTAGVPSGTNLLGLLHHLTFVEHAMFLGDRVTDWQATFQAAPADSGADVVARYRRTVERANRVLDGCTDLGAPVPRPGPGRPAPSLRWALVHMIEETGRHAGHADILREQIDGAVGR
>NC_018524.1|WP_017536544.1|322372_323122_-|hypothetical-protein
MIGKDPTPVRYYMIRWEGLPIGALLVQGERNTRFLAVMGATDLETRISSSKAWGSRLSKDAEEGFGPIDSIRRWKGVPSQPGVGGIPQDARLHTCADLGELSRLLNPGHEPEKDTINERLQDPHMLYGRDRGPFVTKRVDTGYRILARGEVLYRPVRMEGTIIGFLWASDAENARGYEPRPVAGPSAWRAESWWIDQAAEAAARGLTPVGALRERIGMPEDPVGGRLDSSDDELIAASTRDLRQIARPT
>NC_018524.1|WP_187294514.1|323417_323969_-|pentapeptide-repeat-containing-protein
MTLCGDPGNGTADLWSCGCRGLSMRYRYLIAEDLRGTVFDGCDFTKAELQGSLIEGARFVEANFYKACLSECSGEGADFTGARLVGAEFYRSELAGSVWSGAWINASWMHETDLRGADLRGVWFGPDDRAGRTRFVSTRIGARTCGARADGSRVRRMSDLPGSLACSSGTNSRPGSPSRARRR
>NC_018524.1|WP_148281572.1|323952_324318_-|hypothetical-protein
MKRVNEEELEYDYDDYGAALLDGEPFTGEAIDKSGDVVVGLTTFVDGREDGPQVEWYESGQIRAEGWASRFGGAAGVWSEWNESGQLVERKELDEKGNLISWRQWGEDGALIKDETYDPLW
>NC_018524.1|WP_014913589.1|324372_324540_-|hypothetical-protein
MSYDTVALVAQEPGLETVARTLERTVPGLWIQAHPGIGLLELRSDDRRCARLQFI
>NC_018524.1|WP_014908189.1|324746_325814_+|hypothetical-protein
MSPALPLSPDGETERVPGALLIRGDCDDTTWNDVLSRMGELPGMVAHSPGQPLPPAQGPIPRRLLISQDPAWRGAAPVDVSEALSGEDVWVPDLVLIADRGTTRDPALRPLTAFLPDDDDLYRFRVTPRQAAMTYLVTHRPGIEDTLEHHKECGAAEVELEPDESYEDWLDGVSEVMGEVLETATHPPHYRPPVAPLPVVTQNNWGLLVRTDFSNDRAWATLAEDVDRLDPRVETPEEYQPYVQIVDDPAFAGATPEQVMAIVRPNEDENEDEETGEEVVVIADHASMSGSDRTVLVVPLEDNVGWSFRLPSDKVRSMAANLFVGNNDLSDWMNQGSPNGPAVITEKERQAWRGW
>NC_018524.1|WP_014912231.1|326006_326477_-|NUDIX-hydrolase
MASDPTESFARPRVAAGALFFDEQGRVMMVVPTYKDYLDIPGGYIEHGETPSQAAAREVKEELGITPPIGRLLVVDWAPNLSEGDKQLFVFDGGVLDRRWLDQIALDPAELAGYEFHEVASIETATIPRLARRIVQGARARREGTTVYLENGEAVQ
>NC_018524.1|WP_014908483.1|327162_327666_-|DUF2000-domain-containing-protein
MKPSMKMIIALREGLEPALAANAAAVLGLAMGGRLEDSVAADGKDASGNVHAGLNPHPVPTLTASADLLRELHEKASAREDIVTVGFNEVARRSRTYEEYETALAATPTSEIDHVGLAFFGPRNAITRLTKRLPCWLESRAIEGRGMAQGRSPRRAGAQPGVVVLPR

Crispr_ID: NC_018524_5

• CRISPR_ID: NC_018524_5
• CRISPR_location: 326503-326897
• CRISPR_type: Orphan
• Repeat_type: NA
• Spacer_info: 6 spacers

Consensus repeat of NC_018524_5

Consensus_repeat	Method
CGGCCCATCCCCACGTGCATGGGGCTCAG	CRISPRCasFinder
GGCCCATCCCCACGTGCATGGGGCTCAG	CRT
CGGCCCATCCCCACGTGCATGGGGCTCAG	PILER-CR

spacers of NC_018524_5

>5.1|326532|32|NC_018524|CRISPRCasFinder
GGCGTCCTCCAGCACGTTCATGTAGGCGGCGA
>5.2|326593|32|NC_018524|CRISPRCasFinder
CCACAAGGCCCCGCCCCCGAAAGGGGCGGGGC
>5.3|326654|32|NC_018524|CRISPRCasFinder
ATGAGGACACCGACCGAGAGGCCGTCGCACTG
>5.4|326715|32|NC_018524|CRISPRCasFinder
CAAAGGAGTTCACCGGCGGGCACCGGATGGAC
>5.5|326776|32|NC_018524|CRISPRCasFinder
GACAAGCTGTTCAACGCGCGCGAACTCGCCGC
>5.6|326837|32|NC_018524|CRISPRCasFinder
CCGAGGGCGACGCAGGCACGACGCCAGGTCCA
>5.7|326532|33|NC_018524|CRT
GGCGTCCTCCAGCACGTTCATGTAGGCGGCGAG
>5.8|326593|33|NC_018524|CRT
CCACAAGGCCCCGCCCCCGAAAGGGGCGGGGCC
>5.9|326654|33|NC_018524|CRT
ATGAGGACACCGACCGAGAGGCCGTCGCACTGC
>5.10|326715|33|NC_018524|CRT
CAAAGGAGTTCACCGGCGGGCACCGGATGGACC
>5.11|326776|33|NC_018524|CRT
GACAAGCTGTTCAACGCGCGCGAACTCGCCGCC
>5.12|326837|33|NC_018524|CRT
CCGAGGGCGACGCAGGCACGACGCCAGGTCCAC
>5.13|326594|32|NC_018524|PILER-CR
CCACAAGGCCCCGCCCCCGAAAGGGGCGGGGC
>5.14|326655|32|NC_018524|PILER-CR
ATGAGGACACCGACCGAGAGGCCGTCGCACTG
>5.15|326716|32|NC_018524|PILER-CR
CAAAGGAGTTCACCGGCGGGCACCGGATGGAC
>5.16|326777|32|NC_018524|PILER-CR
GACAAGCTGTTCAACGCGCGCGAACTCGCCGC
>5.17|326838|32|NC_018524|PILER-CR
CCGAGGGCGACGCAGGCACGACGCCAGGTCCA

CRISPR arrays and Neighbor proteins around NC_018524_5

CRISPR arrays

The CRISPR arrays of NC_018524_5

>merge|NC_018524|5|326503-326897|CRISPRCasFinder,CRT,PILER-CR
TGGCCCACCCCCACGTGCGTGGGGCTCAGGGCGTCCTCCAGCACGTTCATGTAGGCGGCGAGGGCCCATCCCCACGTGCATGGGGCTCAGCCACAAGGCCCCGCCCCCGAAAGGGGCGGGGCCGGCCCATCCCCACGTGCATGGGGCTCAGATGAGGACACCGACCGAGAGGCCGTCGCACTGCGGCCCATCCCCACGTGCATGGGGCTCAGCAAAGGAGTTCACCGGCGGGCACCGGATGGACCGGCCCATCCCCACGTGCATGGGGCTCAGGACAAGCTGTTCAACGCGCGCGAACTCGCCGCCGGCCCATCCCCACGTGCATGGGGCTCAGCCGAGGGCGACGCAGGCACGACGCCAGGTCCACGGCCCATCCCCACGTGCATGGGGCTCAG

>NC_018524|5|5|326503-326897|CRISPRCasFinder
TGGCCCACCCCCACGTGCGTGGGGCTCAG	GGCGTCCTCCAGCACGTTCATGTAGGCGGCGA
GGGCCCATCCCCACGTGCATGGGGCTCAG	CCACAAGGCCCCGCCCCCGAAAGGGGCGGGGC
CGGCCCATCCCCACGTGCATGGGGCTCAG	ATGAGGACACCGACCGAGAGGCCGTCGCACTG
CGGCCCATCCCCACGTGCATGGGGCTCAG	CAAAGGAGTTCACCGGCGGGCACCGGATGGAC
CGGCCCATCCCCACGTGCATGGGGCTCAG	GACAAGCTGTTCAACGCGCGCGAACTCGCCGC
CGGCCCATCCCCACGTGCATGGGGCTCAG	CCGAGGGCGACGCAGGCACGACGCCAGGTCCA
CGGCCCATCCCCACGTGCATGGGGCTCAG

>NC_018524|5|5|326504-326897|CRT
GGCCCACCCCCACGTGCGTGGGGCTCAG	GGCGTCCTCCAGCACGTTCATGTAGGCGGCGAG
GGCCCATCCCCACGTGCATGGGGCTCAG	CCACAAGGCCCCGCCCCCGAAAGGGGCGGGGCC
GGCCCATCCCCACGTGCATGGGGCTCAG	ATGAGGACACCGACCGAGAGGCCGTCGCACTGC
GGCCCATCCCCACGTGCATGGGGCTCAG	CAAAGGAGTTCACCGGCGGGCACCGGATGGACC
GGCCCATCCCCACGTGCATGGGGCTCAG	GACAAGCTGTTCAACGCGCGCGAACTCGCCGCC
GGCCCATCCCCACGTGCATGGGGCTCAG	CCGAGGGCGACGCAGGCACGACGCCAGGTCCAC
GGCCCATCCCCACGTGCATGGGGCTCAG

>NC_018524|5|6|326565-326897|PILER-CR
GGCCCATCCCCACGTGCATGGGGCTCAGC	CACAAGGCCCCGCCCCCGAAAGGGGCGGGGCC
GGCCCATCCCCACGTGCATGGGGCTCAGA	TGAGGACACCGACCGAGAGGCCGTCGCACTGC
GGCCCATCCCCACGTGCATGGGGCTCAGC	AAAGGAGTTCACCGGCGGGCACCGGATGGACC
GGCCCATCCCCACGTGCATGGGGCTCAGG	ACAAGCTGTTCAACGCGCGCGAACTCGCCGCC
GGCCCATCCCCACGTGCATGGGGCTCAGC	CGAGGGCGACGCAGGCACGACGCCAGGTCCAC
GGCCCATCCCCACGTGCATGGGGCTCAG

Neighbor Proteins Overview

Protein	Signature genes	Signature genes Name	Protein_function
NC_018524.1|WP_041561649.1|327775_328237_+|Lrp/AsnC-family-transcriptional-regulator	unknown	unknown	gnl|CDD|224439
NC_018524.1|WP_014909711.1|320121_320739_+|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl|CDD|379312
NC_018524.1|WP_014908189.1|324746_325814_+|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_187294514.1|323417_323969_-|pentapeptide-repeat-containing-protein	unknown	unknown	gnl|CDD|224276
NC_018524.1|WP_014912845.1|335278_335962_-|thioredoxin-domain-containing-protein	unknown	unknown	gnl|CDD|372611
NC_018524.1|WP_014912252.1|333571_334429_-|cytochrome-c-biogenesis-protein-CcdA	unknown	unknown	gnl|CDD|280792
NC_018524.1|WP_014909755.1|328307_329657_-|MFS-transporter	unknown	unknown	gnl|CDD|129794
NC_018524.1|WP_014912231.1|326006_326477_-|NUDIX-hydrolase	unknown	unknown	gnl|CDD|239217
NC_018524.1|WP_014913589.1|324372_324540_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014912834.1|332031_333570_-|cytochrome-c-biogenesis-protein-ResB	unknown	unknown	gnl|CDD|377471
NC_018524.1|WP_014908648.1|334646_335282_-|vitamin-K-epoxide-reductase-family-protein	unknown	unknown	gnl|CDD|240605
NC_018524.1|WP_014911643.1|336090_336489_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_148281572.1|323952_324318_-|hypothetical-protein	unknown	unknown	gnl|CDD|225405
NC_018524.1|WP_014913421.1|331531_331960_+|OsmC-family-protein	unknown	unknown	gnl|CDD|274650
NC_018524.1|WP_014913615.1|330037_331309_+|erythromycin-esterase-family-protein	unknown	unknown	gnl|CDD|350610
NC_018524.1|WP_014908483.1|327162_327666_-|DUF2000-domain-containing-protein	unknown	unknown	gnl|CDD|378176
NC_018524.1|WP_014912591.1|317321_318476_+|ribosomal-RNA-adenine-dimethylase	unknown	unknown	gnl|CDD|275041
NC_018524.1|WP_014912727.1|320779_321280_+|DinB-family-protein	unknown	unknown	gnl|CDD|368218
NC_018524.1|WP_014912358.1|319447_320035_-|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl|CDD|238045
NC_018524.1|WP_017536544.1|322372_323122_-|hypothetical-protein	unknown	unknown	unknown

rpsblast for functional proteins

Protein	Function_ID	Function_description	E-value
NC_018524.1|WP_041561649.1|327775_328237_+|Lrp/AsnC-family-transcriptional-regulator	gnl|CDD|224439	COG1522, Lrp, Transcriptional regulators [Transcription].	1.05839e-33
NC_018524.1|WP_014909711.1|320121_320739_+|class-I-SAM-dependent-methyltransferase	gnl|CDD|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	1.5345e-16
NC_018524.1|WP_187294514.1|323417_323969_-|pentapeptide-repeat-containing-protein	gnl|CDD|224276	COG1357, COG1357, Pentapeptide repeats containing protein [Function unknown].	8.05949e-13
NC_018524.1|WP_014912845.1|335278_335962_-|thioredoxin-domain-containing-protein	gnl|CDD|372611	pfam13462, Thioredoxin_4, Thioredoxin.	1.1381e-23
NC_018524.1|WP_014912252.1|333571_334429_-|cytochrome-c-biogenesis-protein-CcdA	gnl|CDD|280792	pfam02683, DsbD, Cytochrome C biogenesis protein transmembrane region. This family consists of the transmembrane (i.e. non-catalytic) region of Cytochrome C biogenesis proteins also known as disulphide interchange proteins. These proteins posses a protein disulphide isomerase like domain that is not found within the aligned region of this family.	6.10229e-35
NC_018524.1|WP_014909755.1|328307_329657_-|MFS-transporter	gnl|CDD|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	1.79957e-52
NC_018524.1|WP_014912231.1|326006_326477_-|NUDIX-hydrolase	gnl|CDD|239217	cd02883, Nudix_Hydrolase, Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+ for their activity. Members of this family are recognized by a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which forms a structural motif that functions as a metal binding and catalytic site. Substrates of nudix hydrolase include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance and "house-cleaning" enzymes. Substrate specificity is used to define child families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required. This superfamily consists of at least nine families: IPP (isopentenyl diphosphate) isomerase, ADP ribose pyrophosphatase, mutT pyrophosphohydrolase, coenzyme-A pyrophosphatase, MTH1-7,8-dihydro-8-oxoguanine-triphosphatase, diadenosine tetraphosphate hydrolase, NADH pyrophosphatase, GDP-mannose hydrolase and the c-terminal portion of the mutY adenine glycosylase.	1.32631e-17
NC_018524.1|WP_014912591.1|317321_318476_+|ribosomal-RNA-adenine-dimethylase	gnl|CDD|275041	TIGR04188, conserved_hypothetical_protein, methyltransferase, ATP-grasp peptide maturase system. Members of this protein family are predicted SAM-dependent methyltransferases that regularly occur in the context of a putative peptide modification ATP-grasp enzyme (TIGR04187, related to enzymes of microviridin maturation) and a putative ribosomal peptide modification target (TIGR04186).	8.77333e-93
NC_018524.1|WP_014912834.1|332031_333570_-|cytochrome-c-biogenesis-protein-ResB	gnl|CDD|377471	pfam05140, ResB, ResB-like family. This family includes both ResB and cytochrome c biogenesis proteins. Mutations in ResB indicate that they are essential for growth. ResB is predicted to be a transmembrane protein.	1.50761e-148
NC_018524.1|WP_148281572.1|323952_324318_-|hypothetical-protein	gnl|CDD|225405	COG2849, COG2849, Uncharacterized protein conserved in bacteria [Function unknown].	7.11191e-06
NC_018524.1|WP_014913421.1|331531_331960_+|OsmC-family-protein	gnl|CDD|274650	TIGR03562, osmo_induc_OsmC, peroxiredoxin, OsmC subfamily. pfam02566, OsmC-like protein, contains several deeply split clades of homologous proteins. The clade modeled here includes the protein OsmC, or osmotically induced protein C. The member from Thermus thermophilus was shown to have hydroperoxide peroxidase activity. In many species, this protein is induced by stress and helps resist oxidative stress. [Cellular processes, Detoxification].	2.87618e-63
NC_018524.1|WP_014913615.1|330037_331309_+|erythromycin-esterase-family-protein	gnl|CDD|350610	cd14728, Ere-like, Erythromycin esterase and succinoglycan biosynthesis related proteins. This group contains erythromycin esterase, which shares conserved active site residues of the Tiki/TraB family. Erythromycin esterases (EreA and EreB) disrupt erythromycin via the hydrolysis of the macrolactone ring. A critical catalytic histidine acts as a general base in the activation of a water molecule. Macrolides act by inhibiting bacterial protein synthesis by binding at the exit tunnel of ribosomal subunit 50s, blocking the translation of the polypeptide. Erythromycin esterase, typically found in integrons and transposons, confers antibiotic resistance through the disruption of the drug ring structure. EreB substrate profile is substantially broader than that for EreA, being able to also metabolize semisynthetic derivatives such as azalide azithromycin.	6.11826e-87
NC_018524.1|WP_014912358.1|319447_320035_-|helix-turn-helix-domain-containing-protein	gnl|CDD|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	1.90666e-16
NC_018524.1|WP_014908648.1|334646_335282_-|vitamin-K-epoxide-reductase-family-protein	gnl|CDD|240605	cd12922, VKOR_5, Vitamin K epoxide reductase family in bacteria. This family includes vitamin K epoxide reductase (VKOR) mostly present in actinobacteria. VKOR (also named VKORC1) is an integral membrane protein that catalyzes the reduction of vitamin K 2,3-epoxide and vitamin K to vitamin K hydroquinone, an essential co-factor subsequently used in the gamma-carboxylation of glutamic acid residues in blood coagulation enzymes. All homologs of VKOR contain an active site CXXC motif, which is switched between reduced and disulfide-bonded states during the reaction cycle. In some bacterial homologs, the VKOR domain is fused with domains of the thioredoxin family of oxidoreductases which may function as redox partners in initiating the reduction cascade.	5.47909e-69
NC_018524.1|WP_014912727.1|320779_321280_+|DinB-family-protein	gnl|CDD|368218	pfam04978, DUF664, Protein of unknown function (DUF664). This family is commonly found in Streptomyces coelicolor and is of unknown function. These proteins contain several conserved histidines at their N-terminus that may form a metal binding site.	2.21309e-43
NC_018524.1|WP_014908483.1|327162_327666_-|DUF2000-domain-containing-protein	gnl|CDD|378176	pfam09391, DUF2000, Protein of unknown function (DUF2000). This is a family of proteins of unknown function. The structure of one of the proteins in this family has been shown to adopt an alpha beta fold.	1.42848e-49

Protein sequences

>NC_018524.1|WP_014912231.1|326006_326477_-|NUDIX-hydrolase
MASDPTESFARPRVAAGALFFDEQGRVMMVVPTYKDYLDIPGGYIEHGETPSQAAAREVKEELGITPPIGRLLVVDWAPNLSEGDKQLFVFDGGVLDRRWLDQIALDPAELAGYEFHEVASIETATIPRLARRIVQGARARREGTTVYLENGEAVQ
>NC_018524.1|WP_014908189.1|324746_325814_+|hypothetical-protein
MSPALPLSPDGETERVPGALLIRGDCDDTTWNDVLSRMGELPGMVAHSPGQPLPPAQGPIPRRLLISQDPAWRGAAPVDVSEALSGEDVWVPDLVLIADRGTTRDPALRPLTAFLPDDDDLYRFRVTPRQAAMTYLVTHRPGIEDTLEHHKECGAAEVELEPDESYEDWLDGVSEVMGEVLETATHPPHYRPPVAPLPVVTQNNWGLLVRTDFSNDRAWATLAEDVDRLDPRVETPEEYQPYVQIVDDPAFAGATPEQVMAIVRPNEDENEDEETGEEVVVIADHASMSGSDRTVLVVPLEDNVGWSFRLPSDKVRSMAANLFVGNNDLSDWMNQGSPNGPAVITEKERQAWRGW
>NC_018524.1|WP_014913589.1|324372_324540_-|hypothetical-protein
MSYDTVALVAQEPGLETVARTLERTVPGLWIQAHPGIGLLELRSDDRRCARLQFI
>NC_018524.1|WP_148281572.1|323952_324318_-|hypothetical-protein
MKRVNEEELEYDYDDYGAALLDGEPFTGEAIDKSGDVVVGLTTFVDGREDGPQVEWYESGQIRAEGWASRFGGAAGVWSEWNESGQLVERKELDEKGNLISWRQWGEDGALIKDETYDPLW
>NC_018524.1|WP_187294514.1|323417_323969_-|pentapeptide-repeat-containing-protein
MTLCGDPGNGTADLWSCGCRGLSMRYRYLIAEDLRGTVFDGCDFTKAELQGSLIEGARFVEANFYKACLSECSGEGADFTGARLVGAEFYRSELAGSVWSGAWINASWMHETDLRGADLRGVWFGPDDRAGRTRFVSTRIGARTCGARADGSRVRRMSDLPGSLACSSGTNSRPGSPSRARRR
>NC_018524.1|WP_017536544.1|322372_323122_-|hypothetical-protein
MIGKDPTPVRYYMIRWEGLPIGALLVQGERNTRFLAVMGATDLETRISSSKAWGSRLSKDAEEGFGPIDSIRRWKGVPSQPGVGGIPQDARLHTCADLGELSRLLNPGHEPEKDTINERLQDPHMLYGRDRGPFVTKRVDTGYRILARGEVLYRPVRMEGTIIGFLWASDAENARGYEPRPVAGPSAWRAESWWIDQAAEAAARGLTPVGALRERIGMPEDPVGGRLDSSDDELIAASTRDLRQIARPT
>NC_018524.1|WP_014912727.1|320779_321280_+|DinB-family-protein
MSTTSRDDRRGDSPPPRTGNSEAEVLRGFLDYLRTSIAAKVENAPEPQARTAGVPSGTNLLGLLHHLTFVEHAMFLGDRVTDWQATFQAAPADSGADVVARYRRTVERANRVLDGCTDLGAPVPRPGPGRPAPSLRWALVHMIEETGRHAGHADILREQIDGAVGR
>NC_018524.1|WP_014909711.1|320121_320739_+|class-I-SAM-dependent-methyltransferase
MDTKDATTFWDGVHATRPVATDPQPNDRLVEAVTGLASGRVLDLECGEGGDALWLARQGWHVTAVDLSAVAVARLTALARSHDLQELVTAERHDLHTSFPQGRFDLVSAHYLHSPHDLDRSAVLRAAAHALNPGGLLLVVDHGSAAPSPAPDAHYPTPQEVAADIDLDPATWTVERADTPRRIATGPGGRTAEVTDHILLIRRTA
>NC_018524.1|WP_014912358.1|319447_320035_-|helix-turn-helix-domain-containing-protein
MDDETEDVLDVVGSRLRALRRARGITLADLAVTIGVSESTLSRLESGRRRATLELLLPLARAYDVPLGDLVGAPRTGDPRIHLKPIRRFGMVFVPLSRRPGGTQAFKMIIPARSEPLEPTPQTHEGFEWVYVLDGRLRLVLGERDLTLSPGEVAEFDTSLPHWLGSADGGSVELLVLFDLQGVRAHVRTGTASEA
>NC_018524.1|WP_014912591.1|317321_318476_+|ribosomal-RNA-adenine-dimethylase
MTRSTTATEAFEPEHAARLARDLAEKGAIRSPEWRRVFARVPRHLFVSSFVVRTSEGTVAYDEQTPGRLETIYSDATLITRFSADGLAISSSTEPSLMALMLEHLRLQDGMKVLEVGTGTGYNAALLSERLCSALVTSIDVDGALVDRARGALEAAGYRPALAAVDGARGYPNNAPYQRILATCGLGRIPVSWLDQLDEGGLILANVGLGMALLRKGSDGHARGRLLPEAAGFMRLRSSSAPGVPTVSEVLSVTGGGPERVRVVEKVAGLDDHASSEFLLSLLLPYGLRVVQHRQEGQVHGVLDGASGSWMRVEVDHQGRTTVSERGDRHLWAAYTALLSDWEEAGRPEIGRYGLTITPAGEHHLWLDHPQNTNTPLDQAETTG
>NC_018524.1|WP_014908483.1|327162_327666_-|DUF2000-domain-containing-protein
MKPSMKMIIALREGLEPALAANAAAVLGLAMGGRLEDSVAADGKDASGNVHAGLNPHPVPTLTASADLLRELHEKASAREDIVTVGFNEVARRSRTYEEYETALAATPTSEIDHVGLAFFGPRNAITRLTKRLPCWLESRAIEGRGMAQGRSPRRAGAQPGVVVLPR
>NC_018524.1|WP_041561649.1|327775_328237_+|Lrp/AsnC-family-transcriptional-regulator
MDELDSVIIRELQLNARQTNRELARTVGIAPSTCLERVRSLVERGVIRGYHADIDPAALDRRVEAFVSARLRPLSRSVIDAFKKALIALPEVSAVFVVAGDDDFLIQVSARDLDHLHDFLIDRLSQRREVVSFRSQIIYESSRKHVMEDLSEK
>NC_018524.1|WP_014909755.1|328307_329657_-|MFS-transporter
MSMLQFFIAVDVTVVNIALPSIGDDFGVDGHALTWVVVGYTITGGGLLMLGGRLGDLLGRRRVLLAGTTLFGVASLLAGVAPTFGVLVLARLLQGVGEAIALPAAMATIVLMFPEGRSRSRALSVWAAVASCGLVLGFVLSGVITAHLGWRWVFLISVPFILVVVVAALVLVERDRPVAREAGRLDVSGALLLTASPLLFTYGVVEAGEPGTPSWVSVAALAGAVLAGIGFVRVEARSSEPLLPLSFFADRSRVTANVTTMLISGALSTSFLLFTFYLQDHLGIGPLGAGLMMLPLAVSLIVFSMLVPRLLGRWGARVCVLTGLGFTVAAMTLIATVAVLGAGAPWLVPAMLLIAAGMGFGLVGLQYIAVSGVTEEDAGIASGVQRAADQLGGATGVAVCVGIGFAPALHTADPFLVAALLAGVGLVIGTLVILRTPEPAVPEPSEQAG
>NC_018524.1|WP_014913615.1|330037_331309_+|erythromycin-esterase-family-protein
MTPTSPFSSWSRDHFTPLTHLAPDAPLDDLEPLRGLIGDARVVAVGENSHFIEEFSAVRRRVLRFLVERCGFTVLAFEYGFAEGHVLDTWARGEGTEEDLTDHLASAVPVGVDAPLRWVREHNRRAERPVGFAGVDVPAAGGSLLPALSLVAGYLRRVDPEFLPEVEEAMRIASSFAGPSAAAAAPRWERLDPAERNALGALLSRLAIRFRSVEPLYVSRGGRRDYDVALRTLEVAAHTDYSFRAMADLFAGRGRTADVSARDHAMAASLLWHLERGGAETRIVLAAHNAHILKSPVLFDGRLTGFPMGHYLHDALGGDYFSLALTGVSGNTADMVPEETAPFGFTVHDTELGAPEPGSVEAVFADGDLGPGLVDLRPRRSSLDGSEPDRTRLQSSYLHVPVVDAFDAVLNTETSTVTAEVLG
>NC_018524.1|WP_014913421.1|331531_331960_+|OsmC-family-protein
MATTRKSTTHWEGSLMEGSGTVSLDSSGVGTFDVTWPSRAEQANGRTSPEELLGAAHSTCFSMALSHGLSQAGTPPETVDTSAEVTFQPGTGITGVHLTVQARVPGISEEDFQRAAENAKANCPVSQALTGTEITLSAELAG
>NC_018524.1|WP_014912834.1|332031_333570_-|cytochrome-c-biogenesis-protein-ResB
MAVLSENSGNTMTDKGASGPKGLGVIGWARWIWRTLTSMRTALILLFLLAVGAIPGSFLPQNVVSVDQVATFYQDHPELAPWLDRFYLFDVFSSPWYGAIYLLLFVSLAGCVIPRALVHAKAVRARPVATPRNLSRMPYVARFSTDTPPDEVLAQARKVLKGYRVERYENSVSGETGYLREAGNVLFHFALLGLLLALAAGAFFGNTLPSYDAIYPGHWTDTDAFEPFTIRLEEFEATFIEEGNLRGQASSFVADIRYREGPGEPEQQHTLEVNHPLSVDGVQIYLLGHGYAPRFEVRNADGDLVFDQAVPFLHRETMTYTSDGVIKVPDTGGEELGFVGVFLPTAMEDSEGELVSGFPGVQNPMVTLEAYQGDLGMVDPQSVYQLKTAGMENIGESPVMEIGDTWELPDGAGSITFTGVKDYVSLQSNRDGARVPALLAASSAVVGLLLTLFVRPRRVWVRAIPGEDGRTRVELAGLGKTEVAGDNAEFHEITTRLAGRLTEQMRGGEGER
>NC_018524.1|WP_014912252.1|333571_334429_-|cytochrome-c-biogenesis-protein-CcdA
MDAIGTTVLTGSLLLAAPLALLAGLVSFLSPCVLPLVPGYLSYVSGMSGSHIRERDGVSGGDPCHADGSDPGAGGTGGGATATLSDVDAESARRRWTMVTGSVLFIAGFTLVFVAVGGFIGWLGDLLMAYTDPITRVLGLLTIVLGLAFMGVMPGFGREFRFHRLPRAGLAGAPLLGVLFGLGWTPCIGPTLAAVQTLAFVEGGAGRGMFLSLIYCVGLGLPFVLASLLYRRALNAFGWLKRHTRTVTVVGGVMLVLVGLAMVSGLWTEMTIGMQRWAADFQTVI
>NC_018524.1|WP_014908648.1|334646_335282_-|vitamin-K-epoxide-reductase-family-protein
MTPIEAPERTSTGPDGAIIGRVLPWLLALGGAVGLVAATALLVEKLKVLADPDHVPACSIDPVLSCGTVMTTPQAEAFGIPNPILGIIGFSVVVTVGVVLLAGARPPRWFWLGLQAGTLFGAVFVHWLIFQSLYRIGALCPYCMVVWAVTAPIFWYTTLHNVREGRLPSTPGVRRITDVLVRYHSTVLCLWAAALTVAIAQAFWTYWTTLI
>NC_018524.1|WP_014912845.1|335278_335962_-|thioredoxin-domain-containing-protein
MNKNLTISLSILAILAVVITLGVFAYSGSDGEEASGPRPSAPEAPPTASAELLVRDDSRYLDRVEDAQVTVVEFLDFECEACYAQFPVMERIREDYEGRIDVVIRYFPLPGHANSRPAAAAVEAAAQQDALDEMYVRMFETQPEWGESRESQAELFIGFAEDLGLDVDEFTEVMESPETEARVQADFDDGVELGVQGTPTIFVDGVRTSSMPSYEELSSRIDAGLGE
>NC_018524.1|WP_014911643.1|336090_336489_-|hypothetical-protein
MGNGLRAKRLGTLAVLLGMFVLMSLACSFATAPTDGPDRAAAPATAQVAAADEGGTDLAASATTEDRTSHPCGPPQIQPSISWNLPLLPFPALALFDLFEAPHETSSPRTGAGEPSLHRADGLLTFLCVQRV

Crispr_ID: NC_018524_6

• CRISPR_ID: NC_018524_6
• CRISPR_location: 741240-741367
• CRISPR_type: Orphan
• Repeat_type: NA
• Spacer_info: 1 spacers

Consensus repeat of NC_018524_6

Consensus_repeat	Method
GGACGCGGGCCCGGACGGGGACCGCCCGGACGCGGGGC	CRISPRCasFinder

spacers of NC_018524_6

>6.1|741278|52|NC_018524|CRISPRCasFinder
CGCAGGCTTGGATCCCATGCCGGAGGCGTTGGACGCGAACGGGTTGTTACCC

CRISPR arrays and Neighbor proteins around NC_018524_6

CRISPR arrays

The CRISPR arrays of NC_018524_6

>merge|NC_018524|6|741240-741367|CRISPRCasFinder
GGACGCGGGCCCGGACGGGGACCGCCCGGACGCGGGGCCGCAGGCTTGGATCCCATGCCGGAGGCGTTGGACGCGAACGGGTTGTTACCCGGACGCGGACCCGGACGGGGACCGCCCGGACGCGGGGC

>NC_018524|6|6|741240-741367|CRISPRCasFinder
GGACGCGGGCCCGGACGGGGACCGCCCGGACGCGGGGC	CGCAGGCTTGGATCCCATGCCGGAGGCGTTGGACGCGAACGGGTTGTTACCC
GGACGCGGACCCGGACGGGGACCGCCCGGACGCGGGGC

Neighbor Proteins Overview

Protein	Signature genes	Signature genes Name	Protein_function
NC_018524.1|WP_014911912.1|735209_736172_-|bifunctional-riboflavin-kinase/FAD-synthetase	unknown	unknown	gnl|CDD|235536
NC_018524.1|WP_187294521.1|736339_737233_+|alpha/beta-hydrolase	unknown	unknown	gnl|CDD|223669
NC_018524.1|WP_026124843.1|742470_743493_-|transcription-termination/antitermination-protein-NusA	unknown	unknown	gnl|CDD|237061
NC_018524.1|WP_014908642.1|738170_738614_-|30S-ribosome-binding-factor-RbfA	unknown	unknown	gnl|CDD|234787
NC_018524.1|WP_014912566.1|737256_738090_-|tRNA-pseudouridine(55)-synthase-TruB	unknown	unknown	gnl|CDD|235113
NC_018524.1|WP_014910283.1|751620_752946_+|cytochrome-ubiquinol-oxidase-subunit-I	unknown	unknown	gnl|CDD|376587
NC_018524.1|WP_041561682.1|747298_748150_+|fused-MFS/spermidine-synthase	unknown	unknown	gnl|CDD|223498
NC_018524.1|WP_081536461.1|742094_742442_-|DUF448-domain-containing-protein	unknown	unknown	gnl|CDD|238173
NC_018524.1|WP_014911817.1|744368_744875_+|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014912698.1|743517_744000_-|ribosome-maturation-factor-RimP	unknown	unknown	gnl|CDD|234627
NC_018524.1|WP_014909988.1|750819_751461_+|response-regulator-transcription-factor	unknown	unknown	gnl|CDD|225107
NC_018524.1|WP_014909413.1|744912_745383_+|ferritin-like-domain-containing-protein	unknown	unknown	gnl|CDD|373114
NC_018524.1|WP_081536459.1|728503_730099_+|BCCT-family-transporter	unknown	unknown	gnl|CDD|376718
NC_018524.1|WP_026124844.1|730640_731975_-|insulinase-family-protein	unknown	unknown	gnl|CDD|223685
NC_018524.1|WP_014909037.1|730095_730569_+|Hsp20/alpha-crystallin-family-protein	unknown	unknown	gnl|CDD|223149
NC_018524.1|WP_014912439.1|738616_738913_-|DUF503-domain-containing-protein	unknown	unknown	gnl|CDD|377364
NC_018524.1|WP_041561683.1|748210_749425_+|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014911050.1|732083_734390_-|polyribonucleotide-nucleotidyltransferase	unknown	unknown	gnl|CDD|131743
NC_018524.1|WP_014913440.1|734683_734953_-|30S-ribosomal-protein-S15	unknown	unknown	gnl|CDD|180170
NC_018524.1|WP_041561684.1|749638_750823_+|two-component-sensor-histidine-kinase	unknown	unknown	gnl|CDD|226951

rpsblast for functional proteins

Protein	Function_ID	Function_description	E-value
NC_018524.1|WP_014911912.1|735209_736172_-|bifunctional-riboflavin-kinase/FAD-synthetase	gnl|CDD|235536	PRK05627, PRK05627, bifunctional riboflavin kinase/FAD synthetase.	8.35202e-131
NC_018524.1|WP_187294521.1|736339_737233_+|alpha/beta-hydrolase	gnl|CDD|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	2.81565e-27
NC_018524.1|WP_026124843.1|742470_743493_-|transcription-termination/antitermination-protein-NusA	gnl|CDD|237061	PRK12327, nusA, transcription elongation factor NusA; Provisional.	0
NC_018524.1|WP_014908642.1|738170_738614_-|30S-ribosome-binding-factor-RbfA	gnl|CDD|234787	PRK00521, rbfA, 30S ribosome-binding factor RbfA.	8.87044e-48
NC_018524.1|WP_014912566.1|737256_738090_-|tRNA-pseudouridine(55)-synthase-TruB	gnl|CDD|235113	PRK03287, truB, tRNA pseudouridine synthase B; Provisional.	1.02881e-135
NC_018524.1|WP_014910283.1|751620_752946_+|cytochrome-ubiquinol-oxidase-subunit-I	gnl|CDD|376587	pfam01654, Cyt_bd_oxida_I, Cytochrome bd terminal oxidase subunit I. This family are the alternative oxidases found in many bacteria which oxidize ubiquinol and reduce oxygen as part of the electron transport chain. This family is the subunit I of the oxidase E. coli has two copies of the oxidase, bo and bd', both of which are represented here In some nitrogen fixing bacteria, e.g. Klebsiella pneumoniae this oxidase is responsible for removing oxygen in microaerobic conditions, making the oxidase required for nitrogen fixation. This subunit binds a single b-haem, through ligands at His186 and Met393 (using SW:P11026 numbering). In addition His19 is a ligand for the haem b found in subunit II.	1.34384e-103
NC_018524.1|WP_041561682.1|747298_748150_+|fused-MFS/spermidine-synthase	gnl|CDD|223498	COG0421, SpeE, Spermidine synthase [Amino acid transport and metabolism].	6.13816e-17
NC_018524.1|WP_081536461.1|742094_742442_-|DUF448-domain-containing-protein	gnl|CDD|238173	cd00279, YlxR, Ylxr homologs; group of conserved hypothetical bacterial proteins of unknown function; structure revealed putative RNA binding cleft; proteins are encoded by an operon that includes other proteins involved in transcription and/or translation.	1.76546e-18
NC_018524.1|WP_014909413.1|744912_745383_+|ferritin-like-domain-containing-protein	gnl|CDD|373114	pfam14530, DUF4439, Domain of unknown function (DUF4439). This domain has a ferritin-like fold.	5.3932e-23
NC_018524.1|WP_014912698.1|743517_744000_-|ribosome-maturation-factor-RimP	gnl|CDD|234627	PRK00092, PRK00092, ribosome maturation protein RimP; Reviewed.	3.54356e-49
NC_018524.1|WP_014909988.1|750819_751461_+|response-regulator-transcription-factor	gnl|CDD|225107	COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription].	1.23194e-60
NC_018524.1|WP_081536459.1|728503_730099_+|BCCT-family-transporter	gnl|CDD|376718	pfam02028, BCCT, BCCT, betaine/carnitine/choline family transporter.	0
NC_018524.1|WP_026124844.1|730640_731975_-|insulinase-family-protein	gnl|CDD|223685	COG0612, PqqL, Predicted Zn-dependent peptidases [General function prediction only].	1.34388e-104
NC_018524.1|WP_014909037.1|730095_730569_+|Hsp20/alpha-crystallin-family-protein	gnl|CDD|223149	COG0071, IbpA, Molecular chaperone (small heat shock protein) [Posttranslational modification, protein turnover, chaperones].	1.85705e-22
NC_018524.1|WP_014912439.1|738616_738913_-|DUF503-domain-containing-protein	gnl|CDD|377364	pfam04456, DUF503, Protein of unknown function (DUF503). Family of hypothetical bacterial proteins.	5.26224e-35
NC_018524.1|WP_014911050.1|732083_734390_-|polyribonucleotide-nucleotidyltransferase	gnl|CDD|131743	TIGR02696, polyribonucleotide_nucleotidyltransferase, guanosine pentaphosphate synthetase I/polynucleotide phosphorylase. Sohlberg, et al. present characterization of two proteins from Streptomyces coelicolor. The protein in this family was shown to have poly(A) polymerase activity and may be responsible for polyadenylating RNA in this species. Reference 2 showed that a nearly identical plasmid-encoded protein from Streptomyces antibioticus is a bifunctional enzyme that acts also as a guanosine pentaphosphate synthetase.	0
NC_018524.1|WP_014913440.1|734683_734953_-|30S-ribosomal-protein-S15	gnl|CDD|180170	PRK05626, rpsO, 30S ribosomal protein S15; Reviewed.	3.45957e-52
NC_018524.1|WP_041561684.1|749638_750823_+|two-component-sensor-histidine-kinase	gnl|CDD|226951	COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms].	7.28472e-47

Protein sequences

>NC_018524.1|WP_014912439.1|738616_738913_-|DUF503-domain-containing-protein
MYVGALTLDVLLGDVQSLKQKRSVVRPVVSDLRRKFSVSVSEVGEHDLYRRAKIGVAVVAPTAAHARDQMDTCERFVAGRPELELLSARQRLFNEEED
>NC_018524.1|WP_014908642.1|738170_738614_-|30S-ribosome-binding-factor-RbfA
MVDAARARKIADRIQRIVAEMLDRRIKDPRLGFVTVTDARITADLRDATVYYTVFGSAEEKAASSAALESAKGLIRSEVGRQTGIRHTPSLTFVIDEVQENAQHIEKLLVEARRSDEEVAKKATGAEHAGEADPYKAPREDDEAEDE
>NC_018524.1|WP_014912566.1|737256_738090_-|tRNA-pseudouridine(55)-synthase-TruB
MADSGVVVVDKPRRVGHAGTLDPMATGVLVLGIEKGTKLLGHLTLTEKTYEATIRLGLVTNTDDAEGEPGARVDASAVSDEDVRAAVAKLTGPIQQIPPQVSAIKVNGERAYKAARAGREVELKARTVTIERFEVTDIRRESDADGVLVDVDAVITCSSGTYIRSLARDMGADLGVGGHLTALRRTRVGPYDLSQARTLDQLAKEFTQVPLARAVAAAFPVRTMDEAETRAIRHGNRIGESSLGEGPIGLFAPDGTVVALGENRPGHMKPVVVFDPA
>NC_018524.1|WP_187294521.1|736339_737233_+|alpha/beta-hydrolase
MAMISTDKTRLSYDEAGDGPVVVFAHAGIADRRMWDHQFTNLSRTHRVIRYDQRGYGGSADHEGPIPHHEDLLDLMDALEIGSATLVGASFGGAYAVDAALAAPERVEALALVCPGMSGHRWTGEFLRESREAILAAVPPDRLATYRAGDAVVLPEDVAAMAEAQARFMVLGPDRSPEDLPLEAWDLSLLMLRELFARRWSSPANEPAWPERPAVDRLGEITVPTLVVKGLSEVAAVQEVADLYMEGIPGARSLTMPDTGHLPSVERPGELTAALAEFLDEEVSPSSTTLGRDTSRR
>NC_018524.1|WP_014911912.1|735209_736172_-|bifunctional-riboflavin-kinase/FAD-synthetase
MRRWDGLGDIPTDQGRSVVAIGVFDGVHRGHRALLATAVEHGRRLGLPVVVVTFDPHPERVLRGHTPPVLTSIDRRVGLLDDLGADAVCVLPFTKELSSLSPEDFVQRVLIDRLGAAAVVVGEDFRFGHRAAGNVAVLAELGERFDFVVDGVRLVAEGETITSTRIRALLERGDVSTAAELLGRPHQVGGEIVHGAARGRELLGFPTANLDLDPDTAVPGDGVYAGWLGRREVGPGHESRWPAAISVGTNPTFDGTERTVEAYALDRDDLELYGVDMTVDFVARIRGQERFEDLDDLIVAMRRDVDRCRDVLAPETGDTV
>NC_018524.1|WP_014913440.1|734683_734953_-|30S-ribosomal-protein-S15
MSIDTATKEKIIAEYATKEGDTGSPEVQVALLTHRITELTEHLKDHKHDHHSRRGLLLMVGRRRRLLKYIAKQDITRYRSLIERLGLRR
>NC_018524.1|WP_014911050.1|732083_734390_-|polyribonucleotide-nucleotidyltransferase
MEGVFSAEAVIDNGGFGTRTIRFETGRLARQAAGSATVYLDDETVVLSATTASKRPKDNLDFFPLTVDVEERMYAAGRIPGSFFRREGRPSEDAILTCRLIDRPLRPSFKKGLRNEIQIVETVLALHPEHLYDVVAINAASMSTQIAGLPFSGPIGGVRVALIDGQWVGFPTHAELENATFDMVVAGRVLEDGDVAIMMVEAESTTRTLKLVAEGAVGPNEQTVAEGLEAAKPFIKVLCKAQQAVAEQAGREEGEFPIFLDYEDDAYAAVEGAVREDLAKALTIADKQDREAELDKIKAEAGERLAADFEGREKEVGAAFRSLSKQLMRERVLRDQVRIDGRGPKDIRQLSAEVGILPRVHGSALFERGETQIMGVTTLNMLRMEQTVDTLNPEKTKRYMHNYNFPPYSTGETGRVGSPKRREIGHGALAERALLPVLPSREEFPYAIRQVSEALGSNGSTSMGSVCASTMSLMAAGVPLKEMVSGIAMGLISEGDEFVTLTDILGAEDAFGDMDFKVAGTRDLITALQLDTKLDGIPAEQLALALQQARGARLAILDVMQEAIERPAEMSPNAPRILTVKVPVEKIGEVIGPKGKMINSIQDDTGADITIEDDGTIYIGATDGPSAEAARDTINQIANPTMPEVGDRYLGTVVKTTTFGAFVSLLPGKDGLLHISQIRKLHGGQRIENLDDVISIGEKIQVEIREIDDRGKLSLVPVEVVEAEAAKNEGGESSESAAKGEDKGDDAKGEGAPRRRRRRSSGGRSENT
>NC_018524.1|WP_026124844.1|730640_731975_-|insulinase-family-protein
MSSVPTAAEQEPGTTVTLLEPDGGSGLVRRTVLPGGLRVVTENIPGVRSAAFGISATTGSRDEDSAHAGSAHFLEHLLFKGTRTRSALEISALLDGVGADHNAYTTKEHTCYYAKVLDRDLPLAVDVVGDMVAHSVLDEGEVETERGVILEEIAMYEDEPADLVDDVFAEHFFGDTPLGRPILGTTDTIKALPRERIAEQYRDAYVPSELIVTAAGSLDHAEVVDRVAAIFAEQSAAAGDARPSGPRGPGEPVRTFDGTIVQPRETEQAHIILGSEGIVRTDPRWHALRLLGAALGGGMSSRLFQEVREKRGLAYAVHAYHTAYADTGTFQIYAGCLPEKADEVIGVCREELAKVAASGITEEELVRAKGQIQGAMVMGSEGTNARMGRLLSHELVQPRHFSIDEDLARFDAVTLNDVSEVAADILTRPRALAVIGPYEADRVF
>NC_018524.1|WP_014909037.1|730095_730569_+|Hsp20/alpha-crystallin-family-protein
MTPKKFGNPFYGVVDMITEMNRISDTMTSIENGQAGDRQRGFADAWSPPTDILARGNDLVIRCEVSGVLEEDVTVSLVHGVLTISGERRRDGDDVVYYSSERFMGTFRREISLPDGVTESDIEAGYGEGLLEVTVHGAANASAPRRIAIKRRKKPGK
>NC_018524.1|WP_081536459.1|728503_730099_+|BCCT-family-transporter
MVSSLVIIAFVVLGVAYTDPLLDGATKVRDWIGTDLGWFYVLATTFFLGAAIFLMLSRFGSIKLGPDDSRPEFGTVAWFAMLFTTGMGIGLVFWGVAEPVIHLHAPRSEELAETAPSPAGVGEALGLSFFHWSFHPWAIYIALGLSLGYFAFRKGLPLRPASALYPLLGDRAFGWPGHIVDILAVFGTIFGLATSLGLGTLQINSGLTQVTGMPNNSLTQSIIIIVITGIALYSVMAGIDKGIRRLSVINLWLAFILLAFIFAVGPKLWIVSSMLTGAGEYLGNLVQWSLSFPSPLADETAATFTTGWSIFYWGWWISWSPFVGIFLARISYGRTIREFIIGALFAPVVVSILWFGVFGGSGLYYELFGEGGFQDGDEASAAFHLLDALPLTPIVATIASVLLIVVVAVFFVTSSDSGSLVVDTLTNGGDTNPVKLQRAFWAISEGGVTLILLVLGGTNALGALQAASVVTGLPFAVILVFMLWGLFKGLAKEPKPGVALKKNGDSSRSKVDAGRTARQGGDNAPKEEDGT
>NC_018524.1|WP_081536461.1|742094_742442_-|DUF448-domain-containing-protein
MVAEDGRDRPVRTCVGCRSRAVQSDLVRLVAEGTAITPDTRGRRPGRGAYLHHDRRCFELAERRRVWSRAFRARNEETPTGWDVSRVAALFDDIPSDRTRRDPDRVGMSGPTSRL
>NC_018524.1|WP_026124843.1|742470_743493_-|transcription-termination/antitermination-protein-NusA
MSVLRGLEREKDIAVELVAKAIEDALLIAYHREEGPDKKARVELNRSTGHVTVWVAETDEEGGVVGEFDGTPNGFGRIATSTAKQVILQRLRDAEDELTLGEFAGREHDIVSGIIQQGKDPRNVLVDLGKLEAILPPQEQVPTEDYVHGERLRAYVVQVRKGHRGPSVTLSRTHPNLVRKLFELEVPEIADGTVEIAAIAREAGHRTKMAVRSNRGGVNAKGACIGPLGSRVRNVMAELHGEKIDIVDHSEDPAVFVANALSPARVNSVEIIDMAARVARVVVPDYQQSLAIGKEGQNARLAARLTGWRIDIRSDAEPERSAEDEDASGAADVDDASSAG
>NC_018524.1|WP_014912698.1|743517_744000_-|ribosome-maturation-factor-RimP
MGAQARNERIVELLEPVLAEAGLDLEAVELTPAGKRRVLRVIVDSDKGVDLDTVGEVSQEVNEALDASDVMGELPYVLEVTSPGVDRPLTLPRHWRRSRGRLVKVSLVEGGNLTGRVIESDDQGVTLDVKGRTRVLAYDTIAKAKVEVEFRREADTDAAD
>NC_018524.1|WP_014911817.1|744368_744875_+|hypothetical-protein
MGQWNVSRRTLLGATVAGAAAVGLVGCGEVDWYPYAETPDVAVLRSLIREKERMIARYERALADGAGPSELLEGFLGHHLAHVDALLDALPEDVGPYDDPEKGDGETSAPPEEGPGPTPDRAGLRLLEAAAASARLDQAAAVTDAALAQLVSGIGACEAAHAHLMDRI
>NC_018524.1|WP_014909413.1|744912_745383_+|ferritin-like-domain-containing-protein
MSDSPNPEETGSPEPREGSDPSAEALAEAVSAEHAAVYGCEFVGGAAGDEGRRERASAFARQHKALRDTLRDAARERDWEAPPAKASYPLPEGRGDEEMDAFAAELERRTMEAHLWLSSSPDTDLRITAARALQEATARSLDWGAELDALPGFERL
>NC_018524.1|WP_041561682.1|747298_748150_+|fused-MFS/spermidine-synthase
MGRRVRDRSEPEEELSPVPGVDLLADADRPNSWFLLVEGTPQSHVDLADPSYLDFSYVRRIAHAADLVAPEGEPIEALHLGAGALTVARYVAHTRPGSTQRAVDVDAALVEMVRRRLPWDRRARLRVGIDDARTWIGARHDACADLIVSDVFSGARTPARLTSTEFYAEAARVLRPDGLLVVNVGDGYALKHTRAQVATVRSVLPHAVLTAEPGILRGRRFGNLVIVAGHRPLPEEELGRRAHRDTEMARMVAGEDLDRFVSGHAPVHDADAVDSPEPPVDLF
>NC_018524.1|WP_041561683.1|748210_749425_+|hypothetical-protein
MRLLPRPPGFGRESLETSASGDESPPRLWLHIAVTWVMAGLCIGAIVGGTLWFLGFPEIPRPEELSLRAFEAVLVRAFAVMAGLSGIALLVIAYHRQRNNDLENLRAHRAAERDGVKLFNDRFTSAYTELGNEQATARLGAVYALAHLADDAPDPGLRQTCIDVLCTYLRMPHAPRPGDDVEPGSPEYQEYEAFREVRRSIVRAIGDRLRDEDSPWHGHRFDFSDVVFDGGTLRSVHFLRGKFIFNRAVFAEGDLDLRYSRVVDANMNFRNARFTGGTVNLRHVRFEGGFTDFYKAGFEGSEVLLHDVRIAPKTINLTGVRFASGRVEFDSHRGEPALGDPPDGLLDAVAAGEPGVVRLPGSWTSTSAENGAFDDPEETPSQGERAGRKMTGTGQPHLSGTENL
>NC_018524.1|WP_041561684.1|749638_750823_+|two-component-sensor-histidine-kinase
MAALLRAVPRPTRADLWITITLLVLSVGSTIGIEIVDPVPDDLRPWPWGYALMLAACLPLLLRTPLPRVVGLLSVTASTVYYPLGFPDGLVMLCTAVMLYTLVRRGHRVFGWSLGIGQFVSVNAYEYLALGSVRPEAIGVVGWVLVLLCAGEVVRWRAEYQQADREREEEAARGREEELLRRASDERLRLARDVHDTVAHNISLINVQAGTALYLMEKEPERAAQALSTIKRTSKETLVELRAILGVLRAVDESAPRSPAPGLDRVDALVEGTRDAGVEVDLEMVGAERRLPQGVEGVAYRALQEALTNVVRHSGASRARVRIVHEPSWTTVEVSDDGRGTVGPPAAGNGITGMRERATLVGGEVDVGPAEGGGFRVVVRLPVDGGPDRGEDRR
>NC_018524.1|WP_014909988.1|750819_751461_+|response-regulator-transcription-factor
MIRVLLADDQALVRAGFGALLNSEPDIEVVAEAGDGDEAIRLARSTRPTDGLTATGRILADPALERTRIVILTTFDLDEYIFEALRSGASGFLVKDTEPRDLLQAVRVVHAGEALLSPGITRRLIADFVKRPNRSPGPSPRLNGLTDREREVLSLVGRGLSNEEIAGELVLSPATAKTHVSRAMVKLGVRDRAQLVVLAYETGLVTPGRAEPG
>NC_018524.1|WP_014910283.1|751620_752946_+|cytochrome-ubiquinol-oxidase-subunit-I
MLEDPLALARLQFAFTAATHYMFVALTLGLAPYILFTQFVAVLRGDRSRMLSVRFWGGLYLVNYGMGVLSGLVMELQLALNWSGIQETFGYTFAAPLAIETMTAFFIESTFLGLWIFGWDRMGRWAHLFCFLVVSLTAYGSAWWVLVSNGFLRHPVGFEMVDGVAHLTDPMALVTNPAAVLAFLHVVTGAMTVGALVVAAVSAYHLRRGRDEHGIFRRGIRYSAIMMCVMPMLVVSFGGAQFQIFGQDPPTSGLTYTAEEIATIEASGGGGLVAVANLTGDVVMMTSWAVMFFLGPLIPLFLPLLSARRGRWGRRLGLAPGPELFSRPPARWIRWALAPLLVSPALPYLASIGGWVYRETNRQPWVVVHHLTTADAMTPMSPAAALASFTFFTLAFTVLAVVTYTLLFRYARRGPEGGPLAERRADAGPGADEPAAPVHTF

Crispr_ID: NC_018524_7

• CRISPR_ID: NC_018524_7
• CRISPR_location: 931682-931770
• CRISPR_type: Orphan
• Repeat_type: NA
• Spacer_info: 1 spacers

Consensus repeat of NC_018524_7

Consensus_repeat	Method
GACGAGTAGGAGGACTTACGGAA	CRISPRCasFinder

spacers of NC_018524_7

>7.1|931705|43|NC_018524|CRISPRCasFinder
GGCGGGCGCCACCTGCGCGACCTCGACGCAGTTCTCCTGGGCA

CRISPR arrays and Neighbor proteins around NC_018524_7

CRISPR arrays

The CRISPR arrays of NC_018524_7

>merge|NC_018524|7|931682-931770|CRISPRCasFinder
GACGAGTAGGAGGACTTACGGAAGGCGGGCGCCACCTGCGCGACCTCGACGCAGTTCTCCTGGGCAGACGAGTAGGAGGACTTACGGAA

>NC_018524|7|7|931682-931770|CRISPRCasFinder
GACGAGTAGGAGGACTTACGGAA	GGCGGGCGCCACCTGCGCGACCTCGACGCAGTTCTCCTGGGCA
GACGAGTAGGAGGACTTACGGAA

Neighbor Proteins Overview

Protein	Signature genes	Signature genes Name	Protein_function
NC_018524.1|WP_014908299.1|937895_939569_-|glycoside-hydrolase-family-3-C-terminal-domain-containing-protein	unknown	unknown	gnl|CDD|366376
NC_018524.1|WP_014913126.1|931784_932639_-|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl|CDD|379262
NC_018524.1|WP_014908268.1|932812_933130_+|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014909538.1|930662_931409_-|haloacid-dehalogenase-like-hydrolase	unknown	unknown	gnl|CDD|319809
NC_018524.1|WP_014910653.1|934534_935056_+|GNAT-family-N-acetyltransferase	unknown	unknown	gnl|CDD|366181
NC_018524.1|WP_014911802.1|940251_940488_-|PTS-transporter-subunit-EIIB	unknown	unknown	gnl|CDD|238130
NC_018524.1|WP_014908761.1|915775_916108_-|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl|CDD|224609
NC_018524.1|WP_014909603.1|936577_937036_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014910518.1|937117_937774_-|HAD-family-phosphatase	unknown	unknown	gnl|CDD|319790
NC_018524.1|WP_014911332.1|921498_921963_-|SsrA-binding-protein-SmpB	unknown	unknown	gnl|CDD|376590
NC_018524.1|WP_014911876.1|923028_923718_-|cell-division-ATP-binding-protein-FtsE	unknown	unknown	gnl|CDD|225438
NC_018524.1|WP_014912462.1|916264_917467_-|MFS-transporter	unknown	unknown	gnl|CDD|340863
NC_018524.1|WP_014911896.1|919481_921461_-|cell-division-protein-FtsI	unknown	unknown	gnl|CDD|274573
NC_018524.1|WP_014909821.1|925301_930179_-|NAD-glutamate-dehydrogenase	unknown	unknown	gnl|CDD|377452
NC_018524.1|WP_148281681.1|935175_936279_-|cytochrome-P450	unknown	unknown	gnl|CDD|225035
NC_018524.1|WP_014908355.1|933395_934427_+|methyltransferase-domain-containing-protein	unknown	unknown	gnl|CDD|275041
NC_018524.1|WP_014912279.1|939666_940155_-|PTS-glucose-transporter-subunit-IIA	unknown	unknown	gnl|CDD|376324
NC_018524.1|WP_036567768.1|922030_922885_-|ABC-transporter-permease	unknown	unknown	gnl|CDD|225088
NC_018524.1|WP_014911712.1|924074_925187_-|peptide-chain-release-factor-2	unknown	unknown	gnl|CDD|234799
NC_018524.1|WP_014910097.1|917502_918519_+|winged-helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl|CDD|238042

rpsblast for functional proteins

Protein	Function_ID	Function_description	E-value
NC_018524.1|WP_014908299.1|937895_939569_-|glycoside-hydrolase-family-3-C-terminal-domain-containing-protein	gnl|CDD|366376	pfam00933, Glyco_hydro_3, Glycosyl hydrolase family 3 N terminal domain.	3.55379e-100
NC_018524.1|WP_014913126.1|931784_932639_-|helix-turn-helix-domain-containing-protein	gnl|CDD|379262	pfam13560, HTH_31, Helix-turn-helix domain. This domain is a helix-turn-helix domain that probably binds to DNA.	3.95165e-12
NC_018524.1|WP_014909538.1|930662_931409_-|haloacid-dehalogenase-like-hydrolase	gnl|CDD|319809	cd07506, HAD_like, uncharacterized family of the haloacid dehalogenase-like (HAD) hydrolase superfamily. The haloacid dehalogenase-like (HAD) hydrolases are a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members include 2-L-haloalkanoic acid dehalogenase (C-Cl bond hydrolysis), azetidine hydrolase (C-N bond hydrolysis); phosphonoacetaldehyde hydrolase (C-P bond hydrolysis), phosphoserine phosphatase and phosphomannomutase (CO-P bond hydrolysis), P-type ATPases (PO-P bond hydrolysis) and many others. Members are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	1.25667e-09
NC_018524.1|WP_014910653.1|934534_935056_+|GNAT-family-N-acetyltransferase	gnl|CDD|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	5.13192e-12
NC_018524.1|WP_014908761.1|915775_916108_-|helix-turn-helix-transcriptional-regulator	gnl|CDD|224609	COG1695, COG1695, Predicted transcriptional regulators [Transcription].	4.03303e-20
NC_018524.1|WP_014911802.1|940251_940488_-|PTS-transporter-subunit-EIIB	gnl|CDD|238130	cd00212, PTS_IIB_glc, PTS_IIB, PTS system, glucose/sucrose specific IIB subunit. The bacterial phosphoenolpyruvate: sugar phosphotransferase system (PTS) is a multi-protein system involved in the regulation of a variety of metabolic and transcriptional processes. This family is one of four structurally and functionally distinct group IIB PTS system cytoplasmic enzymes, necessary for the uptake of carbohydrates across the cytoplasmic membrane and their phosphorylation.	2.61216e-20
NC_018524.1|WP_014910518.1|937117_937774_-|HAD-family-phosphatase	gnl|CDD|319790	cd02603, HAD_sEH-N_like, N-terminal lipase phosphatase domain of human soluble epoxide hydrolase, Escherichia coli YihX/HAD4 alpha-D-glucose 1-phosphate phosphatase, and related domains, may be inactive. This family includes the N-terminal phosphatase domain of human soluble epoxide hydrolase (sEH). sEH is a bifunctional enzyme with two distinct enzyme activities, the C-terminal domain has epoxide hydrolysis activity and the N-terminal domain (Ntermphos), which belongs to this family, has lipid phosphatase activity. The latter prefers mono-phosphate esters, and lysophosphatidic acids (LPAs) are the best natural substrates found to date. In addition this family includes Gallus gallus sEH and Xenopus sEH which appears to lack phosphatase activity, and Escherichia coli YihX/HAD4 which selectively hydrolyzes alpha-Glucose-1-P, phosphatase, has significant phosphatase activity against pyridoxal phosphate, and has low beta phosphoglucomutase activity. This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	1.81698e-43
NC_018524.1|WP_014911332.1|921498_921963_-|SsrA-binding-protein-SmpB	gnl|CDD|376590	pfam01668, SmpB, SmpB protein.	5.85534e-90
NC_018524.1|WP_014911876.1|923028_923718_-|cell-division-ATP-binding-protein-FtsE	gnl|CDD|225438	COG2884, FtsE, Predicted ATPase involved in cell division [Cell division and chromosome partitioning].	4.32099e-125
NC_018524.1|WP_014912462.1|916264_917467_-|MFS-transporter	gnl|CDD|340863	cd06173, MFS_MefA_like, Macrolide efflux protein A and similar proteins of the Major Facilitator Superfamily of transporters. This family is composed of Streptococcus pyogenes macrolide efflux protein A (MefA) and similar transporters, many of which remain uncharacterized. Some members may be multidrug resistance (MDR) transporters, which are drug/H+ antiporters (DHAs) that mediate the efflux of a variety of drugs and toxic compounds, conferring resistance to these compounds. MefA confers resistance to 14-membered macrolides including erythromycin and to 15-membered macrolides. It functions as an efflux pump to regulate intracellular macrolide levels. The MefA-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	9.53152e-32
NC_018524.1|WP_014911896.1|919481_921461_-|cell-division-protein-FtsI	gnl|CDD|274573	TIGR03423, pbp2_mrdA, penicillin-binding protein 2. Members of this protein family are penicillin-binding protein 2 (PBP-2), a protein whose gene (designated pbpA or mrdA) generally is found next to the gene for RodA, a protein required for rod (bacillus) shape in many bacteria. PBP-2 acts as a transpeptidase for cell elongation (hence, rod-shape). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan].	1.11823e-41
NC_018524.1|WP_014909821.1|925301_930179_-|NAD-glutamate-dehydrogenase	gnl|CDD|377452	pfam05088, Bac_GDH, Bacterial NAD-glutamate dehydrogenase. This family consists of several bacterial proteins which are closely related to NAD-glutamate dehydrogenase found in Streptomyces clavuligerus. Glutamate dehydrogenases (GDHs) are a broadly distributed group of enzymes that catalyze the reversible oxidative deamination of glutamate to ketoglutarate and ammonia.	0
NC_018524.1|WP_148281681.1|935175_936279_-|cytochrome-P450	gnl|CDD|225035	COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism].	2.73374e-58
NC_018524.1|WP_014908355.1|933395_934427_+|methyltransferase-domain-containing-protein	gnl|CDD|275041	TIGR04188, conserved_hypothetical_protein, methyltransferase, ATP-grasp peptide maturase system. Members of this protein family are predicted SAM-dependent methyltransferases that regularly occur in the context of a putative peptide modification ATP-grasp enzyme (TIGR04187, related to enzymes of microviridin maturation) and a putative ribosomal peptide modification target (TIGR04186).	1.4405e-42
NC_018524.1|WP_014912279.1|939666_940155_-|PTS-glucose-transporter-subunit-IIA	gnl|CDD|376324	pfam00358, PTS_EIIA_1, phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 1.	1.50577e-37
NC_018524.1|WP_036567768.1|922030_922885_-|ABC-transporter-permease	gnl|CDD|225088	COG2177, FtsX, Cell division protein [Cell division and chromosome partitioning].	1.00786e-51
NC_018524.1|WP_014911712.1|924074_925187_-|peptide-chain-release-factor-2	gnl|CDD|234799	PRK00578, prfB, peptide chain release factor 2; Validated.	0
NC_018524.1|WP_014910097.1|917502_918519_+|winged-helix-turn-helix-transcriptional-regulator	gnl|CDD|238042	cd00090, HTH_ARSR, Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to dissociate from DNA in the presence of metal ions.	6.24913e-09

Protein sequences

>NC_018524.1|WP_014909538.1|930662_931409_-|haloacid-dehalogenase-like-hydrolase
MGSSPIPERRGAAISRLVLWNVDLTLLDVGQVMRAAYAEAFEKVTGEPLVYLTSSAGRTDSEMFFEFCARNYVDIEPDGEILSDFLATLEETFGRRADQIPAKGRVMPGAAASLAAVASMPDTVQTVVSGGTRANTTAKLVAFDLDRYLDLSMGGFGSVNYPKSSLIQSIRLHAAGEGGRVYGEEETVFITGSVPDVRAALLGGATPIAVLNDSATEGQLREAGAKIVLPELGDPRAVMTAVHQATPK
>NC_018524.1|WP_014909821.1|925301_930179_-|NAD-glutamate-dehydrogenase
MSGQSDVILQKLLSDAASRWNPGTRLSPEAADEVRRLLPLYYRHTDPEEISGRGPEQICGTAAAHLSFGTERAQGRAKVRVYTPDLERDGWEQQTSIVEIVTDNAPFLVSSVTMALAEMATGVRVVIHPQMTVGRDVTGRLREVDPEIGGDDLLPLDESWMHIEIDRQSDPERVKEITERLESVLGDVRQVDEDAAKMSDRIIRIADEVSAYSDRLVSGGVDPREIGESVEFLRWLSDRNFTFMGYREYALVTDENGDESLRPEPGTGLGILRMDSPASSGFAALPPEIRAKAREPYVLVLTKANSRATVHRPKYLDYVGVKKFDEQGNIVGERRFLGLFTSQAATTSIGHIPILRRKQAEVLAQAGFEADSYDGKDLIELLETFPREELLQIPVGELYNIVRGVLRLRERRGTKLFMRRDPYGGRYMSCFVYMPRDQYSTRVRLDIQNVLADAFRGATMDHNVMIGAAPLARLYLVARAQHGHTLADIDQVALEEKVRQAARSWDVDFDDALVEEFGPTRATTLKERYGAGLTEAYKVDNSPTTAARDIAGIEALIQRTSPDERAGEFTASLYLPEEGDDFSWRFRLARIGEPISLSRVLPVLEHLGVEVVDERPYSLDAEGVGRIWIYDFGLGPIPSSDLSPGRLRTLFEDAFDASWRDLGESDRFNALVVRAGLDWRQLTVLRAYAKYLRQAGSTFTPDYLADVLVANVGIANLLVELFEERFDPDRADEGRTERVEAVIGKIKGELEGVASLDHDRILRSFLAVINATLRTNHYQGGDEARPYLVLKLNPQEIPDLPNPRPRYEMYVYSPRVEGVHLRFGSVARGGLRWSDRFEDFRTEVLGLVKAQMVKNSVIVPSGAKGGFVCKRLPDGGREEVMAEVVSCYKQFISGLLDVTDNLVDGRIVHPERTVRHDADDSYLVVAADKGTATFSDIANGISNERGFWLGDAFASGGSVGYDHKGMGITARGAWESVTYHFREMGVNVQEQPFTTVGIGDMSGDVFGNGMLLSKQIKLIAAFDHRHVFVDPDPDPHTSWVERERMFRLPRSTWEDYSADLISEGGGVFPRTAKSIPVSPQMREALGIEADVTALTPDELIRRVLTSPVDLLWNGGIGTYVKASTQSHAEVGDKANDQVRVDASELRVKVVGEGGNLGLTQPARIEFAREGGRVNSDFIDNSAGVDTSDHEVNIKIMLDREVRAGKLDKADRDRLFIDMTDEVASLVLEDNYAQNTVLAAARKQAREMLHVHGRYMRHLERTKVLKRKQEDLPSDKTIAERRAAGKGLTGPEFATLLSYTKISLKEQIALSDLADDPYLASTLTDYFPTPLRSEEFAAEVASHPLRKEIIVNQVTNQMVNRSGITYAFRLNEELGSSAADIARAYLVVQEVLGLRDLWGEIEALDHRISVDSQLVLLLEIRKLAERSARWLLRNRTFPLDLGTEIGFFAQGVGEVLPQLVDLLRGRDREAFEERRDRYTEMGVPAALAERVAVMVPAYSTLDLVEIAHRTGSPVGRVAALYFELADRFNISWWRERIIDLPRDDRWVTTARSALRDDLYAAHADLTGRVLESGVDVSDDELIAGWSEQNETAVQRAGITLSEIQENERFDLATLSVALRSIRSLVG
>NC_018524.1|WP_014911712.1|924074_925187_-|peptide-chain-release-factor-2
MAELDPAEKIKELAATLASVTAVLDLEAMQTQIAELREQSADPELWADQDNAQKVTRRLSTLESMVNKVGGIGRRLDDLGVLYELAEAEDDPDTRAEADRELEQLRKEIGELEVRTLLNGPHDEREAIVTINSQAGGVDAADWAQMLQRMYLRWAERHGHPTEIYETSYAEEAGIKSTSFAVKSAFAYGTLRGEHGTHRLVRISPFDNQNRRQTSFAGVDVVPMVEQSDHIEIDETELRVDVYRSSGPGGQGVNTTDSAVRITHMPTGIVVSCQNERSQLQNKATAMSMLQAKLLARKRQEEQAALDELRGDSVSSWGTQMRNYVLHPYQSVKDVRTGMETGNTSGVLDGDIDGFIDAEIRWMRSRENNE
>NC_018524.1|WP_014911876.1|923028_923718_-|cell-division-ATP-binding-protein-FtsE
MIHFDNVTKQYLTQKRPALDGVSIDVDKGEFVFLVGPSGSGKSTFLRLVLKEEKPDKGRVHVAGKDLARLSNWKVPHLRRRIGCVFQDFRLLPNKNVFENVAFALEVIGKPRRFIKKVVPEVVELVGLEGKAGRMPGELSGGEQQRVAIARAFVNRPQILLADEPTGNIDPATSIGIMKVLDRINRTGTTVVMATHDAAIVDSMRKRVIELEEGLVVRDQTRGVYGQAY
>NC_018524.1|WP_036567768.1|922030_922885_-|ABC-transporter-permease
MTIAVITTVAISLALFGAGLLVNQQVSEMRNYWDQRITLTIYMCNEISPTAACQENGAATDEDRAALEQQLDSLSEVDSYRYLTAAEAWQDFQDRIGSSNEALAEAAQEGDIPDNYRVQLTDPDNYDAVRDAVDGADGVDSVSNDQRVLEQFFGLLDGLKWAALVVAGVQLAAAALLIGNTIRLSAYSRRRETGIMRLVGASNFYIQLPFLLEGAIAGFIGGVIASGFIVATRFTLLTRIEDWFQFDVALGTGALLYVIGVSVILGVLLCTVTSFLTLRRYLKV
>NC_018524.1|WP_014911332.1|921498_921963_-|SsrA-binding-protein-SmpB
MVKETGHKLIAQNRRARHDYHIDETYEAGLVLTGTEVKSLREGRASLVDGFAHIHDNEVWLEGVHIPEYSQGTWTNHSARRSRKLLLHREQISRLIGKTREPGRTLVPLSLYFSDGRAKVEIALARGKREYDKRHAIAEREAKRDMERALRRRR
>NC_018524.1|WP_014911896.1|919481_921461_-|cell-division-protein-FtsI
MSPRPLGRRIAAAGSGLFVALSLAACTTHPSPEVAVRSFLLSWQDGDHARAAGFTNGDQAEVESALADVHDQLDLASVRFDLGTITRDGDQALAEFEVSADLGIGDPVWNYTGRMPLTDGPQGWLIDWSSSVVHPDLDDGERLAVSYEIEERGQIFDRSGEPLVAADSVTAFGVLPAEMDDKEEGVTELAELLDEDPDPLLNRVRSAPPEQFQPLVLMRDSSVDGTLLSEAGKIAGVQTEEIEINLSPRVSPFLVGEVAGTAEHRVSSRVAGSYQAGDTVGLSGLQNLFQHELAGNATTQVVTLGEDGEQTAVLESWEGVRSGGIETTLDLNVQRAAESALEGMPGDGYLVAVDTASGEVLAAANASGQATDDAAFTGAYSPGGTFTMVSALAALESGAVTSDSPMPCDYQSEVGDRTFTNPSGGFLAGDPDLARNLAFLCTVGFVDVASEVGAEQIQDSAARLGLGADWQLPLPTSTGTVEVGSGDADAAAAMIGEDGVEVSPLGMALAAAAIADGSWNGPTLVREEGPSPATEGSLDEAHLEVIREGLREAVTNRFPEVGVGEEPVYGQAARAEQDDTSLHWFVGYQGDIAFAVLAEVDPEMTMWQQYAVTAATGFLNGVAHGVPETEETVEGQQQPPLGEAVNPDSLPGTEAGPDH
>NC_018524.1|WP_014910097.1|917502_918519_+|winged-helix-turn-helix-transcriptional-regulator
MDSGMFESMPGQVVFESTDLLRCRFATSPLWETLAALHTLFEPHRQNFHLPWVRSVRLPDGVDLSTVLLLFPRPGYVPDFLSPPPEGPLTSIEDELARVRATPVERVDDELRSCLLDPRRALPTSVTDPFLDDPEATRDSLADLLAICWDHLIRPHWPRIRALLDADISLRARTLAEKGLAALMTDLDGRLAWDGTTLNIAEPSAIDRVRLGDRGLLLMPSAFVWPDLVMISEEPWQPTLIYPVRGVGELWTAGDTPPRTLVPVLGRTRARLLAHLAVPETTGNVAARLGLSPATVSTGLTALRDAGLVEARRSGREVFYVRSPLGTALLGGAEREEA
>NC_018524.1|WP_014912462.1|916264_917467_-|MFS-transporter
MSESSFLGVSRVPEFRVLFVAEILSILSLVAVQITLSVLIFDRTGSPLLSSLAFALGFLPHLLGASLLSSAADRFPARTVMVATQLVSGAVMACMAIPGTPIPVMLMLLVVSGTVAPVYSGARSTALADVLTPEGFPLGRSLLRIAAQTAQIGGFSFGGALMLAASPPVALSIAAALMVFSALVVGLGTVRRPGREVSGGLVASSLSGTFRALRAPGLRAVLLLSWVPAALFVWPEALAAPLASSMGGGPMLVALLLTAGPVGTVVGEVAAGALLDAEGRRRWMLPLAFVAFLPMTLFVLEPGPAVAVAVLALGALGWGYTLALDALLLAEAPEETRGRVFSLGSAGLMISQGAGFALAGAMAEFLPAHLVVALAGVGGAVSVAVFGRRFVGRRGVRTAI
>NC_018524.1|WP_014908761.1|915775_916108_-|helix-turn-helix-transcriptional-regulator
MDRRSSWLKGVLDLLVLAALTEGESYGYALAARLDESGLGRIKGGTLYPVLNRLEEAGLVVAEFRAAEKGPGRRYYRLTDQGREVLREQGTAWMEFDGSVREVLRKGGVS
>NC_018524.1|WP_014913126.1|931784_932639_-|helix-turn-helix-domain-containing-protein
MAGGHSPGVRRRRLSAALRKLREEKGMSAAAVAERLEWSTGKLTRSERNEWKFPKRTDVEALLDLYEVEGEGRAHLLSLTEESRGRSDWHQYADLFPGALPDLEAEAVRIRSYESLLIPGLLQTPAYATAIFESSQVVPPEDTQRKVDSRMARRGVLDAPGGPQFICVIDEAALRRVVGSRKVMTEQLRFLIGMAAHYKVTILVLPFEAGAHTAMDGAFALLEFPSPEPGIVSISTGVESLYVEDEAYVDRHRLIFDAVHNLALDPKKSLDLIESIAADYDKRA
>NC_018524.1|WP_014908268.1|932812_933130_+|hypothetical-protein
MASTITSESDLYTEVIQIIRGGEPDDEGIPLAGRISPLAPSLNTRTCACSSVLFGFGFWEALERLNPYRKDSDIWMRVFAEGDDEGDLPEGAQLIETRRVSYRVR
>NC_018524.1|WP_014908355.1|933395_934427_+|methyltransferase-domain-containing-protein
MNMDDLHARLVERLDPDLVWPDIQGLPLIRSADPERWAAYVYDDDAVVTQANDGGSGAINHPSSSSSAPQVMADMIAAARIEPGMRVLEIGTGTGWNAAILTSLVGPTGSVTSLEIDPKVARHARDRLSGAAVRVVEGATPPEGVYDAVIATCSAHRVPDDWTRHLDEEGLLVLPWAPYEAGGPTPVAALAGGRSGSFVRDGSFMRDRGQRVPRQRFPGMDREVERKGTLPYGSQDLLDQDLLTRLVLAAPELMVSVGVRPWTEGTAPIVALSAEDSWAYIWPDGSTTGGGPRDLPRELDRAYSELDGAGRPELSEFTLEVSPDHRTHTVRSGPLGPWQHRLR
>NC_018524.1|WP_014910653.1|934534_935056_+|GNAT-family-N-acetyltransferase
MAGRPRIRERTDEDLDELGTILTRVHAEDGYPVEGVASPRAWLTDPGFLRSWVAERDGVLLGQVSLADPEGAETIALWRERTERDIDEVAVLARLFVSPEARGLGTGEALTRAVMEHAREHDTALVLDVMAKDRAAIRLYERLGWERLGDIVHAFDGYPGAPAHCYAWTSSTT
>NC_018524.1|WP_148281681.1|935175_936279_-|cytochrome-P450
MDPAGGDLQAEAAELRQVGPAVRAVLPGGVVAWSVTRYESIKELVSDPRVSRDFRAHWPDRDRVPDGWTLGALTFMEGFLNRYGEEHRCLRRMVSPAFTPKRVRALEETVRDRARVLIAEMARSAPGDVVDLRSSFSWPLTMWVICELLGVPDERREALGAAVDALLDTSAAPERALETRGHIYRLLAELAEYKREHPAPDLTGDLTAYEGRGELSSEELVGTLLLMIGAGFETAVNLITSSVHSLLTHPEHRERLVRGELSAEEVVEESLRRDPPVMHLPMRYAVEDIDLGEGALIRSGEAILVGFGAHFCVGAHLARLEGRVALEELFATLPDLEPAAPGAEPPRIPSIIVNGAAELPVIPHPAT
>NC_018524.1|WP_014909603.1|936577_937036_-|hypothetical-protein
MYVFLPSTVPALATLLDEGRLEGTPLTAFTADAGPDGDSEEAEYAAMYAAAEASLRMLAADPAAPRRRVVLAAEMPDRAIEHEARHGADVARVLLQGAVPYKRLKSVHVDDPDVAEDIAEAAADPDSDAAEDHELMWFAVQEARHLVDEATA
>NC_018524.1|WP_014910518.1|937117_937774_-|HAD-family-phosphatase
MNGTRRGVISDWGGVLTPPLLDGIRAWLDADRIDADHYYEVMRPYFEGTLPDNPVHSLERGEIDTAEFERDLAALLRSTHGGPVRAEGLIHRMFSRFEPVHDMYETLRAARRSGAGTALLSNSWGNGYPREHFATTFDTVVISGEVGMRKPEERIYLHTCERMGLAPEDCVFIDDLEHNIETAEALGMTGILHTDVESTRRALARFLASEDETEHQPA
>NC_018524.1|WP_014908299.1|937895_939569_-|glycoside-hydrolase-family-3-C-terminal-domain-containing-protein
MKPRALVPVCAGLALMISACTTTPEEVGSSPEDNEQNPGASAEPFEPVLAPRLLAEMDLDDKIGQLLVLSAQGTTAEENASLIETHHPGGLIYFDANLDDAEQIARMSAGVQEIAAEQGQGVPLFLGIDQEQGRVVRMPVGTLFPDAMAVGATGDTELAALRAATTANELTAVGINLNYAPDADVNTDPNNPVIGIRSFGSDPDAVAEMVLAEADAYAENGVVPVAKHFPGHGDTDVDSHSGLPVIDLPRDRWEAEHLPPFRAAVEAGIDSIMTAHVLMPGLESDEDPDPATLSPTLIDGILRDELGYDGVVTTDALNMDGVRQRHSDGEVAVRVIEAGVDQLLMPPNPEEAVAAIHEAVESGRIDEERIDRSVLRILTLKEKRGILEAEPIDPAAATSAMEDPDHAEAAQRVADASVTLLRNENDLLPLAAGTDVRVTGTGADRIAPALADAGMNVVESGEAVLVVGTSGARSSEEQRSLVASGRAQGTPVVVVSQDGPYDLEAFPDVDGYLALYSAVEVSRVAAARVISGQVEPTGTLPVDIPAVDMGIGTGLRY
>NC_018524.1|WP_014912279.1|939666_940155_-|PTS-glucose-transporter-subunit-IIA
MSDVNGALRVLSPVTGTAMSLETVPDPVFSQSMVGPGLAVHPEPGQEGGQESRQTAVAPITGTLVKLHPHAFVVMAPDARRGVLVHLGIDTVQLAGEGFTLLAEEGTEVVAGAPVIEWSPGSVASLGKPSVVPVVALDASADTLSEHVDGAVTSGEDLFVWT
>NC_018524.1|WP_014911802.1|940251_940488_-|PTS-transporter-subunit-EIIB
MADKAEAIVAGLGGAANIEDIEACITRLRTEVADPGLVRENDLKAAGAHGVLVSGNVVQVVVGPEADSLTDEIQDLLE

Crispr_ID: NC_018524_8

• CRISPR_ID: NC_018524_8
• CRISPR_location: 1015401-1015496
• CRISPR_type: Orphan
• Repeat_type: NA
• Spacer_info: 1 spacers

Consensus repeat of NC_018524_8

Consensus_repeat	Method
CGGTCTCCTACCTCGACCACGGGG	CRISPRCasFinder

spacers of NC_018524_8

>8.1|1015425|48|NC_018524|CRISPRCasFinder
TGAAGGTGCGAACCTCCACCTTCACCCCCAGGGGTGTGACCCACCGCT

CRISPR arrays and Neighbor proteins around NC_018524_8

CRISPR arrays

The CRISPR arrays of NC_018524_8

>merge|NC_018524|8|1015401-1015496|CRISPRCasFinder
CGGTCTCCTACCTCGACCACGGGGTGAAGGTGCGAACCTCCACCTTCACCCCCAGGGGTGTGACCCACCGCTCGGTCTCCTACCTCGCCACGGGGG

>NC_018524|8|8|1015401-1015496|CRISPRCasFinder
CGGTCTCCTACCTCGACCACGGGG	TGAAGGTGCGAACCTCCACCTTCACCCCCAGGGGTGTGACCCACCGCT
CGGTCTCCTACCTCGCCACGGGGG

Neighbor Proteins Overview

Protein	Signature genes	Signature genes Name	Protein_function
NC_018524.1|WP_014910402.1|1006480_1007287_+|histidinol-phosphatase	unknown	unknown	gnl|CDD|273949
NC_018524.1|WP_014909213.1|1020114_1020675_+|NUDIX-domain-containing-protein	unknown	unknown	gnl|CDD|239646
NC_018524.1|WP_014913569.1|1008071_1009325_+|ABC-transporter-permease	unknown	unknown	gnl|CDD|223650
NC_018524.1|WP_017533487.1|1021908_1022067_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014913474.1|1005694_1006285_-|TetR-family-transcriptional-regulator	unknown	unknown	gnl|CDD|375982
NC_018524.1|WP_014912314.1|1010365_1011085_+|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl|CDD|213222
NC_018524.1|WP_014910152.1|1004499_1005525_+|ribosome-small-subunit-dependent-GTPase-A	unknown	unknown	gnl|CDD|206747
NC_018524.1|WP_014908245.1|1021066_1021630_-|M48-family-metallopeptidase	unknown	unknown	gnl|CDD|320703
NC_018524.1|WP_014913328.1|1014911_1015394_+|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014910848.1|1003168_1004503_+|3-phosphoshikimate-1-carboxyvinyltransferase	unknown	unknown	gnl|CDD|235037
NC_018524.1|WP_014912586.1|1009333_1010365_+|secretion-protein-HlyD	unknown	unknown	gnl|CDD|273776
NC_018524.1|WP_014909203.1|1011666_1014594_-|UPF0182-family-protein	unknown	unknown	gnl|CDD|377101
NC_018524.1|WP_014913512.1|1017481_1018549_-|NAD-dependent-epimerase/dehydratase-family-protein	unknown	unknown	gnl|CDD|187551
NC_018524.1|WP_026124809.1|1015782_1016850_-|hypothetical-protein	unknown	unknown	gnl|CDD|226011
NC_018524.1|WP_014912705.1|1020684_1021047_+|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014908295.1|1016953_1017391_-|molybdenum-cofactor-biosynthesis-protein-MoaE	unknown	unknown	gnl|CDD|238385
NC_018524.1|WP_014909219.1|1022114_1022393_-|WhiB-family-transcriptional-regulator	unknown	unknown	gnl|CDD|376791
NC_018524.1|WP_014912046.1|1018672_1020118_+|zinc-dependent-metalloprotease	unknown	unknown	gnl|CDD|378392
NC_018524.1|WP_036567764.1|1022592_1022946_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014908261.1|1007339_1007876_+|hypothetical-protein	unknown	unknown	unknown

rpsblast for functional proteins

Protein	Function_ID	Function_description	E-value
NC_018524.1|WP_014910402.1|1006480_1007287_+|histidinol-phosphatase	gnl|CDD|273949	TIGR02067, his_9_HisN, histidinol-phosphatase, inositol monophosphatase family. This subfamily belongs to the inositol monophosphatase family (pfam00459). The members of this family consist of no more than one per species and are found only in species in which histidine is synthesized de novo but no histidinol phosphatase can be found in either of the two described families (TIGR01261, TIGR01856). In at least one species, the member of this family is found near known histidine biosynthesis genes. The role as histidinol-phosphatase wsa first proven in Corynebacterium glutamicum. [Amino acid biosynthesis, Histidine family].	3.97759e-96
NC_018524.1|WP_014913569.1|1008071_1009325_+|ABC-transporter-permease	gnl|CDD|223650	COG0577, SalY, ABC-type antimicrobial peptide transport system, permease component [Defense mechanisms].	6.47574e-19
NC_018524.1|WP_014913474.1|1005694_1006285_-|TetR-family-transcriptional-regulator	gnl|CDD|375982	pfam18556, TetR_C_35, Bacterial Tetracyclin repressor, C-terminal domain. This is the C-terminal tetracyclin repressor domain found in bacteria. Family members include TetR family transcriptional regulators Rv3249c and Rv1816 found in Mycobacterium tuberculosis. Palmitic acid (a fatty acid) and isopropyl laurate (a fatty acid ester), were identified as binding ligands to Rv3249c and Rv1816 respectively. Similar to other TetR family regulators, these proteins are alpha-helical dimeric proteins consisting of a smaller N-terminal DNA-binding domain and a larger C-terminal regulatory domain.	6.22429e-17
NC_018524.1|WP_014912314.1|1010365_1011085_+|ABC-transporter-ATP-binding-protein	gnl|CDD|213222	cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein. This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of lipoproteins from the cytoplasmic membrane (LolCDE). They are clustered together phylogenetically. MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all. An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport. The LolCDE complex catalyzes the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane.	8.40047e-104
NC_018524.1|WP_014910152.1|1004499_1005525_+|ribosome-small-subunit-dependent-GTPase-A	gnl|CDD|206747	cd01854, YjeQ_EngC, Ribosomal interacting GTPase YjeQ/EngC, a circularly permuted subfamily of the Ras GTPases. YjeQ (YloQ in Bacillus subtilis) is a ribosomal small subunit-dependent GTPase; hence also known as RsgA. YjeQ is a late-stage ribosomal biogenesis factor involved in the 30S subunit maturation, and it represents a protein family whose members are broadly conserved in bacteria and have been shown to be essential to the growth of E. coli and B. subtilis. Proteins of the YjeQ family contain all sequence motifs typical of the vast class of P-loop-containing GTPases, but show a circular permutation, with a G4-G1-G3 pattern of motifs as opposed to the regular G1-G3-G4 pattern seen in most GTPases. All YjeQ family proteins display a unique domain architecture, which includes an N-terminal OB-fold RNA-binding domain, the central permuted GTPase domain, and a zinc knuckle-like C-terminal cysteine domain.	1.93752e-93
NC_018524.1|WP_014908245.1|1021066_1021630_-|M48-family-metallopeptidase	gnl|CDD|320703	cd07344, M48_yhfN_like, Peptidase M48 YhfN-like, a novel minigluzincin. M48 YhfN-like protease is considered as a CaaX prenyl protease 1 homolog, with most of the sequences in this family as yet uncharacterized. It contains the zinc metalloprotease motif (HEXXH), likely exposed on the cytoplasmic side. It is probably associated with the endoplasmic reticulum (ER), regardless of whether its genes possess the conventional signal motif (KKXX) in the C-terminal. Proteins in this family proteolytically remove the C-terminal three residues of farnesylated proteins. This novel family of related proteins consist of the soluble minimal scaffold similar to the catalytic domains of the integral-membrane metallopeptidase M48 and M56, thus called minigluzincins.	2.11292e-26
NC_018524.1|WP_014909213.1|1020114_1020675_+|NUDIX-domain-containing-protein	gnl|CDD|239646	cd03674, Nudix_Hydrolase_1, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity. They also contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, U=I, L or V), which forms a structural motif that functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.	1.82169e-35
NC_018524.1|WP_014910848.1|1003168_1004503_+|3-phosphoshikimate-1-carboxyvinyltransferase	gnl|CDD|235037	PRK02427, PRK02427, 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional.	2.10645e-167
NC_018524.1|WP_014912586.1|1009333_1010365_+|secretion-protein-HlyD	gnl|CDD|273776	TIGR01730, COG0845:_Membrane-fusion_protein, RND family efflux transporter, MFP subunit. This model represents the MFP (membrane fusion protein) component of the RND family of transporters. RND refers to Resistance, Nodulation, and cell Division. It is, in part, a subfamily of pfam00529 (Pfam release 7.5) but hits substantial numbers of proteins missed by that model. The related HlyD secretion protein, for which pfam00529 is named, is outside the scope of this model. Attributed functions imply outward transport. These functions include nodulation, acriflavin resistance, heavy metal efflux, and multidrug resistance proteins. Most members of this family are found in Gram-negative bacteria. The proposed function of MFP proteins is to bring the inner and outer membranes together and enable transport to the outside of the outer membrane. Note, however, that a few members of this family are found in Gram-positive bacteria, where there is no outer membrane. [Transport and binding proteins, Unknown substrate].	8.13334e-10
NC_018524.1|WP_014909203.1|1011666_1014594_-|UPF0182-family-protein	gnl|CDD|377101	pfam03699, UPF0182, Uncharacterized protein family (UPF0182). This family contains uncharacterized integral membrane proteins.	0
NC_018524.1|WP_014913512.1|1017481_1018549_-|NAD-dependent-epimerase/dehydratase-family-protein	gnl|CDD|187551	cd05240, UDP_G4E_3_SDR_e, UDP-glucose 4 epimerase (G4E), subgroup 3, extended (e) SDRs. Members of this bacterial subgroup are identified as possible sugar epimerases, such as UDP-glucose 4 epimerase. However, while the NAD(P)-binding motif is fairly well conserved, not all members retain the canonical active site tetrad of the extended SDRs. UDP-glucose 4 epimerase (aka UDP-galactose-4-epimerase), is a homodimeric extended SDR. It catalyzes the NAD-dependent conversion of UDP-galactose to UDP-glucose, the final step in Leloir galactose synthesis. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	1.40932e-55
NC_018524.1|WP_026124809.1|1015782_1016850_-|hypothetical-protein	gnl|CDD|226011	COG3480, SdrC, Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms].	2.40879e-63
NC_018524.1|WP_014908295.1|1016953_1017391_-|molybdenum-cofactor-biosynthesis-protein-MoaE	gnl|CDD|238385	cd00756, MoaE, MoaE family. Members of this family are involved in biosynthesis of the molybdenum cofactor (Moco), an essential cofactor for a diverse group of redox enzymes. Moco biosynthesis is an evolutionarily conserved pathway present in eubacteria, archaea and eukaryotes. Moco contains a tricyclic pyranopterin, termed molybdopterin (MPT), which carries the cis-dithiolene group responsible for molybdenum ligation. This dithiolene group is generated by MPT synthase in the second major step in Moco biosynthesis. MPT synthase is a heterotetramer consisting of two large (MoaE) and two small (MoaD) subunits.	7.41205e-44
NC_018524.1|WP_014909219.1|1022114_1022393_-|WhiB-family-transcriptional-regulator	gnl|CDD|376791	pfam02467, Whib, Transcription factor WhiB. WhiB is a putative transcription factor in Actinobacteria, required for differentiation and sporulation.	5.08361e-15
NC_018524.1|WP_014912046.1|1018672_1020118_+|zinc-dependent-metalloprotease	gnl|CDD|378392	pfam10103, Zincin_2, Zincin-like metallopeptidase. This family of proteins has a conserved HEXXH motif, suggesting they are putative peptidases of zincin fold. The structure of this family has similarity to Peptidase_M1 (pfam01433, Structure 3CMN).	1.72226e-155

Protein sequences

>NC_018524.1|WP_014913328.1|1014911_1015394_+|hypothetical-protein
MDLERHAAEQGWDRPLGLYALVPTSELLTAEPALAGLLGIDSPADPDELTPVEQEELPGDVPLEEALGRILWPEGVAGCALVMERLVVKGSDETLAAGEDPALSGKETEEIRMVAGVLRDGSRHCAMRMRSHDSESEVLNGPDLIPALTSALALTLDLEE
>NC_018524.1|WP_014909203.1|1011666_1014594_-|UPF0182-family-protein
MVVIIAGLMLAANFWTDYKWFNAIGYTSVFLTELWTRVLLFAVAALVMAVIVGASIFFAYRARPGIRPMSLEQQGLDRYRQSIDPHRKLFFWIAVGALALLSGAAASGDWRVYLQFVNSVDFGVNDPEFGIDIAFFAFTYPFLRILLGYMYAAVILAFIAAVIVHYLYGGVRLQNDSGQRATPAARVHLSVLLGLFVLLRAGSYWLDRYGLVFSNRGYTFGASYTDVNAVKTALTILTVISVICALLFFANIVFKNTMIPVASLGLLVLSAVVVGVAYPEIVQRFQVDPNEQRLESPYIERNIESTREAYGIADTEVIDYDATTELTPQELAAEADTIPSVRLADPAVVSQTFQQMQQVRGFYQFPDVLEVDRYPDADGNLIDTIVAVRELDGPPADQDNWLNRHLIYTHGYGMVAAAGNLIDNEGRPVFTEYNIPPRGELSDVVGEYEPRIYYGREGADYVIVQAEEEYDHPLDPEAEEPDVPTLEDAVESSPSPDSDEARAPADGADESQDADAEATEEGEDGDTASGSQAYNRYDGDGGVPLNNFFDRILFAIKYQETSILLNSAITSDSRILYERDPLDRVEKVAPFLTVDSRPYPAVVEGRVVWIVDGYTTSDGYPYANRIDFTQAVTDTFTDGSAQQVGALPGNEVNYIRNSVKATVDAYDGTVTLYGWDENDPVLQTWQGAFPGTIVDRDEMSDELVQHLRYPDDLFKVQREIMREYHVTDAASYYGGQDFWTVPNDPTQEGEVSEPPYRQTINFPGAEEPSFSLTTTFVPRNRENLAAFMAVDSNPESDEYGKLKLLELPRSTVIFGPGQVQNAFDSDADVREVLLPLEQSNAEVTRGNLLTLPFAGGLLYVEPLYVQAGGGGAASFPLLQQVMVGFGEEVAIGSNLQDALNNLFEGGEGPLPDPDEGSEESTGDDETSEAGSEPSDLTDALNEAVEAWEEAQNANEEANERLRDALEALEEAAGEN
>NC_018524.1|WP_014912314.1|1010365_1011085_+|ABC-transporter-ATP-binding-protein
MSFEAPHLLPTPVRSPASPLLRVEGLTRHFMVSGERIDVLHDCTFDVARGEVVAIIGQSGSGKSTLLNVLGLLDRPSGGSYVFDGVDTTGLREGSRSRLRGDGIGFVFQQFHLLERRTALSNVGVPMVLSGVPLLRRRARAKELLESVGLGHRLHSQPHQLSGGEQQRVALARALSRDPALILADEPTGALDAASSTMIMDQLIEQARDHDAAVVVVTHDPKVAERADRIVELVEGRTR
>NC_018524.1|WP_014912586.1|1009333_1010365_+|secretion-protein-HlyD
MKKWIIVGAVTVLLLGLVGSGYLLLSRSGADPSDEDFIGTASDVSGEPVEVELGTVSSVLVLDAIVRAESGEKVRARQGGTVTHLWLNDGASVDKGAPVVNVSLPAEGGAVEGEDGEEDAPATREVTLYAPASGTLSGLDDVLVGDVLEPGATVATVSSGKFQAVAQVPANDLYRFYDDPGEIMLKIDKGPPAAECEFIGLGAGNDSSSEGDDETGGGEGGGSELSCRVPSDLTVFDGVQGKLSVSTGEAENVIVIPVTAVRGNSESGEVIVIGDDGSEEVREISLGLSDGNFLEVTEGLSVGEKVMDPIPLDPRFDIPEEPMDEFDEEFDEDFEDPEIAEES
>NC_018524.1|WP_014913569.1|1008071_1009325_+|ABC-transporter-permease
MLRSLTAGILLAFAGSRANVARTILSCAGIVVGVGALIIVVTAGDLGQRYATAESEANAGRAATMQVTSFSAVTDMAAYEEDIARAGAEKVSLSQMPAQSAVFRNGDETLDYVDLTAVDVSMAEIRRINILQGRWFTEADLGSQAPVLVVNQALGDIIGDSTEIQMGTDRWIDVRVVGVSQGSAFDGDWYSAYLLRSPITEEMIFGPTWDAEAGGMSPGESELGVTHVALLDPADSAAEDMDNGEEFTERLSSAKWRWSADGRPDLMIYRADYAEQTQELIDIMSWGLIGIAAITLTTGLLGVLNVGLVTVRERRRELATYRALGASRFTLFVAVVMEAVVVAVVAGLIALLLSFALVAVAGAVIGNFVALPPDIAMVVPPSAVLVGLGSAAFVGLLAGIIPAIRALRASVVAGLRE
>NC_018524.1|WP_014908261.1|1007339_1007876_+|hypothetical-protein
MRCVLTTTTRLPRTVVLCGAALLLATTACAEGHGKSPMELSEMIAESVRDSADTRMPGLGVAEAHFEPDGFSCDPAVDPEVPGLWRSHAPRETVMDEASVELGLIDADHERSGTVFATVTDPEGGTATAEAELASDEWTGLVYPDDFDAAPLRTGVYTVIWSDAAEGARITCDGFEVD
>NC_018524.1|WP_014910402.1|1006480_1007287_+|histidinol-phosphatase
MGSFDDDLRLAHVLADAADDIALKRFRSLDLVVDTKPDLTPVTEADRMVEETLRGVLSRARPRDAVVGEEYGKSGNSNRVWVIDPIDGTKNYVRGVPVWATLIALLEGDRPVVGLVSAPALHRRWWASQGGGTWAGRNLSKASRCQVSQVTELSDASLSFSSLTGWEEQGRLESFLGLTRSVWRTRAYGDFWSHVMVAEGVVDIAAEPELSLWDAAPLPIILEEAGGRASALRGQGFEDGGPLVCTNGALHEQTLTWLNGGPTPLRRP
>NC_018524.1|WP_014913474.1|1005694_1006285_-|TetR-family-transcriptional-regulator
MGTVSGDGRAGAGVGARERLLDAAYTEVLAGHWGGRRMVDIARAARVSRQTLYNVFGSKEGLLQAVVVREVNALMDTVERVLEADGHDPAHAVGRTIRMVLLGARDNPLLRAVVTGDDELLPVLTTRSEPLLDALGERIHRTLREHCPNADPGVAETVADVTLRLLVSYSLQPIDPDLAARRVEMVVHGILLPVDR
>NC_018524.1|WP_014910152.1|1004499_1005525_+|ribosome-small-subunit-dependent-GTPase-A
MSRTRGGGRHLDEDDIRVRARGGSRPRTRKRPKHEDAREGLVTAVDRGRYRCLVDGVPVVAMKARELGRGSIVVGDRVDVVGDLSGRPDTLARVVRVRERASVLRRTADDTDPVERVIVANADQLAIVCALADPAPQPRFVDRCLVAAYAAGLEPLLCLTKADLASPDEMLAIYRPLGLPYEVLEPDEGLEELRSRLAGRTTVFVGSSGVGKSTLVNRLVPGTDRAVGHVNAVTGRGRHTSTSALALEFEGGWLIDTPGVRSFGLAHIGPEEIVRGFHDLDEFAADCPPDCTHQADAPDCAIGAALDRGEADPDRVASLRRLLSSREGEDDSEPAPQSPTP
>NC_018524.1|WP_014910848.1|1003168_1004503_+|3-phosphoshikimate-1-carboxyvinyltransferase
MPDSVPTPPRPTDVPAGEHWPAPLADSPVRARVRLPGSKSVTNRALIIAALAEGPCAVRRPLVSRDSELMVGALRALGTRVEEVPSDDPDTPDLVVTPAPLRGPASIDVGNAGTVMRFVPPVAALADGRVDFDGDPRARERPVDELLRALRALGARIDDEDRGALPLTIHGTGSVRGGEVTLDASGSSQFVSALLLAGARFDEGVHVRHEGPPVPSQPHLDMTVEMLRAAGAAVTTGENSWRVEPGPLRVSEIAVEPDLSNAAPFLAAALVSKGEVTVEGWPEHTTQPGDVLRELFTRMGGEVSRSGDRGENLTLRGTGAIHGITADLRDVGELTPTIAAVAALADSPSRLTGIAHLRRHETDRIAALAAEINRLGGDVEELADGLVIRPRPLHGGVFHSYDDHRMATSGAVIGLAVPGVEVENIATTRKTMPDFPGLWAEVLS
>NC_018524.1|WP_026124809.1|1015782_1016850_-|hypothetical-protein
MTLVAALALLVGLGYGSLLLPMPYLVAAPGVTLDTLGEQDDGEPIIGVDGAESYEHDGSLSMVTVQYAGGPDHRLNLFTLVSAWISPSQAVLPEELLFPAGRSPEEVSQRQTVQMNDSQTDATAAALNQLDIDYEAIPLVADAVEGMPAEGVVEPGDRILEVDGETVPTSTSGGDPEELVGSAYVVEHVGAREPGDPVSLLLDRDGDELEVELDTVEGDGDTAAVGILIADDMDFPVDIDISVGEIGGPSAGMMFALGIIDRLSEEGLTGGAHVAGSGTITSDGTVGGISGIPQKMVSAKRDGAEYFLVAADSCSQVAQSAAYGELEVVRVETLTDAVNALETIRDGGDDLPRCE
>NC_018524.1|WP_014908295.1|1016953_1017391_-|molybdenum-cofactor-biosynthesis-protein-MoaE
MEEITLAVVRDTPLSVDEVLAAVAHPRAGGTAVFIGTVRDHDHGRDVSALSYSAHPTVEARLREVMEKVLSDTSVAGRPVVRMAAAHRVGDLRIGDLAVVVAAAAEHREEAFAACRRLIDDLKAQVPIWKNQAFEDGATEWVGSP
>NC_018524.1|WP_014913512.1|1017481_1018549_-|NAD-dependent-epimerase/dehydratase-family-protein
MVGVTGAASGMGRLLVQRLATPEGSIRAREVIAIDGEFADLRDVTWRIADVCDPALVWRLDGIDVLVHTADDRSLETRPARRRRHNILAAQTVLTAAAAAGVPRVVLVTSTMVYGAAPDNPVPLPENSTRVSDNGEGLMGDFAEVEELAERARRAHPGLTVTVVRPAPLVGPDLDTLLSRHFSAPRLLTVKGHEQHWQFCHQDDLTSALAFCALHGVTGSDGVVAVAAEGSLSQSEVEEIAGMKHFEVAANLAFGAVRRLHQARITPAAAGEIKFLVYPCVVDCASLREAGWKPEHDNESALGVLLESRDGKHAIAGRTLGRKEVTITAAGAAGAAAAAIGTAAAIRHLRKRGRS
>NC_018524.1|WP_014912046.1|1018672_1020118_+|zinc-dependent-metalloprotease
MSDLPFGFSMPNDPDDESGRRSGDSGSGAGSGRPGGGDSGTPDGFPFGDPQQMADMLRRFADMMSSQPSPGSPGESATSSTSGINWDMAKNIARHAVSQQGDPSVPPADYARVEEALRLADLWLDQATDLPSGVQTAQAWSRSEWIERTMDAWAQLCDPLTAKTVQAMGQNLPEEMSTMAGPLLGMIQQMGGMMVGQQAGQAIGGLAQEVIGTADIGLPLAGEGNAALLPSGVARFSEGLEIPDDEVRLYLAAREAAVHRLYSHVPWLRSHVSRLVEEYAAGMSFDVSGLEDRLGEIDLTNPEALQEVMSGGMGAEGLLQPEDTPQQKAALTRLETTLALIEGWVATVVSAAVAERLPHAGALAETTRRRRATGGPAEHTFAALVGLELRPRRLREAGALWKALEEARGVEGRDAVWQHPDLMPTGADLDDPEAFVAGGSDEGPDFDISSLTGPEGPSDSGADEDDRGDDGRKDDRGEGGA
>NC_018524.1|WP_014909213.1|1020114_1020675_+|NUDIX-domain-containing-protein
MSLREDARAVLTAWAAPDPGQEALRVSYLEHLDAHEDAMWRDCLPGHLTASTAIISADGDRVALVLHRIHRMWLQTGGHCESDDATLAEAALREAAEESGIVGLTLLPAPVRLDRHTVPCGGGSVHLDVQFAAVAPDDAVLVRDPDESAGLGWFPIDSPPEPTDDSVRDLVRAAVVAVRDHGPVRP
>NC_018524.1|WP_014912705.1|1020684_1021047_+|hypothetical-protein
MSLITVVVMVGGLVTTWLVRRSRRALARLLLDERAGRVGAAEAARLRFEHVRRSFLVGRAACGLLAVLIVAVVGRAAVSGSWGAATGYYVAAFGALLLAGLVMLWRVHTDLRRSRAALEG
>NC_018524.1|WP_014908245.1|1021066_1021630_-|M48-family-metallopeptidase
MPSNTRIEVRRSPRRRRTVSAYRDGDTTVVLVPATFSRAEEKRWVDQMLRRLEAREDRRRPGDGELHERAVELARRHLDGTRLPASVRWVDNQNSRWGSCTPETGDIRISRRIAGMPSWVVDYVLVHELAHLHHPNHGREFWELVRRYPKADRARGYLEGYSAGSRSEGCVHDDEDDLETGRNTLEG
>NC_018524.1|WP_017533487.1|1021908_1022067_-|hypothetical-protein
MMQELMRMVERTEEEPRERLARRLGARHLRARQREERRAEEAIMEIAWSRLC
>NC_018524.1|WP_014909219.1|1022114_1022393_-|WhiB-family-transcriptional-regulator
MLASVLVTPQLGEVEIPCRLEPDLFFAEAPADVEAAKAICGDCPIREQCLTDALERREPWGVWGGQLLVSGQVVARKRPRGRPRKNPAPVAA
>NC_018524.1|WP_036567764.1|1022592_1022946_-|hypothetical-protein
MSTKNEQCTGFAATWRSPMTHLIEGTDLSGGAFEGAFTGIRMRTFGGESVIGVRLANGSQPAPQGTRVSETGAVMALLRDESELALDRGEHTGDVHASSETPRLYGALGECPRRIPA

Crispr_ID: NC_018524_9

• CRISPR_ID: NC_018524_9
• CRISPR_location: 1460036-1460675
• CRISPR_type: Orphan
• Repeat_type: I-E
• Spacer_info: 10 spacers

Consensus repeat of NC_018524_9

Consensus_repeat	Method
GGGTCCATCCCCGCGTGCGCGGGGAGCAG	CRISPRCasFinder
GGGTCCATCCCCGCGTGCGCGGGGAGCAG	CRT
GGGTCCATCCCCGCGTGCGCGGGGAGCAG	PILER-CR

spacers of NC_018524_9

>9.1|1460065|32|NC_018524|CRISPRCasFinder,CRT
ACCGGGTGGCATCGCACGGCCGCTCAGGTCGT
>9.2|1460126|32|NC_018524|CRISPRCasFinder,CRT
GGTCGATTCGTCTGACCTGTGACGAGGCCCGG
>9.3|1460187|32|NC_018524|CRISPRCasFinder,CRT
ACGATCAGGCCCTTTCAGGGTTCGGGTCGGTG
>9.4|1460248|32|NC_018524|CRISPRCasFinder,CRT
AGGTCCCGCAGGTGACCGGTTGTGACTGCCGT
>9.5|1460309|32|NC_018524|CRISPRCasFinder,CRT
TGCGGAGCGGTCTCACGGATGTAGTCCATGAA
>9.6|1460370|32|NC_018524|CRISPRCasFinder,CRT
CTCACCACTCGCGGTAAGCCGGTCCGGGTGCC
>9.7|1460431|33|NC_018524|CRISPRCasFinder,CRT
GCACAGGCCGATTCCGGCGTTCGCCGAGTTCTG
>9.8|1460493|32|NC_018524|CRISPRCasFinder,CRT
CGGTGGTAGTCGACCACCTGCGCCGTAGACGC
>9.9|1460554|32|NC_018524|CRISPRCasFinder,CRT
CTACCGCGGGTGATCAAGGACAAGATCGTGGA
>9.10|1460615|32|NC_018524|CRISPRCasFinder,CRT
GGAACGGGTGGAACCCCCACCGGAACCCCGGG
>9.11|1460066|32|NC_018524|PILER-CR
ACCGGGTGGCATCGCACGGCCGCTCAGGTCGT
>9.12|1460127|32|NC_018524|PILER-CR
GGTCGATTCGTCTGACCTGTGACGAGGCCCGG
>9.13|1460188|32|NC_018524|PILER-CR
ACGATCAGGCCCTTTCAGGGTTCGGGTCGGTG
>9.14|1460249|32|NC_018524|PILER-CR
AGGTCCCGCAGGTGACCGGTTGTGACTGCCGT
>9.15|1460310|32|NC_018524|PILER-CR
TGCGGAGCGGTCTCACGGATGTAGTCCATGAA
>9.16|1460371|32|NC_018524|PILER-CR
CTCACCACTCGCGGTAAGCCGGTCCGGGTGCC
>9.17|1460432|33|NC_018524|PILER-CR
GCACAGGCCGATTCCGGCGTTCGCCGAGTTCTG
>9.18|1460494|32|NC_018524|PILER-CR
CGGTGGTAGTCGACCACCTGCGCCGTAGACGC
>9.19|1460555|32|NC_018524|PILER-CR
CTACCGCGGGTGATCAAGGACAAGATCGTGGA
>9.20|1460616|32|NC_018524|PILER-CR
GGAACGGGTGGAACCCCCACCGGAACCCCGGG

CRISPR arrays and Neighbor proteins around NC_018524_9

CRISPR arrays

The CRISPR arrays of NC_018524_9

>merge|NC_018524|9|1460036-1460675|CRISPRCasFinder,CRT,PILER-CR
AGGTCCATCCCCGCGTGCGCGGGGAGCAGACCGGGTGGCATCGCACGGCCGCTCAGGTCGTGGGTCCATCCCCGCGTGCGCGGGGAGCAGGGTCGATTCGTCTGACCTGTGACGAGGCCCGGGGGTCCATCCCCGCGTGCGCGGGGAGCAGACGATCAGGCCCTTTCAGGGTTCGGGTCGGTGGGGTCCATCCCCGCGTGCGCGGGGAGCAGAGGTCCCGCAGGTGACCGGTTGTGACTGCCGTGGGTCCATCCCCGCGTGCGCGGGGAGCAGTGCGGAGCGGTCTCACGGATGTAGTCCATGAAGGGTCCATCCCCGCGTGCGCGGGGAGCAGCTCACCACTCGCGGTAAGCCGGTCCGGGTGCCGGGTCCATCCCCGCGTGCGCGGGGAGCAGGCACAGGCCGATTCCGGCGTTCGCCGAGTTCTGGGGTCCATCCCCGCGTGCGCGGGGAGCAGCGGTGGTAGTCGACCACCTGCGCCGTAGACGCGGGTCCATCCCCGCGTGCGCGGGGAGCAGCTACCGCGGGTGATCAAGGACAAGATCGTGGAGGGTCCATCCCCGCGTGCGCGGGGAGCAGGGAACGGGTGGAACCCCCACCGGAACCCCGGGGGGTCCATCCCCGCGTGCGCGGGGAGCAG

>NC_018524|9|9|1460036-1460675|CRISPRCasFinder
AGGTCCATCCCCGCGTGCGCGGGGAGCAG	ACCGGGTGGCATCGCACGGCCGCTCAGGTCGT
GGGTCCATCCCCGCGTGCGCGGGGAGCAG	GGTCGATTCGTCTGACCTGTGACGAGGCCCGG
GGGTCCATCCCCGCGTGCGCGGGGAGCAG	ACGATCAGGCCCTTTCAGGGTTCGGGTCGGTG
GGGTCCATCCCCGCGTGCGCGGGGAGCAG	AGGTCCCGCAGGTGACCGGTTGTGACTGCCGT
GGGTCCATCCCCGCGTGCGCGGGGAGCAG	TGCGGAGCGGTCTCACGGATGTAGTCCATGAA
GGGTCCATCCCCGCGTGCGCGGGGAGCAG	CTCACCACTCGCGGTAAGCCGGTCCGGGTGCC
GGGTCCATCCCCGCGTGCGCGGGGAGCAG	GCACAGGCCGATTCCGGCGTTCGCCGAGTTCTG
GGGTCCATCCCCGCGTGCGCGGGGAGCAG	CGGTGGTAGTCGACCACCTGCGCCGTAGACGC
GGGTCCATCCCCGCGTGCGCGGGGAGCAG	CTACCGCGGGTGATCAAGGACAAGATCGTGGA
GGGTCCATCCCCGCGTGCGCGGGGAGCAG	GGAACGGGTGGAACCCCCACCGGAACCCCGGG
GGGTCCATCCCCGCGTGCGCGGGGAGCAG

>NC_018524|9|6|1460036-1460675|CRT
AGGTCCATCCCCGCGTGCGCGGGGAGCAG	ACCGGGTGGCATCGCACGGCCGCTCAGGTCGT
GGGTCCATCCCCGCGTGCGCGGGGAGCAG	GGTCGATTCGTCTGACCTGTGACGAGGCCCGG
GGGTCCATCCCCGCGTGCGCGGGGAGCAG	ACGATCAGGCCCTTTCAGGGTTCGGGTCGGTG
GGGTCCATCCCCGCGTGCGCGGGGAGCAG	AGGTCCCGCAGGTGACCGGTTGTGACTGCCGT
GGGTCCATCCCCGCGTGCGCGGGGAGCAG	TGCGGAGCGGTCTCACGGATGTAGTCCATGAA
GGGTCCATCCCCGCGTGCGCGGGGAGCAG	CTCACCACTCGCGGTAAGCCGGTCCGGGTGCC
GGGTCCATCCCCGCGTGCGCGGGGAGCAG	GCACAGGCCGATTCCGGCGTTCGCCGAGTTCTG
GGGTCCATCCCCGCGTGCGCGGGGAGCAG	CGGTGGTAGTCGACCACCTGCGCCGTAGACGC
GGGTCCATCCCCGCGTGCGCGGGGAGCAG	CTACCGCGGGTGATCAAGGACAAGATCGTGGA
GGGTCCATCCCCGCGTGCGCGGGGAGCAG	GGAACGGGTGGAACCCCCACCGGAACCCCGGG
GGGTCCATCCCCGCGTGCGCGGGGAGCAG

>NC_018524|9|7|1460037-1460675|PILER-CR
GGTCCATCCCCGCGTGCGCGGGGAGCAGA	CCGGGTGGCATCGCACGGCCGCTCAGGTCGTG
GGTCCATCCCCGCGTGCGCGGGGAGCAGG	GTCGATTCGTCTGACCTGTGACGAGGCCCGGG
GGTCCATCCCCGCGTGCGCGGGGAGCAGA	CGATCAGGCCCTTTCAGGGTTCGGGTCGGTGG
GGTCCATCCCCGCGTGCGCGGGGAGCAGA	GGTCCCGCAGGTGACCGGTTGTGACTGCCGTG
GGTCCATCCCCGCGTGCGCGGGGAGCAGT	GCGGAGCGGTCTCACGGATGTAGTCCATGAAG
GGTCCATCCCCGCGTGCGCGGGGAGCAGC	TCACCACTCGCGGTAAGCCGGTCCGGGTGCCG
GGTCCATCCCCGCGTGCGCGGGGAGCAGG	CACAGGCCGATTCCGGCGTTCGCCGAGTTCTGG
GGTCCATCCCCGCGTGCGCGGGGAGCAGC	GGTGGTAGTCGACCACCTGCGCCGTAGACGCG
GGTCCATCCCCGCGTGCGCGGGGAGCAGC	TACCGCGGGTGATCAAGGACAAGATCGTGGAG
GGTCCATCCCCGCGTGCGCGGGGAGCAGG	GAACGGGTGGAACCCCCACCGGAACCCCGGGG
GGTCCATCCCCGCGTGCGCGGGGAGCAG

Neighbor Proteins Overview

Protein	Signature genes	Signature genes Name	Protein_function
NC_018524.1|WP_014910141.1|1472619_1475079_+|penicillin-acylase-family-protein	unknown	unknown	gnl|CDD|376618
NC_018524.1|WP_026124745.1|1452147_1452339_-|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl|CDD|133390
NC_018524.1|WP_014912619.1|1467487_1468837_+|MFS-transporter	unknown	unknown	gnl|CDD|349949
NC_018524.1|WP_014912665.1|1455056_1455896_+|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl|CDD|379262
NC_018524.1|WP_014909938.1|1459251_1459836_-|HD-domain-containing-protein	unknown	unknown	gnl|CDD|224808
NC_018524.1|WP_014910185.1|1462243_1462600_+|nucleotide-pyrophosphohydrolase	unknown	unknown	gnl|CDD|212144
NC_018524.1|WP_014912924.1|1466883_1467348_+|GNAT-family-N-acetyltransferase	unknown	unknown	gnl|CDD|366181
NC_018524.1|WP_014912413.1|1452427_1452931_-|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl|CDD|238045
NC_018524.1|WP_014911344.1|1456372_1456558_+|DUF397-domain-containing-protein	unknown	unknown	gnl|CDD|377231
NC_018524.1|WP_041561734.1|1460798_1461212_-|NUDIX-domain-containing-protein	unknown	unknown	gnl|CDD|240038
NC_018524.1|WP_014912826.1|1453893_1454145_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014910023.1|1457020_1457938_+|NADP-dependent-oxidoreductase	unknown	unknown	gnl|CDD|176191
NC_018524.1|WP_014913497.1|1464186_1466709_-|tetratricopeptide-repeat-protein	unknown	unknown	gnl|CDD|276807
NC_018524.1|WP_014910508.1|1471268_1472276_+|Fe2+-enterobactin-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl|CDD|236806
NC_018524.1|WP_041561732.1|1455907_1456099_+|DUF397-domain-containing-protein	unknown	unknown	gnl|CDD|377231
NC_018524.1|WP_014913374.1|1458064_1458907_-|phosphotransferase	unknown	unknown	gnl|CDD|366736
NC_018524.1|WP_014908382.1|1468888_1469926_+|nitronate-monooxygenase	unknown	unknown	gnl|CDD|367316
NC_018524.1|WP_014911781.1|1462693_1463986_-|Fic-family-protein	unknown	unknown	gnl|CDD|225718
NC_018524.1|WP_148281591.1|1454228_1454594_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_017533201.1|1461501_1461768_+|AbrB/MazE/SpoVT-family-DNA-binding-domain-containing-protein	unknown	unknown	gnl|CDD|198034

rpsblast for functional proteins

Protein	Function_ID	Function_description	E-value
NC_018524.1|WP_014910141.1|1472619_1475079_+|penicillin-acylase-family-protein	gnl|CDD|376618	pfam01804, Penicil_amidase, Penicillin amidase. Penicillin amidase or penicillin acylase EC:3.5.1.11 catalyzes the hydrolysis of benzylpenicillin to phenylacetic acid and 6-aminopenicillanic acid (6-APA) a key intermediate in the the synthesis of penicillins. Also in the family is cephalosporin acylase and aculeacin A acylase which are involved in the synthesis of related peptide antibiotics.	7.1091e-178
NC_018524.1|WP_026124745.1|1452147_1452339_-|helix-turn-helix-domain-containing-protein	gnl|CDD|133390	cd04762, HTH_MerR-trunc, Helix-Turn-Helix DNA binding domain of truncated MerR-like proteins. Proteins in this family mostly have a truncated helix-turn-helix (HTH) MerR-like domain. They lack a portion of the C-terminal region, called Wing 2 and the long dimerization helix that is typically present in MerR-like proteins. These truncated domains are found in response regulator receiver (REC) domain proteins (i.e., CheY), cytosine-C5 specific DNA methylases, IS607 transposase-like proteins, and RacA, a bacterial protein that anchors chromosomes to cell poles.	4.60188e-14
NC_018524.1|WP_014912619.1|1467487_1468837_+|MFS-transporter	gnl|CDD|349949	cd06174, MFS, Major Facilitator Superfamily. The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of substrates including ions, sugar phosphates, drugs, neurotransmitters, nucleosides, amino acids, and peptides. They do so using the electrochemical potential of the transported substrates. Uniporters transport a single substrate, while symporters and antiporters transport two substrates in the same or in opposite directions, respectively, across membranes. MFS proteins are typically 400 to 600 amino acids in length, and the majority contain 12 transmembrane alpha helices (TMs) connected by hydrophilic loops. The N- and C-terminal halves of these proteins display weak similarity and may be the result of a gene duplication/fusion event. Based on kinetic studies and the structures of a few bacterial superfamily members, GlpT (glycerol-3-phosphate transporter), LacY (lactose permease), and EmrD (multidrug transporter), MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement. Bacterial members function primarily for nutrient uptake, and as drug-efflux pumps to confer antibiotic resistance. Some MFS proteins have medical significance in humans such as the glucose transporter Glut4, which is impaired in type II diabetes, and glucose-6-phosphate transporter (G6PT), which causes glycogen storage disease when mutated.	5.2029e-18
NC_018524.1|WP_017533201.1|1461501_1461768_+|AbrB/MazE/SpoVT-family-DNA-binding-domain-containing-protein	gnl|CDD|198034	smart00966, SpoVT_AbrB, SpoVT / AbrB like domain. This domain is found in AbrB from Bacillus subtilis. The product of the abrB gene is an ambiactive repressor and activator of the transcription of genes expressed during the transition state between vegetative growth and the onset of stationary phase and sporulation. AbrB is thought to interact directly with the transcription initiation regions of genes under its control. AbrB contains a helix-turn-helix structure, but this domain ends before the helix-turn-helix begins. The product of the B. subtilis gene spoVT is another member of this family and is also a transcriptional regulator. DNA-binding activity in this AbrB homologue requires hexamerisation. Another family member has been isolated from the Sulfolobus solfataricus and has been identified as a homologue of bacterial repressor-like proteins. The Escherichia coli family member SohA or Prl1F appears to be bifunctional and is able to regulate its own expression as well as relieve the export block imposed by high-level synthesis of beta-galactosidase hybrid proteins.	1.45457e-07
NC_018524.1|WP_014909938.1|1459251_1459836_-|HD-domain-containing-protein	gnl|CDD|224808	COG1896, COG1896, Predicted hydrolases of HD superfamily [General function prediction only].	9.8297e-24
NC_018524.1|WP_041561734.1|1460798_1461212_-|NUDIX-domain-containing-protein	gnl|CDD|240038	cd04682, Nudix_Hydrolase_23, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.	1.04949e-20
NC_018524.1|WP_014912413.1|1452427_1452931_-|helix-turn-helix-transcriptional-regulator	gnl|CDD|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	4.83704e-07
NC_018524.1|WP_014911344.1|1456372_1456558_+|DUF397-domain-containing-protein	gnl|CDD|377231	pfam04149, DUF397, Domain of unknown function (DUF397). The function of this family is unknown.	3.54089e-17
NC_018524.1|WP_014913374.1|1458064_1458907_-|phosphotransferase	gnl|CDD|366736	pfam01636, APH, Phosphotransferase enzyme family. This family consists of bacterial antibiotic resistance proteins, which confer resistance to various aminoglycosides they include: aminoglycoside 3'-phosphotransferase or kanamycin kinase / neomycin-kanamycin phosphotransferase and streptomycin 3''-kinase or streptomycin 3''-phosphotransferase. The aminoglycoside phosphotransferases inactivate aminoglycoside antibiotics via phosphorylation. This family also includes homoserine kinase. This family is related to fructosamine kinase pfam03881.	0.000451635
NC_018524.1|WP_014912924.1|1466883_1467348_+|GNAT-family-N-acetyltransferase	gnl|CDD|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	9.68922e-09
NC_018524.1|WP_014910023.1|1457020_1457938_+|NADP-dependent-oxidoreductase	gnl|CDD|176191	cd05289, MDR_like_2, alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases. Members identified as zinc-dependent alcohol dehydrogenases and quinone oxidoreductase. QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR actin the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction.	4.75624e-82
NC_018524.1|WP_014913497.1|1464186_1466709_-|tetratricopeptide-repeat-protein	gnl|CDD|276807	sd00010, SLR, Sel1-like repeat. Sel1-like repeats (SLRs) share similar alpha-helical conformations with Tetratricopeptide repeats (TPRs), but with different consensus sequence lengths and superhelical topologies. SLRs contain 36 to 44 amino acids and are present in bacteria and eukaryotes but not in archaea. SLR proteins are involved in a variety of functions, and many serve as adaptor proteins for the assembly of macromolecular complexes. The SLR family was named after the Caenorhabditis elegans Sel1 protein which is predicted to fold into 11 SLRs, a transmembrane domain, and an N-terminal signal sequence. The human Sel1L protein contains an additional fibronectin type-II domain and an N-terminal PEST sequence. Its downregulation is associated with the development of breast and pancreatic carcinomas.	7.29982e-14
NC_018524.1|WP_014910508.1|1471268_1472276_+|Fe2+-enterobactin-ABC-transporter-substrate-binding-protein	gnl|CDD|236806	PRK10957, PRK10957, iron-enterobactin transporter periplasmic binding protein; Provisional.	8.44687e-78
NC_018524.1|WP_041561732.1|1455907_1456099_+|DUF397-domain-containing-protein	gnl|CDD|377231	pfam04149, DUF397, Domain of unknown function (DUF397). The function of this family is unknown.	8.42116e-15
NC_018524.1|WP_014910185.1|1462243_1462600_+|nucleotide-pyrophosphohydrolase	gnl|CDD|212144	cd11537, NTP-PPase_RS21-C6_like, Nucleoside Triphosphate Pyrophosphohydrolase (EC 3.6.1.8) MazG-like domain found in mouse RS21-C6 protein and its homologs. RS21-C6 proteins, highly expressed in all vertebrate genomes and green plants, act as house-cleaning enzymes, removing 5-methyl dCTP (m5dCTP) in order to prevent gene silencing. They show significant sequence similarity to the dimeric 2-deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTP pyrophosphatase or dUTPase) and NTP-PPase MazG proteins. However, unlike typical tandem-domain MazG proteins, RS21-C6 contains a single MazG-like domain and functions as a tetramer (a dimer of dimers) with a typical four-helical bundle. Divalent ions, such as Mg2+, are required for its pyrophosphatase activity. This family also includes a pyrophosphatase from Archaeoglobus fulgidus (Af1178). Although its biological role remains unclear, Af1178 shows significant sequence similarity to the mouse RS21-C6 protein.	7.45309e-41
NC_018524.1|WP_014908382.1|1468888_1469926_+|nitronate-monooxygenase	gnl|CDD|367316	pfam03060, NMO, Nitronate monooxygenase. Nitronate monooxygenase (NMO), formerly referred to as 2-nitropropane dioxygenase (NPD) (EC:1.13.11.32), is an FMN-dependent enzyme that uses molecular oxygen to oxidize (anionic) alkyl nitronates and, in the case of the enzyme from Neurospora crassa, (neutral) nitroalkanes to the corresponding carbonyl compounds and nitrite. Previously classified as 2-nitropropane dioxygenase, but it is now recognized that this was the result of the slow ionization of nitroalkanes to their nitronate (anionic) forms. The enzymes from the fungus Neurospora crassa and the yeast Williopsis saturnus var. mrakii (formerly classified as Hansenula mrakii) contain non-covalently bound FMN as the cofactor. Active towards linear alkyl nitronates of lengths between 2 and 6 carbon atoms and, with lower activity, towards propyl-2-nitronate. The enzyme from N. crassa can also utilize neutral nitroalkanes, but with lower activity. One atom of oxygen is incorporated into the carbonyl group of the aldehyde product. The reaction appears to involve the formation of an enzyme-bound nitronate radical and an a-peroxynitroethane species, which then decomposes, either in the active site of the enzyme or after release, to acetaldehyde and nitrite.	2.59157e-88
NC_018524.1|WP_014911781.1|1462693_1463986_-|Fic-family-protein	gnl|CDD|225718	COG3177, COG3177, Fic family protein [Function unknown].	6.75834e-33
NC_018524.1|WP_014912665.1|1455056_1455896_+|helix-turn-helix-domain-containing-protein	gnl|CDD|379262	pfam13560, HTH_31, Helix-turn-helix domain. This domain is a helix-turn-helix domain that probably binds to DNA.	1.59872e-09

Protein sequences

>NC_018524.1|WP_014909938.1|1459251_1459836_-|HD-domain-containing-protein
MGEQQDVRALDYLYEAGLLKRYKRTGWVVAGVPDPESIADHSHRTALTAAVIAELEGANPERAAFLALFHDTQETRLTDIPYIGKRYLKASSNAEVTADQTAGMPEGLARLIGGAESEYEAKESAEARCAKDADKLECLLQAVEYREQGTDTQAWIDTSFAALKTDGAQRLAKLALDRSPLAWMHEARDSKPPK
>NC_018524.1|WP_014913374.1|1458064_1458907_-|phosphotransferase
MTTAQEIAGQRHRDHMWNLLVQAAEGFGLTLVGEPVFGWRDRTVGAPGRGPHGDLWVRVTTEFPAWAHGRTWTGNSDADAISGVPRPEVVEVTEWDDPPRRVRAEAATLLPGDVLSTTRFLHGRPEAAELWWSDLRDALDLLAEQDTDRVAVDQETITRRLLVFFGDAIDPTVTRWTTAHGDLHWNNLLGPDLGVLDWELWGSGPAGLDAATLYCHSLTHPETAERVRRVFADLLDTPDGVRAQLFVITRLLLRIERGDDPATAPLLHRKARELLDDQSR
>NC_018524.1|WP_014910023.1|1457020_1457938_+|NADP-dependent-oxidoreductase
MTLAAFYTEYGDSDVLQVSELPVPEPGPGEVQLRVSYASVNPVDIKIRTGMLGDGGPLQGTTITGMDVAGTVERVGAGVTGFSPGDRVAGLSPNGAAAELVNTYAATLVHVPDSVDVRVAATIGVGGGTAVRALGLTGVSRGDTILVDGASGGVGTFLTQLAIARGATVVGTASQANHEHLRELGVVPIEYGEGWQARARAATDHPFDAAFDLVTGGKFTDLRALSSETAPIATLVDPEVPEQGGILVTGREPGFEHALQEVMDAIADGGLRVPIAREFPLSEIAAAQDLVADGHTRGKVIVSVA
>NC_018524.1|WP_014911344.1|1456372_1456558_+|DUF397-domain-containing-protein
MPLPQAEALTFRKSSYSNPNNCVEVADIPGASAIRDTKRRTDGHLPFPTNEWAAFLTTLTR
>NC_018524.1|WP_041561732.1|1455907_1456099_+|DUF397-domain-containing-protein
MYSFPAEAADWRTSTYTQQQNCVEVADVPGVSAVRDTKNRTHGHLEFQSSEWRAFVESVRTRG
>NC_018524.1|WP_014912665.1|1455056_1455896_+|helix-turn-helix-domain-containing-protein
MAASPTIRRRQLSAILRRMRKDAGLSLEEAAKRVEWSRAKLGHIETGERKKPSVVEIKALLHEYNIDPKNPQYEAVLTLVRHAQQRGWWTRYDDILTGSYVELEAEATSIANYEAFGIPGLLQTPGLARLMQRARLWRDSEDIQRAVDARIRRQQILSGDKPTQLWAVIEEHALQRLAGAPEVMREQIKHLIHLADASDHVTIQVLPTDAGVHAGVAGPFVIMDFAEPAGPIVYLETYTDGLYLEREAEVARYRRLWDHIRTSALDEERTIPYLKKMIR
>NC_018524.1|WP_148281591.1|1454228_1454594_-|hypothetical-protein
MMDIQTEAFLSALSDALRLPAPATTNRSVGTSGSSRPTGTSDSPGPSVPLCSRSRSGPAGSRTSSALAVTPAAHPGEHHPALLRARMCQARAALSVALSSGDLAAAVAVLDRLAEAEGVVS
>NC_018524.1|WP_014912826.1|1453893_1454145_-|hypothetical-protein
MDEYGDTWAPPAQVLAELTARWGRTHKIAWTGRFWLATHHHPRAPWRSQIEPTPEQLESRLRAHYGMPPGPPAERTKRRRDAR
>NC_018524.1|WP_014912413.1|1452427_1452931_-|helix-turn-helix-transcriptional-regulator
MNEHDADSLCTESKKALGVHLKRLRKAAGLSGYRLSGVDQSTVSRIETGRIRPSHELLTRLLDAYEADQEGREQAYLLWDQAQLPLQTRRRQVEGTRPAWDQAARPACGPTLLAGASAAEDAARYLTRAQWAGNSQARRSALLDDAEGRLVQVLAALHAARTRLRER
>NC_018524.1|WP_026124745.1|1452147_1452339_-|helix-turn-helix-domain-containing-protein
MTQPDVDPMDLLTPQEVAQAFRVDPKTVRLWAQEGRLRWVRTLGGHRRYFKADVQRLLTEPGR
>NC_018524.1|WP_041561734.1|1460798_1461212_-|NUDIX-domain-containing-protein
MRVDDRSRGAVAIIANARGDLLLHLRDDLPHIAWPGHWSVLGGGCDPGESPREAIVRELDEEAGLAVEDLVELFEVPDVHGSGRLLTFYAGVWDGDAEALPLTEGVKLAWVAPDLLDTLLMPPFIRTALHRYLADRS
>NC_018524.1|WP_017533201.1|1461501_1461768_+|AbrB/MazE/SpoVT-family-DNA-binding-domain-containing-protein
MRRKNQLTLPREVTEALHIREGDEVEFEIGEDGQVVLRGMTVVPADQAWFWDREWQQGEREASEQIAAGRTEEFEDAESMFDALEQER
>NC_018524.1|WP_014910185.1|1462243_1462600_+|nucleotide-pyrophosphohydrolase
MSISSLQLALADFARRRDWEQFHTPKNLAMALAGEAGELAAEFQWLTPEQSQAVMEDPAKAEAVRQEMADVFSYLLRLATVLDVDLEQALKDKIDLNDTRYPVDRAYGTATKYTDLDR
>NC_018524.1|WP_014911781.1|1462693_1463986_-|Fic-family-protein
MATWEEEHWRSSVASGVPRSARRSGTYRRYVPDHVDGLALAIDGPLSRRVNTVERDIRSLNGPGAENLAGIARFLLRSEAIASSQIEGITPSAQQIALAELGQSESVRGISEQARLVANNMTVVRRSTTELVEAPTLTLDHIVELHRSLLPDQPHHHGLRTVQNWIGGSDWNPIGADFVPPEPERVPELMADLVDYINGAAHSPLIQAAIVHAQFETIHPFTDGNGRVGRALIHTVLARRGLAERAVLPISLVLATLRDRYVAGLDTYRHAEPATSAEASAAINAWVGVFVQAAAISVEQARTLMGHIDELRLDWIQRLSNHRESMGRRPAPRADSAVARLLDQLPEAPVVTATTLARILDVSFPAAGAALDELLKAGIVHTKAIERGATAYLAREVLELITMAERALASTRFDTRVSAPGRSVPARPQT
>NC_018524.1|WP_014913497.1|1464186_1466709_-|tetratricopeptide-repeat-protein
MLDGSSDRSVSNSMRDVHGGLVLQMRDQFGEIHLHQQRPDETVPLPPVHEWPRCGDTAPETVGVHPTRQSEGLPPLPPYVLRETDRELRARVRDAKRGGFVLVTGPSSVGKTRAAFEAVRAELPRHTFLAPAENADLSGLPALAGTRRLRSGLVLWLDDLNRYLSRDSVNLSLLNRLIEARVTVVATINNKALKAQFDRVDGTSDTVRLLRAADPLPIGQVWTADEVDRVSEAKDERLEAALTAQEGSPRVAEYLVAGPQVLRDWRVAREPGDDGHPRGYALVAAALDLRKTGLWRPLSRELLEELHHLYLREDTDPEPLEEAWRWVSELRYGVARLLVPDDTGPGLWDPYYYLLETAHRFDEEEIPEQVWEAAEGRLREVTDRISYGMRAVAHDRKEYCVRALRPLPVDELVRAAVIAGRRGHTDMTRLAFDLALDIDAGTAHYYVALHYWDEGPTDENIGILRRSAEHGNLDGMSMLALYLFLRKRYEEARPWFLRAAEGGDDRAMTLAALYAEREKDPDEAEKWYRAAAEAGGAWQMHELGIHLLRHGDRGEAVGRLGEASANGYALATWALAELMFQDGDHDEAERLRQSVPETERAELIVEIAEVLGPIMYFHERWDDAERLWRAAAEATPDQPGPRVSLGWFLHMRERHQEAIAEVRGLALKGDEEAMLLLSSCLEHTDSRFMGRGWSNLWFRSRYKRYYRRVRLHVICACAAFLVPEAMLLGALTSQDTNPARTPLLVAGLAVFLVVLTVPYLLRRGGFFLPRPVATLAAVGTSIVCLAPALILGPEAGAWLLLAVPVIPFGLRAMSEHLIVDLGPVDGEEEEEKEKDTSPSE
>NC_018524.1|WP_014912924.1|1466883_1467348_+|GNAT-family-N-acetyltransferase
MSISTTLNKVSAHDAPALADFLQVVDLTLSGLDSPTVRLWVERDTDGSIIASTGYEIGDDREHALIRSVAVHPGHRSSGKGSALARFAFERAAEEGASTAWLFSRRSGPFWQRLGCAPADRYELANVLSRTHQVRLFKETGQLDREVAWSRPLT
>NC_018524.1|WP_014912619.1|1467487_1468837_+|MFS-transporter
MTTSPRHETPGPPTTEPIASTASPAGDGRVSLLARLGVYTSLSTLADFVYGAVFVTVILARGADPWMVGAIIAAGQVIGLLMEAPSGALGDRYGHRRLLTIGLVFWGVGLLTIGLAPGLALTLVGMCLGHVGASLKSGTLTAILINRVGATDRTARIERIVRISAVSTRLGSVLGAASVMIAGTWLSAGPLVAVGGVLLLALALFAPKCFPTTPVDPDRRVGAILVESVVLVASRRFLPLVLLASALMVATMLLVVAWQPLLAAEYGGEDVRLNGLVLLVMSLALMAGAACARWVDRDRPHLWGPVVASGIALPLLLAAYDVIPLVVGLVLAEFLIGLGGVLSGVWNQLMFTDANRNTMFSAVTVVTLFGAAVTTGSFGLLWDLWSIPTAVALLSVLALVVAMASLVLSRMVPESIDFTWAVRRNAEAEELDGERSEDTRSREESPKGP
>NC_018524.1|WP_014908382.1|1468888_1469926_+|nitronate-monooxygenase
MDLSELLRERPIVQAPMAGGASTSELVTAVDSAGGLGSLAAGYLGVEALARQMKEVRGAGTTVFGVNVFVPSESPAPESVTETYRATLSSDALRYGVEVGEALYDDDGWAAKIDLLVQARVPVVSFTFGCPSAEVLAGFREAGSATIVTVTTVAEARTAVERGADGVCVQGMEAGGHRATFDPTRADDRPLLELLPEVVAEVSVPVIAAGGIMDGSDVAAVLAAGAAAAQSGTAFLRCPESGAQPLHKAALAGSDFAETSLTRAFTGRPARGLTNRFMAEHRDAPDAYPEVHHMTKPLRAAAARMADPQGMALWAGTGFARSRELSAGELVSTLRAEAVEAGARI
>NC_018524.1|WP_014910508.1|1471268_1472276_+|Fe2+-enterobactin-ABC-transporter-substrate-binding-protein
MKLTHSRSTLVTGACSGALALLVLAACGTDPGDTDSPSTTEGEASGTRTVEHVFGETEIPADPANVVSVSVTSTAVLLSLDIPVTASSTTSPSALTDDNGFFAQWAEVAVERGVEPLPGPEVSLEAVGAAAPDLIVGNGFGADAIDQDTYETLSEIAPTVVYGESDTPWTELTEQYAEAFDRGDRADEIAEEYEHLVAETSEALSAEEDVVVLTGTPDGFNVFTSESAQGRLIDELGLTLHEMPEDLAASGNQGGPERADIVRLSPERASDFGDSTLLFVNTQGEEPADYAETAPILESTPAYEEGRAFTLGAEAFRLDYYSVPLIADRLVELLG
>NC_018524.1|WP_014910141.1|1472619_1475079_+|penicillin-acylase-family-protein
MLALIASLLGVWAVRRSFPTTDGELSLPALGSPVTVLRDEYGVANIYADDAEDLFVAQGFTHAQDRFWEMDFRRHVTAGRTAELFGEAQVETDVYLRTMGWRRVAEQEYDLLDEDSRSYLDAYAAGVNAWLDQNDGLSASLEYGLLGITADDYDIEPWTPTDSLAWLKAMAWDLGGNLQEETDRALLLANGLDRDLIEELYPAYPTERHVPITDTDEHDGAAPDADLASAPELPDEALDALANLSGVQDTIPDLIGPSGHPDLGSNSWVVSGEHTDTGSPLLTNDPHLGASMPSTWHQIGLHCTEVSEACPFDVSGFGFSGLPGVIIGQNDSIAWGFTNLNPDVMDLYLERIEGDEYVVDGEKRPLEIIEDTIEVAGGEDVDITIRATHHGPIMSDTGLGANLATIGENPSEGDDAPYAVSLGWTALQPGATADAIFAMNRARDWDEFRAGASRFEVPAQNLVYADEEGNIGYQAPGRVPVRGEGDGRWPAPGWDSDYDWDEEYLPFDELPSVLNPESGFIVTANQSVVDEDYEHFLTTDWDYGYRSQRINDLLAERIAAGPVTVQDMEDVMMDSRHEAAVDITPHLLDVEVDGVTAKAQEELADWDHVNDTDSAGAAFYNATWRHLLPLLFDELGDVDMNTGSRGMYVVGLLLEDPESSWWEGEKADGREEVLATAMDEAAEELTDLLGDTPADWRWGDLHTLTATHESFGSSGIAPVEWLFNRGPVESSGGSSIVNATGWNATEGYGITTVPSMRMVANLADRDASTWIHLTGNSGHAFHPNYDDQLELWAEGSSLPWAVTEEAVREASTDELTLTP

Crispr_ID: NC_018524_10

• CRISPR_ID: NC_018524_10
• CRISPR_location: 2075833-2076006
• CRISPR_type: Orphan
• Repeat_type: NA
• Spacer_info: 2 spacers

Consensus repeat of NC_018524_10

Consensus_repeat	Method
GGGCGGCGGCTTCGGCGGCGGTGGCGG	PILER-CR

spacers of NC_018524_10

>10.1|2075860|45|NC_018524|PILER-CR
CGGTTTCGGTGGCGGCCAGCCCCAGGGCGGCGGCTACGGGAACCA
>10.2|2075932|56|NC_018524|PILER-CR
CCGCAGGGCGGTCGCAGCGGTCCCCCGGCCGACGACCCGTGGGCGACCAACGGTGG

CRISPR arrays and Neighbor proteins around NC_018524_10

CRISPR arrays

The CRISPR arrays of NC_018524_10

>merge|NC_018524|10|2075833-2076006|PILER-CR
GGGCGGCGGCTTCGGCGGCGGTGGCGGCGGTTTCGGTGGCGGCCAGCCCCAGGGCGGCGGCTACGGGAACCAGGGCGGCGGCTTCGGCGGCCCGCAGGGCGGTCGCAGCGGTCCCCCGGCCGACGACCCGTGGGCGACCAACGGTGGTGGCGGCGGCTTCGGCGGCGGTGGCGG

>NC_018524|10|8|2075833-2076006|PILER-CR
GGGCGGCGGCTTCGGCGGCGGTGGCGG	CGGTTTCGGTGGCGGCCAGCCCCAGGGCGGCGGCTACGGGAACCA
GGGCGGCGGCTTCGGCGGCCCGCAGGG	CGGTCGCAGCGGTCCCCCGGCCGACGACCCGTGGGCGACCAACGGTGGTGGCGGCG
GCTTCGGCGGCGGTGGCGG

Neighbor Proteins Overview

Protein	Signature genes	Signature genes Name	Protein_function
NC_018524.1|WP_014908814.1|2076367_2076814_+|50S-ribosomal-protein-L9	unknown	unknown	gnl|CDD|234659
NC_018524.1|WP_014908449.1|2070078_2071155_-|inositol-3-phosphate-synthase	unknown	unknown	gnl|CDD|132491
NC_018524.1|WP_014910833.1|2075066_2075357_+|30S-ribosomal-protein-S6	unknown	unknown	gnl|CDD|179034
NC_018524.1|WP_014908427.1|2076995_2077829_+|N-acetylmuramoyl-L-alanine-amidase	unknown	unknown	gnl|CDD|133475
NC_018524.1|WP_014913358.1|2084347_2084512_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014911583.1|2083296_2083527_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014911622.1|2083818_2084328_-|PH-domain-containing-protein	unknown	unknown	gnl|CDD|367615
NC_018524.1|WP_014909837.1|2068203_2068719_+|GNAT-family-N-acetyltransferase	unknown	unknown	gnl|CDD|366181
NC_018524.1|WP_014913229.1|2068719_2070012_-|MFS-transporter	unknown	unknown	gnl|CDD|340863
NC_018524.1|WP_014909005.1|2077873_2079223_-|MATE-family-efflux-transporter	unknown	unknown	gnl|CDD|240541
NC_018524.1|WP_014909823.1|2067320_2068046_-|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl|CDD|369777
NC_018524.1|WP_014913379.1|2060869_2062753_-|murein-biosynthesis-integral-membrane-protein-MurJ	unknown	unknown	gnl|CDD|240528
NC_018524.1|WP_014911279.1|2072017_2074825_+|penicillin-binding-protein	unknown	unknown	gnl|CDD|223815
NC_018524.1|WP_026125280.1|2065809_2067312_+|CCA-tRNA-nucleotidyltransferase	unknown	unknown	gnl|CDD|131739
NC_018524.1|WP_014911375.1|2079571_2080924_+|replicative-DNA-helicase	unknown	unknown	gnl|CDD|273206
NC_018524.1|WP_014911495.1|2085557_2086211_-|uracil-phosphoribosyltransferase	unknown	unknown	gnl|CDD|234653
NC_018524.1|WP_014912454.1|2084876_2085119_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_036568566.1|2058910_2060707_-|murein-biosynthesis-integral-membrane-protein-MurJ	unknown	unknown	gnl|CDD|240528
NC_018524.1|WP_014910163.1|2081364_2082633_-|zinc-binding-dehydrogenase	unknown	unknown	gnl|CDD|176190
NC_018524.1|WP_187294584.1|2062932_2065458_-|hypothetical-protein	unknown	unknown	gnl|CDD|223003

rpsblast for functional proteins

Protein	Function_ID	Function_description	E-value
NC_018524.1|WP_014908814.1|2076367_2076814_+|50S-ribosomal-protein-L9	gnl|CDD|234659	PRK00137, rplI, 50S ribosomal protein L9; Reviewed.	1.60913e-64
NC_018524.1|WP_014908449.1|2070078_2071155_-|inositol-3-phosphate-synthase	gnl|CDD|132491	TIGR03450, mycothiol_INO1, inositol 1-phosphate synthase, Actinobacterial type. This enzyme, inositol 1-phosphate synthase as found in Actinobacteria, produces an essential precursor for several different products, including mycothiol, which is a glutathione analog, and phosphatidylinositol, which is a phospholipid.	0
NC_018524.1|WP_014910833.1|2075066_2075357_+|30S-ribosomal-protein-S6	gnl|CDD|179034	PRK00453, rpsF, 30S ribosomal protein S6; Reviewed.	1.05422e-37
NC_018524.1|WP_014908427.1|2076995_2077829_+|N-acetylmuramoyl-L-alanine-amidase	gnl|CDD|133475	cd06583, PGRP, Peptidoglycan recognition proteins (PGRPs) are pattern recognition receptors that bind, and in certain cases, hydrolyze peptidoglycans (PGNs) of bacterial cell walls. PGRPs have been divided into three classes: short PGRPs (PGRP-S), that are small (20 kDa) extracellular proteins; intermediate PGRPs (PGRP-I) that are 40-45 kDa and are predicted to be transmembrane proteins; and long PGRPs (PGRP-L), up to 90 kDa, which may be either intracellular or transmembrane. Several structures of PGRPs are known in insects and mammals, some bound with substrates like Muramyl Tripeptide (MTP) or Tracheal Cytotoxin (TCT). The substrate binding site is conserved in PGRP-LCx, PGRP-LE, and PGRP-Ialpha proteins. This family includes Zn-dependent N-Acetylmuramoyl-L-alanine Amidase, EC:3.5.1.28. This enzyme cleaves the amide bond between N-acetylmuramoyl and L-amino acids, preferentially D-lactyl-L-Ala, in bacterial cell walls. The structure for the bacteriophage T7 lysozyme shows that two of the conserved histidines and a cysteine are zinc binding residues. Site-directed mutagenesis of T7 lysozyme indicates that two conserved residues, a Tyr and a Lys, are important for amidase activity.	1.2665e-30
NC_018524.1|WP_014911622.1|2083818_2084328_-|PH-domain-containing-protein	gnl|CDD|367615	pfam03703, bPH_2, Bacterial PH domain. Domain found in uncharacterized family of membrane proteins. 1-3 copies found in each protein, with each copy flanked by transmembrane helices. Members of this family have a PH domain like structure.	9.81627e-09
NC_018524.1|WP_014909837.1|2068203_2068719_+|GNAT-family-N-acetyltransferase	gnl|CDD|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	6.23329e-07
NC_018524.1|WP_014913229.1|2068719_2070012_-|MFS-transporter	gnl|CDD|340863	cd06173, MFS_MefA_like, Macrolide efflux protein A and similar proteins of the Major Facilitator Superfamily of transporters. This family is composed of Streptococcus pyogenes macrolide efflux protein A (MefA) and similar transporters, many of which remain uncharacterized. Some members may be multidrug resistance (MDR) transporters, which are drug/H+ antiporters (DHAs) that mediate the efflux of a variety of drugs and toxic compounds, conferring resistance to these compounds. MefA confers resistance to 14-membered macrolides including erythromycin and to 15-membered macrolides. It functions as an efflux pump to regulate intracellular macrolide levels. The MefA-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	2.72907e-37
NC_018524.1|WP_014909005.1|2077873_2079223_-|MATE-family-efflux-transporter	gnl|CDD|240541	cd13136, MATE_DinF_like, DinF and similar proteins, a subfamily of the multidrug and toxic compound extrusion (MATE)-like proteins. Escherichia coli DinF is a membrane protein that has been found to protect cells against oxidative stress and bile salts. The expression of DinF is regulated as part of the SOS system. It may act by detoxifying oxidizing molecules that have the potential to damage DNA. Some member of this family have been reported to enhance the virulence of plant pathogenic bacteria by enhancing their ability to grow in the presence of toxic compounds. Proteins from the MATE family are involved in exporting metabolites across the cell membrane and are often responsible for multidrug resistance (MDR).	4.05451e-98
NC_018524.1|WP_014909823.1|2067320_2068046_-|class-I-SAM-dependent-methyltransferase	gnl|CDD|369777	pfam08241, Methyltransf_11, Methyltransferase domain. Members of this family are SAM dependent methyltransferases.	1.50384e-19
NC_018524.1|WP_014913379.1|2060869_2062753_-|murein-biosynthesis-integral-membrane-protein-MurJ	gnl|CDD|240528	cd13123, MATE_MurJ_like, MurJ/MviN, a subfamily of the multidrug and toxic compound extrusion (MATE)-like proteins. Escherichia coli MurJ (MviN) has been identified as essential for murein biosynthesis. It has been suggested that MurJ functions as the peptidoglycan lipid II flippase which is involved in translocation of lipid-anchored peptidoglycan precursors across the cytoplasmic membrane, though results obtained in Bacillus subtilis seem to indicate that its MurJ homologs are not essential for growth. Some MviN family members (e.g. in Mycobacterium tuberculosis) possess an extended C-terminal region that contains an intracellular pseudo-kinase domain and an extracellular domain resembling carbohydrate-binding proteins. Proteins from the MATE family are involved in exporting metabolites across the cell membrane and are often responsible for multidrug resistance (MDR).	3.52423e-113
NC_018524.1|WP_014911279.1|2072017_2074825_+|penicillin-binding-protein	gnl|CDD|223815	COG0744, MrcB, Membrane carboxypeptidase (penicillin-binding protein) [Cell envelope biogenesis, outer membrane].	1.73695e-130
NC_018524.1|WP_026125280.1|2065809_2067312_+|CCA-tRNA-nucleotidyltransferase	gnl|CDD|131739	TIGR02692, putative_tRNA_nucleotidyltransferase, tRNA adenylyltransferase. The enzyme tRNA adenylyltransferase, also called tRNA-nucleotidyltransferase and CCA-adding enzyme, can add or repair the required CCA triplet at the 3'-end of tRNA molecules. Genes encoding tRNA include the CCA tail in some but not all bacteria, and this enzyme may be required for viability. Members of this family represent a distinct clade within the larger family pfam01743 (tRNA nucleotidyltransferase/poly(A) polymerase family protein). The example from Streptomyces coelicolor was shown to act as a CCA-adding enzyme and not as a poly(A) polymerase. [Protein synthesis, tRNA and rRNA base modification].	0
NC_018524.1|WP_014911375.1|2079571_2080924_+|replicative-DNA-helicase	gnl|CDD|273206	TIGR00665, DnaB, replicative DNA helicase. This model describes the helicase DnaB, a homohexameric protein required for DNA replication. The homohexamer can form a ring around a single strand of DNA near a replication fork. An intein of > 400 residues is found at a conserved location in DnaB of Synechocystis PCC6803, Rhodothermus marinus (both experimentally confirmed), and Mycobacterium tuberculosis. The intein removes itself by a self-splicing reaction. The seed alignment contains inteins so that the model built from the seed alignment will model a low cost at common intein insertion sites. [DNA metabolism, DNA replication, recombination, and repair].	0
NC_018524.1|WP_014911495.1|2085557_2086211_-|uracil-phosphoribosyltransferase	gnl|CDD|234653	PRK00129, upp, uracil phosphoribosyltransferase; Reviewed.	8.29832e-115
NC_018524.1|WP_036568566.1|2058910_2060707_-|murein-biosynthesis-integral-membrane-protein-MurJ	gnl|CDD|240528	cd13123, MATE_MurJ_like, MurJ/MviN, a subfamily of the multidrug and toxic compound extrusion (MATE)-like proteins. Escherichia coli MurJ (MviN) has been identified as essential for murein biosynthesis. It has been suggested that MurJ functions as the peptidoglycan lipid II flippase which is involved in translocation of lipid-anchored peptidoglycan precursors across the cytoplasmic membrane, though results obtained in Bacillus subtilis seem to indicate that its MurJ homologs are not essential for growth. Some MviN family members (e.g. in Mycobacterium tuberculosis) possess an extended C-terminal region that contains an intracellular pseudo-kinase domain and an extracellular domain resembling carbohydrate-binding proteins. Proteins from the MATE family are involved in exporting metabolites across the cell membrane and are often responsible for multidrug resistance (MDR).	8.38393e-119
NC_018524.1|WP_014910163.1|2081364_2082633_-|zinc-binding-dehydrogenase	gnl|CDD|176190	cd05288, PGDH, Prostaglandin dehydrogenases. Prostaglandins and related eicosanoids are metabolized by the oxidation of the 15(S)-hydroxyl group of the NAD+-dependent (type I 15-PGDH) 15-prostaglandin dehydrogenase (15-PGDH) followed by reduction by NADPH/NADH-dependent (type II 15-PGDH) delta-13 15-prostaglandin reductase (13-PGR) to 15-keto-13,14,-dihydroprostaglandins. 13-PGR is a bifunctional enzyme, since it also has leukotriene B(4) 12-hydroxydehydrogenase activity. These 15-PGDH and related enzymes are members of the medium chain dehydrogenase/reductase family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.	2.19833e-155
NC_018524.1|WP_187294584.1|2062932_2065458_-|hypothetical-protein	gnl|CDD|223003	PHA03169, PHA03169, hypothetical protein; Provisional.	0.00357138

Protein sequences

>NC_018524.1|WP_014910833.1|2075066_2075357_+|30S-ribosomal-protein-S6
MRRYEIMIILDPNLDERTVAPSLENFLGVVRNDGGSVEKTEIWGKRRLAYDIEKNSEGIYAVIDLTAEPATVKELERQLGIAEAVLRTKVLRPEVH
>NC_018524.1|WP_014911279.1|2072017_2074825_+|penicillin-binding-protein
MSTERRRSADGGRRRANGPDDGPRGNGGRRRADGPPREERAGGRRRPDPEDEGGFWGNDEAEPRRRARPPEAGARSEGRPRPEGGRRRADGERPRDPEGRRRRPDDGDRPRRRPDGQRPRRPEDGDRPRRRPDDPRAGGRRRAGSGPRDPRDREHGARSEGGRGSGRGGRGSGGGGGGRRRPRDKEPDDRPWFKRFLSKAWKPALVFCGLMIIGGVAAFAVLYAMAPDKDELTANAEKTASATQIYWAGEEGEEELAVTTGEVRRVSITRDDIPEEVVNGVLAAEQRTFYEDPGINIRGIGRAILSRGEDGGGSTITQQMARNYYSDLDGQPPLTRKIREIFIAIKLNQDLSHDEILTTYLNTIYFGRGASGIEMASQAYFGKSVSELDEAQGAYLGIIIQMPSNFEGTELGPWTQNYLENERWPYVQNQLAQMYEETGGERGLPESEAQNLEIPETLEYNPGEADDPQQGYVRQAVIEEVERRYAGEGVTGAMIATEGLVIKTSLDKELMDAAEEAFSVLPESAADDTMRSLTSVDPSTGEIVAFNGGPDVATVINNSLVHQTQAGSAYKPYVLARALMDGIGLRSQFDGDNAREFPGLASPVHNSGNVDYGPVDLIQSTADSVNTSFVELAIEVGETRVDELAIEMGVDPARSTTSTVGPLIALGTHQVNSLDMASSYATFAAQGRHFPAHMVTEVQTADGKVLEPDDQTELETGTEVLPEGVAADATYAMQEAVLNGGASRAALDDGRPVAGKTGTSSDAVSAWFSGYTPQLSTAVGLSRHSGQPLDFGTDFGDVYGGTTSAMVWKAYMEVAMAGQEHQQFPPPQWVGEDQSFLPTPPPSEEPSDEPSDEPSEEVSEEPSDEPSDEPSDEPEECQPWEDGCEDGGETDNPDDCGTWPWSPPCEEDEDGGDNGGDTGPGQPGNGPAGLIRPRE
>NC_018524.1|WP_014908449.1|2070078_2071155_-|inositol-3-phosphate-synthase
MGSVRVAVVGVGNCAASLVQGVHYYKDADPESRVPGLMHVRFGPYHVRDIEFVAAFDVDAKKVGHDLSDAIVASENNTVKICDVPPTGVTVMRGPTYDGLGRYYRETIQESSEDAVDVVAALKASKADVLVSYLPVGSEEADKFYAQCAIDAGVAFVNALPVFIASDPEWAEKFTKAGVPIIGDDIKSQIGATITHRVLSKLFEDRGVVVDRTYQLNFGGNMDFKNMLERERLESKKISKTQSVTSQIPHELNAGSVHIGPSDHVPWLDDRKWAYIRLEGRAFGDVPLNLEYKLEVWDSPNSAGIIIDAVRAAKIAKDRGIGGPILAPSSYFMKSPPEQYSDAEAHDRVERFIEGENA
>NC_018524.1|WP_014913229.1|2068719_2070012_-|MFS-transporter
MSFFGDLREVLRGPRFRRLFGTRLVSQFSDGIYQAGLAGFVFFNPEQHTGAGEVAMAFAVLLLPFSVVAPFAGVLIDRMPRRQVLFLSSLIKAALAAVTALLIAHGEGPAFFIAALLVLSVNRFLLSGLSAGLPYVVPRDRLMMANAVTPTCGTVASSLGTGVGLAIGMIGGERALGTGMILFVAALGFVGAALVSLTLRHGELGPHLDEEPEEVRAALRNVVVGMTSGVRHVWERVPARVGLLTIGGHRVLFGISTLITLLLYNNTFTGGGVAGMAGFSVAAGLLALGFFLGAVATPSATSRIGENAWIASLLFAAGTALLVFGLPFSPALFPVAAFVLGFVSQGVKVTVDTLVQRHVDDAFRGRVFSVYDVLFNATFVLGAALAAALIPPSGTSAPVVAAMVIAFLSMGAAWTVRARRENRHEVTRIP
>NC_018524.1|WP_014909837.1|2068203_2068719_+|GNAT-family-N-acetyltransferase
MSTTIWYLETTDPDELRPGRDPGGHVALVHAEIPSAELSRFLYSEVGRDYQWVDRGSWGIDEWRARTEDPRVETWVLYERGTPAGYVELEGQDTGDVEIVYFGLLPGFLGRGLGGHMLTEALRRAWSMGERPAGHEATRRVWLHTCSLDGEHALANYRARGLRLYRETTEP
>NC_018524.1|WP_014909823.1|2067320_2068046_-|class-I-SAM-dependent-methyltransferase
MTGDHGLGAPSSSFGERGVAKRIETVRRQLPVRGDRLLDVGCGDGTYTVELAGGYVRVDAVDVEPGRLESFSDRIAGTELEDRVGVHKMSVDSLAFDANTFDRVTAFEVVEHLDHLEEGLSEIRRVLKPGGALSLTTPNRWFPFETHGVLWGARRRSALTAPFLPWVRPLHDRMSDARAFTTQEMGGLLRGAGLRVRAIDYLMPPFDRRPRALQHVADGLEGTPLRVFGMAMAVTAVKPGL
>NC_018524.1|WP_026125280.1|2065809_2067312_+|CCA-tRNA-nucleotidyltransferase
MPNTEFSSNDTARDERIGRSSVVDEPTGEQRAAITALIDSMRTVSEELGDRFAAHDQQLALVGGPVRDALLGRASNDIDLTTDAVPQRILELVDGWADSVWTVGIEFGTVGLRKRGDQLEITTYRSEAYSPKSRKPEVSYGTDIRDDLLRRDFTVNAMAVRLPSGEFVDPFGGLADLRAKVLRTPGRPEDSFSDDPLRIMRAVRFAAQLDFTLAPEVAEAARDMADRLTIVSAERVRDELTKLLLSPNPRRGIELMVDLGIAEHVLPEIPKMRLEIDEHHRHKDVYEHSLTVLDQAIDLERSRGHEPDLVLRLAALLHDIGKPKTRAFEGGNRVTFHHHEVVGASMSRKRLTALRFPKDVVGQVGHLVALHLRFHGYGKGEWTDSAVRRYARDAGDQLERLHILTRADCTTRNRRKAAALARSYDDIERRIETLAEQEELDRIRPDLDGNEIQEILGVGPGPLVGKAYRFLLELRLEHGPMEKETAERELRSWAADHLER
>NC_018524.1|WP_187294584.1|2062932_2065458_-|hypothetical-protein
MTMAAALLPIPATLSPASAEPENEESAPPVAVERITPSSLDEDSTLRVSGEVTNTTGVSVEDVTVRIRYSRNAFTSRDELDGFASGEGLQPDSRGPKKEFEGELKPDGTIEYSLSTPVEDLELGSYGVYPLVVEAVGGDGELLGAQYTFLPYVGEDDKDVEPVDLAWVWPLMDDPGRADDDTFLGEGLHDSVTAEGRLGRLLEAGAQVPLSFDVGDEDLVKELGLNEGPSEEAEDPSPEAGSPSPDEEPSDSSPSPEESGEPRDEASASPEDEESDEDEDQDGGEKERSPERTEGIPVTWAVDPGTMDDILRMAAADHTVVEDLSEVPAGSDPERNERAADQAAQVWLREARGVLAADAVVASSYADTDLASLLRNDMRTDAEASLSISREALRRSLALEADERFALPAEGLMDEGVQELFSSDGADRFLLTEEALPPEPWIDTTLTAEAPLPATGAEEEGVDPFALVADAGLTEVLSMPSHGPGESALALQRFAAETAMIAGEDGGKDRVVVAAPSRDWDPSAELAAGVLKATDDLPWLSPERLDRVKTPDPDEWEDTRQDLNYPQESYGQELSSTYLGQIEDVSRDVRLFNSILVGDSDPFRPSLVRLESVYWREREALAGATRSLVSQAVQGRMEDVRIIPGEPVTLASRTGITGVLVANDLEDESVYVHLSIFSENSERLSIGDYTSSFEIAPGAKTTVYVPLSARINGSTTVHVSLQNADGEPISPQDTMLQVNATGLGTQALLISGIGLLILIAALAPRALRKWARRQAAKAEKNEDGESPSAVTPRDEGAEAGDGEATGSETDERSDGTEGSTSRDDGSEEAEDRPDDDGDARK
>NC_018524.1|WP_014913379.1|2060869_2062753_-|murein-biosynthesis-integral-membrane-protein-MurJ
MVTDSPNGDEYPPRYAPRHRRPASEGPLPGEGPIRPYPGPTPSFEEGELPEPAADPYGPVLGGDRRDAGERRETAEEPVKESAGEAEPSGGMMRSSAIMAVGTMASRLTGFARTIVLAAAIGTHLLGDAYHTAHTIPFILNDLLIGGLMASVVIPFLVKRRKNDLDGGKATEDRLFTSMVLALLVVTTVAILAAEALIWLYGSRFTSLQFDTSVYLARFLLSQIFFVGLSGLLSAMLNTRGKFGAAVWAPVLNNIVIMGVAAMFLVVAGPGRTPETVTSAELTLLGAGTAAGMALQAVVLFVALTRTGYRWRPRLDLRGSGLGEALRSAGWMMLYTLLTQAGLWITTNIANAANVAGIEQGLDVGAGISAYNLAYQLFQLPYAIIAVSLITVLLPRMSAHADDRNWDAVRSDFSRTLRISAFVLVPTAFAVAMFAQPLSILAFARGSVSVEDASAIGQILAVMSLGLVPFTVFQLMLRVFFALGDTRTPALIGIANLAVHSGLALVAYLLLPPDMVVVGVAAGFMFSFLSGLTIAGQVLSRRIEGLDGKHIIGTMLRLHLAVVPSIAAGFGALWLFDTYVGPGLATYIGAPVAGCAVGALLFLVAARVLRVPELSAAVELIRGRLRR
>NC_018524.1|WP_036568566.1|2058910_2060707_-|murein-biosynthesis-integral-membrane-protein-MurJ
MVMPEDVLDAYERSEPESAPETGLKTVRNPEDIGDVGTADRAGLEDGDEIGGSSHTAPGNIAKSTAIMAVGTIASRVTGFVRTIVLAAAIGTQLLGDAYQTAGMVPYMIYDLLIGGLLASVFVPFLVKRRKLDPDGGDKTEQRLVTLMLLALFVLTLVSVLIAEWFIRIYAGGFSGSQYEVSVILARYLVLQIFFIGASGLASAMLNARNRFGAPMWAPVLNNVVIIGICVWFLSIAGPGRSPDTVTQSELALLGLGTALGQVVQAAVLVWALAAAGFRWRPRLDLRGSGLGEAAGAASWMMLYIVVAQVGALVSTNVATRAGSMAAELGFDTGSGIAAYKFASMLFQLPYAIIAVSVITALLPRMSEHVAAGRKDQVRSDFSRGFRLSSVLIVPISVAMIVFAVPFCVMIYAQGSTSAEDAAAIGRILMVFCVMLIPFTLFQLQMRVFYALGDTRTPALVSIPSEIAHAVTAIALLFVLAESPQHIVVWLPLPYGLYYIVGSIIMWYILRKRLNGLDGRRTLATLFKLHLAAVPAAVFGVLMIFVFSGLPGELWPALGAMVAGGLVGAVLFVVAAKFLNVTEVTAFLDLVKTRLRRR
>NC_018524.1|WP_014908814.1|2076367_2076814_+|50S-ribosomal-protein-L9
MKLILTHEVNGLGAPGDVVEVKNGYGRNYLLPRGFAIRWTRGGQKQIDLIQRARKARDIRTLDEAQQVAGQVGALTVRLKQRAGEGGRLFGSVTPADVAEAVKVAGGPELDKRRIEIKNPIKSVGAHKVQVRLHPEVVATIKLDIAGV
>NC_018524.1|WP_014908427.1|2076995_2077829_+|N-acetylmuramoyl-L-alanine-amidase
MAVEKRSETDHPLAVDRRTMLRGTALATGGVLLGGALGISAVGSAAAAAEPRLYTRSDWKARAPKSPISIQSQAPTHIVVHHTATGNASDTSASHAAALSRSIQRHHMDNNGWTDTGQQLTISRGGHIMEGRDNSFKAIRDGGHVIGAHTANHNSHTIGIENEGTYSSETPPAALMSSLVETCVWLCAVYGLDPREAIVGHRDYNSTNCPGDKLYSMLPKLRDDVGSKLRKQLGDMSRQASRGIDPSRLPGFPEAPSNERVAAFYHGPTLGDLDTGR
>NC_018524.1|WP_014909005.1|2077873_2079223_-|MATE-family-efflux-transporter
MATLLSAAPFRHRHDREIFALAVPTFFALIAEPLFLLTDTAIVGSLGTQAIGGLGVAGQVLLTLAAVCIFLAYGTTAAVSRKFGAGDIPGGMRDGIDGLWLAVILGVVTIGIGWPLGPWMIDLLGASPEVAPYALTYLRISLLSTPFLLIIMAGTGVLRGLQDARTPLVVAVASYIGNAVLCATFVLVLDWGIAGSAWSTVLAQGAGAFWYVASIVRSARREGVSLAPSVAGLRASASAGFALFLRSVSMRVVALVTTAVAARLGDESIAAHQVSYNLWALLVFAMDAIAIAGQSIVGRYLGAGDVRGTRAATRRMVEWGVLAGLAFTVVVFLVLPWAHLPFTSDPKVASLITASLVVVALIQPLSGVTMVLDGVLMGAGDQRYLAWASLWTMLVFLPFALVLPSLATSQTWGLVGLWGAFSVWIVARAVTLGLRARGTAWLVTGATRG
>NC_018524.1|WP_014911375.1|2079571_2080924_+|replicative-DNA-helicase
MSVAEQPPEEGGYERTPPHDIQAEQSVLGGMLLSKDAISQVVEIIRSADFYRPAHQIIYESVVDLFSRGEPVDAISVNAELTKRGEAARVGGAPYLHTLTEAIPTAANAGYYAKIVSDRAVLRRLVEVGTRIAQIGYSGDGEVDDLVDHAQAEIYKVAEKRTGEDYVVLGDIMPGALDEIEAIGANDGSMTGVPTGFADFDALTNGLHPGQMVIIAARPAVGKSTLALDFARAASIKHEMTSVFFSLEMGRNEIVMRLLSAEARVPLHTMRSGLMTDDDWARLARRMGEVASAPLFIDDSPNMSMMEIRAKCRRLKQQHDLKLVIVDYLQLMSSPGRVESRQQEVSEMSRSLKLLAKELEVPVVALSQLNRGPEQRTDKRPQVSDLRESGSIEQDADMVILLYREDVHDKESPRAGEADIIVAKHRNGPTADVTVAFQGHYSRFVDMAPS
>NC_018524.1|WP_014910163.1|2081364_2082633_-|zinc-binding-dehydrogenase
MIDGTSSTSLVRLVRDTALASGVSAPLITALPGATSLDDDRLRIPLTTLGRLWELLAYSLPEGTAGLRVAESARLGSMPAWDYLLVNGVDLGDALSESLPYHRVVTAAEEHFTLTEVRIPELAEGQILVRNTWMSVDPYMRGRMDDAPSYIPPFELGAPLEGSAIGVVIASRADSIPVGAHVSHFLGWREHSVVDATGAVVVDIDPVPASAHLGPLGTTGLTAYLALTEIAPVNEGDTVYVSAAAGAVGSVAGQIARRLGAARVVGSAGGPEKTALLTTEFGYDAAIDRREGDLAKSLAEAAPDGIDVYLDSVGGDHLDAALEAMTPRGRVALVGAISGYNATGPLAGPDLYRAATKELSLRGMIVGHYLDRFPEFHSKVMPWLLDGTLRTRETVLDGLENATKAFFGVLDGANTGKMLVRL
>NC_018524.1|WP_014911583.1|2083296_2083527_-|hypothetical-protein
MARRTEHAPHLSRTSTDRRRTRSAAASRRLSGLAPEPALVPRPREDADATTTEHPIMHWVLITDENGRTRPEARWL
>NC_018524.1|WP_014911622.1|2083818_2084328_-|PH-domain-containing-protein
MRLVASSNAAPASVNRYLLPHEQDVVTIRRHPAVLIGPVATVLAALILAGILSRTIGGNSTATLAVIWWLWLLVLVWFVWRVAEWSVDYFVITSARLLLTTGLITRQVNMMPLGKVTDMRFERTLIGRFLGYGTFVMESAGQDQALSRIDFIPYPEQLYLEVVGLIFKE
>NC_018524.1|WP_014913358.1|2084347_2084512_-|hypothetical-protein
MAKLKKWGGYALIGFVAFYLLTQPESAAGVIQGALGGLMGGAESMSRFVNALLP
>NC_018524.1|WP_014912454.1|2084876_2085119_-|hypothetical-protein
MPETPSTSPTQAAHDPHFSRVVSRLASEFSNVHHSSTVSRCVDAAHHGAKDVTGRATPDLVERIARQHLQVLALAFAEQH
>NC_018524.1|WP_014911495.1|2085557_2086211_-|uracil-phosphoribosyltransferase
METLVVDHPLVAHKLTTLRDVRTDSPTFRRLTDELVTLLAYEATRDVRVTEVTIRTPLVEATGTQLSRPTPLVVPILRAGLGMLDGMTRLLPTAEVGFLGMARDEETLQPATYADRLPQDLSGRQCYVLDPMLATGGTLAAALKLLVERGADHITAICLLAAPEGLTAVERKLAESLPEDHGATLRVVTAAVDERLDENGFILPGLGDAGDRLYGCS

Crispr_ID: NC_018524_11

• CRISPR_ID: NC_018524_11
• CRISPR_location: 2250995-2251573
• CRISPR_type: Orphan
• Repeat_type: NA
• Spacer_info: 9 spacers

Consensus repeat of NC_018524_11

Consensus_repeat	Method
CTGA--------GCCCCGCGCACGTGGGGATGGACCG	PILER-CR
CTGAGCCCCACGCACGTGGGGATGG	CRISPRCasFinder
CTGAGCCCCNCGCACGNGGGGATGGACCG	CRT

spacers of NC_018524_11

>11.1|2251024|32|NC_018524|PILER-CR,CRT
AGGTTCTCCCCGACCCTCCACAACCTTCCTCT
>11.2|2251085|32|NC_018524|PILER-CR,CRT
GAGGGCAGCCTCGAACCGACCTGGGTGTGCTT
>11.3|2251146|32|NC_018524|PILER-CR,CRT
CGCGGCGGCGCCTGCGCGACCTGCTCAACGAG
>11.4|2251207|32|NC_018524|PILER-CR,CRT
GCCACGATCGACCGGTGCGCCTCGGTCTCTCG
>11.5|2251268|32|NC_018524|PILER-CR,CRT
TCGTGAGGGTGCTGTTTCGGGATGAGTGAGCC
>11.6|2251329|32|NC_018524|PILER-CR,CRT
ACGTGGCGGATGGCGTCGCGGGCCGCACCGAG
>11.7|2251390|33|NC_018524|PILER-CR,CRT
CTTGAGAAGCTCCCGCGCGACCTGGAGTCCGAG
>11.8|2251452|32|NC_018524|PILER-CR,CRT
CAGTGTGGGCAGGAGATTACCGAGATCGGCGT
>11.9|2251020|36|NC_018524|CRISPRCasFinder
ACCGAGGTTCTCCCCGACCCTCCACAACCTTCCTCT
>11.10|2251081|36|NC_018524|CRISPRCasFinder
ACCGGAGGGCAGCCTCGAACCGACCTGGGTGTGCTT
>11.11|2251142|36|NC_018524|CRISPRCasFinder
ACCGCGCGGCGGCGCCTGCGCGACCTGCTCAACGAG
>11.12|2251203|36|NC_018524|CRISPRCasFinder
ACCGGCCACGATCGACCGGTGCGCCTCGGTCTCTCG
>11.13|2251264|36|NC_018524|CRISPRCasFinder
ACCCTCGTGAGGGTGCTGTTTCGGGATGAGTGAGCC
>11.14|2251325|36|NC_018524|CRISPRCasFinder
ACCGACGTGGCGGATGGCGTCGCGGGCCGCACCGAG
>11.15|2251386|37|NC_018524|CRISPRCasFinder
ACCGCTTGAGAAGCTCCCGCGCGACCTGGAGTCCGAG
>11.16|2251448|36|NC_018524|CRISPRCasFinder
ACCGCAGTGTGGGCAGGAGATTACCGAGATCGGCGT
>11.17|2251509|36|NC_018524|CRISPRCasFinder
ACCGGCGTACGCGTCCATGTCCTCCACACCACCGCG
>11.18|2251513|32|NC_018524|CRT
GCGTACGCGTCCATGTCCTCCACACCACCGCG

CRISPR arrays and Neighbor proteins around NC_018524_11

CRISPR arrays

The CRISPR arrays of NC_018524_11

>merge|NC_018524|11|2250995-2251573|PILER-CR,CRISPRCasFinder,CRT
CTGAGTCCCACGCACGTGGGGATGGACCGAGGTTCTCCCCGACCCTCCACAACCTTCCTCTCTGAGCCCCACGCACGTGGGGATGGACCGGAGGGCAGCCTCGAACCGACCTGGGTGTGCTTCTGAGCCCCACGCACGTGGGGATGGACCGCGCGGCGGCGCCTGCGCGACCTGCTCAACGAGCTGAGCCCCGCGCACGCGGGGATGGACCGGCCACGATCGACCGGTGCGCCTCGGTCTCTCGCTGAGCCCCGCGCACGCGGGGATGGACCCTCGTGAGGGTGCTGTTTCGGGATGAGTGAGCCCTGAGCCCCGCGCACGCGGGGATGGACCGACGTGGCGGATGGCGTCGCGGGCCGCACCGAGCTGAGCCCCGCGCACGCGGGGATGGACCGCTTGAGAAGCTCCCGCGCGACCTGGAGTCCGAGCTGAGCCCCGCGCACGTGGGGATGGACCGCAGTGTGGGCAGGAGATTACCGAGATCGGCGTCTGAGCCCCACGCACGTGGGGATGGACCGGCGTACGCGTCCATGTCCTCCACACCACCGCGCTGAGCCCCACGCACGTGGGGATGGCTCT

>NC_018524|11|9|2250995-2251512|PILER-CR
CTGAGTCCCACGCACGTGGGGATGGACCG	AGGTTCTCCCCGACCCTCCACAACCTTCCTCT
CTGAGCCCCACGCACGTGGGGATGGACCG	GAGGGCAGCCTCGAACCGACCTGGGTGTGCTT
CTGAGCCCCACGCACGTGGGGATGGACCG	CGCGGCGGCGCCTGCGCGACCTGCTCAACGAG
CTGAGCCCCGCGCACGCGGGGATGGACCG	GCCACGATCGACCGGTGCGCCTCGGTCTCTCG
CTGAGCCCCGCGCACGCGGGGATGGACCC	TCGTGAGGGTGCTGTTTCGGGATGAGTGAGCC
CTGAGCCCCGCGCACGCGGGGATGGACCG	ACGTGGCGGATGGCGTCGCGGGCCGCACCGAG
CTGAGCCCCGCGCACGCGGGGATGGACCG	CTTGAGAAGCTCCCGCGCGACCTGGAGTCCGAG
CTGAGCCCCGCGCACGTGGGGATGGACCG	CAGTGTGGGCAGGAGATTACCGAGATCGGCGT
CTGAGCCCCACGCACGTGGGGATGGACCG

>NC_018524|11|10|2250995-2251569|CRISPRCasFinder
CTGAGTCCCACGCACGTGGGGATGG	ACCGAGGTTCTCCCCGACCCTCCACAACCTTCCTCT
CTGAGCCCCACGCACGTGGGGATGG	ACCGGAGGGCAGCCTCGAACCGACCTGGGTGTGCTT
CTGAGCCCCACGCACGTGGGGATGG	ACCGCGCGGCGGCGCCTGCGCGACCTGCTCAACGAG
CTGAGCCCCGCGCACGCGGGGATGG	ACCGGCCACGATCGACCGGTGCGCCTCGGTCTCTCG
CTGAGCCCCGCGCACGCGGGGATGG	ACCCTCGTGAGGGTGCTGTTTCGGGATGAGTGAGCC
CTGAGCCCCGCGCACGCGGGGATGG	ACCGACGTGGCGGATGGCGTCGCGGGCCGCACCGAG
CTGAGCCCCGCGCACGCGGGGATGG	ACCGCTTGAGAAGCTCCCGCGCGACCTGGAGTCCGAG
CTGAGCCCCGCGCACGTGGGGATGG	ACCGCAGTGTGGGCAGGAGATTACCGAGATCGGCGT
CTGAGCCCCACGCACGTGGGGATGG	ACCGGCGTACGCGTCCATGTCCTCCACACCACCGCG
CTGAGCCCCACGCACGTGGGGATGG

>NC_018524|11|7|2250995-2251573|CRT
CTGAGTCCCACGCACGTGGGGATGGACCG	AGGTTCTCCCCGACCCTCCACAACCTTCCTCT
CTGAGCCCCACGCACGTGGGGATGGACCG	GAGGGCAGCCTCGAACCGACCTGGGTGTGCTT
CTGAGCCCCACGCACGTGGGGATGGACCG	CGCGGCGGCGCCTGCGCGACCTGCTCAACGAG
CTGAGCCCCGCGCACGCGGGGATGGACCG	GCCACGATCGACCGGTGCGCCTCGGTCTCTCG
CTGAGCCCCGCGCACGCGGGGATGGACCC	TCGTGAGGGTGCTGTTTCGGGATGAGTGAGCC
CTGAGCCCCGCGCACGCGGGGATGGACCG	ACGTGGCGGATGGCGTCGCGGGCCGCACCGAG
CTGAGCCCCGCGCACGCGGGGATGGACCG	CTTGAGAAGCTCCCGCGCGACCTGGAGTCCGAG
CTGAGCCCCGCGCACGTGGGGATGGACCG	CAGTGTGGGCAGGAGATTACCGAGATCGGCGT
CTGAGCCCCACGCACGTGGGGATGGACCG	GCGTACGCGTCCATGTCCTCCACACCACCGCG
CTGAGCCCCACGCACGTGGGGATGGCTCT

Neighbor Proteins Overview

Protein	Signature genes	Signature genes Name	Protein_function
NC_018524.1|WP_041561796.1|2261055_2264085_-|lantibiotic-dehydratase	unknown	unknown	gnl|CDD|377403
NC_018524.1|WP_187294550.1|2257762_2258818_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014911584.1|2243351_2245235_+|M3-family-metallopeptidase	unknown	unknown	gnl|CDD|341051
NC_018524.1|WP_014910569.1|2253207_2254032_+|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl|CDD|238045
NC_018524.1|WP_014908190.1|2251659_2252202_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014910170.1|2250259_2250784_+|GNAT-family-N-acetyltransferase	unknown	unknown	gnl|CDD|173926
NC_018524.1|WP_014909293.1|2259805_2261059_-|lanthionine-synthetase-C-family-protein	unknown	unknown	gnl|CDD|271201
NC_018524.1|WP_014909607.1|2255550_2256390_-|IS5-family-transposase	unknown	unknown	gnl|CDD|379129
NC_018524.1|WP_014913237.1|2245277_2246099_-|NshR/TsnR-family-23S-rRNA-methyltransferase	unknown	unknown	gnl|CDD|349981
NC_018524.1|WP_014910331.1|2241577_2243128_+|hypothetical-protein	unknown	unknown	gnl|CDD|380492
NC_018524.1|WP_014911866.1|2249342_2249510_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014911180.1|2248062_2248365_+|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_041561795.1|2258955_2259783_-|bacteriocin-biosynthesis-protein	unknown	unknown	gnl|CDD|274836
NC_018524.1|WP_014911464.1|2239561_2241223_-|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl|CDD|224055
NC_018524.1|WP_014909792.1|2247288_2247852_-|RNA-polymerase-sigma-factor	unknown	unknown	gnl|CDD|224511
NC_018524.1|WP_041562164.1|2252375_2252885_+|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014912647.1|2246224_2247301_-|CU044_5270-family-protein	unknown	unknown	unknown
NC_018524.1|WP_014912507.1|2248778_2249333_-|pentapeptide-repeat-containing-protein	unknown	unknown	gnl|CDD|224276
NC_018524.1|WP_148281609.1|2254769_2255393_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_187294586.1|2256526_2257669_+|IS701-family-transposase	unknown	unknown	gnl|CDD|379252

rpsblast for functional proteins

Protein	Function_ID	Function_description	E-value
NC_018524.1|WP_041561796.1|2261055_2264085_-|lantibiotic-dehydratase	gnl|CDD|377403	pfam04738, Lant_dehydr_N, Lantibiotic dehydratase, C-terminus. Lantibiotics are ribosomally synthesized antimicrobial agents derived from ribosomally synthesized peptides. They are produced by bacteria of the Firmicutes phylum, and include mutacin, subtilin, and nisin. Lantibiotic peptides contain thioether bridges termed lanthionines that are thought to be generated by dehydration of serine and threonine residues followed by addition of cysteine residues. This family constitutes the N-terminus of the enzyme proposed to catalyze the dehydration step, via glutamylation of the substrate during lantibiotic biosynthesis. The enzyme dehydrates Ser/Thr residues in the precursor by glutamylation.	0
NC_018524.1|WP_014911584.1|2243351_2245235_+|M3-family-metallopeptidase	gnl|CDD|341051	cd06456, M3A_DCP, Peptidase family M3, dipeptidyl carboxypeptidase (DCP). Peptidase family M3 dipeptidyl carboxypeptidase (DCP; Dcp II; peptidyl dipeptidase; EC 3.4.15.5). This metal-binding M3A family also includes oligopeptidase A (OpdA; EC 3.4.24.70). DCP cleaves dipeptides off the C-termini of various peptides and proteins, the smallest substrate being N-blocked tripeptides and unblocked tetrapeptides. DCP from Escherichia coli is inhibited by the anti-hypertensive drug captopril, an inhibitor of the mammalian angiotensin converting enzyme (ACE, also called peptidyl dipeptidase A). OpdA may play a specific role in the degradation of signal peptides after they are released from precursor forms of secreted proteins. It can also cleave N-acetyl-L-Ala. This family also includes Arabidopsis thaliana organellar oligopeptidase OOP (At5g65620), which plays a role in targeting peptide degradation in mitochondria and chloroplasts; it degrades peptide substrates that are between 8 to 23 amino acid residues, and shows a weak preference for hydrophobic residues (F/L) at the P1 position.	0
NC_018524.1|WP_014910569.1|2253207_2254032_+|helix-turn-helix-domain-containing-protein	gnl|CDD|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	2.19421e-11
NC_018524.1|WP_014910170.1|2250259_2250784_+|GNAT-family-N-acetyltransferase	gnl|CDD|173926	cd04301, NAT_SF, N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate. NAT (N-Acyltransferase) is a large superfamily of enzymes that mostly catalyze the transfer of an acyl group to a substrate and are implicated in a variety of functions, ranging from bacterial antibiotic resistance to circadian rhythms in mammals. Members include GCN5-related N-Acetyltransferases (GNAT) such as Aminoglycoside N-acetyltransferases, Histone N-acetyltransferase (HAT) enzymes, and Serotonin N-acetyltransferase, which catalyze the transfer of an acetyl group to a substrate. The kinetic mechanism of most GNATs involves the ordered formation of a ternary complex: the reaction begins with Acetyl Coenzyme A (AcCoA) binding, followed by binding of substrate, then direct transfer of the acetyl group from AcCoA to the substrate, followed by product and subsequent CoA release. Other family members include Arginine/ornithine N-succinyltransferase, Myristoyl-CoA: protein N-myristoyltransferase, and Acyl-homoserinelactone synthase which have a similar catalytic mechanism but differ in types of acyl groups transferred. Leucyl/phenylalanyl-tRNA-protein transferase and FemXAB nonribosomal peptidyltransferases which catalyze similar peptidyltransferase reactions are also included.	0.00722028
NC_018524.1|WP_014909293.1|2259805_2261059_-|lanthionine-synthetase-C-family-protein	gnl|CDD|271201	cd04793, LanC, Cyclases involved in the biosynthesis of lantibiotics. LanC is the cyclase enzyme of the lanthionine synthetase. Lanthinoine is a lantibiotic, a unique class of peptide antibiotics. They are ribosomally synthesized as precursor peptides and then post-translationally modified to contain thioether cross-links called lanthionines (Lans) or methyllanthionines (MeLans) in addition to 2,3-didehydroalanine (Dha) and (Z)-2,3-didehydrobutyrine (Dhb). These unusual amino acids are introduced by the dehydration of serine and threonine residues, followed by thioether formation via addition of cysteine thiols, catalysed by LanB and LanC or LanM. LanC, the cyclase component, is a zinc metalloprotein, whose bound metal has been proposed to activate the thiol substrate for nucleophilic addition. Also contains SpaC (the cyclase involved in the biosynthesis of subtilin), NisC, and homologs.	8.62538e-110
NC_018524.1|WP_014912507.1|2248778_2249333_-|pentapeptide-repeat-containing-protein	gnl|CDD|224276	COG1357, COG1357, Pentapeptide repeats containing protein [Function unknown].	9.5763e-10
NC_018524.1|WP_014910331.1|2241577_2243128_+|hypothetical-protein	gnl|CDD|380492	cd06268, PBP1_ABC_transporter_LIVBP-like, periplasmic binding domain of ATP-binding cassette transporter-like systems that belong to the type 1 periplasmic binding fold protein superfamily. Periplasmic binding domain of ATP-binding cassette transporter-like systems that belong to the type 1 periplasmic binding fold protein superfamily. They are mostly present in archaea and eubacteria, and are primarily involved in scavenging solutes from the environment. ABC-type transporters couple ATP hydrolysis with the uptake and efflux of a wide range of substrates across bacterial membranes, including amino acids, peptides, lipids and sterols, and various drugs. These systems are comprised of transmembrane domains, nucleotide binding domains, and in most bacterial uptake systems, periplasmic binding proteins (PBPs) which transfer the ligand to the extracellular gate of the transmembrane domains. These PBPs bind their substrates selectively and with high affinity. Members of this group include ABC-type Leucine-Isoleucine-Valine-Binding Proteins (LIVBP), which are homologous to the aliphatic amidase transcriptional repressor, AmiC, of Pseudomonas aeruginosa. The uncharacterized periplasmic components of various ABC-type transport systems are included in this group.	0.00449657
NC_018524.1|WP_014911464.1|2239561_2241223_-|ABC-transporter-ATP-binding-protein	gnl|CDD|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	1.29135e-78
NC_018524.1|WP_014909792.1|2247288_2247852_-|RNA-polymerase-sigma-factor	gnl|CDD|224511	COG1595, RpoE, DNA-directed RNA polymerase specialized sigma subunit, sigma24 homolog [Transcription].	6.13711e-23
NC_018524.1|WP_041561795.1|2258955_2259783_-|bacteriocin-biosynthesis-protein	gnl|CDD|274836	TIGR03891, lantibiotic_dehydratase, thiopeptide-type bacteriocin biosynthesis domain. This domain occurs within longer proteins that contain lantibiotic dehydratase domains (see pfam04737 and pfam04738), and as single-domain proteins in bacteriocin biosynthesis genomic contexts. Three named genes in this family, SioK in Streptomyces sioyaensis, TsrD in Streptomyces laurentii, and NosD in Streptomyces actuosus, all occur in regions associated with thiopeptide biosynthesis. [Cellular processes, Toxin production and resistance].	3.43728e-47
NC_018524.1|WP_014913237.1|2245277_2246099_-|NshR/TsnR-family-23S-rRNA-methyltransferase	gnl|CDD|349981	cd18108, SpoU-like_NHR, Nosiheptide-resistance methyltransferase (NHR). Nosiheptide-resistance methyltransferase (NHR) confers resistance to the thiazole antibiotic nosiheptide via catalyzing 2'O-methylation of 23S rRNA at the nucleotide A1067. NHR is a member of the SPOUT (SpoU-TrmD) methyltransferase (MTase) superfamily, a large class of S-adenosyl-L-methionine (AdoMet or SAM)-dependent RNA MTases which are structurally characterized by a deep trefoil knot.	2.08095e-72
NC_018524.1|WP_014909607.1|2255550_2256390_-|IS5-family-transposase	gnl|CDD|379129	pfam13340, DUF4096, Putative transposase of IS4/5 family (DUF4096).	4.54386e-32
NC_018524.1|WP_187294586.1|2256526_2257669_+|IS701-family-transposase	gnl|CDD|379252	pfam13546, DDE_5, DDE superfamily endonuclease. This family of proteins are related to pfam00665 and are probably endonucleases of the DDE superfamily. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	1.46783e-53

Protein sequences

>NC_018524.1|WP_014910170.1|2250259_2250784_+|GNAT-family-N-acetyltransferase
MFTMRPATKADIPAVAEMVASRCDWMERRGLESWRENIDDLAGQAAAGFMWVLTVGERIVGCTTVTTQAPPKDWTAREAEEPSLYLFTTVTDPAYREHRPGTLIAWWAVDQAARQGRRWVRRGCYFPKLAEYYESQGYTLVKEQERSAGHLYLLARRAERLDLDALGLTTRSPV
>NC_018524.1|WP_014911866.1|2249342_2249510_-|hypothetical-protein
MTTILTGLEASERAADLIDRLQPTTPVGLFDNRDTWDNVGGGPWYHRSTWDNWKK
>NC_018524.1|WP_014912507.1|2248778_2249333_-|pentapeptide-repeat-containing-protein
MQTAEIRGAKVLLPSDDEPAVRVWPYSDPLEEEKVANTHFASLDLTSHRLVDINLNRCRFTGSRLMGVSLARVSMSDVLFEGCQFDYATWEQVKVTGDVAFVGCSFKEAEIIGSDLRGAVFDDCAFAANIKSTKMSGADLRGSDLSGLSGLASLHGAQVTELQLRQLSEVMIRDLDLTITELPL
>NC_018524.1|WP_014911180.1|2248062_2248365_+|hypothetical-protein
MTPVQIVRAAAVTLIAGGSVLGLVPGGPCGAGWWSPDGAHGAASFGWFAYSEISTPPREFGISGCATATAPVASWAIALLVMGAVLLVLSFNAHRLGRSK
>NC_018524.1|WP_014909792.1|2247288_2247852_-|RNA-polymerase-sigma-factor
MRRGRAGDDHSGQRDFNALFEEHYDAVYRYARRRVGPDQADDVASEAFVVAWRRRDRLPPGRELPWLYACARRIGLAHHRLERRQGSIAASLERETDTTHHDDTDRVLDRDRALAALARLTEIERELVMLVTWEGLDCRQAAKVVGCTHVTARGRLHRARRKLTAYMKADAPEPARVRVPKEVSWTT
>NC_018524.1|WP_014912647.1|2246224_2247301_-|CU044_5270-family-protein
MDDLTALRAAFDGTDPAADARPTPEARQRARVEAIARLKEHESMTRPLWKRVPVLVAGAATAALAVGAGVIVLPGDDHVGIPLAYAAQPEPIEVTGGDPVDGTERLTELADVAAERGAAPGEGDVAFVSTSDVQLHRLTANAGDEDPPESYGYRFVPYDRTGWEAPNGDVRRDSDPKPPLEAGGAEADHEWFLEQGSESYEDTLHESLVWPADLPTDTEGMLEVLADYGEGPEDESLPALTNAVDRLYESRPLSGSEEAAVQRVFAEVADVSYLGSATDSLGREGELFSFEVEDEGLVTEVRYMYDAEDGALLYRDATLLEEAPEYGDAADFGLEYPLLTEQVGFVWSGWVGAIGERP
>NC_018524.1|WP_014913237.1|2245277_2246099_-|NshR/TsnR-family-23S-rRNA-methyltransferase
MDNLEIIENASDPAVQRILDVTKSSRANIKTTLIEDAEPLTQCIRAGVEFIEIYGIETQPPSEELLELCRERRIPVRLFATSVVNQVFKGERKPKTFGIARVPRPSRLSDIARRGGDVIVLDGVRIVGNIGAITRSALALGASGIILVDSDLTSVADRRLIRASRGYVFSLPIVLAEREEAISFVRKEGIPLLVLDADGDVPLKSLGDNKERLALLFGSEKGGPSEMFEEASSASISIPMISSTESLNVSVSVGIVLHERIGPNFEARRSDPR
>NC_018524.1|WP_014911584.1|2243351_2245235_+|M3-family-metallopeptidase
MTDNPFLTPSELPYGLPDFAAIREEHFRPAFDQGVAEHLAEVAAIVADPEPPTFENTIAALERSGRTLNRVETVLHTLAGSDATEAVQELERELSPKATRHRDAIYLDRGLWDRIKRVTTSDPEEATLLERYRLDYIKAGADLDEAGQERMRELNAELAELGTEFSRNLVRASTESALVTEDVSDLDGLDEAQIQAIESDGKYVLPLLNTTVQPALAQLTDRATREKLYTLSVERAPRNREIAVRVAAIRSEQARLRGYPDHASFKVADQTAKTVEAVEERLGRLVGPARRNVESEAAALAEHAGHDIEPWDWPYYAEQVRKARYDLDESELRPYFELGRVIEDGVLYAATRLYGITFTERSDLRGYHDDVRVWEVFDGDGTALGLFLLDPYARPTKRGGAWMHNLVEQSFLLDEKPVVVNNLNITKPVSGPTLLTFDEVETAFHEFGHALHGLLSSVRYPRVEGTSVPRDFVEFPSQVNEMWATWPEILANYAKHHETGEPVPTELLDRLAPGTVVEDPEAFEIEALERVGALHPLVRPRYRTSYFMHVFSNDYSAGYYSYVWSEVLDAESVDWFKENGGLRRESGDRFRQKVLAVGGSVDSMDAVRDFLGREPGMEPLLARKGLN
>NC_018524.1|WP_014910331.1|2241577_2243128_+|hypothetical-protein
MADPAGWRGADRKRSLLLGTAAALVLAVVATTLLMWDRFTCGGPNNGVREIADECVGVTEGDYVFHDDFTRVQELIREENERVAALGDDLPVVRVALLGTFTFDPVSPMDPGRMLRSLEGAYTAQKRANDTHDFGDRTPRIQLVVANMGSRQHQWEPVVDDLVDMARDEERPLVAVTGMGVSIASARDIARTLDGQGIPMVSTALTADGLAHGPGGIDDAGDEENPTLPGVLRVAPSNTEYIKALRGHLDGLDERARAIIVYDRTEPDLFVASLKQAYTEHLDPYIDGRPVQEYEGTTVGDDPVRGLFAEVTMNVCVSGADTVLFAGRAPDLDEFMESLAASTCDRPMRIMFVATGLSVLNEEGRMAFLADNDLTLVYASGIDTRWNLVPQGSADAPEGYRAFREAYIEHFPSTEHDPEGLRNGYALVNHDAVAVAAQAIRMTNELGDADGPPTAHEVRARMTLLNTAHEVRAGGGTLGYSPEGAGEATGRFVPIVEMPLEPGDAPAPDPHVIGDE
>NC_018524.1|WP_014911464.1|2239561_2241223_-|ABC-transporter-ATP-binding-protein
MWWLITRQPGRILTGTLYGTLWMTTVMVPPYLMARAIDDGLRAGRPGALVLWVAAMAAVLLFNVAVSVLRHRTMTQVRMDAAHRTMRVVNGHSTVLGSSLARRVSSGELSTVQAADVMLIAHILTMTGPGVGAVIAYVGVAVLLVGISPLLGAIVVIGVPVLAVVIGPLLGRLQDRERSYREHQGETTALAADIVSGLRVLCGIGGKDHFARRYRDRSGELLHQGYRVSETTSWFQAVTYCLPVIFLGAVTWVAARLTLDGQITVGEAVAVYGYVALLIIPILFLIEGATGLVQGLVSVRRVLRVLTLEPPLAGSGMNRPGPEEDAELVDPASGVTVPPGRCTALVSASPEEAAAVADRLCRHTDSDVLWGGIPLRDVGLNEVRERLLLCDNESYLFAGSLREVLDPHGRFPDEELRAALRTAGAVDVLTSLPDGLDSRVDPQGRNLSGGQRQRVRLARAVLASPEVLALVEPTSAVDAHTEAAIAERLVEARIGRTTVVVGTSPLLLDRADRIVLLVDGTAVAVGTHGELIASRRDYRALVLRGADEEGERA
>NC_018524.1|WP_014908190.1|2251659_2252202_-|hypothetical-protein
MNRFIEPGPDFRELFLSFEHTAFRLETRDHYGAPYEQESLRRFLADEPDDLPWLRSWLDMIREATAAGRLFSRVRVVSTPLTDYSRFGVWCSRFTTGAGEDIRYLERGRAEDSGLPRHDYWLFDSRTLLKMHFDDSSVFLGGQIIEDPQEVVRHNHWRDVARHHAVEREDFAAEQRLQRV
>NC_018524.1|WP_041562164.1|2252375_2252885_+|hypothetical-protein
MAQDEFDGLFEEFESECLHMEMRDSYGTQAEILPFAKWAEGEEDDFAWMDGWCDTLRRGRAKGKVFRRVLVVSEPLSRYQRWAHSTTPPLVEAGEDIRWVPRRTVSSLALPGNDFYLIDGEKVVFMHYSGEGAMEDIVVSTDPADIELCRSAFGAVWGRAIPHSDYRVV
>NC_018524.1|WP_014910569.1|2253207_2254032_+|helix-turn-helix-domain-containing-protein
MALEPDELAAASGNLGETLRELRRGAGLSGERLARRCSMSQSKISKIETGRLIPTLVDLDRLLTALEVSPEQAGPVLAKVRAANTEWQGKRELWRKGLETRQHELCFLETSATEAGYFLPTMVTGLLATPAYIRASLTHSPGDVSATVAKKIARQEVLREGPCSFTFLLTEQAVRWAILPPEGMAEQAARLVEVSRLERVRLGVIPLGAVLPRGPRNTFTVYDDRLATVEIFTGRLAFREPLDVGTYRELFAMYEEHALFGDQARERIRSWFEV
>NC_018524.1|WP_148281609.1|2254769_2255393_-|hypothetical-protein
MPFELKLAGQTHEGELAFGVAWPRSGRDSPGFGWSVDASTALKLLEAIKDGHLEAEQAQQILTDLISQAGELVDESRRIDWAYARCFGDCDLCMRRKAKYEGYVAKYSAWAQAWEAAGASPDRYPFAMTKSTVHRSDCGIVTPAPYSLQHKPIDLRTFAHIEGDVMVGALPSTRHETHVWMSERTGPKGGRNYRLCKTCSPEIDDGR
>NC_018524.1|WP_014909607.1|2255550_2256390_-|IS5-family-transposase
MTRRPTYPSDLTDEQWTLIEPLLPPANTGGRPEKHPRRDVVDAILYVVRTGCSWRHLPVDFPPWQTVYWYFSRWEEAKVTEQVMAVLRRRLRTAQGRGGEPSAGIIDSQSVKGADTVGQGSRGYDAGKKVNGRKRFIVTDTLGLLLVVCVMAASVQDRDGARTTLLSLYLCTPVRFVFADAGFAGKLVAWAERFVATTVHIVRKAPDQVGFAVIPRRWVVERSLAWLTAHRRLARDYERDPAVSEAMVRWAAIGQMARRLARGQDSVRQRAWTGQDLIP
>NC_018524.1|WP_187294586.1|2256526_2257669_+|IS701-family-transposase
MTDLETWSRSFSEFTASFAHRFPRVESRRQATSYLRGLLSELERKNGWTLAEMCGEQGPERLQRLLNFYAWDTDGVRDDVRDLVVEVLADPDHGVLILDDTGFLKKGTKSAGVARQYSGTAGRIENCQIGVFLAYASSKGRALIDRELYLPKAWTEDRDRCRASGIGEQVAFATKNELGHAMLRRAVQSGIPFGWVTADEAYGQVSRLRLWMEEHDIHHVVAVPKSQTVITMDLGQERAHRLIADLPEQAWERLSCADGAHGPRVYDWARADIRPWREPGKGHWLLARRSITDPEELAYYICFADENTTLVELARVAASRWAVEECFQAAKNETGLDHYQVRGYRAWYRHITLSMAALAFLVRLRQGVQKGDQNTPRACV
>NC_018524.1|WP_187294550.1|2257762_2258818_-|hypothetical-protein
MTRACEAMNKAALIASDTGQPDLAEALCWQQYETFAPAAPLTAKAATFAVQPLVNLGRLAIRTGNPSDAYTVLESLFEAVDRGGPANVLGRSRPVGNLVDTPGERAELRRFLWAVLLADGTRALCASERWQDAMHHLHRYRGIGLRMLDGRQAAVLAALHLEDIDTATDLLAATDRSQAWEHAVAACLSVATDLVAGRDSASAVTSMIETVRHLPPTPGGTVFATRLGVLACELAPDQHALATHLITGALETTDAHVAAAVLGSPTLATRLTEEQGQVLREHVTQAQPTGTKRPIGLEEELVEIGNRAAGFLIRGLQTSGLDVTDLSTATTGCCLCVCDSGSPGHAAGTGV
>NC_018524.1|WP_041561795.1|2258955_2259783_-|bacteriocin-biosynthesis-protein
MPNDAPITEMWWQVNVEFPDPATDEQTGVHHLAPALKQSGRAWFLMRKKGAWRCRTHLPDTPAGQTAVREQVGELLDEITHTGHISTWTPVVYEPETRAFGGTEAMAAAHALFCADTRHLMEFLAAAEGGPDRRKEVSLLLCHTLMRAAGLDRYEQGDVWDRVASTRPLHTAGPPPEKVHHKVHRLLSVDPGPRAAHFAPSGAFAGFALWAQAFQDCGHELADLHTRGRLERGLRAVLAHHVIFCWNRLGLSAPVQAVLSHTAARIIFDPETVNL
>NC_018524.1|WP_014909293.1|2259805_2261059_-|lanthionine-synthetase-C-family-protein
MTVTVTIANRAHTTAQEILDSLADPDHVRFLPDKPALRQRPSSMGGGAAGVALAHVEAARTGHGPWESARTWIARALSEPINGSNTATLWSGAPALGLLTTIAATSPARLARARARLAGATTRLTLDRLSQANTRIDRGQGPSLAEFDLIQGLTGLAVYHLHTHPEAPITRHVLAYLVRLSRPLPDDPHRLPGWWTEHSPHNSPAPEFPGGHLNLGMAHGIAAPLAVLSLALRHGVTVDGHTDAIGRILDVLDARRHAGPRGTWWPYYLTPQRWENGPTTAACEQRPTWCYGTPGLARAQQLAGIALHDPHRQAMAEQTMADCLRDASQLDTLADLGLCHGWAGLLHCAWRINTDAPDTPLTQDLDRIATTLLDRLEGEPHPDPEFLDGRAGIALALHTYANGAAPGVPWDAHLALA
>NC_018524.1|WP_041561796.1|2261055_2264085_-|lantibiotic-dehydratase
MHPRFTAHPTGVLRVSALSSPGDAPPWPNGPIDSPEHHDAWIAWLRQVHDHPVLGAAIRDAGPTLVQRIGRVCQGNASGRDLTRVARSTARYVLRAQSRAAPFGLFAGVAPTRFTSAVSGTIGVDHRPMARVSAAWTTAAVDRLESCEPEFTAHLPVVVNTLAVVRDDRILVEHQPEPGADQGTRSSLRLTAPARMVLETARTPTSWAQVEAALNTAFPDRGDAVRALVGTLVRHRVLLTCLHPPMDTPDPLRHLITAARGAGADRYPRAAAVLAHLEAAQRSLEDHDHAPEPAVRAAAMSRSRTALAAVAPVDAPTSVDLRLESDLDLPRTVSWQIQDAAGVLARLSPVRQCTPAWADYHRRFCERYGIGAVVPVTEVIDPDRGLGLPAGFHGSRLPTPPAQALSERDAVLLDLAQQAAVDGTGEIVVDDALLDRLGAAPLDAVWPHTELRVRVHATSREALDAGDFRVVVAGASRGAGTTVGRFLDLLPPSGRDPLLDLYRRLPTLRQDAILAQLTCPASSARGDQVSRTPVVLPTRLALGQHHPADPNALGLDDLAVTADPHRLHLVTRYGLRPVEPVVFHALEFTRAAHPQMRFLTELPWAFTAVLVPFSWGAATHLPYLPRVRWRQCVLAPARWRLDAHTLPGPHAPWQEWVDHLDQWRATRRVPAQVELGENDQRLRLNLDLSAHQDLVRSELVTAGRVFLREASTDRELGWIGGRAHELVATVTATQTPIRVRTLPGSAHPRSPEHLPGTMAGWCSLKLYGHPDRTTELITEEFPRLSASERALSWWFLRYRDPEPHLRVRIRVEGPEQLGAVHTWTRDLRERGLVATIVHDTYTPESGRFGPGAAMKAAETLFVADSRAVTSQLTTESTDHGTRVWAAVSMTDLVHHLLGDEPTARRWLIDHAPPGVTDRGEAQRTITLTHPDHDDRPALLRDAWQNRAEAASAYTKALADFGFTASHILPDLLHLHSTRLFGPDPDAERACLSLARAAALSWNARAKEGQ

Crispr_ID: NC_018524_13

• CRISPR_ID: NC_018524_13
• CRISPR_location: 2254440-2254529
• CRISPR_type: Orphan
• Repeat_type: I-E
• Spacer_info: 1 spacers

Consensus repeat of NC_018524_13

Consensus_repeat	Method
CTGCTCCCCGCGCACGCGGGGATGGACCC	CRISPRCasFinder

spacers of NC_018524_13

>13.1|2254469|32|NC_018524|CRISPRCasFinder
CGACGACGGCAACGCCCTACGCCTAGTCGACG

CRISPR arrays and Neighbor proteins around NC_018524_13

CRISPR arrays

The CRISPR arrays of NC_018524_13

>merge|NC_018524|13|2254440-2254529|CRISPRCasFinder
CTGCTCCCCGCGCACGCGGGGATGGACCCCGACGACGGCAACGCCCTACGCCTAGTCGACGCTGCTCCCTGCGCACGTAGGGGTGGGTCA

>NC_018524|13|12|2254440-2254529|CRISPRCasFinder
CTGCTCCCCGCGCACGCGGGGATGGACCC	CGACGACGGCAACGCCCTACGCCTAGTCGACG
CTGCTCCCTGCGCACGTAGGGGTGGGTCA

Neighbor Proteins Overview

Protein	Signature genes	Signature genes Name	Protein_function
NC_018524.1|WP_014913548.1|2264169_2264316_-|FxLD-family-lanthipeptide	unknown	unknown	gnl|CDD|275157
NC_018524.1|WP_187294550.1|2257762_2258818_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014908190.1|2251659_2252202_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014910569.1|2253207_2254032_+|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl|CDD|238045
NC_018524.1|WP_187294551.1|2266048_2267245_+|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl|CDD|379262
NC_018524.1|WP_014910170.1|2250259_2250784_+|GNAT-family-N-acetyltransferase	unknown	unknown	gnl|CDD|173926
NC_018524.1|WP_014909293.1|2259805_2261059_-|lanthionine-synthetase-C-family-protein	unknown	unknown	gnl|CDD|271201
NC_018524.1|WP_014909607.1|2255550_2256390_-|IS5-family-transposase	unknown	unknown	gnl|CDD|379129
NC_018524.1|WP_148281691.1|2264367_2265540_-|methyltransferase,-FxLD-system	unknown	unknown	gnl|CDD|275158
NC_018524.1|WP_014913237.1|2245277_2246099_-|NshR/TsnR-family-23S-rRNA-methyltransferase	unknown	unknown	gnl|CDD|349981
NC_018524.1|WP_041561796.1|2261055_2264085_-|lantibiotic-dehydratase	unknown	unknown	gnl|CDD|377403
NC_018524.1|WP_014911866.1|2249342_2249510_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014911180.1|2248062_2248365_+|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_041561795.1|2258955_2259783_-|bacteriocin-biosynthesis-protein	unknown	unknown	gnl|CDD|274836
NC_018524.1|WP_014909792.1|2247288_2247852_-|RNA-polymerase-sigma-factor	unknown	unknown	gnl|CDD|224511
NC_018524.1|WP_041562164.1|2252375_2252885_+|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014912647.1|2246224_2247301_-|CU044_5270-family-protein	unknown	unknown	unknown
NC_018524.1|WP_014912507.1|2248778_2249333_-|pentapeptide-repeat-containing-protein	unknown	unknown	gnl|CDD|224276
NC_018524.1|WP_148281609.1|2254769_2255393_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_187294586.1|2256526_2257669_+|IS701-family-transposase	unknown	unknown	gnl|CDD|379252

rpsblast for functional proteins

Protein	Function_ID	Function_description	E-value
NC_018524.1|WP_014913548.1|2264169_2264316_-|FxLD-family-lanthipeptide	gnl|CDD|275157	TIGR04363, hypothetical_protein, FxLD family lantipeptide. Members of this protein family occur with a cassette of lanthionine-type peptide modification enzymes. Members are small (about 60 amino acids long), rich in Cys, and variable in copy number per genome (from one to three). These features suggest that members of this family are modified to become lantipeptides, although not necessarily a lantibiotic. There is no GlyGly cleavage motif to separate a leader peptide from core region.The considerable abundance in Streptomyces and relatively strong consideration hints at a non-antibiotic function. The motif FxLD in the N-terminal region is nearly invariant.	1.93056e-09
NC_018524.1|WP_014910569.1|2253207_2254032_+|helix-turn-helix-domain-containing-protein	gnl|CDD|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	2.19421e-11
NC_018524.1|WP_014910170.1|2250259_2250784_+|GNAT-family-N-acetyltransferase	gnl|CDD|173926	cd04301, NAT_SF, N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate. NAT (N-Acyltransferase) is a large superfamily of enzymes that mostly catalyze the transfer of an acyl group to a substrate and are implicated in a variety of functions, ranging from bacterial antibiotic resistance to circadian rhythms in mammals. Members include GCN5-related N-Acetyltransferases (GNAT) such as Aminoglycoside N-acetyltransferases, Histone N-acetyltransferase (HAT) enzymes, and Serotonin N-acetyltransferase, which catalyze the transfer of an acetyl group to a substrate. The kinetic mechanism of most GNATs involves the ordered formation of a ternary complex: the reaction begins with Acetyl Coenzyme A (AcCoA) binding, followed by binding of substrate, then direct transfer of the acetyl group from AcCoA to the substrate, followed by product and subsequent CoA release. Other family members include Arginine/ornithine N-succinyltransferase, Myristoyl-CoA: protein N-myristoyltransferase, and Acyl-homoserinelactone synthase which have a similar catalytic mechanism but differ in types of acyl groups transferred. Leucyl/phenylalanyl-tRNA-protein transferase and FemXAB nonribosomal peptidyltransferases which catalyze similar peptidyltransferase reactions are also included.	0.00722028
NC_018524.1|WP_014909293.1|2259805_2261059_-|lanthionine-synthetase-C-family-protein	gnl|CDD|271201	cd04793, LanC, Cyclases involved in the biosynthesis of lantibiotics. LanC is the cyclase enzyme of the lanthionine synthetase. Lanthinoine is a lantibiotic, a unique class of peptide antibiotics. They are ribosomally synthesized as precursor peptides and then post-translationally modified to contain thioether cross-links called lanthionines (Lans) or methyllanthionines (MeLans) in addition to 2,3-didehydroalanine (Dha) and (Z)-2,3-didehydrobutyrine (Dhb). These unusual amino acids are introduced by the dehydration of serine and threonine residues, followed by thioether formation via addition of cysteine thiols, catalysed by LanB and LanC or LanM. LanC, the cyclase component, is a zinc metalloprotein, whose bound metal has been proposed to activate the thiol substrate for nucleophilic addition. Also contains SpaC (the cyclase involved in the biosynthesis of subtilin), NisC, and homologs.	8.62538e-110
NC_018524.1|WP_148281691.1|2264367_2265540_-|methyltransferase,-FxLD-system	gnl|CDD|275158	TIGR04364, methyltran_FxLD, methyltransferase, FxLD system. Members of this family resemble occur regularly in the vicinity of lantibiotic biosynthesis enzymes and their probable target, the FxLD family of putative ribosomal natural product precursor (TIGR04363). Members resemble protein-L-isoaspartate O-methyltransferase (TIGR00080) and a predicted methyltranserase, TIGR04188, of another putative peptide modification system.	1.67513e-143
NC_018524.1|WP_014912507.1|2248778_2249333_-|pentapeptide-repeat-containing-protein	gnl|CDD|224276	COG1357, COG1357, Pentapeptide repeats containing protein [Function unknown].	9.5763e-10
NC_018524.1|WP_041561796.1|2261055_2264085_-|lantibiotic-dehydratase	gnl|CDD|377403	pfam04738, Lant_dehydr_N, Lantibiotic dehydratase, C-terminus. Lantibiotics are ribosomally synthesized antimicrobial agents derived from ribosomally synthesized peptides. They are produced by bacteria of the Firmicutes phylum, and include mutacin, subtilin, and nisin. Lantibiotic peptides contain thioether bridges termed lanthionines that are thought to be generated by dehydration of serine and threonine residues followed by addition of cysteine residues. This family constitutes the N-terminus of the enzyme proposed to catalyze the dehydration step, via glutamylation of the substrate during lantibiotic biosynthesis. The enzyme dehydrates Ser/Thr residues in the precursor by glutamylation.	0
NC_018524.1|WP_187294551.1|2266048_2267245_+|helix-turn-helix-domain-containing-protein	gnl|CDD|379262	pfam13560, HTH_31, Helix-turn-helix domain. This domain is a helix-turn-helix domain that probably binds to DNA.	0.00041684
NC_018524.1|WP_014909792.1|2247288_2247852_-|RNA-polymerase-sigma-factor	gnl|CDD|224511	COG1595, RpoE, DNA-directed RNA polymerase specialized sigma subunit, sigma24 homolog [Transcription].	6.13711e-23
NC_018524.1|WP_041561795.1|2258955_2259783_-|bacteriocin-biosynthesis-protein	gnl|CDD|274836	TIGR03891, lantibiotic_dehydratase, thiopeptide-type bacteriocin biosynthesis domain. This domain occurs within longer proteins that contain lantibiotic dehydratase domains (see pfam04737 and pfam04738), and as single-domain proteins in bacteriocin biosynthesis genomic contexts. Three named genes in this family, SioK in Streptomyces sioyaensis, TsrD in Streptomyces laurentii, and NosD in Streptomyces actuosus, all occur in regions associated with thiopeptide biosynthesis. [Cellular processes, Toxin production and resistance].	3.43728e-47
NC_018524.1|WP_014913237.1|2245277_2246099_-|NshR/TsnR-family-23S-rRNA-methyltransferase	gnl|CDD|349981	cd18108, SpoU-like_NHR, Nosiheptide-resistance methyltransferase (NHR). Nosiheptide-resistance methyltransferase (NHR) confers resistance to the thiazole antibiotic nosiheptide via catalyzing 2'O-methylation of 23S rRNA at the nucleotide A1067. NHR is a member of the SPOUT (SpoU-TrmD) methyltransferase (MTase) superfamily, a large class of S-adenosyl-L-methionine (AdoMet or SAM)-dependent RNA MTases which are structurally characterized by a deep trefoil knot.	2.08095e-72
NC_018524.1|WP_014909607.1|2255550_2256390_-|IS5-family-transposase	gnl|CDD|379129	pfam13340, DUF4096, Putative transposase of IS4/5 family (DUF4096).	4.54386e-32
NC_018524.1|WP_187294586.1|2256526_2257669_+|IS701-family-transposase	gnl|CDD|379252	pfam13546, DDE_5, DDE superfamily endonuclease. This family of proteins are related to pfam00665 and are probably endonucleases of the DDE superfamily. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	1.46783e-53

Protein sequences

>NC_018524.1|WP_014910569.1|2253207_2254032_+|helix-turn-helix-domain-containing-protein
MALEPDELAAASGNLGETLRELRRGAGLSGERLARRCSMSQSKISKIETGRLIPTLVDLDRLLTALEVSPEQAGPVLAKVRAANTEWQGKRELWRKGLETRQHELCFLETSATEAGYFLPTMVTGLLATPAYIRASLTHSPGDVSATVAKKIARQEVLREGPCSFTFLLTEQAVRWAILPPEGMAEQAARLVEVSRLERVRLGVIPLGAVLPRGPRNTFTVYDDRLATVEIFTGRLAFREPLDVGTYRELFAMYEEHALFGDQARERIRSWFEV
>NC_018524.1|WP_041562164.1|2252375_2252885_+|hypothetical-protein
MAQDEFDGLFEEFESECLHMEMRDSYGTQAEILPFAKWAEGEEDDFAWMDGWCDTLRRGRAKGKVFRRVLVVSEPLSRYQRWAHSTTPPLVEAGEDIRWVPRRTVSSLALPGNDFYLIDGEKVVFMHYSGEGAMEDIVVSTDPADIELCRSAFGAVWGRAIPHSDYRVV
>NC_018524.1|WP_014908190.1|2251659_2252202_-|hypothetical-protein
MNRFIEPGPDFRELFLSFEHTAFRLETRDHYGAPYEQESLRRFLADEPDDLPWLRSWLDMIREATAAGRLFSRVRVVSTPLTDYSRFGVWCSRFTTGAGEDIRYLERGRAEDSGLPRHDYWLFDSRTLLKMHFDDSSVFLGGQIIEDPQEVVRHNHWRDVARHHAVEREDFAAEQRLQRV
>NC_018524.1|WP_014910170.1|2250259_2250784_+|GNAT-family-N-acetyltransferase
MFTMRPATKADIPAVAEMVASRCDWMERRGLESWRENIDDLAGQAAAGFMWVLTVGERIVGCTTVTTQAPPKDWTAREAEEPSLYLFTTVTDPAYREHRPGTLIAWWAVDQAARQGRRWVRRGCYFPKLAEYYESQGYTLVKEQERSAGHLYLLARRAERLDLDALGLTTRSPV
>NC_018524.1|WP_014911866.1|2249342_2249510_-|hypothetical-protein
MTTILTGLEASERAADLIDRLQPTTPVGLFDNRDTWDNVGGGPWYHRSTWDNWKK
>NC_018524.1|WP_014912507.1|2248778_2249333_-|pentapeptide-repeat-containing-protein
MQTAEIRGAKVLLPSDDEPAVRVWPYSDPLEEEKVANTHFASLDLTSHRLVDINLNRCRFTGSRLMGVSLARVSMSDVLFEGCQFDYATWEQVKVTGDVAFVGCSFKEAEIIGSDLRGAVFDDCAFAANIKSTKMSGADLRGSDLSGLSGLASLHGAQVTELQLRQLSEVMIRDLDLTITELPL
>NC_018524.1|WP_014911180.1|2248062_2248365_+|hypothetical-protein
MTPVQIVRAAAVTLIAGGSVLGLVPGGPCGAGWWSPDGAHGAASFGWFAYSEISTPPREFGISGCATATAPVASWAIALLVMGAVLLVLSFNAHRLGRSK
>NC_018524.1|WP_014909792.1|2247288_2247852_-|RNA-polymerase-sigma-factor
MRRGRAGDDHSGQRDFNALFEEHYDAVYRYARRRVGPDQADDVASEAFVVAWRRRDRLPPGRELPWLYACARRIGLAHHRLERRQGSIAASLERETDTTHHDDTDRVLDRDRALAALARLTEIERELVMLVTWEGLDCRQAAKVVGCTHVTARGRLHRARRKLTAYMKADAPEPARVRVPKEVSWTT
>NC_018524.1|WP_014912647.1|2246224_2247301_-|CU044_5270-family-protein
MDDLTALRAAFDGTDPAADARPTPEARQRARVEAIARLKEHESMTRPLWKRVPVLVAGAATAALAVGAGVIVLPGDDHVGIPLAYAAQPEPIEVTGGDPVDGTERLTELADVAAERGAAPGEGDVAFVSTSDVQLHRLTANAGDEDPPESYGYRFVPYDRTGWEAPNGDVRRDSDPKPPLEAGGAEADHEWFLEQGSESYEDTLHESLVWPADLPTDTEGMLEVLADYGEGPEDESLPALTNAVDRLYESRPLSGSEEAAVQRVFAEVADVSYLGSATDSLGREGELFSFEVEDEGLVTEVRYMYDAEDGALLYRDATLLEEAPEYGDAADFGLEYPLLTEQVGFVWSGWVGAIGERP
>NC_018524.1|WP_014913237.1|2245277_2246099_-|NshR/TsnR-family-23S-rRNA-methyltransferase
MDNLEIIENASDPAVQRILDVTKSSRANIKTTLIEDAEPLTQCIRAGVEFIEIYGIETQPPSEELLELCRERRIPVRLFATSVVNQVFKGERKPKTFGIARVPRPSRLSDIARRGGDVIVLDGVRIVGNIGAITRSALALGASGIILVDSDLTSVADRRLIRASRGYVFSLPIVLAEREEAISFVRKEGIPLLVLDADGDVPLKSLGDNKERLALLFGSEKGGPSEMFEEASSASISIPMISSTESLNVSVSVGIVLHERIGPNFEARRSDPR
>NC_018524.1|WP_148281609.1|2254769_2255393_-|hypothetical-protein
MPFELKLAGQTHEGELAFGVAWPRSGRDSPGFGWSVDASTALKLLEAIKDGHLEAEQAQQILTDLISQAGELVDESRRIDWAYARCFGDCDLCMRRKAKYEGYVAKYSAWAQAWEAAGASPDRYPFAMTKSTVHRSDCGIVTPAPYSLQHKPIDLRTFAHIEGDVMVGALPSTRHETHVWMSERTGPKGGRNYRLCKTCSPEIDDGR
>NC_018524.1|WP_014909607.1|2255550_2256390_-|IS5-family-transposase
MTRRPTYPSDLTDEQWTLIEPLLPPANTGGRPEKHPRRDVVDAILYVVRTGCSWRHLPVDFPPWQTVYWYFSRWEEAKVTEQVMAVLRRRLRTAQGRGGEPSAGIIDSQSVKGADTVGQGSRGYDAGKKVNGRKRFIVTDTLGLLLVVCVMAASVQDRDGARTTLLSLYLCTPVRFVFADAGFAGKLVAWAERFVATTVHIVRKAPDQVGFAVIPRRWVVERSLAWLTAHRRLARDYERDPAVSEAMVRWAAIGQMARRLARGQDSVRQRAWTGQDLIP
>NC_018524.1|WP_187294586.1|2256526_2257669_+|IS701-family-transposase
MTDLETWSRSFSEFTASFAHRFPRVESRRQATSYLRGLLSELERKNGWTLAEMCGEQGPERLQRLLNFYAWDTDGVRDDVRDLVVEVLADPDHGVLILDDTGFLKKGTKSAGVARQYSGTAGRIENCQIGVFLAYASSKGRALIDRELYLPKAWTEDRDRCRASGIGEQVAFATKNELGHAMLRRAVQSGIPFGWVTADEAYGQVSRLRLWMEEHDIHHVVAVPKSQTVITMDLGQERAHRLIADLPEQAWERLSCADGAHGPRVYDWARADIRPWREPGKGHWLLARRSITDPEELAYYICFADENTTLVELARVAASRWAVEECFQAAKNETGLDHYQVRGYRAWYRHITLSMAALAFLVRLRQGVQKGDQNTPRACV
>NC_018524.1|WP_187294550.1|2257762_2258818_-|hypothetical-protein
MTRACEAMNKAALIASDTGQPDLAEALCWQQYETFAPAAPLTAKAATFAVQPLVNLGRLAIRTGNPSDAYTVLESLFEAVDRGGPANVLGRSRPVGNLVDTPGERAELRRFLWAVLLADGTRALCASERWQDAMHHLHRYRGIGLRMLDGRQAAVLAALHLEDIDTATDLLAATDRSQAWEHAVAACLSVATDLVAGRDSASAVTSMIETVRHLPPTPGGTVFATRLGVLACELAPDQHALATHLITGALETTDAHVAAAVLGSPTLATRLTEEQGQVLREHVTQAQPTGTKRPIGLEEELVEIGNRAAGFLIRGLQTSGLDVTDLSTATTGCCLCVCDSGSPGHAAGTGV
>NC_018524.1|WP_041561795.1|2258955_2259783_-|bacteriocin-biosynthesis-protein
MPNDAPITEMWWQVNVEFPDPATDEQTGVHHLAPALKQSGRAWFLMRKKGAWRCRTHLPDTPAGQTAVREQVGELLDEITHTGHISTWTPVVYEPETRAFGGTEAMAAAHALFCADTRHLMEFLAAAEGGPDRRKEVSLLLCHTLMRAAGLDRYEQGDVWDRVASTRPLHTAGPPPEKVHHKVHRLLSVDPGPRAAHFAPSGAFAGFALWAQAFQDCGHELADLHTRGRLERGLRAVLAHHVIFCWNRLGLSAPVQAVLSHTAARIIFDPETVNL
>NC_018524.1|WP_014909293.1|2259805_2261059_-|lanthionine-synthetase-C-family-protein
MTVTVTIANRAHTTAQEILDSLADPDHVRFLPDKPALRQRPSSMGGGAAGVALAHVEAARTGHGPWESARTWIARALSEPINGSNTATLWSGAPALGLLTTIAATSPARLARARARLAGATTRLTLDRLSQANTRIDRGQGPSLAEFDLIQGLTGLAVYHLHTHPEAPITRHVLAYLVRLSRPLPDDPHRLPGWWTEHSPHNSPAPEFPGGHLNLGMAHGIAAPLAVLSLALRHGVTVDGHTDAIGRILDVLDARRHAGPRGTWWPYYLTPQRWENGPTTAACEQRPTWCYGTPGLARAQQLAGIALHDPHRQAMAEQTMADCLRDASQLDTLADLGLCHGWAGLLHCAWRINTDAPDTPLTQDLDRIATTLLDRLEGEPHPDPEFLDGRAGIALALHTYANGAAPGVPWDAHLALA
>NC_018524.1|WP_041561796.1|2261055_2264085_-|lantibiotic-dehydratase
MHPRFTAHPTGVLRVSALSSPGDAPPWPNGPIDSPEHHDAWIAWLRQVHDHPVLGAAIRDAGPTLVQRIGRVCQGNASGRDLTRVARSTARYVLRAQSRAAPFGLFAGVAPTRFTSAVSGTIGVDHRPMARVSAAWTTAAVDRLESCEPEFTAHLPVVVNTLAVVRDDRILVEHQPEPGADQGTRSSLRLTAPARMVLETARTPTSWAQVEAALNTAFPDRGDAVRALVGTLVRHRVLLTCLHPPMDTPDPLRHLITAARGAGADRYPRAAAVLAHLEAAQRSLEDHDHAPEPAVRAAAMSRSRTALAAVAPVDAPTSVDLRLESDLDLPRTVSWQIQDAAGVLARLSPVRQCTPAWADYHRRFCERYGIGAVVPVTEVIDPDRGLGLPAGFHGSRLPTPPAQALSERDAVLLDLAQQAAVDGTGEIVVDDALLDRLGAAPLDAVWPHTELRVRVHATSREALDAGDFRVVVAGASRGAGTTVGRFLDLLPPSGRDPLLDLYRRLPTLRQDAILAQLTCPASSARGDQVSRTPVVLPTRLALGQHHPADPNALGLDDLAVTADPHRLHLVTRYGLRPVEPVVFHALEFTRAAHPQMRFLTELPWAFTAVLVPFSWGAATHLPYLPRVRWRQCVLAPARWRLDAHTLPGPHAPWQEWVDHLDQWRATRRVPAQVELGENDQRLRLNLDLSAHQDLVRSELVTAGRVFLREASTDRELGWIGGRAHELVATVTATQTPIRVRTLPGSAHPRSPEHLPGTMAGWCSLKLYGHPDRTTELITEEFPRLSASERALSWWFLRYRDPEPHLRVRIRVEGPEQLGAVHTWTRDLRERGLVATIVHDTYTPESGRFGPGAAMKAAETLFVADSRAVTSQLTTESTDHGTRVWAAVSMTDLVHHLLGDEPTARRWLIDHAPPGVTDRGEAQRTITLTHPDHDDRPALLRDAWQNRAEAASAYTKALADFGFTASHILPDLLHLHSTRLFGPDPDAERACLSLARAAALSWNARAKEGQ
>NC_018524.1|WP_014913548.1|2264169_2264316_-|FxLD-family-lanthipeptide
MNEHQIDADGFDLDVEVVESGPRLDALLNLTGDNCGTTCESACSTTCA
>NC_018524.1|WP_148281691.1|2264367_2265540_-|methyltransferase,-FxLD-system
MVDTLLHLQKEWGMPEISDRVASVLRKVPRHVFVPEVSLDEAYAPDYAPPIRRAEDGLVTSSMSAVRVQAMMLDQAGLEPGMRVLEIGSGGYNAALIAELVGSTGEVTTIDIDPEVTDRARRYLDEAGYQDVRVVTGDADTGVPEFAPYDRIIVTVRAWDLPPAWIAQLTETGRLITPMRLRGVNRTVAFDRIDGHLVSRPDHHLTVFVPMQGAGAHEERGIAVQGNEIALYSAEEPVDVSALRKALHGPRKEFWSGVEFTHPDRLHLWIASHADRYALLHVAEDVLEHGPAGPLARQPVPVVLADDGSVAVRTKRALGEGRFEIGVFAYGPQGERAAQDYIDVLRAWERHDGSMARIEVWPSGTPETDLPTDRVRVLDKAHTRTVLAWT
>NC_018524.1|WP_187294551.1|2266048_2267245_+|helix-turn-helix-domain-containing-protein
MVLLLHHATGLTHEALAVLCGLTQSTITRALAGRGLTRPDVVTRVLTALGAPDVSRAPSFGSRPRSASTSWEQRLGQDATTTLEQVRALVNRAAPEEVVELLEADVRRLCSAYVHTPLTELYPHIIERRRAALDLASTLTHPEQSRRAHIAATRLVGLQTHASMDTGAYSHAFTHATAAQVLADRVADPGLKAWVCALHSLIAYWDSRPEDALRAAEAGLVHSVTDSNLARLHALRARAAAAFGDRNTTRDAIAAAEDHNGQTVLPGVLGFPQAKTHTYAGTALLALGSPAERRLAISHTERAIALYTGPTRSTGDLLAARLDLATAHLRDHDPDGALEQIDLVCASPPEQRTASIAQRVRGLIPLAQGLQTPLALRIRDRLFAFDPTPTAHRSPTVR

Crispr_ID: NC_018524_12

• CRISPR_ID: NC_018524_12
• CRISPR_location: 2254140-2254354
• CRISPR_type: Orphan
• Repeat_type: I-E
• Spacer_info: 3 spacers

Consensus repeat of NC_018524_12

Consensus_repeat	Method
TGGGTCCATCCCCGCGTGCGCGGGGAGCAGTC	PILER-CR
CTGCTCCCCGCGCACGCGGGGATGGACCC	CRISPRCasFinder
CTGCTCCCCGCGCACGCGGGGATGGACCC	CRT

spacers of NC_018524_12

>12.1|2254172|29|NC_018524|PILER-CR
ACTCCCACGTCAACGTCCTGCCACTGTGG
>12.2|2254233|29|NC_018524|PILER-CR
CTCGTCGGGGGCTTTTTCACGCCCTTATT
>12.3|2254171|32|NC_018524|CRISPRCasFinder,CRT
AACTCCCACGTCAACGTCCTGCCACTGTGGGT
>12.4|2254232|32|NC_018524|CRISPRCasFinder,CRT
ACTCGTCGGGGGCTTTTTCACGCCCTTATTCC
>12.5|2254293|32|NC_018524|CRISPRCasFinder,CRT
TGCGTCATGTGCTGGCCAGGCCCCGCACGTAC

CRISPR arrays and Neighbor proteins around NC_018524_12

CRISPR arrays

The CRISPR arrays of NC_018524_12

>merge|NC_018524|12|2254140-2254354|PILER-CR,CRISPRCasFinder,CRT
GACTGCTCCCCGCGCACGCGGGGATGGACCCAACTCCCACGTCAACGTCCTGCCACTGTGGGTCTGCTCCCCGCGCACGCGGGGATGGACCCACTCGTCGGGGGCTTTTTCACGCCCTTATTCCCTGCTCCCCGCGCACGCGGGGATGGACCCTGCGTCATGTGCTGGCCAGGCCCCGCACGTACCTGCTCCCCGCGCACGCGGGGATGGGACGT

>NC_018524|12|10|2254140-2254293|PILER-CR
GACTGCTCCCCGCGCACGCGGGGATGGACCCA	ACTCCCACGTCAACGTCCTGCCACTGTGG
GTCTGCTCCCCGCGCACGCGGGGATGGACCCA	CTCGTCGGGGGCTTTTTCACGCCCTTATT
CCCTGCTCCCCGCGCACGCGGGGATGGACCCT

>NC_018524|12|11|2254142-2254354|CRISPRCasFinder
CTGCTCCCCGCGCACGCGGGGATGGACCC	AACTCCCACGTCAACGTCCTGCCACTGTGGGT
CTGCTCCCCGCGCACGCGGGGATGGACCC	ACTCGTCGGGGGCTTTTTCACGCCCTTATTCC
CTGCTCCCCGCGCACGCGGGGATGGACCC	TGCGTCATGTGCTGGCCAGGCCCCGCACGTAC
CTGCTCCCCGCGCACGCGGGGATGGGACGT

>NC_018524|12|8|2254142-2254353|CRT
CTGCTCCCCGCGCACGCGGGGATGGACCC	AACTCCCACGTCAACGTCCTGCCACTGTGGGT
CTGCTCCCCGCGCACGCGGGGATGGACCC	ACTCGTCGGGGGCTTTTTCACGCCCTTATTCC
CTGCTCCCCGCGCACGCGGGGATGGACCC	TGCGTCATGTGCTGGCCAGGCCCCGCACGTAC
CTGCTCCCCGCGCACGCGGGGATGGGACG

Neighbor Proteins Overview

Protein	Signature genes	Signature genes Name	Protein_function
NC_018524.1|WP_014913548.1|2264169_2264316_-|FxLD-family-lanthipeptide	unknown	unknown	gnl|CDD|275157
NC_018524.1|WP_187294550.1|2257762_2258818_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014908190.1|2251659_2252202_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014910569.1|2253207_2254032_+|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl|CDD|238045
NC_018524.1|WP_187294551.1|2266048_2267245_+|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl|CDD|379262
NC_018524.1|WP_014910170.1|2250259_2250784_+|GNAT-family-N-acetyltransferase	unknown	unknown	gnl|CDD|173926
NC_018524.1|WP_014909293.1|2259805_2261059_-|lanthionine-synthetase-C-family-protein	unknown	unknown	gnl|CDD|271201
NC_018524.1|WP_014909607.1|2255550_2256390_-|IS5-family-transposase	unknown	unknown	gnl|CDD|379129
NC_018524.1|WP_148281691.1|2264367_2265540_-|methyltransferase,-FxLD-system	unknown	unknown	gnl|CDD|275158
NC_018524.1|WP_014913237.1|2245277_2246099_-|NshR/TsnR-family-23S-rRNA-methyltransferase	unknown	unknown	gnl|CDD|349981
NC_018524.1|WP_041561796.1|2261055_2264085_-|lantibiotic-dehydratase	unknown	unknown	gnl|CDD|377403
NC_018524.1|WP_014911866.1|2249342_2249510_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014911180.1|2248062_2248365_+|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_041561795.1|2258955_2259783_-|bacteriocin-biosynthesis-protein	unknown	unknown	gnl|CDD|274836
NC_018524.1|WP_014909792.1|2247288_2247852_-|RNA-polymerase-sigma-factor	unknown	unknown	gnl|CDD|224511
NC_018524.1|WP_041562164.1|2252375_2252885_+|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014912647.1|2246224_2247301_-|CU044_5270-family-protein	unknown	unknown	unknown
NC_018524.1|WP_014912507.1|2248778_2249333_-|pentapeptide-repeat-containing-protein	unknown	unknown	gnl|CDD|224276
NC_018524.1|WP_148281609.1|2254769_2255393_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_187294586.1|2256526_2257669_+|IS701-family-transposase	unknown	unknown	gnl|CDD|379252

rpsblast for functional proteins

Protein	Function_ID	Function_description	E-value
NC_018524.1|WP_014913548.1|2264169_2264316_-|FxLD-family-lanthipeptide	gnl|CDD|275157	TIGR04363, hypothetical_protein, FxLD family lantipeptide. Members of this protein family occur with a cassette of lanthionine-type peptide modification enzymes. Members are small (about 60 amino acids long), rich in Cys, and variable in copy number per genome (from one to three). These features suggest that members of this family are modified to become lantipeptides, although not necessarily a lantibiotic. There is no GlyGly cleavage motif to separate a leader peptide from core region.The considerable abundance in Streptomyces and relatively strong consideration hints at a non-antibiotic function. The motif FxLD in the N-terminal region is nearly invariant.	1.93056e-09
NC_018524.1|WP_014910569.1|2253207_2254032_+|helix-turn-helix-domain-containing-protein	gnl|CDD|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	2.19421e-11
NC_018524.1|WP_014910170.1|2250259_2250784_+|GNAT-family-N-acetyltransferase	gnl|CDD|173926	cd04301, NAT_SF, N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate. NAT (N-Acyltransferase) is a large superfamily of enzymes that mostly catalyze the transfer of an acyl group to a substrate and are implicated in a variety of functions, ranging from bacterial antibiotic resistance to circadian rhythms in mammals. Members include GCN5-related N-Acetyltransferases (GNAT) such as Aminoglycoside N-acetyltransferases, Histone N-acetyltransferase (HAT) enzymes, and Serotonin N-acetyltransferase, which catalyze the transfer of an acetyl group to a substrate. The kinetic mechanism of most GNATs involves the ordered formation of a ternary complex: the reaction begins with Acetyl Coenzyme A (AcCoA) binding, followed by binding of substrate, then direct transfer of the acetyl group from AcCoA to the substrate, followed by product and subsequent CoA release. Other family members include Arginine/ornithine N-succinyltransferase, Myristoyl-CoA: protein N-myristoyltransferase, and Acyl-homoserinelactone synthase which have a similar catalytic mechanism but differ in types of acyl groups transferred. Leucyl/phenylalanyl-tRNA-protein transferase and FemXAB nonribosomal peptidyltransferases which catalyze similar peptidyltransferase reactions are also included.	0.00722028
NC_018524.1|WP_014909293.1|2259805_2261059_-|lanthionine-synthetase-C-family-protein	gnl|CDD|271201	cd04793, LanC, Cyclases involved in the biosynthesis of lantibiotics. LanC is the cyclase enzyme of the lanthionine synthetase. Lanthinoine is a lantibiotic, a unique class of peptide antibiotics. They are ribosomally synthesized as precursor peptides and then post-translationally modified to contain thioether cross-links called lanthionines (Lans) or methyllanthionines (MeLans) in addition to 2,3-didehydroalanine (Dha) and (Z)-2,3-didehydrobutyrine (Dhb). These unusual amino acids are introduced by the dehydration of serine and threonine residues, followed by thioether formation via addition of cysteine thiols, catalysed by LanB and LanC or LanM. LanC, the cyclase component, is a zinc metalloprotein, whose bound metal has been proposed to activate the thiol substrate for nucleophilic addition. Also contains SpaC (the cyclase involved in the biosynthesis of subtilin), NisC, and homologs.	8.62538e-110
NC_018524.1|WP_148281691.1|2264367_2265540_-|methyltransferase,-FxLD-system	gnl|CDD|275158	TIGR04364, methyltran_FxLD, methyltransferase, FxLD system. Members of this family resemble occur regularly in the vicinity of lantibiotic biosynthesis enzymes and their probable target, the FxLD family of putative ribosomal natural product precursor (TIGR04363). Members resemble protein-L-isoaspartate O-methyltransferase (TIGR00080) and a predicted methyltranserase, TIGR04188, of another putative peptide modification system.	1.67513e-143
NC_018524.1|WP_014912507.1|2248778_2249333_-|pentapeptide-repeat-containing-protein	gnl|CDD|224276	COG1357, COG1357, Pentapeptide repeats containing protein [Function unknown].	9.5763e-10
NC_018524.1|WP_041561796.1|2261055_2264085_-|lantibiotic-dehydratase	gnl|CDD|377403	pfam04738, Lant_dehydr_N, Lantibiotic dehydratase, C-terminus. Lantibiotics are ribosomally synthesized antimicrobial agents derived from ribosomally synthesized peptides. They are produced by bacteria of the Firmicutes phylum, and include mutacin, subtilin, and nisin. Lantibiotic peptides contain thioether bridges termed lanthionines that are thought to be generated by dehydration of serine and threonine residues followed by addition of cysteine residues. This family constitutes the N-terminus of the enzyme proposed to catalyze the dehydration step, via glutamylation of the substrate during lantibiotic biosynthesis. The enzyme dehydrates Ser/Thr residues in the precursor by glutamylation.	0
NC_018524.1|WP_187294551.1|2266048_2267245_+|helix-turn-helix-domain-containing-protein	gnl|CDD|379262	pfam13560, HTH_31, Helix-turn-helix domain. This domain is a helix-turn-helix domain that probably binds to DNA.	0.00041684
NC_018524.1|WP_014909792.1|2247288_2247852_-|RNA-polymerase-sigma-factor	gnl|CDD|224511	COG1595, RpoE, DNA-directed RNA polymerase specialized sigma subunit, sigma24 homolog [Transcription].	6.13711e-23
NC_018524.1|WP_041561795.1|2258955_2259783_-|bacteriocin-biosynthesis-protein	gnl|CDD|274836	TIGR03891, lantibiotic_dehydratase, thiopeptide-type bacteriocin biosynthesis domain. This domain occurs within longer proteins that contain lantibiotic dehydratase domains (see pfam04737 and pfam04738), and as single-domain proteins in bacteriocin biosynthesis genomic contexts. Three named genes in this family, SioK in Streptomyces sioyaensis, TsrD in Streptomyces laurentii, and NosD in Streptomyces actuosus, all occur in regions associated with thiopeptide biosynthesis. [Cellular processes, Toxin production and resistance].	3.43728e-47
NC_018524.1|WP_014913237.1|2245277_2246099_-|NshR/TsnR-family-23S-rRNA-methyltransferase	gnl|CDD|349981	cd18108, SpoU-like_NHR, Nosiheptide-resistance methyltransferase (NHR). Nosiheptide-resistance methyltransferase (NHR) confers resistance to the thiazole antibiotic nosiheptide via catalyzing 2'O-methylation of 23S rRNA at the nucleotide A1067. NHR is a member of the SPOUT (SpoU-TrmD) methyltransferase (MTase) superfamily, a large class of S-adenosyl-L-methionine (AdoMet or SAM)-dependent RNA MTases which are structurally characterized by a deep trefoil knot.	2.08095e-72
NC_018524.1|WP_014909607.1|2255550_2256390_-|IS5-family-transposase	gnl|CDD|379129	pfam13340, DUF4096, Putative transposase of IS4/5 family (DUF4096).	4.54386e-32
NC_018524.1|WP_187294586.1|2256526_2257669_+|IS701-family-transposase	gnl|CDD|379252	pfam13546, DDE_5, DDE superfamily endonuclease. This family of proteins are related to pfam00665 and are probably endonucleases of the DDE superfamily. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	1.46783e-53

Protein sequences

>NC_018524.1|WP_014910569.1|2253207_2254032_+|helix-turn-helix-domain-containing-protein
MALEPDELAAASGNLGETLRELRRGAGLSGERLARRCSMSQSKISKIETGRLIPTLVDLDRLLTALEVSPEQAGPVLAKVRAANTEWQGKRELWRKGLETRQHELCFLETSATEAGYFLPTMVTGLLATPAYIRASLTHSPGDVSATVAKKIARQEVLREGPCSFTFLLTEQAVRWAILPPEGMAEQAARLVEVSRLERVRLGVIPLGAVLPRGPRNTFTVYDDRLATVEIFTGRLAFREPLDVGTYRELFAMYEEHALFGDQARERIRSWFEV
>NC_018524.1|WP_041562164.1|2252375_2252885_+|hypothetical-protein
MAQDEFDGLFEEFESECLHMEMRDSYGTQAEILPFAKWAEGEEDDFAWMDGWCDTLRRGRAKGKVFRRVLVVSEPLSRYQRWAHSTTPPLVEAGEDIRWVPRRTVSSLALPGNDFYLIDGEKVVFMHYSGEGAMEDIVVSTDPADIELCRSAFGAVWGRAIPHSDYRVV
>NC_018524.1|WP_014908190.1|2251659_2252202_-|hypothetical-protein
MNRFIEPGPDFRELFLSFEHTAFRLETRDHYGAPYEQESLRRFLADEPDDLPWLRSWLDMIREATAAGRLFSRVRVVSTPLTDYSRFGVWCSRFTTGAGEDIRYLERGRAEDSGLPRHDYWLFDSRTLLKMHFDDSSVFLGGQIIEDPQEVVRHNHWRDVARHHAVEREDFAAEQRLQRV
>NC_018524.1|WP_014910170.1|2250259_2250784_+|GNAT-family-N-acetyltransferase
MFTMRPATKADIPAVAEMVASRCDWMERRGLESWRENIDDLAGQAAAGFMWVLTVGERIVGCTTVTTQAPPKDWTAREAEEPSLYLFTTVTDPAYREHRPGTLIAWWAVDQAARQGRRWVRRGCYFPKLAEYYESQGYTLVKEQERSAGHLYLLARRAERLDLDALGLTTRSPV
>NC_018524.1|WP_014911866.1|2249342_2249510_-|hypothetical-protein
MTTILTGLEASERAADLIDRLQPTTPVGLFDNRDTWDNVGGGPWYHRSTWDNWKK
>NC_018524.1|WP_014912507.1|2248778_2249333_-|pentapeptide-repeat-containing-protein
MQTAEIRGAKVLLPSDDEPAVRVWPYSDPLEEEKVANTHFASLDLTSHRLVDINLNRCRFTGSRLMGVSLARVSMSDVLFEGCQFDYATWEQVKVTGDVAFVGCSFKEAEIIGSDLRGAVFDDCAFAANIKSTKMSGADLRGSDLSGLSGLASLHGAQVTELQLRQLSEVMIRDLDLTITELPL
>NC_018524.1|WP_014911180.1|2248062_2248365_+|hypothetical-protein
MTPVQIVRAAAVTLIAGGSVLGLVPGGPCGAGWWSPDGAHGAASFGWFAYSEISTPPREFGISGCATATAPVASWAIALLVMGAVLLVLSFNAHRLGRSK
>NC_018524.1|WP_014909792.1|2247288_2247852_-|RNA-polymerase-sigma-factor
MRRGRAGDDHSGQRDFNALFEEHYDAVYRYARRRVGPDQADDVASEAFVVAWRRRDRLPPGRELPWLYACARRIGLAHHRLERRQGSIAASLERETDTTHHDDTDRVLDRDRALAALARLTEIERELVMLVTWEGLDCRQAAKVVGCTHVTARGRLHRARRKLTAYMKADAPEPARVRVPKEVSWTT
>NC_018524.1|WP_014912647.1|2246224_2247301_-|CU044_5270-family-protein
MDDLTALRAAFDGTDPAADARPTPEARQRARVEAIARLKEHESMTRPLWKRVPVLVAGAATAALAVGAGVIVLPGDDHVGIPLAYAAQPEPIEVTGGDPVDGTERLTELADVAAERGAAPGEGDVAFVSTSDVQLHRLTANAGDEDPPESYGYRFVPYDRTGWEAPNGDVRRDSDPKPPLEAGGAEADHEWFLEQGSESYEDTLHESLVWPADLPTDTEGMLEVLADYGEGPEDESLPALTNAVDRLYESRPLSGSEEAAVQRVFAEVADVSYLGSATDSLGREGELFSFEVEDEGLVTEVRYMYDAEDGALLYRDATLLEEAPEYGDAADFGLEYPLLTEQVGFVWSGWVGAIGERP
>NC_018524.1|WP_014913237.1|2245277_2246099_-|NshR/TsnR-family-23S-rRNA-methyltransferase
MDNLEIIENASDPAVQRILDVTKSSRANIKTTLIEDAEPLTQCIRAGVEFIEIYGIETQPPSEELLELCRERRIPVRLFATSVVNQVFKGERKPKTFGIARVPRPSRLSDIARRGGDVIVLDGVRIVGNIGAITRSALALGASGIILVDSDLTSVADRRLIRASRGYVFSLPIVLAEREEAISFVRKEGIPLLVLDADGDVPLKSLGDNKERLALLFGSEKGGPSEMFEEASSASISIPMISSTESLNVSVSVGIVLHERIGPNFEARRSDPR
>NC_018524.1|WP_148281609.1|2254769_2255393_-|hypothetical-protein
MPFELKLAGQTHEGELAFGVAWPRSGRDSPGFGWSVDASTALKLLEAIKDGHLEAEQAQQILTDLISQAGELVDESRRIDWAYARCFGDCDLCMRRKAKYEGYVAKYSAWAQAWEAAGASPDRYPFAMTKSTVHRSDCGIVTPAPYSLQHKPIDLRTFAHIEGDVMVGALPSTRHETHVWMSERTGPKGGRNYRLCKTCSPEIDDGR
>NC_018524.1|WP_014909607.1|2255550_2256390_-|IS5-family-transposase
MTRRPTYPSDLTDEQWTLIEPLLPPANTGGRPEKHPRRDVVDAILYVVRTGCSWRHLPVDFPPWQTVYWYFSRWEEAKVTEQVMAVLRRRLRTAQGRGGEPSAGIIDSQSVKGADTVGQGSRGYDAGKKVNGRKRFIVTDTLGLLLVVCVMAASVQDRDGARTTLLSLYLCTPVRFVFADAGFAGKLVAWAERFVATTVHIVRKAPDQVGFAVIPRRWVVERSLAWLTAHRRLARDYERDPAVSEAMVRWAAIGQMARRLARGQDSVRQRAWTGQDLIP
>NC_018524.1|WP_187294586.1|2256526_2257669_+|IS701-family-transposase
MTDLETWSRSFSEFTASFAHRFPRVESRRQATSYLRGLLSELERKNGWTLAEMCGEQGPERLQRLLNFYAWDTDGVRDDVRDLVVEVLADPDHGVLILDDTGFLKKGTKSAGVARQYSGTAGRIENCQIGVFLAYASSKGRALIDRELYLPKAWTEDRDRCRASGIGEQVAFATKNELGHAMLRRAVQSGIPFGWVTADEAYGQVSRLRLWMEEHDIHHVVAVPKSQTVITMDLGQERAHRLIADLPEQAWERLSCADGAHGPRVYDWARADIRPWREPGKGHWLLARRSITDPEELAYYICFADENTTLVELARVAASRWAVEECFQAAKNETGLDHYQVRGYRAWYRHITLSMAALAFLVRLRQGVQKGDQNTPRACV
>NC_018524.1|WP_187294550.1|2257762_2258818_-|hypothetical-protein
MTRACEAMNKAALIASDTGQPDLAEALCWQQYETFAPAAPLTAKAATFAVQPLVNLGRLAIRTGNPSDAYTVLESLFEAVDRGGPANVLGRSRPVGNLVDTPGERAELRRFLWAVLLADGTRALCASERWQDAMHHLHRYRGIGLRMLDGRQAAVLAALHLEDIDTATDLLAATDRSQAWEHAVAACLSVATDLVAGRDSASAVTSMIETVRHLPPTPGGTVFATRLGVLACELAPDQHALATHLITGALETTDAHVAAAVLGSPTLATRLTEEQGQVLREHVTQAQPTGTKRPIGLEEELVEIGNRAAGFLIRGLQTSGLDVTDLSTATTGCCLCVCDSGSPGHAAGTGV
>NC_018524.1|WP_041561795.1|2258955_2259783_-|bacteriocin-biosynthesis-protein
MPNDAPITEMWWQVNVEFPDPATDEQTGVHHLAPALKQSGRAWFLMRKKGAWRCRTHLPDTPAGQTAVREQVGELLDEITHTGHISTWTPVVYEPETRAFGGTEAMAAAHALFCADTRHLMEFLAAAEGGPDRRKEVSLLLCHTLMRAAGLDRYEQGDVWDRVASTRPLHTAGPPPEKVHHKVHRLLSVDPGPRAAHFAPSGAFAGFALWAQAFQDCGHELADLHTRGRLERGLRAVLAHHVIFCWNRLGLSAPVQAVLSHTAARIIFDPETVNL
>NC_018524.1|WP_014909293.1|2259805_2261059_-|lanthionine-synthetase-C-family-protein
MTVTVTIANRAHTTAQEILDSLADPDHVRFLPDKPALRQRPSSMGGGAAGVALAHVEAARTGHGPWESARTWIARALSEPINGSNTATLWSGAPALGLLTTIAATSPARLARARARLAGATTRLTLDRLSQANTRIDRGQGPSLAEFDLIQGLTGLAVYHLHTHPEAPITRHVLAYLVRLSRPLPDDPHRLPGWWTEHSPHNSPAPEFPGGHLNLGMAHGIAAPLAVLSLALRHGVTVDGHTDAIGRILDVLDARRHAGPRGTWWPYYLTPQRWENGPTTAACEQRPTWCYGTPGLARAQQLAGIALHDPHRQAMAEQTMADCLRDASQLDTLADLGLCHGWAGLLHCAWRINTDAPDTPLTQDLDRIATTLLDRLEGEPHPDPEFLDGRAGIALALHTYANGAAPGVPWDAHLALA
>NC_018524.1|WP_041561796.1|2261055_2264085_-|lantibiotic-dehydratase
MHPRFTAHPTGVLRVSALSSPGDAPPWPNGPIDSPEHHDAWIAWLRQVHDHPVLGAAIRDAGPTLVQRIGRVCQGNASGRDLTRVARSTARYVLRAQSRAAPFGLFAGVAPTRFTSAVSGTIGVDHRPMARVSAAWTTAAVDRLESCEPEFTAHLPVVVNTLAVVRDDRILVEHQPEPGADQGTRSSLRLTAPARMVLETARTPTSWAQVEAALNTAFPDRGDAVRALVGTLVRHRVLLTCLHPPMDTPDPLRHLITAARGAGADRYPRAAAVLAHLEAAQRSLEDHDHAPEPAVRAAAMSRSRTALAAVAPVDAPTSVDLRLESDLDLPRTVSWQIQDAAGVLARLSPVRQCTPAWADYHRRFCERYGIGAVVPVTEVIDPDRGLGLPAGFHGSRLPTPPAQALSERDAVLLDLAQQAAVDGTGEIVVDDALLDRLGAAPLDAVWPHTELRVRVHATSREALDAGDFRVVVAGASRGAGTTVGRFLDLLPPSGRDPLLDLYRRLPTLRQDAILAQLTCPASSARGDQVSRTPVVLPTRLALGQHHPADPNALGLDDLAVTADPHRLHLVTRYGLRPVEPVVFHALEFTRAAHPQMRFLTELPWAFTAVLVPFSWGAATHLPYLPRVRWRQCVLAPARWRLDAHTLPGPHAPWQEWVDHLDQWRATRRVPAQVELGENDQRLRLNLDLSAHQDLVRSELVTAGRVFLREASTDRELGWIGGRAHELVATVTATQTPIRVRTLPGSAHPRSPEHLPGTMAGWCSLKLYGHPDRTTELITEEFPRLSASERALSWWFLRYRDPEPHLRVRIRVEGPEQLGAVHTWTRDLRERGLVATIVHDTYTPESGRFGPGAAMKAAETLFVADSRAVTSQLTTESTDHGTRVWAAVSMTDLVHHLLGDEPTARRWLIDHAPPGVTDRGEAQRTITLTHPDHDDRPALLRDAWQNRAEAASAYTKALADFGFTASHILPDLLHLHSTRLFGPDPDAERACLSLARAAALSWNARAKEGQ
>NC_018524.1|WP_014913548.1|2264169_2264316_-|FxLD-family-lanthipeptide
MNEHQIDADGFDLDVEVVESGPRLDALLNLTGDNCGTTCESACSTTCA
>NC_018524.1|WP_148281691.1|2264367_2265540_-|methyltransferase,-FxLD-system
MVDTLLHLQKEWGMPEISDRVASVLRKVPRHVFVPEVSLDEAYAPDYAPPIRRAEDGLVTSSMSAVRVQAMMLDQAGLEPGMRVLEIGSGGYNAALIAELVGSTGEVTTIDIDPEVTDRARRYLDEAGYQDVRVVTGDADTGVPEFAPYDRIIVTVRAWDLPPAWIAQLTETGRLITPMRLRGVNRTVAFDRIDGHLVSRPDHHLTVFVPMQGAGAHEERGIAVQGNEIALYSAEEPVDVSALRKALHGPRKEFWSGVEFTHPDRLHLWIASHADRYALLHVAEDVLEHGPAGPLARQPVPVVLADDGSVAVRTKRALGEGRFEIGVFAYGPQGERAAQDYIDVLRAWERHDGSMARIEVWPSGTPETDLPTDRVRVLDKAHTRTVLAWT
>NC_018524.1|WP_187294551.1|2266048_2267245_+|helix-turn-helix-domain-containing-protein
MVLLLHHATGLTHEALAVLCGLTQSTITRALAGRGLTRPDVVTRVLTALGAPDVSRAPSFGSRPRSASTSWEQRLGQDATTTLEQVRALVNRAAPEEVVELLEADVRRLCSAYVHTPLTELYPHIIERRRAALDLASTLTHPEQSRRAHIAATRLVGLQTHASMDTGAYSHAFTHATAAQVLADRVADPGLKAWVCALHSLIAYWDSRPEDALRAAEAGLVHSVTDSNLARLHALRARAAAAFGDRNTTRDAIAAAEDHNGQTVLPGVLGFPQAKTHTYAGTALLALGSPAERRLAISHTERAIALYTGPTRSTGDLLAARLDLATAHLRDHDPDGALEQIDLVCASPPEQRTASIAQRVRGLIPLAQGLQTPLALRIRDRLFAFDPTPTAHRSPTVR

Crispr_ID: NC_018524_14

• CRISPR_ID: NC_018524_14
• CRISPR_location: 2268230-2268687
• CRISPR_type: Orphan
• Repeat_type: I-E:I-E,II-B
• Spacer_info: 7 spacers

Consensus repeat of NC_018524_14

Consensus_repeat	Method
CGGTCCATCCCCACGTGCGTGGGGTTCAC	PILER-CR
CTGCTCCCCGCGCACGCGGGGATGACCCC	CRISPRCasFinder
GTGAACCCCACGCACGTGGGGATGGACCG	CRT

spacers of NC_018524_14

>14.1|2268259|33|NC_018524|PILER-CR,CRISPRCasFinder,CRT
GATGGGAGTACCTCCTCCAGGGACGCGCCTGGC
>14.2|2268321|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT
CCGATTCGCCGCCGTGGCCGCCACACTCACCG
>14.3|2268382|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT
GCGCACCCGGACCTCACCAAGGAGTTCACCCG
>14.4|2268443|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT
GACTATGGTCCCATTCAGGCCGCTCGGGCCAC
>14.5|2268504|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT
AGGTCTCTTCATTCAACGTTCGCGTAGTGCCC
>14.6|2268565|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT
AACACCGGTCTCGCGACCGGAGACGAGGTCAT
>14.7|2268626|32|NC_018524|CRISPRCasFinder,CRT
GTCGAGACGGTCCGGCACGAGGTCGAACACAA

CRISPR arrays and Neighbor proteins around NC_018524_14

CRISPR arrays

The CRISPR arrays of NC_018524_14

>merge|NC_018524|14|2268230-2268687|PILER-CR,CRISPRCasFinder,CRT
GTGAACCCCACGCACGTGGGGATGGACCGGATGGGAGTACCTCCTCCAGGGACGCGCCTGGCGTGAACCCCACGCACGTGGGGATGGACCCCCGATTCGCCGCCGTGGCCGCCACACTCACCGGTGAACCCCACGCACGTGGGGATGGACCGGCGCACCCGGACCTCACCAAGGAGTTCACCCGGTGAACCCCACGCACGTGGGGATGGACCGGACTATGGTCCCATTCAGGCCGCTCGGGCCACGTGAACCCCACGCACGTGGGGATGGACCGAGGTCTCTTCATTCAACGTTCGCGTAGTGCCCGTGAACCCCACGCACGTGGGGATGGACCGAACACCGGTCTCGCGACCGGAGACGAGGTCATCTGCACCCCACGCACGTGGGGATGGACCGGTCGAGACGGTCCGGCACGAGGTCGAACACAACTGAGCCCCACGTATGTGGGGATGGGCCGG

>NC_018524|14|11|2268230-2268625|PILER-CR
GTGAACCCCACGCACGTGGGGATGGACCG	GATGGGAGTACCTCCTCCAGGGACGCGCCTGGC
GTGAACCCCACGCACGTGGGGATGGACCC	CCGATTCGCCGCCGTGGCCGCCACACTCACCG
GTGAACCCCACGCACGTGGGGATGGACCG	GCGCACCCGGACCTCACCAAGGAGTTCACCCG
GTGAACCCCACGCACGTGGGGATGGACCG	GACTATGGTCCCATTCAGGCCGCTCGGGCCAC
GTGAACCCCACGCACGTGGGGATGGACCG	AGGTCTCTTCATTCAACGTTCGCGTAGTGCCC
GTGAACCCCACGCACGTGGGGATGGACCG	AACACCGGTCTCGCGACCGGAGACGAGGTCAT
CTGCACCCCACGCACGTGGGGATGGACCG

>NC_018524|14|13|2268230-2268687|CRISPRCasFinder
GTGAACCCCACGCACGTGGGGATGGACCG	GATGGGAGTACCTCCTCCAGGGACGCGCCTGGC
GTGAACCCCACGCACGTGGGGATGGACCC	CCGATTCGCCGCCGTGGCCGCCACACTCACCG
GTGAACCCCACGCACGTGGGGATGGACCG	GCGCACCCGGACCTCACCAAGGAGTTCACCCG
GTGAACCCCACGCACGTGGGGATGGACCG	GACTATGGTCCCATTCAGGCCGCTCGGGCCAC
GTGAACCCCACGCACGTGGGGATGGACCG	AGGTCTCTTCATTCAACGTTCGCGTAGTGCCC
GTGAACCCCACGCACGTGGGGATGGACCG	AACACCGGTCTCGCGACCGGAGACGAGGTCAT
CTGCACCCCACGCACGTGGGGATGGACCG	GTCGAGACGGTCCGGCACGAGGTCGAACACAA
CTGAGCCCCACGTATGTGGGGATGGGCCGG

>NC_018524|14|9|2268230-2268686|CRT
GTGAACCCCACGCACGTGGGGATGGACCG	GATGGGAGTACCTCCTCCAGGGACGCGCCTGGC
GTGAACCCCACGCACGTGGGGATGGACCC	CCGATTCGCCGCCGTGGCCGCCACACTCACCG
GTGAACCCCACGCACGTGGGGATGGACCG	GCGCACCCGGACCTCACCAAGGAGTTCACCCG
GTGAACCCCACGCACGTGGGGATGGACCG	GACTATGGTCCCATTCAGGCCGCTCGGGCCAC
GTGAACCCCACGCACGTGGGGATGGACCG	AGGTCTCTTCATTCAACGTTCGCGTAGTGCCC
GTGAACCCCACGCACGTGGGGATGGACCG	AACACCGGTCTCGCGACCGGAGACGAGGTCAT
CTGCACCCCACGCACGTGGGGATGGACCG	GTCGAGACGGTCCGGCACGAGGTCGAACACAA
CTGAGCCCCACGTATGTGGGGATGGGCCG

Neighbor Proteins Overview

Protein	Signature genes	Signature genes Name	Protein_function
NC_018524.1|WP_041561796.1|2261055_2264085_-|lantibiotic-dehydratase	unknown	unknown	gnl|CDD|377403
NC_018524.1|WP_014912826.1|2273773_2274025_+|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_187294552.1|2273163_2273340_+|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014911619.1|2271238_2271424_-|DUF397-domain-containing-protein	unknown	unknown	gnl|CDD|377231
NC_018524.1|WP_017536469.1|2275542_2275734_+|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl|CDD|133390
NC_018524.1|WP_014913548.1|2264169_2264316_-|FxLD-family-lanthipeptide	unknown	unknown	gnl|CDD|275157
NC_018524.1|WP_014910936.1|2272050_2272884_-|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl|CDD|379262
NC_018524.1|WP_014909112.1|2271416_2271626_-|DUF397-domain-containing-protein	unknown	unknown	gnl|CDD|377231
NC_018524.1|WP_187294550.1|2257762_2258818_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_148281691.1|2264367_2265540_-|methyltransferase,-FxLD-system	unknown	unknown	gnl|CDD|275158
NC_018524.1|WP_041561797.1|2274092_2274848_+|SAM-dependent-methyltransferase	unknown	unknown	gnl|CDD|252734
NC_018524.1|WP_014912062.1|2267256_2268096_+|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl|CDD|369777
NC_018524.1|WP_187294551.1|2266048_2267245_+|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl|CDD|379262
NC_018524.1|WP_081536491.1|2271850_2272042_-|DUF397-domain-containing-protein	unknown	unknown	gnl|CDD|377231
NC_018524.1|WP_014909293.1|2259805_2261059_-|lanthionine-synthetase-C-family-protein	unknown	unknown	gnl|CDD|271201
NC_018524.1|WP_041561795.1|2258955_2259783_-|bacteriocin-biosynthesis-protein	unknown	unknown	gnl|CDD|274836
NC_018524.1|WP_081536563.1|2268844_2270254_+|hypothetical-protein	unknown	unknown	gnl|CDD|224276
NC_018524.1|WP_041562167.1|2274988_2275486_+|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl|CDD|238045
NC_018524.1|WP_014909607.1|2255550_2256390_-|IS5-family-transposase	unknown	unknown	gnl|CDD|379129
NC_018524.1|WP_187294586.1|2256526_2257669_+|IS701-family-transposase	unknown	unknown	gnl|CDD|379252

rpsblast for functional proteins

Protein	Function_ID	Function_description	E-value
NC_018524.1|WP_041561796.1|2261055_2264085_-|lantibiotic-dehydratase	gnl|CDD|377403	pfam04738, Lant_dehydr_N, Lantibiotic dehydratase, C-terminus. Lantibiotics are ribosomally synthesized antimicrobial agents derived from ribosomally synthesized peptides. They are produced by bacteria of the Firmicutes phylum, and include mutacin, subtilin, and nisin. Lantibiotic peptides contain thioether bridges termed lanthionines that are thought to be generated by dehydration of serine and threonine residues followed by addition of cysteine residues. This family constitutes the N-terminus of the enzyme proposed to catalyze the dehydration step, via glutamylation of the substrate during lantibiotic biosynthesis. The enzyme dehydrates Ser/Thr residues in the precursor by glutamylation.	0
NC_018524.1|WP_014911619.1|2271238_2271424_-|DUF397-domain-containing-protein	gnl|CDD|377231	pfam04149, DUF397, Domain of unknown function (DUF397). The function of this family is unknown.	2.17941e-15
NC_018524.1|WP_017536469.1|2275542_2275734_+|helix-turn-helix-domain-containing-protein	gnl|CDD|133390	cd04762, HTH_MerR-trunc, Helix-Turn-Helix DNA binding domain of truncated MerR-like proteins. Proteins in this family mostly have a truncated helix-turn-helix (HTH) MerR-like domain. They lack a portion of the C-terminal region, called Wing 2 and the long dimerization helix that is typically present in MerR-like proteins. These truncated domains are found in response regulator receiver (REC) domain proteins (i.e., CheY), cytosine-C5 specific DNA methylases, IS607 transposase-like proteins, and RacA, a bacterial protein that anchors chromosomes to cell poles.	2.52461e-14
NC_018524.1|WP_014913548.1|2264169_2264316_-|FxLD-family-lanthipeptide	gnl|CDD|275157	TIGR04363, hypothetical_protein, FxLD family lantipeptide. Members of this protein family occur with a cassette of lanthionine-type peptide modification enzymes. Members are small (about 60 amino acids long), rich in Cys, and variable in copy number per genome (from one to three). These features suggest that members of this family are modified to become lantipeptides, although not necessarily a lantibiotic. There is no GlyGly cleavage motif to separate a leader peptide from core region.The considerable abundance in Streptomyces and relatively strong consideration hints at a non-antibiotic function. The motif FxLD in the N-terminal region is nearly invariant.	1.93056e-09
NC_018524.1|WP_014910936.1|2272050_2272884_-|helix-turn-helix-domain-containing-protein	gnl|CDD|379262	pfam13560, HTH_31, Helix-turn-helix domain. This domain is a helix-turn-helix domain that probably binds to DNA.	5.79287e-08
NC_018524.1|WP_014909112.1|2271416_2271626_-|DUF397-domain-containing-protein	gnl|CDD|377231	pfam04149, DUF397, Domain of unknown function (DUF397). The function of this family is unknown.	2.47959e-18
NC_018524.1|WP_014909293.1|2259805_2261059_-|lanthionine-synthetase-C-family-protein	gnl|CDD|271201	cd04793, LanC, Cyclases involved in the biosynthesis of lantibiotics. LanC is the cyclase enzyme of the lanthionine synthetase. Lanthinoine is a lantibiotic, a unique class of peptide antibiotics. They are ribosomally synthesized as precursor peptides and then post-translationally modified to contain thioether cross-links called lanthionines (Lans) or methyllanthionines (MeLans) in addition to 2,3-didehydroalanine (Dha) and (Z)-2,3-didehydrobutyrine (Dhb). These unusual amino acids are introduced by the dehydration of serine and threonine residues, followed by thioether formation via addition of cysteine thiols, catalysed by LanB and LanC or LanM. LanC, the cyclase component, is a zinc metalloprotein, whose bound metal has been proposed to activate the thiol substrate for nucleophilic addition. Also contains SpaC (the cyclase involved in the biosynthesis of subtilin), NisC, and homologs.	8.62538e-110
NC_018524.1|WP_148281691.1|2264367_2265540_-|methyltransferase,-FxLD-system	gnl|CDD|275158	TIGR04364, methyltran_FxLD, methyltransferase, FxLD system. Members of this family resemble occur regularly in the vicinity of lantibiotic biosynthesis enzymes and their probable target, the FxLD family of putative ribosomal natural product precursor (TIGR04363). Members resemble protein-L-isoaspartate O-methyltransferase (TIGR00080) and a predicted methyltranserase, TIGR04188, of another putative peptide modification system.	1.67513e-143
NC_018524.1|WP_041561797.1|2274092_2274848_+|SAM-dependent-methyltransferase	gnl|CDD|252734	pfam04672, Methyltransf_19, S-adenosyl methyltransferase. This family contains a SAM (S-adenosyl methyltransferase) domain, with a central beta sheet with 3 alpha-helices on both sides. Crystal packing analysis of the structure Structure 3giw suggests that a monomer is the solution state oligomeric form. An unidentified ligand (UNL, cyan) was found at the putative active site surrounded by the residues His57, His170, Phe171, Tyr216 and Met22. The UNL is likely to be a phenylalanine or phenylalanine-like molecule. (details derived from TOPSAN).	5.82992e-16
NC_018524.1|WP_014912062.1|2267256_2268096_+|class-I-SAM-dependent-methyltransferase	gnl|CDD|369777	pfam08241, Methyltransf_11, Methyltransferase domain. Members of this family are SAM dependent methyltransferases.	5.88552e-21
NC_018524.1|WP_187294551.1|2266048_2267245_+|helix-turn-helix-domain-containing-protein	gnl|CDD|379262	pfam13560, HTH_31, Helix-turn-helix domain. This domain is a helix-turn-helix domain that probably binds to DNA.	0.00041684
NC_018524.1|WP_081536491.1|2271850_2272042_-|DUF397-domain-containing-protein	gnl|CDD|377231	pfam04149, DUF397, Domain of unknown function (DUF397). The function of this family is unknown.	8.55809e-19
NC_018524.1|WP_041561795.1|2258955_2259783_-|bacteriocin-biosynthesis-protein	gnl|CDD|274836	TIGR03891, lantibiotic_dehydratase, thiopeptide-type bacteriocin biosynthesis domain. This domain occurs within longer proteins that contain lantibiotic dehydratase domains (see pfam04737 and pfam04738), and as single-domain proteins in bacteriocin biosynthesis genomic contexts. Three named genes in this family, SioK in Streptomyces sioyaensis, TsrD in Streptomyces laurentii, and NosD in Streptomyces actuosus, all occur in regions associated with thiopeptide biosynthesis. [Cellular processes, Toxin production and resistance].	3.43728e-47
NC_018524.1|WP_081536563.1|2268844_2270254_+|hypothetical-protein	gnl|CDD|224276	COG1357, COG1357, Pentapeptide repeats containing protein [Function unknown].	5.12362e-05
NC_018524.1|WP_041562167.1|2274988_2275486_+|helix-turn-helix-transcriptional-regulator	gnl|CDD|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	1.89716e-07
NC_018524.1|WP_014909607.1|2255550_2256390_-|IS5-family-transposase	gnl|CDD|379129	pfam13340, DUF4096, Putative transposase of IS4/5 family (DUF4096).	4.54386e-32
NC_018524.1|WP_187294586.1|2256526_2257669_+|IS701-family-transposase	gnl|CDD|379252	pfam13546, DDE_5, DDE superfamily endonuclease. This family of proteins are related to pfam00665 and are probably endonucleases of the DDE superfamily. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	1.46783e-53

Protein sequences

>NC_018524.1|WP_014912062.1|2267256_2268096_+|class-I-SAM-dependent-methyltransferase
MEDRPRTSNDRSLLTGHAYRDDRPLAARQRLYDHQRPRYDLPGMVLEQAGERTGVWADVGCGNGRYLERIRAERPAVRTIGLDLSASMLTDLPGPVVCADAARLPLRSRSAQVVLAMHMLYHVDTPEQALEEAARVLAPDGILIASTNACADKAELDEWWARAAADVLGTDTGPKRMKLSDHFPAERAAEAVGVHFAEVDVIALDGVIEVDTPAPILDHYASYQAWSEGTGVPFEATLERVSSVLSARLKDGPLRITTRQALIIGRRSLTHGPQPTTGR
>NC_018524.1|WP_187294551.1|2266048_2267245_+|helix-turn-helix-domain-containing-protein
MVLLLHHATGLTHEALAVLCGLTQSTITRALAGRGLTRPDVVTRVLTALGAPDVSRAPSFGSRPRSASTSWEQRLGQDATTTLEQVRALVNRAAPEEVVELLEADVRRLCSAYVHTPLTELYPHIIERRRAALDLASTLTHPEQSRRAHIAATRLVGLQTHASMDTGAYSHAFTHATAAQVLADRVADPGLKAWVCALHSLIAYWDSRPEDALRAAEAGLVHSVTDSNLARLHALRARAAAAFGDRNTTRDAIAAAEDHNGQTVLPGVLGFPQAKTHTYAGTALLALGSPAERRLAISHTERAIALYTGPTRSTGDLLAARLDLATAHLRDHDPDGALEQIDLVCASPPEQRTASIAQRVRGLIPLAQGLQTPLALRIRDRLFAFDPTPTAHRSPTVR
>NC_018524.1|WP_148281691.1|2264367_2265540_-|methyltransferase,-FxLD-system
MVDTLLHLQKEWGMPEISDRVASVLRKVPRHVFVPEVSLDEAYAPDYAPPIRRAEDGLVTSSMSAVRVQAMMLDQAGLEPGMRVLEIGSGGYNAALIAELVGSTGEVTTIDIDPEVTDRARRYLDEAGYQDVRVVTGDADTGVPEFAPYDRIIVTVRAWDLPPAWIAQLTETGRLITPMRLRGVNRTVAFDRIDGHLVSRPDHHLTVFVPMQGAGAHEERGIAVQGNEIALYSAEEPVDVSALRKALHGPRKEFWSGVEFTHPDRLHLWIASHADRYALLHVAEDVLEHGPAGPLARQPVPVVLADDGSVAVRTKRALGEGRFEIGVFAYGPQGERAAQDYIDVLRAWERHDGSMARIEVWPSGTPETDLPTDRVRVLDKAHTRTVLAWT
>NC_018524.1|WP_014913548.1|2264169_2264316_-|FxLD-family-lanthipeptide
MNEHQIDADGFDLDVEVVESGPRLDALLNLTGDNCGTTCESACSTTCA
>NC_018524.1|WP_041561796.1|2261055_2264085_-|lantibiotic-dehydratase
MHPRFTAHPTGVLRVSALSSPGDAPPWPNGPIDSPEHHDAWIAWLRQVHDHPVLGAAIRDAGPTLVQRIGRVCQGNASGRDLTRVARSTARYVLRAQSRAAPFGLFAGVAPTRFTSAVSGTIGVDHRPMARVSAAWTTAAVDRLESCEPEFTAHLPVVVNTLAVVRDDRILVEHQPEPGADQGTRSSLRLTAPARMVLETARTPTSWAQVEAALNTAFPDRGDAVRALVGTLVRHRVLLTCLHPPMDTPDPLRHLITAARGAGADRYPRAAAVLAHLEAAQRSLEDHDHAPEPAVRAAAMSRSRTALAAVAPVDAPTSVDLRLESDLDLPRTVSWQIQDAAGVLARLSPVRQCTPAWADYHRRFCERYGIGAVVPVTEVIDPDRGLGLPAGFHGSRLPTPPAQALSERDAVLLDLAQQAAVDGTGEIVVDDALLDRLGAAPLDAVWPHTELRVRVHATSREALDAGDFRVVVAGASRGAGTTVGRFLDLLPPSGRDPLLDLYRRLPTLRQDAILAQLTCPASSARGDQVSRTPVVLPTRLALGQHHPADPNALGLDDLAVTADPHRLHLVTRYGLRPVEPVVFHALEFTRAAHPQMRFLTELPWAFTAVLVPFSWGAATHLPYLPRVRWRQCVLAPARWRLDAHTLPGPHAPWQEWVDHLDQWRATRRVPAQVELGENDQRLRLNLDLSAHQDLVRSELVTAGRVFLREASTDRELGWIGGRAHELVATVTATQTPIRVRTLPGSAHPRSPEHLPGTMAGWCSLKLYGHPDRTTELITEEFPRLSASERALSWWFLRYRDPEPHLRVRIRVEGPEQLGAVHTWTRDLRERGLVATIVHDTYTPESGRFGPGAAMKAAETLFVADSRAVTSQLTTESTDHGTRVWAAVSMTDLVHHLLGDEPTARRWLIDHAPPGVTDRGEAQRTITLTHPDHDDRPALLRDAWQNRAEAASAYTKALADFGFTASHILPDLLHLHSTRLFGPDPDAERACLSLARAAALSWNARAKEGQ
>NC_018524.1|WP_014909293.1|2259805_2261059_-|lanthionine-synthetase-C-family-protein
MTVTVTIANRAHTTAQEILDSLADPDHVRFLPDKPALRQRPSSMGGGAAGVALAHVEAARTGHGPWESARTWIARALSEPINGSNTATLWSGAPALGLLTTIAATSPARLARARARLAGATTRLTLDRLSQANTRIDRGQGPSLAEFDLIQGLTGLAVYHLHTHPEAPITRHVLAYLVRLSRPLPDDPHRLPGWWTEHSPHNSPAPEFPGGHLNLGMAHGIAAPLAVLSLALRHGVTVDGHTDAIGRILDVLDARRHAGPRGTWWPYYLTPQRWENGPTTAACEQRPTWCYGTPGLARAQQLAGIALHDPHRQAMAEQTMADCLRDASQLDTLADLGLCHGWAGLLHCAWRINTDAPDTPLTQDLDRIATTLLDRLEGEPHPDPEFLDGRAGIALALHTYANGAAPGVPWDAHLALA
>NC_018524.1|WP_041561795.1|2258955_2259783_-|bacteriocin-biosynthesis-protein
MPNDAPITEMWWQVNVEFPDPATDEQTGVHHLAPALKQSGRAWFLMRKKGAWRCRTHLPDTPAGQTAVREQVGELLDEITHTGHISTWTPVVYEPETRAFGGTEAMAAAHALFCADTRHLMEFLAAAEGGPDRRKEVSLLLCHTLMRAAGLDRYEQGDVWDRVASTRPLHTAGPPPEKVHHKVHRLLSVDPGPRAAHFAPSGAFAGFALWAQAFQDCGHELADLHTRGRLERGLRAVLAHHVIFCWNRLGLSAPVQAVLSHTAARIIFDPETVNL
>NC_018524.1|WP_187294550.1|2257762_2258818_-|hypothetical-protein
MTRACEAMNKAALIASDTGQPDLAEALCWQQYETFAPAAPLTAKAATFAVQPLVNLGRLAIRTGNPSDAYTVLESLFEAVDRGGPANVLGRSRPVGNLVDTPGERAELRRFLWAVLLADGTRALCASERWQDAMHHLHRYRGIGLRMLDGRQAAVLAALHLEDIDTATDLLAATDRSQAWEHAVAACLSVATDLVAGRDSASAVTSMIETVRHLPPTPGGTVFATRLGVLACELAPDQHALATHLITGALETTDAHVAAAVLGSPTLATRLTEEQGQVLREHVTQAQPTGTKRPIGLEEELVEIGNRAAGFLIRGLQTSGLDVTDLSTATTGCCLCVCDSGSPGHAAGTGV
>NC_018524.1|WP_187294586.1|2256526_2257669_+|IS701-family-transposase
MTDLETWSRSFSEFTASFAHRFPRVESRRQATSYLRGLLSELERKNGWTLAEMCGEQGPERLQRLLNFYAWDTDGVRDDVRDLVVEVLADPDHGVLILDDTGFLKKGTKSAGVARQYSGTAGRIENCQIGVFLAYASSKGRALIDRELYLPKAWTEDRDRCRASGIGEQVAFATKNELGHAMLRRAVQSGIPFGWVTADEAYGQVSRLRLWMEEHDIHHVVAVPKSQTVITMDLGQERAHRLIADLPEQAWERLSCADGAHGPRVYDWARADIRPWREPGKGHWLLARRSITDPEELAYYICFADENTTLVELARVAASRWAVEECFQAAKNETGLDHYQVRGYRAWYRHITLSMAALAFLVRLRQGVQKGDQNTPRACV
>NC_018524.1|WP_014909607.1|2255550_2256390_-|IS5-family-transposase
MTRRPTYPSDLTDEQWTLIEPLLPPANTGGRPEKHPRRDVVDAILYVVRTGCSWRHLPVDFPPWQTVYWYFSRWEEAKVTEQVMAVLRRRLRTAQGRGGEPSAGIIDSQSVKGADTVGQGSRGYDAGKKVNGRKRFIVTDTLGLLLVVCVMAASVQDRDGARTTLLSLYLCTPVRFVFADAGFAGKLVAWAERFVATTVHIVRKAPDQVGFAVIPRRWVVERSLAWLTAHRRLARDYERDPAVSEAMVRWAAIGQMARRLARGQDSVRQRAWTGQDLIP
>NC_018524.1|WP_081536563.1|2268844_2270254_+|hypothetical-protein
MNERFGRVRRGLSWTAIIVGGLGAAVALWPLATAVWDLLGFTTGQTWRVAAVGVCALVLATGVVGVNWKRTTPVRLVWLILVAWALAVGMVAGMTILAWLVLDSPQWKPPEALTPQNLDAIATRAFAIVAGLGGVALLVIAYRRQRSTENGEEREVSKLFTDTFDSASDKLGSEHAAVRLAGVHALARLADEAPEGREDLVQMVIDVLCAYLRMPYEPRPDEPSGKHDQSALPAAFPTTAVDLGRLRGIESDDQHEKQQEAKEERRRRVLEFEASQQVRHTITRIIGNRLREDTRWRGKDYDFTGVVFDGGDLAGAHFSGGRVSFDWAEFSSGKVFFSWAEFSGGLVSFFGAEFSGGLVSFDWAEFSGGLVTFAKAKFSDGEVLFDGTEFSGGTVLFSWAEFSGERMSFDRAEFSGGQVVFDNASGTCPKGLLEEMGRPRVVLPEQWRRASDGSGEEEASEMPTDVPDH
>NC_018524.1|WP_014911619.1|2271238_2271424_-|DUF397-domain-containing-protein
MPETTHPLNFRKSSYSANESACVEVADTPGTSAIRDTKRRSDGHLPFPTSEWAAFLATLSR
>NC_018524.1|WP_014909112.1|2271416_2271626_-|DUF397-domain-containing-protein
MPLPQAEALTFRKSSYSSSHGQNCVEVADVPGASAVRDSQSPGSGHLTFSSSEWTALLTTARRTEAHHA
>NC_018524.1|WP_081536491.1|2271850_2272042_-|DUF397-domain-containing-protein
MNLFPTEALTFRKSSYSDRNNCVEVADLPGGSAMRDSQNPTDGHLEISAAEWSALLAGVRSKK
>NC_018524.1|WP_014910936.1|2272050_2272884_-|helix-turn-helix-domain-containing-protein
MADNRRSIRRRRLSVEIKKARVEAGMTIEEVSEATEWSMGKISNIETGVRLKPTVMEIRGLLDVYEVTDERRREAILNLTRQARELGWWSKYTDVFTDDFVAFEGEARRIRTYELARIPGLLQTPRYVESLMRASLYQSPPDIERAVETRRQRQQILTAPDAPELWAVIDEAALLRIQREDVLKEQVEHLIAVAEADNTVTLQILPFSNGMHAGLQGPFVILEFVPGVSPVVYLETDTDGLYLEEPDELERYGRLFDHVRASARYPEASLQILKNLI
>NC_018524.1|WP_187294552.1|2273163_2273340_+|hypothetical-protein
MRSYVLDLLASTPAPSRAPSLTPVFVPRPRRPLEALNASEVPLLERVLTGLRNLPEVA
>NC_018524.1|WP_014912826.1|2273773_2274025_+|hypothetical-protein
MDEYGDTWAPPAQVLAELTARWGRTHKIAWTGRFWLATHHHPRAPWRSQIEPTPEQLESRLRAHYGMPPGPPAERTKRRRDAR
>NC_018524.1|WP_041561797.1|2274092_2274848_+|SAM-dependent-methyltransferase
MTNAARTFDYLDYGKDSWSQDRHTAVRMAEASPALAGQMLVHRKAREGVVDAVCHSFSQVIDLGCGLPTMRRAPHERGRVLWGSRARTVYVDHDLAVLAAARAWWEHPARVRGGNVHVLDLDLRYPKILASALGEHLDLSVPVGVLSTLTLDHLEDSEVTGLVEALAARLAPGSGWGITHLSGMVGAADVYTGQAVEQGADTRLVARESDGLRKVFEESGWRWHVSPPNDPGRGEPPIAALTTLTGTTRPC
>NC_018524.1|WP_041562167.1|2274988_2275486_+|helix-turn-helix-transcriptional-regulator
MNEHDADSLCADSKKELGVHLKRLRKAAGLSGYRLSGVDQSTVSRIETGRIRPSHELMIRLLDAYEADQEGREQAYLLWDQAQLPLQTRRRQVEGTRPAWDQAARPAYGPTLLAGASAAEDAARYLTRAQWAGNSPARRNALLDDAEGRLVQVLAALHAARTRTR
>NC_018524.1|WP_017536469.1|2275542_2275734_+|helix-turn-helix-domain-containing-protein
MTQPDVDPMDLLTPQEVAQAFRVDPKTVRLWAQEGRLRWVRTLGGHRRYFKSDVQRLLTEPGR

Crispr_ID: NC_018524_15

• CRISPR_ID: NC_018524_15
• CRISPR_location: 2270308-2271179
• CRISPR_type: Orphan
• Repeat_type: NA:I-E
• Spacer_info: 14 spacers

Consensus repeat of NC_018524_15

Consensus_repeat	Method
CTGCTCCCCGCGCACGCGGGGATGACCCC	CRISPRCasFinder
CTGNTCCCCNCGCACGNGGGGATGG	CRT

spacers of NC_018524_15

>15.1|2270337|32|NC_018524|CRISPRCasFinder
GGCTCGTTGAAGGCGATCGTGTACTCGTTGGA
>15.2|2270398|32|NC_018524|CRISPRCasFinder
TCCAGGAGGCCGAGACAGCTACCGTTCCCCGA
>15.3|2270459|32|NC_018524|CRISPRCasFinder
GAGCACAGCGACGGCACCGCCAACGGCTGGTG
>15.4|2270520|32|NC_018524|CRISPRCasFinder
CCGTGGCACCACTGCTGTCCGCAGCTACACAC
>15.5|2270581|32|NC_018524|CRISPRCasFinder
GTCTCGGCAGACGGGGACAGCGAGGGCTACCA
>15.6|2270642|32|NC_018524|CRISPRCasFinder
CGGTGCCCTCTTCGGGGGCAGGGCCGGTGTTA
>15.7|2270703|32|NC_018524|CRISPRCasFinder
AAGGACGTGCGACGTGCGAAGCACGCTGTTGT
>15.8|2270764|32|NC_018524|CRISPRCasFinder
GGACCGCTACGGGACGCCCACCTATGGACCGA
>15.9|2270825|32|NC_018524|CRISPRCasFinder
TGTTGTTCTCCCGCCTCGGACGCCTCCCGGTC
>15.10|2270886|32|NC_018524|CRISPRCasFinder
CGCTGGACGGCGATCGGCAGTCGCTGCCGTCT
>15.11|2270947|32|NC_018524|CRISPRCasFinder
TACCGGTCCCGTAGACGCCGGTAGGTCTCCGC
>15.12|2271008|32|NC_018524|CRISPRCasFinder
TCGATCGCGTGGAACCCCGGGACGTCCTTGAT
>15.13|2271069|25|NC_018524|CRISPRCasFinder
TCGGCGATCCGGCGGTACGCGGTCG
>15.14|2270333|36|NC_018524|CRT
ACCCGGCTCGTTGAAGGCGATCGTGTACTCGTTGGA
>15.15|2270394|36|NC_018524|CRT
ACCCTCCAGGAGGCCGAGACAGCTACCGTTCCCCGA
>15.16|2270455|36|NC_018524|CRT
CCCCGAGCACAGCGACGGCACCGCCAACGGCTGGTG
>15.17|2270516|36|NC_018524|CRT
ACCCCCGTGGCACCACTGCTGTCCGCAGCTACACAC
>15.18|2270577|36|NC_018524|CRT
CCCCGTCTCGGCAGACGGGGACAGCGAGGGCTACCA
>15.19|2270638|36|NC_018524|CRT
CCCCCGGTGCCCTCTTCGGGGGCAGGGCCGGTGTTA
>15.20|2270699|36|NC_018524|CRT
ACCCAAGGACGTGCGACGTGCGAAGCACGCTGTTGT
>15.21|2270760|36|NC_018524|CRT
ACCCGGACCGCTACGGGACGCCCACCTATGGACCGA
>15.22|2270821|36|NC_018524|CRT
ACCCTGTTGTTCTCCCGCCTCGGACGCCTCCCGGTC
>15.23|2270882|36|NC_018524|CRT
ACCGCGCTGGACGGCGATCGGCAGTCGCTGCCGTCT
>15.24|2270943|36|NC_018524|CRT
GCCGTACCGGTCCCGTAGACGCCGGTAGGTCTCCGC
>15.25|2271004|36|NC_018524|CRT
ACCCTCGATCGCGTGGAACCCCGGGACGTCCTTGAT
>15.26|2271065|29|NC_018524|CRT
ACCGTCGGCGATCCGGCGGTACGCGGTCG
>15.27|2271119|36|NC_018524|CRT
ACCCTCCCTGGCGAGGGTGTCGAAGACACGGACCCT

CRISPR arrays and Neighbor proteins around NC_018524_15

CRISPR arrays

The CRISPR arrays of NC_018524_15

>merge|NC_018524|15|2270308-2271179|CRISPRCasFinder,CRT
CTGAGCCCCACGCATGTGGGGATGGACCCGGCTCGTTGAAGGCGATCGTGTACTCGTTGGACTGCTCCCCGCGCACGCGGGGATGGACCCTCCAGGAGGCCGAGACAGCTACCGTTCCCCGACTGCTCCCCGCGCACGCGGGGATGGCCCCGAGCACAGCGACGGCACCGCCAACGGCTGGTGCTGCTCCCCGCGCACGCGGGGAGGGACCCCCGTGGCACCACTGCTGTCCGCAGCTACACACCTGCTCCCCGCGCACGCGGGGATGACCCCGTCTCGGCAGACGGGGACAGCGAGGGCTACCACTGCTCCCCGCGCACGCGGGGATGGCCCCCGGTGCCCTCTTCGGGGGCAGGGCCGGTGTTACTGCTCCCCGCGCACGCGGGGATGGACCCAAGGACGTGCGACGTGCGAAGCACGCTGTTGTCTGCTCCCCGCGCACGCGGGGATGGACCCGGACCGCTACGGGACGCCCACCTATGGACCGACTGCTCCCCGCGCACGCGGGGATGGACCCTGTTGTTCTCCCGCCTCGGACGCCTCCCGGTCCTGCTCCCCGCGCACGTGGGGATGGACCGCGCTGGACGGCGATCGGCAGTCGCTGCCGTCTCTGAGCCCCACGTACGTGGGGATGGGCCGTACCGGTCCCGTAGACGCCGGTAGGTCTCCGCCTGAGCCCCACGCACGTGGGGATGGACCCTCGATCGCGTGGAACCCCGGGACGTCCTTGATCTGTTCCCCGCGCACGCGGGGATGGACCGTCGGCGATCCGGCGGTACGCGGTCGGTGAGCCCCACGCATGTGGGGATGGACCCTCCCTGGCGAGGGTGTCGAAGACACGGACCCTCTGCTCCCCATGCATGTGGGGTTGT

>NC_018524|15|14|2270308-2271122|CRISPRCasFinder
CTGAGCCCCACGCATGTGGGGATGGACCC	GGCTCGTTGAAGGCGATCGTGTACTCGTTGGA
CTGCTCCCCGCGCACGCGGGGATGGACCC	TCCAGGAGGCCGAGACAGCTACCGTTCCCCGA
CTGCTCCCCGCGCACGCGGGGATGGCCCC	GAGCACAGCGACGGCACCGCCAACGGCTGGTG
CTGCTCCCCGCGCACGCGGGGAGGGACCC	CCGTGGCACCACTGCTGTCCGCAGCTACACAC
CTGCTCCCCGCGCACGCGGGGATGACCCC	GTCTCGGCAGACGGGGACAGCGAGGGCTACCA
CTGCTCCCCGCGCACGCGGGGATGGCCCC	CGGTGCCCTCTTCGGGGGCAGGGCCGGTGTTA
CTGCTCCCCGCGCACGCGGGGATGGACCC	AAGGACGTGCGACGTGCGAAGCACGCTGTTGT
CTGCTCCCCGCGCACGCGGGGATGGACCC	GGACCGCTACGGGACGCCCACCTATGGACCGA
CTGCTCCCCGCGCACGCGGGGATGGACCC	TGTTGTTCTCCCGCCTCGGACGCCTCCCGGTC
CTGCTCCCCGCGCACGTGGGGATGGACCG	CGCTGGACGGCGATCGGCAGTCGCTGCCGTCT
CTGAGCCCCACGTACGTGGGGATGGGCCG	TACCGGTCCCGTAGACGCCGGTAGGTCTCCGC
CTGAGCCCCACGCACGTGGGGATGGACCC	TCGATCGCGTGGAACCCCGGGACGTCCTTGAT
CTGTTCCCCGCGCACGCGGGGATGGACCG	TCGGCGATCCGGCGGTACGCGGTCG
GTGAGCCCCACGCATGTGGGGATGGACCC

>NC_018524|15|10|2270308-2271179|CRT
CTGAGCCCCACGCATGTGGGGATGG	ACCCGGCTCGTTGAAGGCGATCGTGTACTCGTTGGA
CTGCTCCCCGCGCACGCGGGGATGG	ACCCTCCAGGAGGCCGAGACAGCTACCGTTCCCCGA
CTGCTCCCCGCGCACGCGGGGATGG	CCCCGAGCACAGCGACGGCACCGCCAACGGCTGGTG
CTGCTCCCCGCGCACGCGGGGAGGG	ACCCCCGTGGCACCACTGCTGTCCGCAGCTACACAC
CTGCTCCCCGCGCACGCGGGGATGA	CCCCGTCTCGGCAGACGGGGACAGCGAGGGCTACCA
CTGCTCCCCGCGCACGCGGGGATGG	CCCCCGGTGCCCTCTTCGGGGGCAGGGCCGGTGTTA
CTGCTCCCCGCGCACGCGGGGATGG	ACCCAAGGACGTGCGACGTGCGAAGCACGCTGTTGT
CTGCTCCCCGCGCACGCGGGGATGG	ACCCGGACCGCTACGGGACGCCCACCTATGGACCGA
CTGCTCCCCGCGCACGCGGGGATGG	ACCCTGTTGTTCTCCCGCCTCGGACGCCTCCCGGTC
CTGCTCCCCGCGCACGTGGGGATGG	ACCGCGCTGGACGGCGATCGGCAGTCGCTGCCGTCT
CTGAGCCCCACGTACGTGGGGATGG	GCCGTACCGGTCCCGTAGACGCCGGTAGGTCTCCGC
CTGAGCCCCACGCACGTGGGGATGG	ACCCTCGATCGCGTGGAACCCCGGGACGTCCTTGAT
CTGTTCCCCGCGCACGCGGGGATGG	ACCGTCGGCGATCCGGCGGTACGCGGTCG
GTGAGCCCCACGCATGTGGGGATGG	ACCCTCCCTGGCGAGGGTGTCGAAGACACGGACCCT
CTGCTCCCCATGCATGTGGGGTTGT

Neighbor Proteins Overview

Protein	Signature genes	Signature genes Name	Protein_function
NC_018524.1|WP_041561796.1|2261055_2264085_-|lantibiotic-dehydratase	unknown	unknown	gnl|CDD|377403
NC_018524.1|WP_014912826.1|2273773_2274025_+|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_187294552.1|2273163_2273340_+|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014911619.1|2271238_2271424_-|DUF397-domain-containing-protein	unknown	unknown	gnl|CDD|377231
NC_018524.1|WP_017536469.1|2275542_2275734_+|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl|CDD|133390
NC_018524.1|WP_014913548.1|2264169_2264316_-|FxLD-family-lanthipeptide	unknown	unknown	gnl|CDD|275157
NC_018524.1|WP_014910936.1|2272050_2272884_-|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl|CDD|379262
NC_018524.1|WP_014909112.1|2271416_2271626_-|DUF397-domain-containing-protein	unknown	unknown	gnl|CDD|377231
NC_018524.1|WP_187294550.1|2257762_2258818_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_148281691.1|2264367_2265540_-|methyltransferase,-FxLD-system	unknown	unknown	gnl|CDD|275158
NC_018524.1|WP_041561797.1|2274092_2274848_+|SAM-dependent-methyltransferase	unknown	unknown	gnl|CDD|252734
NC_018524.1|WP_014912062.1|2267256_2268096_+|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl|CDD|369777
NC_018524.1|WP_187294551.1|2266048_2267245_+|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl|CDD|379262
NC_018524.1|WP_081536491.1|2271850_2272042_-|DUF397-domain-containing-protein	unknown	unknown	gnl|CDD|377231
NC_018524.1|WP_014909293.1|2259805_2261059_-|lanthionine-synthetase-C-family-protein	unknown	unknown	gnl|CDD|271201
NC_018524.1|WP_041561795.1|2258955_2259783_-|bacteriocin-biosynthesis-protein	unknown	unknown	gnl|CDD|274836
NC_018524.1|WP_081536563.1|2268844_2270254_+|hypothetical-protein	unknown	unknown	gnl|CDD|224276
NC_018524.1|WP_041562167.1|2274988_2275486_+|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl|CDD|238045
NC_018524.1|WP_187294586.1|2256526_2257669_+|IS701-family-transposase	unknown	unknown	gnl|CDD|379252
NC_018524.1|WP_014910898.1|2276046_2276856_-|xanthine-dehydrogenase-accessory-protein-XdhC	unknown	unknown	gnl|CDD|274366

rpsblast for functional proteins

Protein	Function_ID	Function_description	E-value
NC_018524.1|WP_041561796.1|2261055_2264085_-|lantibiotic-dehydratase	gnl|CDD|377403	pfam04738, Lant_dehydr_N, Lantibiotic dehydratase, C-terminus. Lantibiotics are ribosomally synthesized antimicrobial agents derived from ribosomally synthesized peptides. They are produced by bacteria of the Firmicutes phylum, and include mutacin, subtilin, and nisin. Lantibiotic peptides contain thioether bridges termed lanthionines that are thought to be generated by dehydration of serine and threonine residues followed by addition of cysteine residues. This family constitutes the N-terminus of the enzyme proposed to catalyze the dehydration step, via glutamylation of the substrate during lantibiotic biosynthesis. The enzyme dehydrates Ser/Thr residues in the precursor by glutamylation.	0
NC_018524.1|WP_014911619.1|2271238_2271424_-|DUF397-domain-containing-protein	gnl|CDD|377231	pfam04149, DUF397, Domain of unknown function (DUF397). The function of this family is unknown.	2.17941e-15
NC_018524.1|WP_017536469.1|2275542_2275734_+|helix-turn-helix-domain-containing-protein	gnl|CDD|133390	cd04762, HTH_MerR-trunc, Helix-Turn-Helix DNA binding domain of truncated MerR-like proteins. Proteins in this family mostly have a truncated helix-turn-helix (HTH) MerR-like domain. They lack a portion of the C-terminal region, called Wing 2 and the long dimerization helix that is typically present in MerR-like proteins. These truncated domains are found in response regulator receiver (REC) domain proteins (i.e., CheY), cytosine-C5 specific DNA methylases, IS607 transposase-like proteins, and RacA, a bacterial protein that anchors chromosomes to cell poles.	2.52461e-14
NC_018524.1|WP_014913548.1|2264169_2264316_-|FxLD-family-lanthipeptide	gnl|CDD|275157	TIGR04363, hypothetical_protein, FxLD family lantipeptide. Members of this protein family occur with a cassette of lanthionine-type peptide modification enzymes. Members are small (about 60 amino acids long), rich in Cys, and variable in copy number per genome (from one to three). These features suggest that members of this family are modified to become lantipeptides, although not necessarily a lantibiotic. There is no GlyGly cleavage motif to separate a leader peptide from core region.The considerable abundance in Streptomyces and relatively strong consideration hints at a non-antibiotic function. The motif FxLD in the N-terminal region is nearly invariant.	1.93056e-09
NC_018524.1|WP_014910936.1|2272050_2272884_-|helix-turn-helix-domain-containing-protein	gnl|CDD|379262	pfam13560, HTH_31, Helix-turn-helix domain. This domain is a helix-turn-helix domain that probably binds to DNA.	5.79287e-08
NC_018524.1|WP_014909112.1|2271416_2271626_-|DUF397-domain-containing-protein	gnl|CDD|377231	pfam04149, DUF397, Domain of unknown function (DUF397). The function of this family is unknown.	2.47959e-18
NC_018524.1|WP_014909293.1|2259805_2261059_-|lanthionine-synthetase-C-family-protein	gnl|CDD|271201	cd04793, LanC, Cyclases involved in the biosynthesis of lantibiotics. LanC is the cyclase enzyme of the lanthionine synthetase. Lanthinoine is a lantibiotic, a unique class of peptide antibiotics. They are ribosomally synthesized as precursor peptides and then post-translationally modified to contain thioether cross-links called lanthionines (Lans) or methyllanthionines (MeLans) in addition to 2,3-didehydroalanine (Dha) and (Z)-2,3-didehydrobutyrine (Dhb). These unusual amino acids are introduced by the dehydration of serine and threonine residues, followed by thioether formation via addition of cysteine thiols, catalysed by LanB and LanC or LanM. LanC, the cyclase component, is a zinc metalloprotein, whose bound metal has been proposed to activate the thiol substrate for nucleophilic addition. Also contains SpaC (the cyclase involved in the biosynthesis of subtilin), NisC, and homologs.	8.62538e-110
NC_018524.1|WP_148281691.1|2264367_2265540_-|methyltransferase,-FxLD-system	gnl|CDD|275158	TIGR04364, methyltran_FxLD, methyltransferase, FxLD system. Members of this family resemble occur regularly in the vicinity of lantibiotic biosynthesis enzymes and their probable target, the FxLD family of putative ribosomal natural product precursor (TIGR04363). Members resemble protein-L-isoaspartate O-methyltransferase (TIGR00080) and a predicted methyltranserase, TIGR04188, of another putative peptide modification system.	1.67513e-143
NC_018524.1|WP_041561797.1|2274092_2274848_+|SAM-dependent-methyltransferase	gnl|CDD|252734	pfam04672, Methyltransf_19, S-adenosyl methyltransferase. This family contains a SAM (S-adenosyl methyltransferase) domain, with a central beta sheet with 3 alpha-helices on both sides. Crystal packing analysis of the structure Structure 3giw suggests that a monomer is the solution state oligomeric form. An unidentified ligand (UNL, cyan) was found at the putative active site surrounded by the residues His57, His170, Phe171, Tyr216 and Met22. The UNL is likely to be a phenylalanine or phenylalanine-like molecule. (details derived from TOPSAN).	5.82992e-16
NC_018524.1|WP_014912062.1|2267256_2268096_+|class-I-SAM-dependent-methyltransferase	gnl|CDD|369777	pfam08241, Methyltransf_11, Methyltransferase domain. Members of this family are SAM dependent methyltransferases.	5.88552e-21
NC_018524.1|WP_187294551.1|2266048_2267245_+|helix-turn-helix-domain-containing-protein	gnl|CDD|379262	pfam13560, HTH_31, Helix-turn-helix domain. This domain is a helix-turn-helix domain that probably binds to DNA.	0.00041684
NC_018524.1|WP_081536491.1|2271850_2272042_-|DUF397-domain-containing-protein	gnl|CDD|377231	pfam04149, DUF397, Domain of unknown function (DUF397). The function of this family is unknown.	8.55809e-19
NC_018524.1|WP_041561795.1|2258955_2259783_-|bacteriocin-biosynthesis-protein	gnl|CDD|274836	TIGR03891, lantibiotic_dehydratase, thiopeptide-type bacteriocin biosynthesis domain. This domain occurs within longer proteins that contain lantibiotic dehydratase domains (see pfam04737 and pfam04738), and as single-domain proteins in bacteriocin biosynthesis genomic contexts. Three named genes in this family, SioK in Streptomyces sioyaensis, TsrD in Streptomyces laurentii, and NosD in Streptomyces actuosus, all occur in regions associated with thiopeptide biosynthesis. [Cellular processes, Toxin production and resistance].	3.43728e-47
NC_018524.1|WP_081536563.1|2268844_2270254_+|hypothetical-protein	gnl|CDD|224276	COG1357, COG1357, Pentapeptide repeats containing protein [Function unknown].	5.12362e-05
NC_018524.1|WP_041562167.1|2274988_2275486_+|helix-turn-helix-transcriptional-regulator	gnl|CDD|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	1.89716e-07
NC_018524.1|WP_187294586.1|2256526_2257669_+|IS701-family-transposase	gnl|CDD|379252	pfam13546, DDE_5, DDE superfamily endonuclease. This family of proteins are related to pfam00665 and are probably endonucleases of the DDE superfamily. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	1.46783e-53
NC_018524.1|WP_014910898.1|2276046_2276856_-|xanthine-dehydrogenase-accessory-protein-XdhC	gnl|CDD|274366	TIGR02964, conserved_hypothetical_protein, xanthine dehydrogenase accessory protein XdhC. Members of this protein family are the accessory protein XdhC for insertion of the molybdenum cofactor into the xanthine dehydrogenase large chain, XdhB, in bacteria. This protein is not part of the mature xanthine dehydrogenase. Xanthine dehydrogenase is an enzyme for purine catabolism, from other purines to xanthine to urate to further breakdown products. [Protein fate, Protein folding and stabilization, Purines, pyrimidines, nucleosides, and nucleotides, Other].	1.10982e-90

Protein sequences

>NC_018524.1|WP_081536563.1|2268844_2270254_+|hypothetical-protein
MNERFGRVRRGLSWTAIIVGGLGAAVALWPLATAVWDLLGFTTGQTWRVAAVGVCALVLATGVVGVNWKRTTPVRLVWLILVAWALAVGMVAGMTILAWLVLDSPQWKPPEALTPQNLDAIATRAFAIVAGLGGVALLVIAYRRQRSTENGEEREVSKLFTDTFDSASDKLGSEHAAVRLAGVHALARLADEAPEGREDLVQMVIDVLCAYLRMPYEPRPDEPSGKHDQSALPAAFPTTAVDLGRLRGIESDDQHEKQQEAKEERRRRVLEFEASQQVRHTITRIIGNRLREDTRWRGKDYDFTGVVFDGGDLAGAHFSGGRVSFDWAEFSSGKVFFSWAEFSGGLVSFFGAEFSGGLVSFDWAEFSGGLVTFAKAKFSDGEVLFDGTEFSGGTVLFSWAEFSGERMSFDRAEFSGGQVVFDNASGTCPKGLLEEMGRPRVVLPEQWRRASDGSGEEEASEMPTDVPDH
>NC_018524.1|WP_014912062.1|2267256_2268096_+|class-I-SAM-dependent-methyltransferase
MEDRPRTSNDRSLLTGHAYRDDRPLAARQRLYDHQRPRYDLPGMVLEQAGERTGVWADVGCGNGRYLERIRAERPAVRTIGLDLSASMLTDLPGPVVCADAARLPLRSRSAQVVLAMHMLYHVDTPEQALEEAARVLAPDGILIASTNACADKAELDEWWARAAADVLGTDTGPKRMKLSDHFPAERAAEAVGVHFAEVDVIALDGVIEVDTPAPILDHYASYQAWSEGTGVPFEATLERVSSVLSARLKDGPLRITTRQALIIGRRSLTHGPQPTTGR
>NC_018524.1|WP_187294551.1|2266048_2267245_+|helix-turn-helix-domain-containing-protein
MVLLLHHATGLTHEALAVLCGLTQSTITRALAGRGLTRPDVVTRVLTALGAPDVSRAPSFGSRPRSASTSWEQRLGQDATTTLEQVRALVNRAAPEEVVELLEADVRRLCSAYVHTPLTELYPHIIERRRAALDLASTLTHPEQSRRAHIAATRLVGLQTHASMDTGAYSHAFTHATAAQVLADRVADPGLKAWVCALHSLIAYWDSRPEDALRAAEAGLVHSVTDSNLARLHALRARAAAAFGDRNTTRDAIAAAEDHNGQTVLPGVLGFPQAKTHTYAGTALLALGSPAERRLAISHTERAIALYTGPTRSTGDLLAARLDLATAHLRDHDPDGALEQIDLVCASPPEQRTASIAQRVRGLIPLAQGLQTPLALRIRDRLFAFDPTPTAHRSPTVR
>NC_018524.1|WP_148281691.1|2264367_2265540_-|methyltransferase,-FxLD-system
MVDTLLHLQKEWGMPEISDRVASVLRKVPRHVFVPEVSLDEAYAPDYAPPIRRAEDGLVTSSMSAVRVQAMMLDQAGLEPGMRVLEIGSGGYNAALIAELVGSTGEVTTIDIDPEVTDRARRYLDEAGYQDVRVVTGDADTGVPEFAPYDRIIVTVRAWDLPPAWIAQLTETGRLITPMRLRGVNRTVAFDRIDGHLVSRPDHHLTVFVPMQGAGAHEERGIAVQGNEIALYSAEEPVDVSALRKALHGPRKEFWSGVEFTHPDRLHLWIASHADRYALLHVAEDVLEHGPAGPLARQPVPVVLADDGSVAVRTKRALGEGRFEIGVFAYGPQGERAAQDYIDVLRAWERHDGSMARIEVWPSGTPETDLPTDRVRVLDKAHTRTVLAWT
>NC_018524.1|WP_014913548.1|2264169_2264316_-|FxLD-family-lanthipeptide
MNEHQIDADGFDLDVEVVESGPRLDALLNLTGDNCGTTCESACSTTCA
>NC_018524.1|WP_041561796.1|2261055_2264085_-|lantibiotic-dehydratase
MHPRFTAHPTGVLRVSALSSPGDAPPWPNGPIDSPEHHDAWIAWLRQVHDHPVLGAAIRDAGPTLVQRIGRVCQGNASGRDLTRVARSTARYVLRAQSRAAPFGLFAGVAPTRFTSAVSGTIGVDHRPMARVSAAWTTAAVDRLESCEPEFTAHLPVVVNTLAVVRDDRILVEHQPEPGADQGTRSSLRLTAPARMVLETARTPTSWAQVEAALNTAFPDRGDAVRALVGTLVRHRVLLTCLHPPMDTPDPLRHLITAARGAGADRYPRAAAVLAHLEAAQRSLEDHDHAPEPAVRAAAMSRSRTALAAVAPVDAPTSVDLRLESDLDLPRTVSWQIQDAAGVLARLSPVRQCTPAWADYHRRFCERYGIGAVVPVTEVIDPDRGLGLPAGFHGSRLPTPPAQALSERDAVLLDLAQQAAVDGTGEIVVDDALLDRLGAAPLDAVWPHTELRVRVHATSREALDAGDFRVVVAGASRGAGTTVGRFLDLLPPSGRDPLLDLYRRLPTLRQDAILAQLTCPASSARGDQVSRTPVVLPTRLALGQHHPADPNALGLDDLAVTADPHRLHLVTRYGLRPVEPVVFHALEFTRAAHPQMRFLTELPWAFTAVLVPFSWGAATHLPYLPRVRWRQCVLAPARWRLDAHTLPGPHAPWQEWVDHLDQWRATRRVPAQVELGENDQRLRLNLDLSAHQDLVRSELVTAGRVFLREASTDRELGWIGGRAHELVATVTATQTPIRVRTLPGSAHPRSPEHLPGTMAGWCSLKLYGHPDRTTELITEEFPRLSASERALSWWFLRYRDPEPHLRVRIRVEGPEQLGAVHTWTRDLRERGLVATIVHDTYTPESGRFGPGAAMKAAETLFVADSRAVTSQLTTESTDHGTRVWAAVSMTDLVHHLLGDEPTARRWLIDHAPPGVTDRGEAQRTITLTHPDHDDRPALLRDAWQNRAEAASAYTKALADFGFTASHILPDLLHLHSTRLFGPDPDAERACLSLARAAALSWNARAKEGQ
>NC_018524.1|WP_014909293.1|2259805_2261059_-|lanthionine-synthetase-C-family-protein
MTVTVTIANRAHTTAQEILDSLADPDHVRFLPDKPALRQRPSSMGGGAAGVALAHVEAARTGHGPWESARTWIARALSEPINGSNTATLWSGAPALGLLTTIAATSPARLARARARLAGATTRLTLDRLSQANTRIDRGQGPSLAEFDLIQGLTGLAVYHLHTHPEAPITRHVLAYLVRLSRPLPDDPHRLPGWWTEHSPHNSPAPEFPGGHLNLGMAHGIAAPLAVLSLALRHGVTVDGHTDAIGRILDVLDARRHAGPRGTWWPYYLTPQRWENGPTTAACEQRPTWCYGTPGLARAQQLAGIALHDPHRQAMAEQTMADCLRDASQLDTLADLGLCHGWAGLLHCAWRINTDAPDTPLTQDLDRIATTLLDRLEGEPHPDPEFLDGRAGIALALHTYANGAAPGVPWDAHLALA
>NC_018524.1|WP_041561795.1|2258955_2259783_-|bacteriocin-biosynthesis-protein
MPNDAPITEMWWQVNVEFPDPATDEQTGVHHLAPALKQSGRAWFLMRKKGAWRCRTHLPDTPAGQTAVREQVGELLDEITHTGHISTWTPVVYEPETRAFGGTEAMAAAHALFCADTRHLMEFLAAAEGGPDRRKEVSLLLCHTLMRAAGLDRYEQGDVWDRVASTRPLHTAGPPPEKVHHKVHRLLSVDPGPRAAHFAPSGAFAGFALWAQAFQDCGHELADLHTRGRLERGLRAVLAHHVIFCWNRLGLSAPVQAVLSHTAARIIFDPETVNL
>NC_018524.1|WP_187294550.1|2257762_2258818_-|hypothetical-protein
MTRACEAMNKAALIASDTGQPDLAEALCWQQYETFAPAAPLTAKAATFAVQPLVNLGRLAIRTGNPSDAYTVLESLFEAVDRGGPANVLGRSRPVGNLVDTPGERAELRRFLWAVLLADGTRALCASERWQDAMHHLHRYRGIGLRMLDGRQAAVLAALHLEDIDTATDLLAATDRSQAWEHAVAACLSVATDLVAGRDSASAVTSMIETVRHLPPTPGGTVFATRLGVLACELAPDQHALATHLITGALETTDAHVAAAVLGSPTLATRLTEEQGQVLREHVTQAQPTGTKRPIGLEEELVEIGNRAAGFLIRGLQTSGLDVTDLSTATTGCCLCVCDSGSPGHAAGTGV
>NC_018524.1|WP_187294586.1|2256526_2257669_+|IS701-family-transposase
MTDLETWSRSFSEFTASFAHRFPRVESRRQATSYLRGLLSELERKNGWTLAEMCGEQGPERLQRLLNFYAWDTDGVRDDVRDLVVEVLADPDHGVLILDDTGFLKKGTKSAGVARQYSGTAGRIENCQIGVFLAYASSKGRALIDRELYLPKAWTEDRDRCRASGIGEQVAFATKNELGHAMLRRAVQSGIPFGWVTADEAYGQVSRLRLWMEEHDIHHVVAVPKSQTVITMDLGQERAHRLIADLPEQAWERLSCADGAHGPRVYDWARADIRPWREPGKGHWLLARRSITDPEELAYYICFADENTTLVELARVAASRWAVEECFQAAKNETGLDHYQVRGYRAWYRHITLSMAALAFLVRLRQGVQKGDQNTPRACV
>NC_018524.1|WP_014911619.1|2271238_2271424_-|DUF397-domain-containing-protein
MPETTHPLNFRKSSYSANESACVEVADTPGTSAIRDTKRRSDGHLPFPTSEWAAFLATLSR
>NC_018524.1|WP_014909112.1|2271416_2271626_-|DUF397-domain-containing-protein
MPLPQAEALTFRKSSYSSSHGQNCVEVADVPGASAVRDSQSPGSGHLTFSSSEWTALLTTARRTEAHHA
>NC_018524.1|WP_081536491.1|2271850_2272042_-|DUF397-domain-containing-protein
MNLFPTEALTFRKSSYSDRNNCVEVADLPGGSAMRDSQNPTDGHLEISAAEWSALLAGVRSKK
>NC_018524.1|WP_014910936.1|2272050_2272884_-|helix-turn-helix-domain-containing-protein
MADNRRSIRRRRLSVEIKKARVEAGMTIEEVSEATEWSMGKISNIETGVRLKPTVMEIRGLLDVYEVTDERRREAILNLTRQARELGWWSKYTDVFTDDFVAFEGEARRIRTYELARIPGLLQTPRYVESLMRASLYQSPPDIERAVETRRQRQQILTAPDAPELWAVIDEAALLRIQREDVLKEQVEHLIAVAEADNTVTLQILPFSNGMHAGLQGPFVILEFVPGVSPVVYLETDTDGLYLEEPDELERYGRLFDHVRASARYPEASLQILKNLI
>NC_018524.1|WP_187294552.1|2273163_2273340_+|hypothetical-protein
MRSYVLDLLASTPAPSRAPSLTPVFVPRPRRPLEALNASEVPLLERVLTGLRNLPEVA
>NC_018524.1|WP_014912826.1|2273773_2274025_+|hypothetical-protein
MDEYGDTWAPPAQVLAELTARWGRTHKIAWTGRFWLATHHHPRAPWRSQIEPTPEQLESRLRAHYGMPPGPPAERTKRRRDAR
>NC_018524.1|WP_041561797.1|2274092_2274848_+|SAM-dependent-methyltransferase
MTNAARTFDYLDYGKDSWSQDRHTAVRMAEASPALAGQMLVHRKAREGVVDAVCHSFSQVIDLGCGLPTMRRAPHERGRVLWGSRARTVYVDHDLAVLAAARAWWEHPARVRGGNVHVLDLDLRYPKILASALGEHLDLSVPVGVLSTLTLDHLEDSEVTGLVEALAARLAPGSGWGITHLSGMVGAADVYTGQAVEQGADTRLVARESDGLRKVFEESGWRWHVSPPNDPGRGEPPIAALTTLTGTTRPC
>NC_018524.1|WP_041562167.1|2274988_2275486_+|helix-turn-helix-transcriptional-regulator
MNEHDADSLCADSKKELGVHLKRLRKAAGLSGYRLSGVDQSTVSRIETGRIRPSHELMIRLLDAYEADQEGREQAYLLWDQAQLPLQTRRRQVEGTRPAWDQAARPAYGPTLLAGASAAEDAARYLTRAQWAGNSPARRNALLDDAEGRLVQVLAALHAARTRTR
>NC_018524.1|WP_017536469.1|2275542_2275734_+|helix-turn-helix-domain-containing-protein
MTQPDVDPMDLLTPQEVAQAFRVDPKTVRLWAQEGRLRWVRTLGGHRRYFKSDVQRLLTEPGR
>NC_018524.1|WP_014910898.1|2276046_2276856_-|xanthine-dehydrogenase-accessory-protein-XdhC
MTWIAAVAGLRERREFGVLATVATVRGHAPRDAGAKLVVGRTETWGSIGGGNVEAVVIDRAREMIAASGAEPELIDFALNDKVTGPHGVQCCGGTVSVLLEPLPTVRAVAIFGVGHVGLELARVLARQDLDLHLVDSRSEMLTEERLSVLADAVARVRAHHTPLLPEEVLEGLPPGAHVLIMTHDHAEDAALCDAALRTTHLGSIGLIGSSAKWARFRRRLASEGGHDEEDIDRIKTPIGLPDVTGKDPATIAVSVAADLLRTFEAETD

Crispr_ID: NC_018524_16

• CRISPR_ID: NC_018524_16
• CRISPR_location: 2357339-2357434
• CRISPR_type: Orphan
• Repeat_type: NA
• Spacer_info: 1 spacers

Consensus repeat of NC_018524_16

Consensus_repeat	Method
CCGTCGGGTCCGCAGCGTCCTCC	CRISPRCasFinder

spacers of NC_018524_16

>16.1|2357362|49|NC_018524|CRISPRCasFinder
GCCGCCGCAGGCACCGTCCGGCCCGCCACCGGCCTCCGGCCCTCGGATC

CRISPR arrays and Neighbor proteins around NC_018524_16

CRISPR arrays

The CRISPR arrays of NC_018524_16

>merge|NC_018524|16|2357339-2357434|CRISPRCasFinder
CCCTCCGAACGGCAGGGACCTCCGCCGCCGCAGGCACCGTCCGGCCCGCCACCGGCCTCCGGCCCTCGGATCCCCTCGGGACCGCAGCGTCCTCCG

>NC_018524|16|15|2357339-2357434|CRISPRCasFinder
CCCTCCGAACGGCAGGGACCTCC	GCCGCCGCAGGCACCGTCCGGCCCGCCACCGGCCTCCGGCCCTCGGATC
CCCTCGGGACCGCAGCGTCCTCCG

Neighbor Proteins Overview

Protein	Signature genes	Signature genes Name	Protein_function
NC_018524.1|WP_014908700.1|2364796_2365369_+|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_148281615.1|2359855_2362882_+|sigma-70-family-RNA-polymerase-sigma-factor	unknown	unknown	gnl|CDD|274357
NC_018524.1|WP_014908832.1|2368664_2369741_+|ribonucleotide-diphosphate-reductase-subunit-beta	unknown	unknown	gnl|CDD|235968
NC_018524.1|WP_014912394.1|2371317_2371497_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014909589.1|2352955_2353285_+|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014913391.1|2354715_2356041_+|type-VII-secretion-integral-membrane-protein-EccD	unknown	unknown	gnl|CDD|274855
NC_018524.1|WP_148281613.1|2348332_2349193_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014910193.1|2352222_2352492_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014910336.1|2353653_2354631_+|TNT-domain-containing-protein	unknown	unknown	gnl|CDD|379424
NC_018524.1|WP_014910069.1|2363069_2364770_+|NYN-domain-containing-protein	unknown	unknown	gnl|CDD|350235
NC_018524.1|WP_014908335.1|2371892_2373467_+|sodium/proline-symporter-PutP	unknown	unknown	gnl|CDD|271369
NC_018524.1|WP_014909629.1|2346670_2348242_-|immunity-49-family-protein	unknown	unknown	gnl|CDD|373949
NC_018524.1|WP_014912421.1|2353310_2353604_+|pore-forming-ESAT-6-family-protein	unknown	unknown	unknown
NC_018524.1|WP_014910013.1|2370009_2371230_+|acyl-CoA-dehydrogenase-family-protein	unknown	unknown	gnl|CDD|173847
NC_018524.1|WP_041561805.1|2356052_2356925_+|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_041561807.1|2366019_2368560_+|ribonucleoside-diphosphate-reductase-subunit-alpha	unknown	unknown	gnl|CDD|235966
NC_018524.1|WP_026124985.1|2373590_2374175_+|putative-glycolipid-binding-domain-containing-protein	unknown	unknown	gnl|CDD|377662
NC_018524.1|WP_017534416.1|2358983_2359745_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_148281614.1|2349193_2351707_-|hypothetical-protein	unknown	unknown	gnl|CDD|237171
NC_018524.1|WP_014910837.1|2351848_2352190_-|hypothetical-protein	unknown	unknown	unknown

rpsblast for functional proteins

Protein	Function_ID	Function_description	E-value
NC_018524.1|WP_014910336.1|2353653_2354631_+|TNT-domain-containing-protein	gnl|CDD|379424	pfam14021, TNT, Tuberculosis necrotizing toxin. This is the C-terminal domain secreted by Mycobacterium tuberculosis (Mtb). It induces necrosis of infected cells to evade immune responses. Mtb utilizes the protein CpnT to kill human macrophages by secreting its C-terminal domain (CTD), named tuberculosis necrotizing toxin (TNT) that induces necrosis. It acts as a NAD+ glycohydrolase which hydrolyzes the essential cellular coenzyme NAD+ in the cytosol of infected macrophages resulting in necrotic cell death. CpnT transports its toxic CTD from the cell surface of M. tuberculosis by proteolytic cleavage, where the toxin is cleaved to induce host cell death. Structural analysis determined that the TNT core contains only six beta-strands as opposed to seven found in all known NAD+-utilizing toxins, and is significantly smaller, with only two short alpha-helices and two 3/10 helices. Furthermore, the putative NAD+ binding pocket identified Q822, Y765 and R757 as residues possibly involved in NAD+-binding and hydrolysis based on similar positions of catalytic amino acids of ADP-ribosylating toxins. While glutamine 822 residue was detected to be highly conserved among TNT homologs.	3.67902e-24
NC_018524.1|WP_148281615.1|2359855_2362882_+|sigma-70-family-RNA-polymerase-sigma-factor	gnl|CDD|274357	TIGR02937, RNA_polymerase_sigma_factor, RNA polymerase sigma factor, sigma-70 family. This model encompasses all varieties of the sigma-70 type sigma factors including the ECF subfamily. A number of sigma factors have names with a different number than 70 (i.e. sigma-38), but in fact, all except for the Sigma-54 family (TIGR02395) are included within this family. Several Pfam models hit segments of these sequences including Sigma-70 region 2 (pfam04542) and Sigma-70, region 4 (pfam04545), but not always above their respective trusted cutoffs.	3.98401e-29
NC_018524.1|WP_014910069.1|2363069_2364770_+|NYN-domain-containing-protein	gnl|CDD|350235	cd10911, PIN_LabA, PIN domain of Synechococcus elongatus LabA (low-amplitude and bright) and related proteins. This subfamily contains Synechococcus elongatus PCC 7942 LabA which participates in cyanobacterial circadian timing, it is required for negative feedback regulation of the autokinase/autophosphatase KaiC, a central component of the circadian clock system, and appears to be necessary for KaiC-dependent repression of gene expression. This subfamily belongs to the LabA-like domain family which includes the N-terminal domain of limkain b1, a human autoantigen localized to a subset of ABCD3 and PXF marked peroxisomes. Also included in the LabA-like domain family are human ZNF451, uncharacterized Bacillus subtilis YqxD, uncharacterized Escherichia coli YaiI, and the N-terminal domain of a well-conserved group of mainly bacterial proteins with no defined function, which contain a C-terminal LabA_like_C domain. Curiously Pseudomonas putida S16 NicB , which is described as a putative NADH-dependent hydroxylase involved in the microbial degradation of nicotine also falls into the LabA-like family. The PIN (PilT N terminus) domain belongs to a large nuclease superfamily. The structural properties of the PIN domain indicate its active center, consisting of three highly conserved catalytic residues which coordinate metal ions; in some members, additional metal coordinating residues can be found while some others lack several of these key catalytic residues. The PIN active site is geometrically similar in the active center of structure-specific 5' nucleases, PIN-domain ribonucleases of eukaryotic rRNA editing proteins, and bacterial toxins of toxin-antitoxin (TA) operons.	8.85936e-16
NC_018524.1|WP_014908832.1|2368664_2369741_+|ribonucleotide-diphosphate-reductase-subunit-beta	gnl|CDD|235968	PRK07209, PRK07209, ribonucleotide-diphosphate reductase subunit beta; Validated.	0
NC_018524.1|WP_014908335.1|2371892_2373467_+|sodium/proline-symporter-PutP	gnl|CDD|271369	cd11475, SLC5sbd_PutP, Na(+)/proline cotransporter PutP and related proteins; solute binding domain. Escherichia coli PutP catalyzes the Na+-coupled uptake of proline with a stoichiometry of 1:1. The putP gene is part of the put operon; this operon in addition encodes a proline dehydrogenase, allowing the use of proline as a source of nitrogen and/or carbon. This subfamily also includes the Bacillus subtilis Na+/proline cotransporter (OpuE) which has an osmoprotective instead of catabolic role. Expression of the opuE gene is under osmotic control and different sigma factors contribute to its regulation; it is also a putative CcpA-activated gene. This subfamily belongs to the solute carrier 5 (SLC5) transporter family.	0
NC_018524.1|WP_014909629.1|2346670_2348242_-|immunity-49-family-protein	gnl|CDD|373949	pfam15575, Imm49, Immunity protein 49. A predicted immunity protein with an all alpha-helical fold and a conserved proline residue. Proteins containing this domain are present in bacterial polymorphic toxin systems as an immediate gene neighbor of the toxin gene, usually containing a domain of the Tox-REAse-1 or Tox-REase-6 families.	1.43636e-49
NC_018524.1|WP_014910013.1|2370009_2371230_+|acyl-CoA-dehydrogenase-family-protein	gnl|CDD|173847	cd01158, SCAD_SBCAD, Short chain acyl-CoA dehydrogenases and eukaryotic short/branched chain acyl-CoA dehydrogenases. Short chain acyl-CoA dehydrogenase (SCAD). SCAD is a mitochondrial beta-oxidation enzyme. It catalyzes the alpha,beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of SCAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. This subgroup also contains the eukaryotic short/branched chain acyl-CoA dehydrogenase(SBCAD), the bacterial butyryl-CoA dehydorgenase(BCAD) and 2-methylbutyryl-CoA dehydrogenase, which is involved in isoleucine catabolism. These enzymes are homotetramers.	8.6144e-89
NC_018524.1|WP_026124985.1|2373590_2374175_+|putative-glycolipid-binding-domain-containing-protein	gnl|CDD|377662	pfam06475, Glycolipid_bind, Putative glycolipid-binding. This family has a novel fold known as a spiral beta-roll, consisting of a 15-stranded beta sheet wrapped around a single alpha helix. It forms dimers. It has some structural similarity to the E. coli lipoprotein localization factors LolA and LolB. Its structure suggests that it may have a role in glycolipid binding. Its genomic context supports a role in glycolipid metabolism.	2.12987e-52
NC_018524.1|WP_041561807.1|2366019_2368560_+|ribonucleoside-diphosphate-reductase-subunit-alpha	gnl|CDD|235966	PRK07207, PRK07207, ribonucleoside-diphosphate reductase subunit alpha.	0
NC_018524.1|WP_014913391.1|2354715_2356041_+|type-VII-secretion-integral-membrane-protein-EccD	gnl|CDD|274855	TIGR03920, T7SS_EccD, type VII secretion integral membrane protein EccD. Members of this family are EccD, a component of actinobacterial type VII secretion systems (T7SS) with ten to eleven predicted transmembrane helix regions. [Protein fate, Protein and peptide secretion and trafficking].	2.90661e-19
NC_018524.1|WP_148281614.1|2349193_2351707_-|hypothetical-protein	gnl|CDD|237171	PRK12678, PRK12678, transcription termination factor Rho; Provisional.	2.96595e-05

Protein sequences

>NC_018524.1|WP_041561805.1|2356052_2356925_+|hypothetical-protein
MDVEQRVRPVFGDGWARRVGRLLFRPLGPVDGVARAVELGSGLQRSTVTGRRIAVDDVGTGADATVVAALMARALAHLRHDRVLVVDAKTGEPSLATRLGASEPGDLGATDAAAFETVRDGLGQVTDRLWTARTDPEDGGTYASGLLPVSRFFGVTLVAGERGGGFLETMAARAHSRVRVVRATREAVVRLGRELDAVASGENAAELARTVVVLAREQDTGQDLDVTRTARIIEESGAAVIVLPPDRHLEQRIEALPDRIAESTHRLVQAVAVEALARAVDGGSSTEGGR
>NC_018524.1|WP_014913391.1|2354715_2356041_+|type-VII-secretion-integral-membrane-protein-EccD
MTAWSRVTLVGEERRVDAVLPADEPVGALMPEVLELLGDPVENPARSRHLVTTSGTALVGETTLAEREVADGAVLRLVRAEDPVPAPVVHEVPEAVSQAIDDHSGRWTPSAARWTATAALVALAVLGAWLGHLHSPSTGGMTGLAVVAALLLVAGAALGAFWREPLGTALSMAGAAVGVLTLWLACDLFGWPEWARWGGSVALVAGLVLMLGLTSGLGRGGLIGGGTGLALAVVWSGAAAFGLPAHQVAAVMTVACVVLLSTILRLALMFSGLAVFDDRRNAGEDVARGDVLSSVADAHRSLVIATVAVAAAAVTAGVGLASQLDPWTAGLAVALAVVVASRSRLFPLTVQKAVLVVASLVVAGAFLLALTQTYAWGIWPALGTVAAVAAIPAVVLSVEQPEHVRARLRGITSRCEAVAVIVLVPLAVGAFGTYQRLLETF
>NC_018524.1|WP_014910336.1|2353653_2354631_+|TNT-domain-containing-protein
MARDYDSQLLESVAVRRQRLREAVLFGGGRTRRRLDENIAKVIGSVCLAAVVCGGSVGWSFIDHRLGTQRVEQEQAASGPATRALPPTPGNWVGSEVTFDQLRAELDEAGVAPSLYVLPGDPRPDPGTVDSYYLITEDSEGYLSVSVMDHDQGRPGAEFRTEDETARWLHQELATVEADPAPLTSSQETEAAAASTALADKVRDELEQRSGGSYLHTLEPGDLVDAFGQESGRHLGPDGTPFAERGLPEHARADPDGEPLYHRYRVIHPFQVTATTAPAEGDLPGGGIRFTLDTAGFGETPPAPTLRWLIGNGYVERVAVTEVPD
>NC_018524.1|WP_014912421.1|2353310_2353604_+|pore-forming-ESAT-6-family-protein
MKNAYDLGASQEAQGNINTIMNRLEGIIGERDTDVSTAMSEFEATGVSEEYSEKELKWHNAANEVREIIRLVRETLETNDSTAQETLSRANSAVQSI
>NC_018524.1|WP_014909589.1|2352955_2353285_+|hypothetical-protein
MSRWEVGDATLTTLGQNTAGSGDELSSLVQQLVQAAEPLAGKFDGAGKAAFDSFKARADGIASDLRAGLGSIQVGQEGMNAAFVGGADTMADDANANMGAANFDGAKFR
>NC_018524.1|WP_014910193.1|2352222_2352492_-|hypothetical-protein
MKFELIDLPEPTPSSSDEPTEHEPGLPPVRVVAERARGRVRAESEALRVTLDRMWESIASTRTERSPATTIPSVVPTGFRPEAFSRRDD
>NC_018524.1|WP_014910837.1|2351848_2352190_-|hypothetical-protein
MSQWNIQPEAVGGVLQTVVGHFGEEGSGEGFVGIFDKLQDNLEQAGEASADAAVNMALMEFAGHYFGILGDMASLTMSAVSGASEATTHYVNGNLEMAEEAQENAGVIPDPEP
>NC_018524.1|WP_148281614.1|2349193_2351707_-|hypothetical-protein
MSDLIDPSSFPIPETKTYTLDYVAGKLTRQGDELTTVVGDITSAWSGLEDCYSAPESADLYTVLSPLTGDAEEVATALSTTGDALSTFAERVAEIKRDWYALRTEAREFLSSIDYGEKEGWRDGSGIWFWKEESPDVVKHNELIKRGNDLVEAYEEAARDCANAITSQFDGTVFVPNSADGTPPGEGQFAYGFDGSVDVPTEWGSAQKTDHAWYNDAGDAVGDFVVGIGEDLGGAIGIHSATNGWFGASWGDNLAEYWGDAFYGAAAMAGFSRDEEGWGWSGSTMKDSWRDAAHAMVPWEEWGERPWYTIGTAALNIGSVVAGVALSATGVGAVVGAPLLAWRGSKVLSSVGGGRTPDLDTPDTPRLSQAELARIPRYGDGPVTPVDLSGVDAAKLDTSALGRMNESLERLSAARSGGGDGSGSGRPGGSETDTQGTGARPTTAGSTPDTERTERRSPTGRKDDETENPTAGQLQDTQDFLDGIDQESTNSVREGAQREQDKWVAEQTVPDDASSLYDTPVQRYESEPARVEAPVQEKVGAGVGAEGGGLKVNAHSDNGHVNASTDTTGSPMDTPRTGGSGGHHLLGSESGRGGTLGGNGSSGGGGGTGGPGNGNGNGGVPGGRLPDDPNSSDRPNDRSDAEDRPNDRTDTDDRPNDKSDTEDQPNERNNPEDKNERREDTSQQEKKKNRREWPAKSDIDGPAGGKTLREPHQRHTFGGIKSGAVKEKNSLIHPGEMESVRLDIEGIAEGRASFHDETNLYHINNRSYGVEDNGTVYPVQGPGITLLDRNAYKALKEIIKANGDPERTRVMFERAPAFKNNPEAVEQARDLYRRFKK
>NC_018524.1|WP_148281613.1|2348332_2349193_-|hypothetical-protein
MNYDAMLPTSIAPGKLKSTLSKIFELPETDVDVNHSDYFGERNWDAKVTCDYEEKVGDVKIYLDIYAVDDIDTLPSSQEFALRLANLLCSSVIQQVDEPLYGVAKITTPSGETGYVRFDFPYEDEEIHVISGTEVPIPEFPKVGFSRFPEMIKSQNLPKIITDQYFPKEVPGDLGKLYSLSSAWEKLTVRMRTGWPPSGWYPASMYQDDLKARDEWEEICHRLAEETTAGPTKAMALIDRIFIESTVDDSGDSLVRAGEISTEDLASRPWYWRRRPKDAPWVEKDH
>NC_018524.1|WP_014909629.1|2346670_2348242_-|immunity-49-family-protein
MLDDLEDRLFEPLTWPLETEAREALQEYVNLIDCGKGGPEREIGGFLDFCGADLRKFQLQWQFLWGSDFSGVRLDGADLYKAELVEALLHSASLQGANLHKADMSACEAQRASFAGANLLNTDLSESDLREADFKEVWAGGTLFFNSDLRGADFRRARFGTEKAGVWTDFSGAKVRGVRFSGTEGTVLGPIDVGENSRSILDGLDLEKWFADQGAPEVRVRKLKKGWLPIDIPKHDTGKPHFWDYMEFFEKRIEKRISWLINSQMMAGMAMDAVGLESLNYLSVDRRASEITTWEAWTTWMQVAEAPFAMCTLEPGQTTERLINQKIRTLKYLPPSNACDAGGWLTAFFLAATCRDEKRVFSLCQISPEFLREASEIEGGGYDDYIYPWIAAVQDFILDRPTLGENLYQAMDLSQPQNATISRAEVLDSLVFPVMNAFYRFVQQDTAKFNEAMGQGLRLFHAYYTADEERAENIYGTIPTHLFGIACLAYDLAQVAPDFNPDLDTPYFPVHILHRTRRNDIPI
>NC_018524.1|WP_017534416.1|2358983_2359745_-|hypothetical-protein
MGETEVGSGARDRMLHRARELRAPWRRRSREVGWGRFEDWWTPSVDALCTAHVAGDDLSGPCARLGEARARAGFGIGPSLEDLDAFARAVGWEQVPLPLARSLAEGWERGGRSRGDCQDPLTGLANSEYLRTRVGELYRGVEDGVPAAFGHHLVVVALDPALDPWRRTARLIVLGHELRRFFTRGESVCLVNRARIAVIATEDPDANGSLTRLRDEVCWEHGAAVWSAPLPSSHREASALLDSLDGGGDRADV
>NC_018524.1|WP_148281615.1|2359855_2362882_+|sigma-70-family-RNA-polymerase-sigma-factor
MTRIRDIFSSTCFRTPITPAPRTRFRRVAGAAQELKGRRGVTDADGEYTETLLGDAEIIRQVKAGDNAAFGTLYERHAGAARGLARQLLRGEAEVEDAVAEAFTKVLSVIQRGGGPTDAFRPYLLTAVRNAAYDRGRGEKRQVVTDDMESFDAGEPFVDPALEGLERSLIARAFLSLPERWQSVLWHTEIEGVKPAEAATILGMNPNGVAALAYRAREGLRQAYLQMHLAGSGTAEACRPTIGLLGAYVRGGLSKRDTTKVDRHMDDCGECREVYAELMDVNVGLRGVMLPLVVGFGATGYLASVPGATAGGAWWNRMSRRGQQATAGAAAAAGMAVAVAFALVGGDTPIPEEPSPAAAPPIDAPAEDPPPPAQDTPDDPPPATPDEPAPVPAPPADVPPEEVPDPPAPQEPDAPAPDAPAPEDPREDPPPAPEEPEPEPAPEEPLPEFAVGIDPVGSLVPGSEGIMVLDVLNTGQDTAEDVLAQITLPPGVEMISSGGAGNAVPMASGNGDWGCSAGSGGGECVRSGMAAGESSTHFLDVRVAPDADVDVPAGVVISSGNVSHRATGERGVTSEGIPARYATAGQVRTEAVGNSLMTCTDPEESKKPTWPWPWWGTPGIPETPEALPGPTPPAPTEDPGPTLPLPEQEDADLGRAPADHVSPEDAGEALDDLLGGGEEGTPDGPPGYPTPEAPSPEDEDPAPTGPPLTPEPPELPGETVEPTDPGEDHRDEDEPEEHEEGDCAQARARSGEGIDNDNWVMAPLDRDQDPTTTSSSSATWSLPEGGSVRWAGLYFSASGDPGVPTARVKGPGMAAYTTVTATETRSADLPAYSAYQSFADVTDLVRASGGGQWWVADVPAQGGRGVYAGWSLVLVLEDPAVEGYQQAMVLDETSAVFQDSNGAVFPVSGLLPTAVRTGVDVVAWEGDAELGGDRVLIDGVPHAPSEGPGTVDNAFVGSARGADGDPMTFGTDVTRFDAVLGRESEIRILSEQDALLVGVIALAAPMRT
>NC_018524.1|WP_014910069.1|2363069_2364770_+|NYN-domain-containing-protein
MDRCALFVDAGYLLADGAMAVHGTRNRDSVAWDYSGLVQFLNEVARDRTGLPLLRCYWYEAIADDRRTQEQDGIADIPGIKFRAARIRPGRREGVESYVQRDLTTLARTGVLCDAVLVSGDEDMAPVVADVQEMGVRVTVVHISVEGNWTISRSLRQECDDLIEIGAGHLRPHVELLSGGGSTQENAAKTTTPFANGRATPVPEQAPARPRSAERGRRAQPEQPADTSTGGLEAMFAGTGGQSVPQGSAMEQLRAMRRSLAQQRGDHLAGSGGENRASGGIDANGFPTGGQPVNGAAAYPGSPAGQNGQTPYPPPSTGAHQSMRGAEPNGYGLPSAPPNGTAPGLGTGPAGYDSTGPQPGFGGGTGPQPAFGGTGSQAAFDPGTGPQVSFATDAPQGPPPRRTPPAPDPRYGGGPGEDQGFGGGSDPNPTYGTSTEADAARRGGADPRFGERRPTGPEYDDRFGPRGHQESAPSPGYAQQTGPAPHTVDEAVHVAHREGNDFAESIAREAPALWVEAVLARRPRMPSDLEARLLQGSSLPIDHLLRDEVRDGLRQGFWQALERART
>NC_018524.1|WP_014908700.1|2364796_2365369_+|hypothetical-protein
MGAMRLTHVTTAELDRLEFHAVRSGEHGRIAAQLLDLANRVDAGSEVGRAELFVRAGEQWEIAQEFERACSAYQRAIDDGGVTVIDPHALSAGALLQLDERRQAEYHLERLESGGPAGLPTLIHVAEALYAHDDLEGAERWATAGARFHAGCSRSPYVEDLFLELLRIRFRIRSDLGRPEDDLDLILDEV
>NC_018524.1|WP_041561807.1|2366019_2368560_+|ribonucleoside-diphosphate-reductase-subunit-alpha
MTLDVEAAPVSVRPTQTHEGGPGTAIDRIEHVVAEACAGLTGVSAEKVLDEARRGFYPGIADSEVELALVMAARSFVEVDPDYSYVAARLLLDKLRTEALSFVFDAHETAGQTEMGDRYAGYLAAYVRRGVELGQLDPALAGFDLDVLGRALHADRDEQFTFLGLQTLYDRYFLHSDDVRYELPQAFFMRVAMGLALNEDDREARAIEFYELLSSFDFMASTPTLFNAGTVRAQLSSCFLTTIGDDLQEIFHGIGNNAMLSKYSGGLGNDWTPVRGLGSHIKGTNGKSQGVVPFLKIANDTAVAVNQGGKRKGAVCAYLETWHIDIEEFLDLRKNTGDERRRTHDMNTANWVPDLFMKRVEEQGSWTLFSPDEVPDLHDKYGLEFVEAYERYEAEARAGRIKVHRTLPAVDLWRRMLTMLFETGHPWITFKDPSNLRSPQQHVGVVHSSNLCTEITLNTDKDEVAVCNLGSVNLARHVSAEGIDIERLRRTVRTAVRMLDNVIDVNFYTIPEARRANMRHRPVGLGLMGFQDALFELRTPYGSEGAVSFADESMELIGYYAIEASMELAAERGSYETFEGSLWSRGVLPIDSLRLLAEARGGDLDMDRGETLDWDSLRERVRTTGMRNSNVMAIAPTATIANITGVNQSIEPVYRNLYVKSNMSGDFTVVNDHLVRDLKERGLWDEEMVAELKRHDGSLGEIDRVPDDLKDLYATSFEVDPSWLVEAGSRRQKWIDQAQSLNLYMAAPSGRKLDALYRKAWRSGLKTTYYLRAQSATHVEKSTLKGTDGRLNAVSATPAPAPTPAPAPSPSPVPVPVAEPTAAEEEFEIVEDQACSIDDPECEACQ
>NC_018524.1|WP_014908832.1|2368664_2369741_+|ribonucleotide-diphosphate-reductase-subunit-beta
MTTVSENNDTTGLGEIERDAARVNVDDKAMINARADVNQLLPLKYTWAWEKYLAGCNNHWMPTEVAMQADIALWKSKDGLTEDERLMLKRNLGFFATAESLVANNIVLAVYRQLTNPECRQYLLRQAFEEAVHTHTFQYICESLGLDEGELFNMYREVPSITAKDAWALKYTQNLEDPDFSTGTPEADQAFLRDLVAFYVIFEGMWFYTGFAQILSLGRRNKMVGIAEQYQYILRDESIHLNFGIDVINQIKIENPHLWSEEFQAEVRRMLTEACELEVAYGRETMPRGVLGLNADLCEQYMRFITDRRAEQIGLAPIFGETENPFPWMSEMMDLQKEKNFFETRVIEYQTGGGLDWD
>NC_018524.1|WP_014910013.1|2370009_2371230_+|acyl-CoA-dehydrogenase-family-protein
MDHVFGDERHRRLRAEVREFAEHEVAPRIPEMERRRHVDHELSRLIAEQGWIGVTVDPAYGGMGAGHLAKTIIIEEMSRVSGAMGAMVQASQLGVAKIVHFGNPAQRAAWLPRVAAGRCLPTIAVTEYGSGGHVLGMTGGAVRDGDDYVLNGRKVFVGNSHVGDLHGVVVRTGEGSRGLSAFLVESDRPGFSLGPHEGTMGLHGFSFGELIFEDCRVPAANMLGEEGDGLAVAYSSSVLYGRANLAAVALGIHRALVEETCAYASEQHRYGRPLCEVPSVKLKLGQMQSRLMMATLSLYHAVSLLDRGAACDHELINAKLVNVEYALDTARNAMEIHAARGLYTDRPIERYLRDAHHIFAPAGTSDVQLLRLGEAALGVDRGQWSERLADRTAVSESGPVAAPLVA
>NC_018524.1|WP_014912394.1|2371317_2371497_-|hypothetical-protein
MDAQPAAIRARSIGPSGICPRGEHDWKPSAPGSARHLCTKCNSMMTRNYEPEVAEPAAD
>NC_018524.1|WP_014908335.1|2371892_2373467_+|sodium/proline-symporter-PutP
MEDSSIGSIVIFGVYLAGMVGIGLWVYKRTVSQADFVLGGRSLNSWVSGLSANASDFSGWLLLGLPGAIYVSGLGEAWIAVGLASGFAGSWLIIAPRLRVYTERVTDSRTGAESDSLTLSSFLENRFNDRTRLLRAVSAILIIVFYFFYVASGLVAMASLFDMVFGLDPAPAIAIGVAIVVLYTVLGGFLAVSYTDVVQAMMMWLALLVVPIMAISALGGFAGLTDGVTDKAEGLMSAFGGTSLDADTGAWITTETLGAVVIVSGLAWGFGYFGQPHILARYMGIRSVKDIPKAAGISVVWAVTAMILAVLVGFIGIAYFDTPLGDPEQVFPSLIASLTNPLVAGVLLAAILAAVMSTADSQLLVAASALTEDGYKAFVDEKASPRSLLWISRGTVVAVAIIAALVALYGNSSVMDLVGYAWAGFGAGFGPVLLLALFWKRMTWAGALAGMIVGGSSAILWDILDSAYLGTGLYAMVPAVALSFLSILLFNGLGKVSEQMEADFDRVEAELKSGGHDEKPTAAV
>NC_018524.1|WP_026124985.1|2373590_2374175_+|putative-glycolipid-binding-domain-containing-protein
MSSPPQHPTAWARTDVPEGMGIGTLLPEPDGFRLEAGETVFAREERFLTRFTVWTDLAWATTRVHAEVLSAAGTETVTLQAQGGHWSDGKGGELRELVGCLDVDIAATPLTNTLPIRRLGLRPGEHRDIAVVWIDIPSLRIRRVRQRYTRHHAENGLELYTYRDPLHGEYRISVDGDGVVVDYERFVRRWSPDP

Crispr_ID: NC_018524_18

• CRISPR_ID: NC_018524_18
• CRISPR_location: 2357840-2358003
• CRISPR_type: Orphan
• Repeat_type: NA
• Spacer_info: 3 spacers

Consensus repeat of NC_018524_18

Consensus_repeat	Method
CCGTCGGGTCCGCAGCGTCCTCC	CRISPRCasFinder

spacers of NC_018524_18

>18.1|2357863|22|NC_018524|CRISPRCasFinder
GGGCCGGTTCCCCGCGCAGCCA
>18.2|2357908|28|NC_018524|CRISPRCasFinder
CGCCGGGCCGCCCGGGGCCGGCTCCGCG
>18.3|2357959|22|NC_018524|CRISPRCasFinder
CGGGCCTCCCGCGGCCCAGGCC

CRISPR arrays and Neighbor proteins around NC_018524_18

CRISPR arrays

The CRISPR arrays of NC_018524_18

>merge|NC_018524|18|2357840-2358003|CRISPRCasFinder
CCCTCCGGTCCGCAGAACCCTCCGGGCCGGTTCCCCGCGCAGCCACCCTCGGGTCCCCGACGTCCGCTCGCCGGGCCGCCCGGGGCCGGCTCCGCGCCGTCCGGGCCGCAGCGACCTCCCGGGCCTCCCGCGGCCCAGGCCCCGTCGGGGCCGCAGAGCCCCGC

>NC_018524|18|17|2357840-2358003|CRISPRCasFinder
CCCTCCGGTCCGCAGAACCCTCC	GGGCCGGTTCCCCGCGCAGCCA
CCCTCGGGTCCCCGACGTCCGCT	CGCCGGGCCGCCCGGGGCCGGCTCCGCG
CCGTCCGGGCCGCAGCGACCTCC	CGGGCCTCCCGCGGCCCAGGCC
CCGTCGGGGCCGCAGAGCCCCGC

Neighbor Proteins Overview

Protein	Signature genes	Signature genes Name	Protein_function
NC_018524.1|WP_014908700.1|2364796_2365369_+|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_148281615.1|2359855_2362882_+|sigma-70-family-RNA-polymerase-sigma-factor	unknown	unknown	gnl|CDD|274357
NC_018524.1|WP_014908832.1|2368664_2369741_+|ribonucleotide-diphosphate-reductase-subunit-beta	unknown	unknown	gnl|CDD|235968
NC_018524.1|WP_014912394.1|2371317_2371497_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014909589.1|2352955_2353285_+|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014913391.1|2354715_2356041_+|type-VII-secretion-integral-membrane-protein-EccD	unknown	unknown	gnl|CDD|274855
NC_018524.1|WP_148281613.1|2348332_2349193_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014910193.1|2352222_2352492_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014910336.1|2353653_2354631_+|TNT-domain-containing-protein	unknown	unknown	gnl|CDD|379424
NC_018524.1|WP_014910069.1|2363069_2364770_+|NYN-domain-containing-protein	unknown	unknown	gnl|CDD|350235
NC_018524.1|WP_014908335.1|2371892_2373467_+|sodium/proline-symporter-PutP	unknown	unknown	gnl|CDD|271369
NC_018524.1|WP_014909629.1|2346670_2348242_-|immunity-49-family-protein	unknown	unknown	gnl|CDD|373949
NC_018524.1|WP_014912421.1|2353310_2353604_+|pore-forming-ESAT-6-family-protein	unknown	unknown	unknown
NC_018524.1|WP_014910013.1|2370009_2371230_+|acyl-CoA-dehydrogenase-family-protein	unknown	unknown	gnl|CDD|173847
NC_018524.1|WP_041561805.1|2356052_2356925_+|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_041561807.1|2366019_2368560_+|ribonucleoside-diphosphate-reductase-subunit-alpha	unknown	unknown	gnl|CDD|235966
NC_018524.1|WP_026124985.1|2373590_2374175_+|putative-glycolipid-binding-domain-containing-protein	unknown	unknown	gnl|CDD|377662
NC_018524.1|WP_017534416.1|2358983_2359745_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_148281614.1|2349193_2351707_-|hypothetical-protein	unknown	unknown	gnl|CDD|237171
NC_018524.1|WP_014910837.1|2351848_2352190_-|hypothetical-protein	unknown	unknown	unknown

rpsblast for functional proteins

Protein	Function_ID	Function_description	E-value
NC_018524.1|WP_014910336.1|2353653_2354631_+|TNT-domain-containing-protein	gnl|CDD|379424	pfam14021, TNT, Tuberculosis necrotizing toxin. This is the C-terminal domain secreted by Mycobacterium tuberculosis (Mtb). It induces necrosis of infected cells to evade immune responses. Mtb utilizes the protein CpnT to kill human macrophages by secreting its C-terminal domain (CTD), named tuberculosis necrotizing toxin (TNT) that induces necrosis. It acts as a NAD+ glycohydrolase which hydrolyzes the essential cellular coenzyme NAD+ in the cytosol of infected macrophages resulting in necrotic cell death. CpnT transports its toxic CTD from the cell surface of M. tuberculosis by proteolytic cleavage, where the toxin is cleaved to induce host cell death. Structural analysis determined that the TNT core contains only six beta-strands as opposed to seven found in all known NAD+-utilizing toxins, and is significantly smaller, with only two short alpha-helices and two 3/10 helices. Furthermore, the putative NAD+ binding pocket identified Q822, Y765 and R757 as residues possibly involved in NAD+-binding and hydrolysis based on similar positions of catalytic amino acids of ADP-ribosylating toxins. While glutamine 822 residue was detected to be highly conserved among TNT homologs.	3.67902e-24
NC_018524.1|WP_148281615.1|2359855_2362882_+|sigma-70-family-RNA-polymerase-sigma-factor	gnl|CDD|274357	TIGR02937, RNA_polymerase_sigma_factor, RNA polymerase sigma factor, sigma-70 family. This model encompasses all varieties of the sigma-70 type sigma factors including the ECF subfamily. A number of sigma factors have names with a different number than 70 (i.e. sigma-38), but in fact, all except for the Sigma-54 family (TIGR02395) are included within this family. Several Pfam models hit segments of these sequences including Sigma-70 region 2 (pfam04542) and Sigma-70, region 4 (pfam04545), but not always above their respective trusted cutoffs.	3.98401e-29
NC_018524.1|WP_014910069.1|2363069_2364770_+|NYN-domain-containing-protein	gnl|CDD|350235	cd10911, PIN_LabA, PIN domain of Synechococcus elongatus LabA (low-amplitude and bright) and related proteins. This subfamily contains Synechococcus elongatus PCC 7942 LabA which participates in cyanobacterial circadian timing, it is required for negative feedback regulation of the autokinase/autophosphatase KaiC, a central component of the circadian clock system, and appears to be necessary for KaiC-dependent repression of gene expression. This subfamily belongs to the LabA-like domain family which includes the N-terminal domain of limkain b1, a human autoantigen localized to a subset of ABCD3 and PXF marked peroxisomes. Also included in the LabA-like domain family are human ZNF451, uncharacterized Bacillus subtilis YqxD, uncharacterized Escherichia coli YaiI, and the N-terminal domain of a well-conserved group of mainly bacterial proteins with no defined function, which contain a C-terminal LabA_like_C domain. Curiously Pseudomonas putida S16 NicB , which is described as a putative NADH-dependent hydroxylase involved in the microbial degradation of nicotine also falls into the LabA-like family. The PIN (PilT N terminus) domain belongs to a large nuclease superfamily. The structural properties of the PIN domain indicate its active center, consisting of three highly conserved catalytic residues which coordinate metal ions; in some members, additional metal coordinating residues can be found while some others lack several of these key catalytic residues. The PIN active site is geometrically similar in the active center of structure-specific 5' nucleases, PIN-domain ribonucleases of eukaryotic rRNA editing proteins, and bacterial toxins of toxin-antitoxin (TA) operons.	8.85936e-16
NC_018524.1|WP_014908832.1|2368664_2369741_+|ribonucleotide-diphosphate-reductase-subunit-beta	gnl|CDD|235968	PRK07209, PRK07209, ribonucleotide-diphosphate reductase subunit beta; Validated.	0
NC_018524.1|WP_014908335.1|2371892_2373467_+|sodium/proline-symporter-PutP	gnl|CDD|271369	cd11475, SLC5sbd_PutP, Na(+)/proline cotransporter PutP and related proteins; solute binding domain. Escherichia coli PutP catalyzes the Na+-coupled uptake of proline with a stoichiometry of 1:1. The putP gene is part of the put operon; this operon in addition encodes a proline dehydrogenase, allowing the use of proline as a source of nitrogen and/or carbon. This subfamily also includes the Bacillus subtilis Na+/proline cotransporter (OpuE) which has an osmoprotective instead of catabolic role. Expression of the opuE gene is under osmotic control and different sigma factors contribute to its regulation; it is also a putative CcpA-activated gene. This subfamily belongs to the solute carrier 5 (SLC5) transporter family.	0
NC_018524.1|WP_014909629.1|2346670_2348242_-|immunity-49-family-protein	gnl|CDD|373949	pfam15575, Imm49, Immunity protein 49. A predicted immunity protein with an all alpha-helical fold and a conserved proline residue. Proteins containing this domain are present in bacterial polymorphic toxin systems as an immediate gene neighbor of the toxin gene, usually containing a domain of the Tox-REAse-1 or Tox-REase-6 families.	1.43636e-49
NC_018524.1|WP_014910013.1|2370009_2371230_+|acyl-CoA-dehydrogenase-family-protein	gnl|CDD|173847	cd01158, SCAD_SBCAD, Short chain acyl-CoA dehydrogenases and eukaryotic short/branched chain acyl-CoA dehydrogenases. Short chain acyl-CoA dehydrogenase (SCAD). SCAD is a mitochondrial beta-oxidation enzyme. It catalyzes the alpha,beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of SCAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. This subgroup also contains the eukaryotic short/branched chain acyl-CoA dehydrogenase(SBCAD), the bacterial butyryl-CoA dehydorgenase(BCAD) and 2-methylbutyryl-CoA dehydrogenase, which is involved in isoleucine catabolism. These enzymes are homotetramers.	8.6144e-89
NC_018524.1|WP_026124985.1|2373590_2374175_+|putative-glycolipid-binding-domain-containing-protein	gnl|CDD|377662	pfam06475, Glycolipid_bind, Putative glycolipid-binding. This family has a novel fold known as a spiral beta-roll, consisting of a 15-stranded beta sheet wrapped around a single alpha helix. It forms dimers. It has some structural similarity to the E. coli lipoprotein localization factors LolA and LolB. Its structure suggests that it may have a role in glycolipid binding. Its genomic context supports a role in glycolipid metabolism.	2.12987e-52
NC_018524.1|WP_041561807.1|2366019_2368560_+|ribonucleoside-diphosphate-reductase-subunit-alpha	gnl|CDD|235966	PRK07207, PRK07207, ribonucleoside-diphosphate reductase subunit alpha.	0
NC_018524.1|WP_014913391.1|2354715_2356041_+|type-VII-secretion-integral-membrane-protein-EccD	gnl|CDD|274855	TIGR03920, T7SS_EccD, type VII secretion integral membrane protein EccD. Members of this family are EccD, a component of actinobacterial type VII secretion systems (T7SS) with ten to eleven predicted transmembrane helix regions. [Protein fate, Protein and peptide secretion and trafficking].	2.90661e-19
NC_018524.1|WP_148281614.1|2349193_2351707_-|hypothetical-protein	gnl|CDD|237171	PRK12678, PRK12678, transcription termination factor Rho; Provisional.	2.96595e-05

Protein sequences

>NC_018524.1|WP_041561805.1|2356052_2356925_+|hypothetical-protein
MDVEQRVRPVFGDGWARRVGRLLFRPLGPVDGVARAVELGSGLQRSTVTGRRIAVDDVGTGADATVVAALMARALAHLRHDRVLVVDAKTGEPSLATRLGASEPGDLGATDAAAFETVRDGLGQVTDRLWTARTDPEDGGTYASGLLPVSRFFGVTLVAGERGGGFLETMAARAHSRVRVVRATREAVVRLGRELDAVASGENAAELARTVVVLAREQDTGQDLDVTRTARIIEESGAAVIVLPPDRHLEQRIEALPDRIAESTHRLVQAVAVEALARAVDGGSSTEGGR
>NC_018524.1|WP_014913391.1|2354715_2356041_+|type-VII-secretion-integral-membrane-protein-EccD
MTAWSRVTLVGEERRVDAVLPADEPVGALMPEVLELLGDPVENPARSRHLVTTSGTALVGETTLAEREVADGAVLRLVRAEDPVPAPVVHEVPEAVSQAIDDHSGRWTPSAARWTATAALVALAVLGAWLGHLHSPSTGGMTGLAVVAALLLVAGAALGAFWREPLGTALSMAGAAVGVLTLWLACDLFGWPEWARWGGSVALVAGLVLMLGLTSGLGRGGLIGGGTGLALAVVWSGAAAFGLPAHQVAAVMTVACVVLLSTILRLALMFSGLAVFDDRRNAGEDVARGDVLSSVADAHRSLVIATVAVAAAAVTAGVGLASQLDPWTAGLAVALAVVVASRSRLFPLTVQKAVLVVASLVVAGAFLLALTQTYAWGIWPALGTVAAVAAIPAVVLSVEQPEHVRARLRGITSRCEAVAVIVLVPLAVGAFGTYQRLLETF
>NC_018524.1|WP_014910336.1|2353653_2354631_+|TNT-domain-containing-protein
MARDYDSQLLESVAVRRQRLREAVLFGGGRTRRRLDENIAKVIGSVCLAAVVCGGSVGWSFIDHRLGTQRVEQEQAASGPATRALPPTPGNWVGSEVTFDQLRAELDEAGVAPSLYVLPGDPRPDPGTVDSYYLITEDSEGYLSVSVMDHDQGRPGAEFRTEDETARWLHQELATVEADPAPLTSSQETEAAAASTALADKVRDELEQRSGGSYLHTLEPGDLVDAFGQESGRHLGPDGTPFAERGLPEHARADPDGEPLYHRYRVIHPFQVTATTAPAEGDLPGGGIRFTLDTAGFGETPPAPTLRWLIGNGYVERVAVTEVPD
>NC_018524.1|WP_014912421.1|2353310_2353604_+|pore-forming-ESAT-6-family-protein
MKNAYDLGASQEAQGNINTIMNRLEGIIGERDTDVSTAMSEFEATGVSEEYSEKELKWHNAANEVREIIRLVRETLETNDSTAQETLSRANSAVQSI
>NC_018524.1|WP_014909589.1|2352955_2353285_+|hypothetical-protein
MSRWEVGDATLTTLGQNTAGSGDELSSLVQQLVQAAEPLAGKFDGAGKAAFDSFKARADGIASDLRAGLGSIQVGQEGMNAAFVGGADTMADDANANMGAANFDGAKFR
>NC_018524.1|WP_014910193.1|2352222_2352492_-|hypothetical-protein
MKFELIDLPEPTPSSSDEPTEHEPGLPPVRVVAERARGRVRAESEALRVTLDRMWESIASTRTERSPATTIPSVVPTGFRPEAFSRRDD
>NC_018524.1|WP_014910837.1|2351848_2352190_-|hypothetical-protein
MSQWNIQPEAVGGVLQTVVGHFGEEGSGEGFVGIFDKLQDNLEQAGEASADAAVNMALMEFAGHYFGILGDMASLTMSAVSGASEATTHYVNGNLEMAEEAQENAGVIPDPEP
>NC_018524.1|WP_148281614.1|2349193_2351707_-|hypothetical-protein
MSDLIDPSSFPIPETKTYTLDYVAGKLTRQGDELTTVVGDITSAWSGLEDCYSAPESADLYTVLSPLTGDAEEVATALSTTGDALSTFAERVAEIKRDWYALRTEAREFLSSIDYGEKEGWRDGSGIWFWKEESPDVVKHNELIKRGNDLVEAYEEAARDCANAITSQFDGTVFVPNSADGTPPGEGQFAYGFDGSVDVPTEWGSAQKTDHAWYNDAGDAVGDFVVGIGEDLGGAIGIHSATNGWFGASWGDNLAEYWGDAFYGAAAMAGFSRDEEGWGWSGSTMKDSWRDAAHAMVPWEEWGERPWYTIGTAALNIGSVVAGVALSATGVGAVVGAPLLAWRGSKVLSSVGGGRTPDLDTPDTPRLSQAELARIPRYGDGPVTPVDLSGVDAAKLDTSALGRMNESLERLSAARSGGGDGSGSGRPGGSETDTQGTGARPTTAGSTPDTERTERRSPTGRKDDETENPTAGQLQDTQDFLDGIDQESTNSVREGAQREQDKWVAEQTVPDDASSLYDTPVQRYESEPARVEAPVQEKVGAGVGAEGGGLKVNAHSDNGHVNASTDTTGSPMDTPRTGGSGGHHLLGSESGRGGTLGGNGSSGGGGGTGGPGNGNGNGGVPGGRLPDDPNSSDRPNDRSDAEDRPNDRTDTDDRPNDKSDTEDQPNERNNPEDKNERREDTSQQEKKKNRREWPAKSDIDGPAGGKTLREPHQRHTFGGIKSGAVKEKNSLIHPGEMESVRLDIEGIAEGRASFHDETNLYHINNRSYGVEDNGTVYPVQGPGITLLDRNAYKALKEIIKANGDPERTRVMFERAPAFKNNPEAVEQARDLYRRFKK
>NC_018524.1|WP_148281613.1|2348332_2349193_-|hypothetical-protein
MNYDAMLPTSIAPGKLKSTLSKIFELPETDVDVNHSDYFGERNWDAKVTCDYEEKVGDVKIYLDIYAVDDIDTLPSSQEFALRLANLLCSSVIQQVDEPLYGVAKITTPSGETGYVRFDFPYEDEEIHVISGTEVPIPEFPKVGFSRFPEMIKSQNLPKIITDQYFPKEVPGDLGKLYSLSSAWEKLTVRMRTGWPPSGWYPASMYQDDLKARDEWEEICHRLAEETTAGPTKAMALIDRIFIESTVDDSGDSLVRAGEISTEDLASRPWYWRRRPKDAPWVEKDH
>NC_018524.1|WP_014909629.1|2346670_2348242_-|immunity-49-family-protein
MLDDLEDRLFEPLTWPLETEAREALQEYVNLIDCGKGGPEREIGGFLDFCGADLRKFQLQWQFLWGSDFSGVRLDGADLYKAELVEALLHSASLQGANLHKADMSACEAQRASFAGANLLNTDLSESDLREADFKEVWAGGTLFFNSDLRGADFRRARFGTEKAGVWTDFSGAKVRGVRFSGTEGTVLGPIDVGENSRSILDGLDLEKWFADQGAPEVRVRKLKKGWLPIDIPKHDTGKPHFWDYMEFFEKRIEKRISWLINSQMMAGMAMDAVGLESLNYLSVDRRASEITTWEAWTTWMQVAEAPFAMCTLEPGQTTERLINQKIRTLKYLPPSNACDAGGWLTAFFLAATCRDEKRVFSLCQISPEFLREASEIEGGGYDDYIYPWIAAVQDFILDRPTLGENLYQAMDLSQPQNATISRAEVLDSLVFPVMNAFYRFVQQDTAKFNEAMGQGLRLFHAYYTADEERAENIYGTIPTHLFGIACLAYDLAQVAPDFNPDLDTPYFPVHILHRTRRNDIPI
>NC_018524.1|WP_017534416.1|2358983_2359745_-|hypothetical-protein
MGETEVGSGARDRMLHRARELRAPWRRRSREVGWGRFEDWWTPSVDALCTAHVAGDDLSGPCARLGEARARAGFGIGPSLEDLDAFARAVGWEQVPLPLARSLAEGWERGGRSRGDCQDPLTGLANSEYLRTRVGELYRGVEDGVPAAFGHHLVVVALDPALDPWRRTARLIVLGHELRRFFTRGESVCLVNRARIAVIATEDPDANGSLTRLRDEVCWEHGAAVWSAPLPSSHREASALLDSLDGGGDRADV
>NC_018524.1|WP_148281615.1|2359855_2362882_+|sigma-70-family-RNA-polymerase-sigma-factor
MTRIRDIFSSTCFRTPITPAPRTRFRRVAGAAQELKGRRGVTDADGEYTETLLGDAEIIRQVKAGDNAAFGTLYERHAGAARGLARQLLRGEAEVEDAVAEAFTKVLSVIQRGGGPTDAFRPYLLTAVRNAAYDRGRGEKRQVVTDDMESFDAGEPFVDPALEGLERSLIARAFLSLPERWQSVLWHTEIEGVKPAEAATILGMNPNGVAALAYRAREGLRQAYLQMHLAGSGTAEACRPTIGLLGAYVRGGLSKRDTTKVDRHMDDCGECREVYAELMDVNVGLRGVMLPLVVGFGATGYLASVPGATAGGAWWNRMSRRGQQATAGAAAAAGMAVAVAFALVGGDTPIPEEPSPAAAPPIDAPAEDPPPPAQDTPDDPPPATPDEPAPVPAPPADVPPEEVPDPPAPQEPDAPAPDAPAPEDPREDPPPAPEEPEPEPAPEEPLPEFAVGIDPVGSLVPGSEGIMVLDVLNTGQDTAEDVLAQITLPPGVEMISSGGAGNAVPMASGNGDWGCSAGSGGGECVRSGMAAGESSTHFLDVRVAPDADVDVPAGVVISSGNVSHRATGERGVTSEGIPARYATAGQVRTEAVGNSLMTCTDPEESKKPTWPWPWWGTPGIPETPEALPGPTPPAPTEDPGPTLPLPEQEDADLGRAPADHVSPEDAGEALDDLLGGGEEGTPDGPPGYPTPEAPSPEDEDPAPTGPPLTPEPPELPGETVEPTDPGEDHRDEDEPEEHEEGDCAQARARSGEGIDNDNWVMAPLDRDQDPTTTSSSSATWSLPEGGSVRWAGLYFSASGDPGVPTARVKGPGMAAYTTVTATETRSADLPAYSAYQSFADVTDLVRASGGGQWWVADVPAQGGRGVYAGWSLVLVLEDPAVEGYQQAMVLDETSAVFQDSNGAVFPVSGLLPTAVRTGVDVVAWEGDAELGGDRVLIDGVPHAPSEGPGTVDNAFVGSARGADGDPMTFGTDVTRFDAVLGRESEIRILSEQDALLVGVIALAAPMRT
>NC_018524.1|WP_014910069.1|2363069_2364770_+|NYN-domain-containing-protein
MDRCALFVDAGYLLADGAMAVHGTRNRDSVAWDYSGLVQFLNEVARDRTGLPLLRCYWYEAIADDRRTQEQDGIADIPGIKFRAARIRPGRREGVESYVQRDLTTLARTGVLCDAVLVSGDEDMAPVVADVQEMGVRVTVVHISVEGNWTISRSLRQECDDLIEIGAGHLRPHVELLSGGGSTQENAAKTTTPFANGRATPVPEQAPARPRSAERGRRAQPEQPADTSTGGLEAMFAGTGGQSVPQGSAMEQLRAMRRSLAQQRGDHLAGSGGENRASGGIDANGFPTGGQPVNGAAAYPGSPAGQNGQTPYPPPSTGAHQSMRGAEPNGYGLPSAPPNGTAPGLGTGPAGYDSTGPQPGFGGGTGPQPAFGGTGSQAAFDPGTGPQVSFATDAPQGPPPRRTPPAPDPRYGGGPGEDQGFGGGSDPNPTYGTSTEADAARRGGADPRFGERRPTGPEYDDRFGPRGHQESAPSPGYAQQTGPAPHTVDEAVHVAHREGNDFAESIAREAPALWVEAVLARRPRMPSDLEARLLQGSSLPIDHLLRDEVRDGLRQGFWQALERART
>NC_018524.1|WP_014908700.1|2364796_2365369_+|hypothetical-protein
MGAMRLTHVTTAELDRLEFHAVRSGEHGRIAAQLLDLANRVDAGSEVGRAELFVRAGEQWEIAQEFERACSAYQRAIDDGGVTVIDPHALSAGALLQLDERRQAEYHLERLESGGPAGLPTLIHVAEALYAHDDLEGAERWATAGARFHAGCSRSPYVEDLFLELLRIRFRIRSDLGRPEDDLDLILDEV
>NC_018524.1|WP_041561807.1|2366019_2368560_+|ribonucleoside-diphosphate-reductase-subunit-alpha
MTLDVEAAPVSVRPTQTHEGGPGTAIDRIEHVVAEACAGLTGVSAEKVLDEARRGFYPGIADSEVELALVMAARSFVEVDPDYSYVAARLLLDKLRTEALSFVFDAHETAGQTEMGDRYAGYLAAYVRRGVELGQLDPALAGFDLDVLGRALHADRDEQFTFLGLQTLYDRYFLHSDDVRYELPQAFFMRVAMGLALNEDDREARAIEFYELLSSFDFMASTPTLFNAGTVRAQLSSCFLTTIGDDLQEIFHGIGNNAMLSKYSGGLGNDWTPVRGLGSHIKGTNGKSQGVVPFLKIANDTAVAVNQGGKRKGAVCAYLETWHIDIEEFLDLRKNTGDERRRTHDMNTANWVPDLFMKRVEEQGSWTLFSPDEVPDLHDKYGLEFVEAYERYEAEARAGRIKVHRTLPAVDLWRRMLTMLFETGHPWITFKDPSNLRSPQQHVGVVHSSNLCTEITLNTDKDEVAVCNLGSVNLARHVSAEGIDIERLRRTVRTAVRMLDNVIDVNFYTIPEARRANMRHRPVGLGLMGFQDALFELRTPYGSEGAVSFADESMELIGYYAIEASMELAAERGSYETFEGSLWSRGVLPIDSLRLLAEARGGDLDMDRGETLDWDSLRERVRTTGMRNSNVMAIAPTATIANITGVNQSIEPVYRNLYVKSNMSGDFTVVNDHLVRDLKERGLWDEEMVAELKRHDGSLGEIDRVPDDLKDLYATSFEVDPSWLVEAGSRRQKWIDQAQSLNLYMAAPSGRKLDALYRKAWRSGLKTTYYLRAQSATHVEKSTLKGTDGRLNAVSATPAPAPTPAPAPSPSPVPVPVAEPTAAEEEFEIVEDQACSIDDPECEACQ
>NC_018524.1|WP_014908832.1|2368664_2369741_+|ribonucleotide-diphosphate-reductase-subunit-beta
MTTVSENNDTTGLGEIERDAARVNVDDKAMINARADVNQLLPLKYTWAWEKYLAGCNNHWMPTEVAMQADIALWKSKDGLTEDERLMLKRNLGFFATAESLVANNIVLAVYRQLTNPECRQYLLRQAFEEAVHTHTFQYICESLGLDEGELFNMYREVPSITAKDAWALKYTQNLEDPDFSTGTPEADQAFLRDLVAFYVIFEGMWFYTGFAQILSLGRRNKMVGIAEQYQYILRDESIHLNFGIDVINQIKIENPHLWSEEFQAEVRRMLTEACELEVAYGRETMPRGVLGLNADLCEQYMRFITDRRAEQIGLAPIFGETENPFPWMSEMMDLQKEKNFFETRVIEYQTGGGLDWD
>NC_018524.1|WP_014910013.1|2370009_2371230_+|acyl-CoA-dehydrogenase-family-protein
MDHVFGDERHRRLRAEVREFAEHEVAPRIPEMERRRHVDHELSRLIAEQGWIGVTVDPAYGGMGAGHLAKTIIIEEMSRVSGAMGAMVQASQLGVAKIVHFGNPAQRAAWLPRVAAGRCLPTIAVTEYGSGGHVLGMTGGAVRDGDDYVLNGRKVFVGNSHVGDLHGVVVRTGEGSRGLSAFLVESDRPGFSLGPHEGTMGLHGFSFGELIFEDCRVPAANMLGEEGDGLAVAYSSSVLYGRANLAAVALGIHRALVEETCAYASEQHRYGRPLCEVPSVKLKLGQMQSRLMMATLSLYHAVSLLDRGAACDHELINAKLVNVEYALDTARNAMEIHAARGLYTDRPIERYLRDAHHIFAPAGTSDVQLLRLGEAALGVDRGQWSERLADRTAVSESGPVAAPLVA
>NC_018524.1|WP_014912394.1|2371317_2371497_-|hypothetical-protein
MDAQPAAIRARSIGPSGICPRGEHDWKPSAPGSARHLCTKCNSMMTRNYEPEVAEPAAD
>NC_018524.1|WP_014908335.1|2371892_2373467_+|sodium/proline-symporter-PutP
MEDSSIGSIVIFGVYLAGMVGIGLWVYKRTVSQADFVLGGRSLNSWVSGLSANASDFSGWLLLGLPGAIYVSGLGEAWIAVGLASGFAGSWLIIAPRLRVYTERVTDSRTGAESDSLTLSSFLENRFNDRTRLLRAVSAILIIVFYFFYVASGLVAMASLFDMVFGLDPAPAIAIGVAIVVLYTVLGGFLAVSYTDVVQAMMMWLALLVVPIMAISALGGFAGLTDGVTDKAEGLMSAFGGTSLDADTGAWITTETLGAVVIVSGLAWGFGYFGQPHILARYMGIRSVKDIPKAAGISVVWAVTAMILAVLVGFIGIAYFDTPLGDPEQVFPSLIASLTNPLVAGVLLAAILAAVMSTADSQLLVAASALTEDGYKAFVDEKASPRSLLWISRGTVVAVAIIAALVALYGNSSVMDLVGYAWAGFGAGFGPVLLLALFWKRMTWAGALAGMIVGGSSAILWDILDSAYLGTGLYAMVPAVALSFLSILLFNGLGKVSEQMEADFDRVEAELKSGGHDEKPTAAV
>NC_018524.1|WP_026124985.1|2373590_2374175_+|putative-glycolipid-binding-domain-containing-protein
MSSPPQHPTAWARTDVPEGMGIGTLLPEPDGFRLEAGETVFAREERFLTRFTVWTDLAWATTRVHAEVLSAAGTETVTLQAQGGHWSDGKGGELRELVGCLDVDIAATPLTNTLPIRRLGLRPGEHRDIAVVWIDIPSLRIRRVRQRYTRHHAENGLELYTYRDPLHGEYRISVDGDGVVVDYERFVRRWSPDP

Crispr_ID: NC_018524_17

• CRISPR_ID: NC_018524_17
• CRISPR_location: 2357492-2357779
• CRISPR_type: Orphan
• Repeat_type: NA
• Spacer_info: 5 spacers

Consensus repeat of NC_018524_17

Consensus_repeat	Method
CCGTCGGGTCCGCAGCGTCCTCC	CRISPRCasFinder

spacers of NC_018524_17

>17.1|2357515|22|NC_018524|CRISPRCasFinder
CGGGCCCCCTCCGGCCCAGGCC
>17.2|2357560|28|NC_018524|CRISPRCasFinder
GGCCGGGCCGGTCCCTCACGCTTCGGCT
>17.3|2357611|28|NC_018524|CRISPRCasFinder
CGGCGGCCCGCACGGTCCCTTCTCCGCG
>17.4|2357662|22|NC_018524|CRISPRCasFinder
GGGCCGGTTCCCTCAGCATGCT
>17.5|2357707|49|NC_018524|CRISPRCasFinder
GTCGGGTCCGCAGCGTCCTCCGGCCGGGCCGGTCCCTCCCGCCTCGGCT

CRISPR arrays and Neighbor proteins around NC_018524_17

CRISPR arrays

The CRISPR arrays of NC_018524_17

>merge|NC_018524|17|2357492-2357779|CRISPRCasFinder
CCCTCGGGCCCTCAACGGCCTCCCGGGCCCCCTCCGGCCCAGGCCCCGTCGGGTCCGCAGCGTCCTCCGGCCGGGCCGGTCCCTCACGCTTCGGCTCCGTCGGGTCCGCAGCCTCCTCCCGGCGGCCCGCACGGTCCCTTCTCCGCGCCGTCCGGTCCGCAGAACCCCGCGGGCCGGTTCCCTCAGCATGCTCCGTCGGGCCCTCAGCACGCCCCGTCGGGTCCGCAGCGTCCTCCGGCCGGGCCGGTCCCTCCCGCCTCGGCTCCGTCGGGTCCGCAGAACCCTCCA

>NC_018524|17|16|2357492-2357779|CRISPRCasFinder
CCCTCGGGCCCTCAACGGCCTCC	CGGGCCCCCTCCGGCCCAGGCC
CCGTCGGGTCCGCAGCGTCCTCC	GGCCGGGCCGGTCCCTCACGCTTCGGCT
CCGTCGGGTCCGCAGCCTCCTCC	CGGCGGCCCGCACGGTCCCTTCTCCGCG
CCGTCCGGTCCGCAGAACCCCGC	GGGCCGGTTCCCTCAGCATGCT
CCGTCGGGCCCTCAGCACGCCCC	GTCGGGTCCGCAGCGTCCTCCGGCCGGGCCGGTCCCTCCCGCCTCGGCT
CCGTCGGGTCCGCAGAACCCTCCA

Neighbor Proteins Overview

Protein	Signature genes	Signature genes Name	Protein_function
NC_018524.1|WP_014908700.1|2364796_2365369_+|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_148281615.1|2359855_2362882_+|sigma-70-family-RNA-polymerase-sigma-factor	unknown	unknown	gnl|CDD|274357
NC_018524.1|WP_014908832.1|2368664_2369741_+|ribonucleotide-diphosphate-reductase-subunit-beta	unknown	unknown	gnl|CDD|235968
NC_018524.1|WP_014912394.1|2371317_2371497_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014909589.1|2352955_2353285_+|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014913391.1|2354715_2356041_+|type-VII-secretion-integral-membrane-protein-EccD	unknown	unknown	gnl|CDD|274855
NC_018524.1|WP_148281613.1|2348332_2349193_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014910193.1|2352222_2352492_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014910336.1|2353653_2354631_+|TNT-domain-containing-protein	unknown	unknown	gnl|CDD|379424
NC_018524.1|WP_014910069.1|2363069_2364770_+|NYN-domain-containing-protein	unknown	unknown	gnl|CDD|350235
NC_018524.1|WP_014908335.1|2371892_2373467_+|sodium/proline-symporter-PutP	unknown	unknown	gnl|CDD|271369
NC_018524.1|WP_014909629.1|2346670_2348242_-|immunity-49-family-protein	unknown	unknown	gnl|CDD|373949
NC_018524.1|WP_014912421.1|2353310_2353604_+|pore-forming-ESAT-6-family-protein	unknown	unknown	unknown
NC_018524.1|WP_014910013.1|2370009_2371230_+|acyl-CoA-dehydrogenase-family-protein	unknown	unknown	gnl|CDD|173847
NC_018524.1|WP_041561805.1|2356052_2356925_+|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_041561807.1|2366019_2368560_+|ribonucleoside-diphosphate-reductase-subunit-alpha	unknown	unknown	gnl|CDD|235966
NC_018524.1|WP_026124985.1|2373590_2374175_+|putative-glycolipid-binding-domain-containing-protein	unknown	unknown	gnl|CDD|377662
NC_018524.1|WP_017534416.1|2358983_2359745_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_148281614.1|2349193_2351707_-|hypothetical-protein	unknown	unknown	gnl|CDD|237171
NC_018524.1|WP_014910837.1|2351848_2352190_-|hypothetical-protein	unknown	unknown	unknown

rpsblast for functional proteins

Protein	Function_ID	Function_description	E-value
NC_018524.1|WP_014910336.1|2353653_2354631_+|TNT-domain-containing-protein	gnl|CDD|379424	pfam14021, TNT, Tuberculosis necrotizing toxin. This is the C-terminal domain secreted by Mycobacterium tuberculosis (Mtb). It induces necrosis of infected cells to evade immune responses. Mtb utilizes the protein CpnT to kill human macrophages by secreting its C-terminal domain (CTD), named tuberculosis necrotizing toxin (TNT) that induces necrosis. It acts as a NAD+ glycohydrolase which hydrolyzes the essential cellular coenzyme NAD+ in the cytosol of infected macrophages resulting in necrotic cell death. CpnT transports its toxic CTD from the cell surface of M. tuberculosis by proteolytic cleavage, where the toxin is cleaved to induce host cell death. Structural analysis determined that the TNT core contains only six beta-strands as opposed to seven found in all known NAD+-utilizing toxins, and is significantly smaller, with only two short alpha-helices and two 3/10 helices. Furthermore, the putative NAD+ binding pocket identified Q822, Y765 and R757 as residues possibly involved in NAD+-binding and hydrolysis based on similar positions of catalytic amino acids of ADP-ribosylating toxins. While glutamine 822 residue was detected to be highly conserved among TNT homologs.	3.67902e-24
NC_018524.1|WP_148281615.1|2359855_2362882_+|sigma-70-family-RNA-polymerase-sigma-factor	gnl|CDD|274357	TIGR02937, RNA_polymerase_sigma_factor, RNA polymerase sigma factor, sigma-70 family. This model encompasses all varieties of the sigma-70 type sigma factors including the ECF subfamily. A number of sigma factors have names with a different number than 70 (i.e. sigma-38), but in fact, all except for the Sigma-54 family (TIGR02395) are included within this family. Several Pfam models hit segments of these sequences including Sigma-70 region 2 (pfam04542) and Sigma-70, region 4 (pfam04545), but not always above their respective trusted cutoffs.	3.98401e-29
NC_018524.1|WP_014910069.1|2363069_2364770_+|NYN-domain-containing-protein	gnl|CDD|350235	cd10911, PIN_LabA, PIN domain of Synechococcus elongatus LabA (low-amplitude and bright) and related proteins. This subfamily contains Synechococcus elongatus PCC 7942 LabA which participates in cyanobacterial circadian timing, it is required for negative feedback regulation of the autokinase/autophosphatase KaiC, a central component of the circadian clock system, and appears to be necessary for KaiC-dependent repression of gene expression. This subfamily belongs to the LabA-like domain family which includes the N-terminal domain of limkain b1, a human autoantigen localized to a subset of ABCD3 and PXF marked peroxisomes. Also included in the LabA-like domain family are human ZNF451, uncharacterized Bacillus subtilis YqxD, uncharacterized Escherichia coli YaiI, and the N-terminal domain of a well-conserved group of mainly bacterial proteins with no defined function, which contain a C-terminal LabA_like_C domain. Curiously Pseudomonas putida S16 NicB , which is described as a putative NADH-dependent hydroxylase involved in the microbial degradation of nicotine also falls into the LabA-like family. The PIN (PilT N terminus) domain belongs to a large nuclease superfamily. The structural properties of the PIN domain indicate its active center, consisting of three highly conserved catalytic residues which coordinate metal ions; in some members, additional metal coordinating residues can be found while some others lack several of these key catalytic residues. The PIN active site is geometrically similar in the active center of structure-specific 5' nucleases, PIN-domain ribonucleases of eukaryotic rRNA editing proteins, and bacterial toxins of toxin-antitoxin (TA) operons.	8.85936e-16
NC_018524.1|WP_014908832.1|2368664_2369741_+|ribonucleotide-diphosphate-reductase-subunit-beta	gnl|CDD|235968	PRK07209, PRK07209, ribonucleotide-diphosphate reductase subunit beta; Validated.	0
NC_018524.1|WP_014908335.1|2371892_2373467_+|sodium/proline-symporter-PutP	gnl|CDD|271369	cd11475, SLC5sbd_PutP, Na(+)/proline cotransporter PutP and related proteins; solute binding domain. Escherichia coli PutP catalyzes the Na+-coupled uptake of proline with a stoichiometry of 1:1. The putP gene is part of the put operon; this operon in addition encodes a proline dehydrogenase, allowing the use of proline as a source of nitrogen and/or carbon. This subfamily also includes the Bacillus subtilis Na+/proline cotransporter (OpuE) which has an osmoprotective instead of catabolic role. Expression of the opuE gene is under osmotic control and different sigma factors contribute to its regulation; it is also a putative CcpA-activated gene. This subfamily belongs to the solute carrier 5 (SLC5) transporter family.	0
NC_018524.1|WP_014909629.1|2346670_2348242_-|immunity-49-family-protein	gnl|CDD|373949	pfam15575, Imm49, Immunity protein 49. A predicted immunity protein with an all alpha-helical fold and a conserved proline residue. Proteins containing this domain are present in bacterial polymorphic toxin systems as an immediate gene neighbor of the toxin gene, usually containing a domain of the Tox-REAse-1 or Tox-REase-6 families.	1.43636e-49
NC_018524.1|WP_014910013.1|2370009_2371230_+|acyl-CoA-dehydrogenase-family-protein	gnl|CDD|173847	cd01158, SCAD_SBCAD, Short chain acyl-CoA dehydrogenases and eukaryotic short/branched chain acyl-CoA dehydrogenases. Short chain acyl-CoA dehydrogenase (SCAD). SCAD is a mitochondrial beta-oxidation enzyme. It catalyzes the alpha,beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of SCAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. This subgroup also contains the eukaryotic short/branched chain acyl-CoA dehydrogenase(SBCAD), the bacterial butyryl-CoA dehydorgenase(BCAD) and 2-methylbutyryl-CoA dehydrogenase, which is involved in isoleucine catabolism. These enzymes are homotetramers.	8.6144e-89
NC_018524.1|WP_026124985.1|2373590_2374175_+|putative-glycolipid-binding-domain-containing-protein	gnl|CDD|377662	pfam06475, Glycolipid_bind, Putative glycolipid-binding. This family has a novel fold known as a spiral beta-roll, consisting of a 15-stranded beta sheet wrapped around a single alpha helix. It forms dimers. It has some structural similarity to the E. coli lipoprotein localization factors LolA and LolB. Its structure suggests that it may have a role in glycolipid binding. Its genomic context supports a role in glycolipid metabolism.	2.12987e-52
NC_018524.1|WP_041561807.1|2366019_2368560_+|ribonucleoside-diphosphate-reductase-subunit-alpha	gnl|CDD|235966	PRK07207, PRK07207, ribonucleoside-diphosphate reductase subunit alpha.	0
NC_018524.1|WP_014913391.1|2354715_2356041_+|type-VII-secretion-integral-membrane-protein-EccD	gnl|CDD|274855	TIGR03920, T7SS_EccD, type VII secretion integral membrane protein EccD. Members of this family are EccD, a component of actinobacterial type VII secretion systems (T7SS) with ten to eleven predicted transmembrane helix regions. [Protein fate, Protein and peptide secretion and trafficking].	2.90661e-19
NC_018524.1|WP_148281614.1|2349193_2351707_-|hypothetical-protein	gnl|CDD|237171	PRK12678, PRK12678, transcription termination factor Rho; Provisional.	2.96595e-05

Protein sequences

>NC_018524.1|WP_041561805.1|2356052_2356925_+|hypothetical-protein
MDVEQRVRPVFGDGWARRVGRLLFRPLGPVDGVARAVELGSGLQRSTVTGRRIAVDDVGTGADATVVAALMARALAHLRHDRVLVVDAKTGEPSLATRLGASEPGDLGATDAAAFETVRDGLGQVTDRLWTARTDPEDGGTYASGLLPVSRFFGVTLVAGERGGGFLETMAARAHSRVRVVRATREAVVRLGRELDAVASGENAAELARTVVVLAREQDTGQDLDVTRTARIIEESGAAVIVLPPDRHLEQRIEALPDRIAESTHRLVQAVAVEALARAVDGGSSTEGGR
>NC_018524.1|WP_014913391.1|2354715_2356041_+|type-VII-secretion-integral-membrane-protein-EccD
MTAWSRVTLVGEERRVDAVLPADEPVGALMPEVLELLGDPVENPARSRHLVTTSGTALVGETTLAEREVADGAVLRLVRAEDPVPAPVVHEVPEAVSQAIDDHSGRWTPSAARWTATAALVALAVLGAWLGHLHSPSTGGMTGLAVVAALLLVAGAALGAFWREPLGTALSMAGAAVGVLTLWLACDLFGWPEWARWGGSVALVAGLVLMLGLTSGLGRGGLIGGGTGLALAVVWSGAAAFGLPAHQVAAVMTVACVVLLSTILRLALMFSGLAVFDDRRNAGEDVARGDVLSSVADAHRSLVIATVAVAAAAVTAGVGLASQLDPWTAGLAVALAVVVASRSRLFPLTVQKAVLVVASLVVAGAFLLALTQTYAWGIWPALGTVAAVAAIPAVVLSVEQPEHVRARLRGITSRCEAVAVIVLVPLAVGAFGTYQRLLETF
>NC_018524.1|WP_014910336.1|2353653_2354631_+|TNT-domain-containing-protein
MARDYDSQLLESVAVRRQRLREAVLFGGGRTRRRLDENIAKVIGSVCLAAVVCGGSVGWSFIDHRLGTQRVEQEQAASGPATRALPPTPGNWVGSEVTFDQLRAELDEAGVAPSLYVLPGDPRPDPGTVDSYYLITEDSEGYLSVSVMDHDQGRPGAEFRTEDETARWLHQELATVEADPAPLTSSQETEAAAASTALADKVRDELEQRSGGSYLHTLEPGDLVDAFGQESGRHLGPDGTPFAERGLPEHARADPDGEPLYHRYRVIHPFQVTATTAPAEGDLPGGGIRFTLDTAGFGETPPAPTLRWLIGNGYVERVAVTEVPD
>NC_018524.1|WP_014912421.1|2353310_2353604_+|pore-forming-ESAT-6-family-protein
MKNAYDLGASQEAQGNINTIMNRLEGIIGERDTDVSTAMSEFEATGVSEEYSEKELKWHNAANEVREIIRLVRETLETNDSTAQETLSRANSAVQSI
>NC_018524.1|WP_014909589.1|2352955_2353285_+|hypothetical-protein
MSRWEVGDATLTTLGQNTAGSGDELSSLVQQLVQAAEPLAGKFDGAGKAAFDSFKARADGIASDLRAGLGSIQVGQEGMNAAFVGGADTMADDANANMGAANFDGAKFR
>NC_018524.1|WP_014910193.1|2352222_2352492_-|hypothetical-protein
MKFELIDLPEPTPSSSDEPTEHEPGLPPVRVVAERARGRVRAESEALRVTLDRMWESIASTRTERSPATTIPSVVPTGFRPEAFSRRDD
>NC_018524.1|WP_014910837.1|2351848_2352190_-|hypothetical-protein
MSQWNIQPEAVGGVLQTVVGHFGEEGSGEGFVGIFDKLQDNLEQAGEASADAAVNMALMEFAGHYFGILGDMASLTMSAVSGASEATTHYVNGNLEMAEEAQENAGVIPDPEP
>NC_018524.1|WP_148281614.1|2349193_2351707_-|hypothetical-protein
MSDLIDPSSFPIPETKTYTLDYVAGKLTRQGDELTTVVGDITSAWSGLEDCYSAPESADLYTVLSPLTGDAEEVATALSTTGDALSTFAERVAEIKRDWYALRTEAREFLSSIDYGEKEGWRDGSGIWFWKEESPDVVKHNELIKRGNDLVEAYEEAARDCANAITSQFDGTVFVPNSADGTPPGEGQFAYGFDGSVDVPTEWGSAQKTDHAWYNDAGDAVGDFVVGIGEDLGGAIGIHSATNGWFGASWGDNLAEYWGDAFYGAAAMAGFSRDEEGWGWSGSTMKDSWRDAAHAMVPWEEWGERPWYTIGTAALNIGSVVAGVALSATGVGAVVGAPLLAWRGSKVLSSVGGGRTPDLDTPDTPRLSQAELARIPRYGDGPVTPVDLSGVDAAKLDTSALGRMNESLERLSAARSGGGDGSGSGRPGGSETDTQGTGARPTTAGSTPDTERTERRSPTGRKDDETENPTAGQLQDTQDFLDGIDQESTNSVREGAQREQDKWVAEQTVPDDASSLYDTPVQRYESEPARVEAPVQEKVGAGVGAEGGGLKVNAHSDNGHVNASTDTTGSPMDTPRTGGSGGHHLLGSESGRGGTLGGNGSSGGGGGTGGPGNGNGNGGVPGGRLPDDPNSSDRPNDRSDAEDRPNDRTDTDDRPNDKSDTEDQPNERNNPEDKNERREDTSQQEKKKNRREWPAKSDIDGPAGGKTLREPHQRHTFGGIKSGAVKEKNSLIHPGEMESVRLDIEGIAEGRASFHDETNLYHINNRSYGVEDNGTVYPVQGPGITLLDRNAYKALKEIIKANGDPERTRVMFERAPAFKNNPEAVEQARDLYRRFKK
>NC_018524.1|WP_148281613.1|2348332_2349193_-|hypothetical-protein
MNYDAMLPTSIAPGKLKSTLSKIFELPETDVDVNHSDYFGERNWDAKVTCDYEEKVGDVKIYLDIYAVDDIDTLPSSQEFALRLANLLCSSVIQQVDEPLYGVAKITTPSGETGYVRFDFPYEDEEIHVISGTEVPIPEFPKVGFSRFPEMIKSQNLPKIITDQYFPKEVPGDLGKLYSLSSAWEKLTVRMRTGWPPSGWYPASMYQDDLKARDEWEEICHRLAEETTAGPTKAMALIDRIFIESTVDDSGDSLVRAGEISTEDLASRPWYWRRRPKDAPWVEKDH
>NC_018524.1|WP_014909629.1|2346670_2348242_-|immunity-49-family-protein
MLDDLEDRLFEPLTWPLETEAREALQEYVNLIDCGKGGPEREIGGFLDFCGADLRKFQLQWQFLWGSDFSGVRLDGADLYKAELVEALLHSASLQGANLHKADMSACEAQRASFAGANLLNTDLSESDLREADFKEVWAGGTLFFNSDLRGADFRRARFGTEKAGVWTDFSGAKVRGVRFSGTEGTVLGPIDVGENSRSILDGLDLEKWFADQGAPEVRVRKLKKGWLPIDIPKHDTGKPHFWDYMEFFEKRIEKRISWLINSQMMAGMAMDAVGLESLNYLSVDRRASEITTWEAWTTWMQVAEAPFAMCTLEPGQTTERLINQKIRTLKYLPPSNACDAGGWLTAFFLAATCRDEKRVFSLCQISPEFLREASEIEGGGYDDYIYPWIAAVQDFILDRPTLGENLYQAMDLSQPQNATISRAEVLDSLVFPVMNAFYRFVQQDTAKFNEAMGQGLRLFHAYYTADEERAENIYGTIPTHLFGIACLAYDLAQVAPDFNPDLDTPYFPVHILHRTRRNDIPI
>NC_018524.1|WP_017534416.1|2358983_2359745_-|hypothetical-protein
MGETEVGSGARDRMLHRARELRAPWRRRSREVGWGRFEDWWTPSVDALCTAHVAGDDLSGPCARLGEARARAGFGIGPSLEDLDAFARAVGWEQVPLPLARSLAEGWERGGRSRGDCQDPLTGLANSEYLRTRVGELYRGVEDGVPAAFGHHLVVVALDPALDPWRRTARLIVLGHELRRFFTRGESVCLVNRARIAVIATEDPDANGSLTRLRDEVCWEHGAAVWSAPLPSSHREASALLDSLDGGGDRADV
>NC_018524.1|WP_148281615.1|2359855_2362882_+|sigma-70-family-RNA-polymerase-sigma-factor
MTRIRDIFSSTCFRTPITPAPRTRFRRVAGAAQELKGRRGVTDADGEYTETLLGDAEIIRQVKAGDNAAFGTLYERHAGAARGLARQLLRGEAEVEDAVAEAFTKVLSVIQRGGGPTDAFRPYLLTAVRNAAYDRGRGEKRQVVTDDMESFDAGEPFVDPALEGLERSLIARAFLSLPERWQSVLWHTEIEGVKPAEAATILGMNPNGVAALAYRAREGLRQAYLQMHLAGSGTAEACRPTIGLLGAYVRGGLSKRDTTKVDRHMDDCGECREVYAELMDVNVGLRGVMLPLVVGFGATGYLASVPGATAGGAWWNRMSRRGQQATAGAAAAAGMAVAVAFALVGGDTPIPEEPSPAAAPPIDAPAEDPPPPAQDTPDDPPPATPDEPAPVPAPPADVPPEEVPDPPAPQEPDAPAPDAPAPEDPREDPPPAPEEPEPEPAPEEPLPEFAVGIDPVGSLVPGSEGIMVLDVLNTGQDTAEDVLAQITLPPGVEMISSGGAGNAVPMASGNGDWGCSAGSGGGECVRSGMAAGESSTHFLDVRVAPDADVDVPAGVVISSGNVSHRATGERGVTSEGIPARYATAGQVRTEAVGNSLMTCTDPEESKKPTWPWPWWGTPGIPETPEALPGPTPPAPTEDPGPTLPLPEQEDADLGRAPADHVSPEDAGEALDDLLGGGEEGTPDGPPGYPTPEAPSPEDEDPAPTGPPLTPEPPELPGETVEPTDPGEDHRDEDEPEEHEEGDCAQARARSGEGIDNDNWVMAPLDRDQDPTTTSSSSATWSLPEGGSVRWAGLYFSASGDPGVPTARVKGPGMAAYTTVTATETRSADLPAYSAYQSFADVTDLVRASGGGQWWVADVPAQGGRGVYAGWSLVLVLEDPAVEGYQQAMVLDETSAVFQDSNGAVFPVSGLLPTAVRTGVDVVAWEGDAELGGDRVLIDGVPHAPSEGPGTVDNAFVGSARGADGDPMTFGTDVTRFDAVLGRESEIRILSEQDALLVGVIALAAPMRT
>NC_018524.1|WP_014910069.1|2363069_2364770_+|NYN-domain-containing-protein
MDRCALFVDAGYLLADGAMAVHGTRNRDSVAWDYSGLVQFLNEVARDRTGLPLLRCYWYEAIADDRRTQEQDGIADIPGIKFRAARIRPGRREGVESYVQRDLTTLARTGVLCDAVLVSGDEDMAPVVADVQEMGVRVTVVHISVEGNWTISRSLRQECDDLIEIGAGHLRPHVELLSGGGSTQENAAKTTTPFANGRATPVPEQAPARPRSAERGRRAQPEQPADTSTGGLEAMFAGTGGQSVPQGSAMEQLRAMRRSLAQQRGDHLAGSGGENRASGGIDANGFPTGGQPVNGAAAYPGSPAGQNGQTPYPPPSTGAHQSMRGAEPNGYGLPSAPPNGTAPGLGTGPAGYDSTGPQPGFGGGTGPQPAFGGTGSQAAFDPGTGPQVSFATDAPQGPPPRRTPPAPDPRYGGGPGEDQGFGGGSDPNPTYGTSTEADAARRGGADPRFGERRPTGPEYDDRFGPRGHQESAPSPGYAQQTGPAPHTVDEAVHVAHREGNDFAESIAREAPALWVEAVLARRPRMPSDLEARLLQGSSLPIDHLLRDEVRDGLRQGFWQALERART
>NC_018524.1|WP_014908700.1|2364796_2365369_+|hypothetical-protein
MGAMRLTHVTTAELDRLEFHAVRSGEHGRIAAQLLDLANRVDAGSEVGRAELFVRAGEQWEIAQEFERACSAYQRAIDDGGVTVIDPHALSAGALLQLDERRQAEYHLERLESGGPAGLPTLIHVAEALYAHDDLEGAERWATAGARFHAGCSRSPYVEDLFLELLRIRFRIRSDLGRPEDDLDLILDEV
>NC_018524.1|WP_041561807.1|2366019_2368560_+|ribonucleoside-diphosphate-reductase-subunit-alpha
MTLDVEAAPVSVRPTQTHEGGPGTAIDRIEHVVAEACAGLTGVSAEKVLDEARRGFYPGIADSEVELALVMAARSFVEVDPDYSYVAARLLLDKLRTEALSFVFDAHETAGQTEMGDRYAGYLAAYVRRGVELGQLDPALAGFDLDVLGRALHADRDEQFTFLGLQTLYDRYFLHSDDVRYELPQAFFMRVAMGLALNEDDREARAIEFYELLSSFDFMASTPTLFNAGTVRAQLSSCFLTTIGDDLQEIFHGIGNNAMLSKYSGGLGNDWTPVRGLGSHIKGTNGKSQGVVPFLKIANDTAVAVNQGGKRKGAVCAYLETWHIDIEEFLDLRKNTGDERRRTHDMNTANWVPDLFMKRVEEQGSWTLFSPDEVPDLHDKYGLEFVEAYERYEAEARAGRIKVHRTLPAVDLWRRMLTMLFETGHPWITFKDPSNLRSPQQHVGVVHSSNLCTEITLNTDKDEVAVCNLGSVNLARHVSAEGIDIERLRRTVRTAVRMLDNVIDVNFYTIPEARRANMRHRPVGLGLMGFQDALFELRTPYGSEGAVSFADESMELIGYYAIEASMELAAERGSYETFEGSLWSRGVLPIDSLRLLAEARGGDLDMDRGETLDWDSLRERVRTTGMRNSNVMAIAPTATIANITGVNQSIEPVYRNLYVKSNMSGDFTVVNDHLVRDLKERGLWDEEMVAELKRHDGSLGEIDRVPDDLKDLYATSFEVDPSWLVEAGSRRQKWIDQAQSLNLYMAAPSGRKLDALYRKAWRSGLKTTYYLRAQSATHVEKSTLKGTDGRLNAVSATPAPAPTPAPAPSPSPVPVPVAEPTAAEEEFEIVEDQACSIDDPECEACQ
>NC_018524.1|WP_014908832.1|2368664_2369741_+|ribonucleotide-diphosphate-reductase-subunit-beta
MTTVSENNDTTGLGEIERDAARVNVDDKAMINARADVNQLLPLKYTWAWEKYLAGCNNHWMPTEVAMQADIALWKSKDGLTEDERLMLKRNLGFFATAESLVANNIVLAVYRQLTNPECRQYLLRQAFEEAVHTHTFQYICESLGLDEGELFNMYREVPSITAKDAWALKYTQNLEDPDFSTGTPEADQAFLRDLVAFYVIFEGMWFYTGFAQILSLGRRNKMVGIAEQYQYILRDESIHLNFGIDVINQIKIENPHLWSEEFQAEVRRMLTEACELEVAYGRETMPRGVLGLNADLCEQYMRFITDRRAEQIGLAPIFGETENPFPWMSEMMDLQKEKNFFETRVIEYQTGGGLDWD
>NC_018524.1|WP_014910013.1|2370009_2371230_+|acyl-CoA-dehydrogenase-family-protein
MDHVFGDERHRRLRAEVREFAEHEVAPRIPEMERRRHVDHELSRLIAEQGWIGVTVDPAYGGMGAGHLAKTIIIEEMSRVSGAMGAMVQASQLGVAKIVHFGNPAQRAAWLPRVAAGRCLPTIAVTEYGSGGHVLGMTGGAVRDGDDYVLNGRKVFVGNSHVGDLHGVVVRTGEGSRGLSAFLVESDRPGFSLGPHEGTMGLHGFSFGELIFEDCRVPAANMLGEEGDGLAVAYSSSVLYGRANLAAVALGIHRALVEETCAYASEQHRYGRPLCEVPSVKLKLGQMQSRLMMATLSLYHAVSLLDRGAACDHELINAKLVNVEYALDTARNAMEIHAARGLYTDRPIERYLRDAHHIFAPAGTSDVQLLRLGEAALGVDRGQWSERLADRTAVSESGPVAAPLVA
>NC_018524.1|WP_014912394.1|2371317_2371497_-|hypothetical-protein
MDAQPAAIRARSIGPSGICPRGEHDWKPSAPGSARHLCTKCNSMMTRNYEPEVAEPAAD
>NC_018524.1|WP_014908335.1|2371892_2373467_+|sodium/proline-symporter-PutP
MEDSSIGSIVIFGVYLAGMVGIGLWVYKRTVSQADFVLGGRSLNSWVSGLSANASDFSGWLLLGLPGAIYVSGLGEAWIAVGLASGFAGSWLIIAPRLRVYTERVTDSRTGAESDSLTLSSFLENRFNDRTRLLRAVSAILIIVFYFFYVASGLVAMASLFDMVFGLDPAPAIAIGVAIVVLYTVLGGFLAVSYTDVVQAMMMWLALLVVPIMAISALGGFAGLTDGVTDKAEGLMSAFGGTSLDADTGAWITTETLGAVVIVSGLAWGFGYFGQPHILARYMGIRSVKDIPKAAGISVVWAVTAMILAVLVGFIGIAYFDTPLGDPEQVFPSLIASLTNPLVAGVLLAAILAAVMSTADSQLLVAASALTEDGYKAFVDEKASPRSLLWISRGTVVAVAIIAALVALYGNSSVMDLVGYAWAGFGAGFGPVLLLALFWKRMTWAGALAGMIVGGSSAILWDILDSAYLGTGLYAMVPAVALSFLSILLFNGLGKVSEQMEADFDRVEAELKSGGHDEKPTAAV
>NC_018524.1|WP_026124985.1|2373590_2374175_+|putative-glycolipid-binding-domain-containing-protein
MSSPPQHPTAWARTDVPEGMGIGTLLPEPDGFRLEAGETVFAREERFLTRFTVWTDLAWATTRVHAEVLSAAGTETVTLQAQGGHWSDGKGGELRELVGCLDVDIAATPLTNTLPIRRLGLRPGEHRDIAVVWIDIPSLRIRRVRQRYTRHHAENGLELYTYRDPLHGEYRISVDGDGVVVDYERFVRRWSPDP

Crispr_ID: NC_018524_19

• CRISPR_ID: NC_018524_19
• CRISPR_location: 4408931-4409149
• CRISPR_type: Orphan
• Repeat_type: I-E,II-B
• Spacer_info: 3 spacers
• Cas_protein_info: csa3

Consensus repeat of NC_018524_19

Consensus_repeat	Method
CCTGAGCCCCACGCACGTGGGGATGGACCGTCCA	CRISPRCasFinder
CCTGAGCCCCACGCACGTGGGGATGGACC	CRT

spacers of NC_018524_19

>19.1|4408965|28|NC_018524|CRISPRCasFinder
TCCCGGCCCCGGGAGATCTCATAGCGGG
>19.2|4409027|27|NC_018524|CRISPRCasFinder
CCACCGCGCCGAGCGCGAACGGGAGCG
>19.3|4409088|28|NC_018524|CRISPRCasFinder
GCCCTATGACCGGTCGACTGGTTTCCTA
>19.4|4408960|33|NC_018524|CRT
GTCCATCCCGGCCCCGGGAGATCTCATAGCGGG
>19.5|4409022|32|NC_018524|CRT
TTCCACCACCGCGCCGAGCGCGAACGGGAGCG
>19.6|4409083|33|NC_018524|CRT
GGGCGGCCCTATGACCGGTCGACTGGTTTCCTA

CRISPR arrays and Neighbor proteins around NC_018524_19

CRISPR arrays

The CRISPR arrays of NC_018524_19

>merge|NC_018524|19|4408931-4409149|CRISPRCasFinder,CRT
CCTGAGCCCCACGCACGTGGGGATGGACCGTCCATCCCGGCCCCGGGAGATCTCATAGCGGGCCTGAGCCCCACGCACGTGGGGATGGACCTTCCACCACCGCGCCGAGCGCGAACGGGAGCGCCTGAGCCCCGCGCACGCGGGGATGGACCGGGCGGCCCTATGACCGGTCGACTGGTTTCCTACCTGAGCCCCACGCACGTGGGGATGGGCCCTTCA

>NC_018524|19|18|4408931-4409149|CRISPRCasFinder
CCTGAGCCCCACGCACGTGGGGATGGACCGTCCA	TCCCGGCCCCGGGAGATCTCATAGCGGG
CCTGAGCCCCACGCACGTGGGGATGGACCTTCCA	CCACCGCGCCGAGCGCGAACGGGAGCG
CCTGAGCCCCGCGCACGCGGGGATGGACCGGGCG	GCCCTATGACCGGTCGACTGGTTTCCTA
CCTGAGCCCCACGCACGTGGGGATGGGCCCTTCA

>NC_018524|19|11|4408931-4409144|CRT
CCTGAGCCCCACGCACGTGGGGATGGACC	GTCCATCCCGGCCCCGGGAGATCTCATAGCGGG
CCTGAGCCCCACGCACGTGGGGATGGACC	TTCCACCACCGCGCCGAGCGCGAACGGGAGCG
CCTGAGCCCCGCGCACGCGGGGATGGACC	GGGCGGCCCTATGACCGGTCGACTGGTTTCCTA
CCTGAGCCCCACGCACGTGGGGATGGGCC

Neighbor Proteins Overview

Protein	Signature genes	Signature genes Name	Protein_function
NC_018524.1|WP_014909902.1|4409488_4409665_-|DUF397-domain-containing-protein	unknown	unknown	gnl|CDD|377231
NC_018524.1|WP_014913498.1|4413836_4414358_+|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl|CDD|238045
NC_018524.1|WP_148281643.1|4407950_4408730_+|hypothetical-protein	unknown	unknown	gnl|CDD|275041
NC_018524.1|WP_014911605.1|4413447_4413654_+|DUF397-domain-containing-protein	unknown	unknown	gnl|CDD|377231
NC_018524.1|WP_148281707.1|4405210_4406731_-|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl|CDD|173867
NC_018524.1|WP_041561937.1|4398025_4398934_+|GntR-family-transcriptional-regulator	unknown	unknown	gnl|CDD|225099
NC_018524.1|WP_014911007.1|4409264_4409444_-|DUF397-domain-containing-protein	unknown	unknown	gnl|CDD|377231
NC_018524.1|WP_014910513.1|4400194_4401559_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014911251.1|4411329_4411638_+|ATP-binding-protein	unknown	unknown	gnl|CDD|340413
NC_018524.1|WP_014913227.1|4409964_4410135_-|DUF397-domain-containing-protein	unknown	unknown	gnl|CDD|377231
NC_018524.1|WP_014912473.1|4401609_4402413_-|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl|CDD|224048
NC_018524.1|WP_017536469.1|4414410_4414602_+|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl|CDD|133390
NC_018524.1|WP_014913511.1|4399010_4400108_+|winged-helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl|CDD|238042
NC_018524.1|WP_014909785.1|4404226_4404946_-|ABC-transporter-permease	unknown	unknown	gnl|CDD|224094
NC_018524.1|WP_014911103.1|4402412_4403273_-|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl|CDD|223521
NC_018524.1|WP_081536538.1|4410131_4410944_-|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl|CDD|197775
NC_018524.1|WP_041561939.1|4415170_4416490_-|YjiH-family-protein	unknown	unknown	gnl|CDD|225851
NC_018524.1|WP_014910150.1|4403269_4404223_-|ABC-transporter-permease	unknown	unknown	gnl|CDD|223674
NC_018524.1|WP_041561938.1|4412027_4412288_+|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014913063.1|4395856_4396873_+|pyridoxal-phosphate-dependent-enzyme	unknown	unknown	gnl|CDD|107204

HMMScan for Signature genes

Protein	Cas_name	Cas_description	E-value	Identity	Coverage
NC_018524.1|WP_014913511.1|4399010_4400108_+|winged-helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	3.7e-12	41.4	2.5

rpsblast for functional proteins

Protein	Function_ID	Function_description	E-value
NC_018524.1|WP_014909902.1|4409488_4409665_-|DUF397-domain-containing-protein	gnl|CDD|377231	pfam04149, DUF397, Domain of unknown function (DUF397). The function of this family is unknown.	8.21361e-16
NC_018524.1|WP_014913498.1|4413836_4414358_+|helix-turn-helix-domain-containing-protein	gnl|CDD|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	9.41663e-07
NC_018524.1|WP_148281643.1|4407950_4408730_+|hypothetical-protein	gnl|CDD|275041	TIGR04188, conserved_hypothetical_protein, methyltransferase, ATP-grasp peptide maturase system. Members of this protein family are predicted SAM-dependent methyltransferases that regularly occur in the context of a putative peptide modification ATP-grasp enzyme (TIGR04187, related to enzymes of microviridin maturation) and a putative ribosomal peptide modification target (TIGR04186).	1.06324e-31
NC_018524.1|WP_014911605.1|4413447_4413654_+|DUF397-domain-containing-protein	gnl|CDD|377231	pfam04149, DUF397, Domain of unknown function (DUF397). The function of this family is unknown.	2.8547e-05
NC_018524.1|WP_148281707.1|4405210_4406731_-|ABC-transporter-substrate-binding-protein	gnl|CDD|173867	cd08502, PBP2_NikA_DppA_OppA_like_16, The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	2.04843e-113
NC_018524.1|WP_041561937.1|4398025_4398934_+|GntR-family-transcriptional-regulator	gnl|CDD|225099	COG2188, PhnF, Transcriptional regulators [Transcription].	2.23557e-49
NC_018524.1|WP_014911007.1|4409264_4409444_-|DUF397-domain-containing-protein	gnl|CDD|377231	pfam04149, DUF397, Domain of unknown function (DUF397). The function of this family is unknown.	2.99214e-18
NC_018524.1|WP_014911251.1|4411329_4411638_+|ATP-binding-protein	gnl|CDD|340413	cd16936, HATPase_RsbW-like, Histidine kinase-like ATPase domain of RsbW, an anti sigma-B factor and serine-protein kinase involved in regulating sigma-B during stress in Bacilli, and related domains. This family includes histidine kinase-like ATPase (HATPase) domain of RsbW, an anti sigma-B factor as well as a serine-protein kinase involved in regulating sigma-B during stress in Bacilli. The alternative sigma factor sigma-B is an important regulator of the general stress response of Bacillus cereus and B. subtilis. RsbW is an anti-sigma factor while RsbV is an anti-sigma factor antagonist (anti-anti-sigma factor). RsbW can also act as a kinase on RsbV. In a partner-switching mechanism, RsbW, RsbV, and sigma-B participate as follows: in non-stressed cells, sigma-B is present in an inactive form complexed with RsbW; in this form, sigma-B is unable to bind to RNA polymerase. Under stress, RsbV binds to RsbW, forming an RsbV-RsbW complex, and sigma-B is released to bind to RNA polymerase. RsbW may then act as a kinase on RsbV, phosphorylating a serine residue; RsbW is then released to bind to sigma-B, hence blocking its ability to bind RNA polymerase. A phosphatase then dephosphorylates RsbV so that it can again form a complex with RsbW, leading to the release of sigma-B.	7.09778e-06
NC_018524.1|WP_014913227.1|4409964_4410135_-|DUF397-domain-containing-protein	gnl|CDD|377231	pfam04149, DUF397, Domain of unknown function (DUF397). The function of this family is unknown.	1.05862e-17
NC_018524.1|WP_014912473.1|4401609_4402413_-|ABC-transporter-ATP-binding-protein	gnl|CDD|224048	COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only].	6.8135e-112
NC_018524.1|WP_017536469.1|4414410_4414602_+|helix-turn-helix-domain-containing-protein	gnl|CDD|133390	cd04762, HTH_MerR-trunc, Helix-Turn-Helix DNA binding domain of truncated MerR-like proteins. Proteins in this family mostly have a truncated helix-turn-helix (HTH) MerR-like domain. They lack a portion of the C-terminal region, called Wing 2 and the long dimerization helix that is typically present in MerR-like proteins. These truncated domains are found in response regulator receiver (REC) domain proteins (i.e., CheY), cytosine-C5 specific DNA methylases, IS607 transposase-like proteins, and RacA, a bacterial protein that anchors chromosomes to cell poles.	2.52461e-14
NC_018524.1|WP_014913511.1|4399010_4400108_+|winged-helix-turn-helix-transcriptional-regulator	gnl|CDD|238042	cd00090, HTH_ARSR, Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to dissociate from DNA in the presence of metal ions.	4.87837e-12
NC_018524.1|WP_014909785.1|4404226_4404946_-|ABC-transporter-permease	gnl|CDD|224094	COG1173, DppC, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	5.69252e-67
NC_018524.1|WP_014911103.1|4402412_4403273_-|ABC-transporter-ATP-binding-protein	gnl|CDD|223521	COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	1.32731e-121
NC_018524.1|WP_081536538.1|4410131_4410944_-|helix-turn-helix-transcriptional-regulator	gnl|CDD|197775	smart00530, HTH_XRE, Helix-turn-helix XRE-family like proteins.	1.63198e-09
NC_018524.1|WP_041561939.1|4415170_4416490_-|YjiH-family-protein	gnl|CDD|225851	COG3314, COG3314, Uncharacterized protein conserved in bacteria [Function unknown].	6.51436e-111
NC_018524.1|WP_014910150.1|4403269_4404223_-|ABC-transporter-permease	gnl|CDD|223674	COG0601, DppB, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	6.71521e-110
NC_018524.1|WP_014913063.1|4395856_4396873_+|pyridoxal-phosphate-dependent-enzyme	gnl|CDD|107204	cd01561, CBS_like, CBS_like: This subgroup includes Cystathionine beta-synthase (CBS) and Cysteine synthase. CBS is a unique heme-containing enzyme that catalyzes a pyridoxal 5'-phosphate (PLP)-dependent condensation of serine and homocysteine to give cystathionine. Deficiency of CBS leads to homocystinuria, an inherited disease of sulfur metabolism characterized by increased levels of the toxic metabolite homocysteine. Cysteine synthase on the other hand catalyzes the last step of cysteine biosynthesis. This subgroup also includes an O-Phosphoserine sulfhydrylase found in hyperthermophilic archaea which produces L-cysteine from sulfide and the more thermostable O-phospho-L-serine.	3.45911e-66

Protein sequences

>NC_018524.1|WP_148281643.1|4407950_4408730_+|hypothetical-protein
MCGGRRRAGPPAPRGASPPCRPAWAGGAGARGCAGAPPQSGPGCVWKRRPGLYDRVISTAAVNRVPYHWIAQTRPGGKIISPWGNAFHNGVLADLQVGPHGTASGRFGGNVAFMWVRDQRVTREAVEIFVSDDHEFRVGRTELYPLEPLKFDASFAIGLRMPTVINDIVFASDEDDPRFTVWLVDPGSGSWASWHVHPGEASHEVRQYGPRELFSEFESAYQWWLDSGSPAVDRFGMTVSSNHQLIWMDAPTNIITSML
>NC_018524.1|WP_148281707.1|4405210_4406731_-|ABC-transporter-substrate-binding-protein
MGGTALLLSGCGSPQGGGASSEPVTGGELVVASLPAVIDPHATTSRSNWMVAASVCEGLFANAADTSIQDGLVESYEYDVDAGVYTLRLREGVPFHEGGRLTAADVVASLDRYADSDPGELFNSLVEEVAETDELTVTITTVNPTGAIPALLSTPDTGAYVMSASSLEAAGDDELSSLDCTGPYRLDEFTVDRQATASRFDEYAPRDEDPDGAAGAKTAHADTLRFVPFNESNTLNQLRTAEVNVAPQFLGVDQLDVYEADPSLRAVLSEDSEFSIMQFNLRSELMGDVLMRRAVLNALDFAEIETQYLGGTDYFTEDSSFFPPGSPWYSDAGSEAYTDRSAEEAERLLDEAGYDGTPVRVLYRPSNDNYGPIVQQQLEAVGLNVDLQAMDAATFGSTRTEEDTWEVFLGGGAAYSDPLTVVFLNDDFPGWWATEEKAELMAAVTEGEDTESRKPAWDELQGLIWEDVPFIRFGHEPRLAVTSADVGGFEATQGTVRGFYNIWIDQ
>NC_018524.1|WP_014909785.1|4404226_4404946_-|ABC-transporter-permease
MWTVLLHGARTSLGIAAACTLLAIAAGFLTGVVCGYFRWVDAVVMRVIDGLMSFPNIILVMSLVGVLGRGVGPVLFGLTVVLVPPIARVVRAAALTARSAPMVESARALGARDSWILFRYVAPESVSVLIVQATMGFAATVLSIAALSFLGIGLPPDVPSWGASLSAAQQYAAVAWWIGVFPGAAILLTVLGLILLGDGLRDAMDPRARRLAELARSSKSSARSSRRTRTAVRSDEKDG
>NC_018524.1|WP_014910150.1|4403269_4404223_-|ABC-transporter-permease
MLSYVFKRLLALIPTVAVPMVLLFVLLRLTPGDPAAVILGENATATEIAELRTELGLDAPMWQQFLDWLARMARFDFGESIFLHAPVAELVLSAALVTGQLALISMLLALLIGPALGAVAGATRSRALDRTMVVGSAVGVAMPTFWLAILMVMLFGVTLQWLPVAGFTPITEDPVQYVRYMALPCLALGTLEAATLFRYSRNGVLDAKHQPFVATARAQGLPERTITRSYVFPAALAPLVTVVGLSLASMLGGAVVTENVFSLPGLGKLLLTAVERRDYPLIEGCIFFIAVAFVLVNLLVDVVAATLDPRIRLEAKE
>NC_018524.1|WP_014911103.1|4402412_4403273_-|ABC-transporter-ATP-binding-protein
MTTNSTDDILLDVRGLDVDVLTPEGPRRVVHSLDLTLRRRGTLGIVGESGSGKSMTATAVMGILPETAIASGKVLYRGRDLLSLPARERRAMAGREMGFVFQEPMSALHPTKTIGAQMAAPLRLHLGLTRRQARARSAELLDLVGIPPSRGVLDAYVHQLSGGMRQRVMIAMSISCEPALLIADEPTTALDATIQKQILDLLADLREELGLSVLLISHDLGLVSRYTDDVVVMLDGHAMESGPTDRVVSAPESGYTRGLLEASPRLGHSPDRLPVIDKSRFTKAVQ
>NC_018524.1|WP_014912473.1|4401609_4402413_-|ABC-transporter-ATP-binding-protein
MSTTDGAAGAEPVLRMEHVTKRFRLGGVLRRTAHVAVRDASLELGRDEVLGLVGESGSGKSTLGRMAIGLIRPTSGSVTVLGRDILSLRRSELRTYRRRMQMVFQDSSNSLNPRMTLRELLEEPYRVQGLHTPAEREVRALALADEVGLARSWMGRLPHEFSGGQRQRVSIARALALEPELIVADEPVSALDVSVQAKVLNLLKDIRRARGLSLLFVSHDMAVVDFMCDRVAVLNGGRVVESGPTSQVLRAPADDYTRTLIEAVPRL
>NC_018524.1|WP_014910513.1|4400194_4401559_-|hypothetical-protein
MTTRHAQAKHALIRGPVPETEGNRAVVLEPYGVDRIPTYDYVQEEYLVSGTAAGDPYSTRILIRRPADMSSYTGRALAEVSHIWGGNSVWRAFNRQIMRGGFIWVGIDSQAPSALDLIKGVDPRRYAEMTFSSGELAKDFAGSIPFTENPTPEVLAREYDEFKERWWRATPQSFEIIAQVANALREGLPGLPEAAVRTLLFAGISQTGGVVRRFVERHHSVLRRPEGGPVFDGYMPCASGGPALPDVDVPVMEVLGEAEFQSVRWACGVSGQVRGLTHRRPDSPSFRLYEVAGMAHRETRHMSDRDRERLRNCPLPEGARWSTFPNSHVYNALLESLSAWARGEATPPASRLLETEGDTDTVLRDGFGNARGGLRTTYTDAPLSTLVAATPMGRPSWYHGSETPLGRERLVERYGDADGYRREHARVLNRMLAAGFVRPEDAEQLRLEAELVDF
>NC_018524.1|WP_014913511.1|4399010_4400108_+|winged-helix-turn-helix-transcriptional-regulator
MPIVFDLVSTDASRVVVRPSPLAELMAFLHSVAEPGHHPGASRDIRAVRSGVDRATERRLRTFAPLWARFRLRALLPLDTSHPATFQDELALMNAMPAPVFDSMVAETIASGSWERYYGLRDPDDHRVEFLEVCRAKSEEREELGELFLADRAAFRQNLSDLLQHCHDTFFRTRWEATLPQLTTAEREVRGRFSQDRLGVVLASLTPGGHYLPQTAQVAYDKLQNAFVSCAGRDLVLVPSLFTRPHLVVKFEEAQPRANLPIVVQFPITELGTTDVPLRELQHRMAVLSDPARLVLCRHLVNEHCTTGELATRVGMTEPQVSRHLRRLREAGLLESVRDGRLVRHRIRLGTVYSLGHQFLTRLVQ
>NC_018524.1|WP_041561937.1|4398025_4398934_+|GntR-family-transcriptional-regulator
MTAMPVDRSDSRPLHSQVADALRAEIRDRSIPPGDALPSEAALRERFGVSRSVVRQALATLEDKGSVRRTRGRAPVAAIPTEHHRLVQRVTGLFDQFSAEGLSLRTAVLSLERARTGPPSAVHHLVTEDLLRLERVRSVDDEALSYVRTWLPAERFAELDAAMLANASLHRLMEVRFGAVPSSGRRQIRAVPADPRIARELGVPDGVPLLLLEGGTFDQDGLPLEWFESWHRSDRVVFDIEADGATDQVRIAPGPSLAAAPAPAMPPRGAPPEGAEPHGGLDRAVALAAELRAELDRLRTGG
>NC_018524.1|WP_014913063.1|4395856_4396873_+|pyridoxal-phosphate-dependent-enzyme
MDDHVSEAIARPDLIDLGEGLLCLRFESMKVASALAAVRHLLDTGVVRPGDTLLDSSSGIYAYGLALAAHRYGLRCHIVGSTTIDHPLRIQLAVLGATLERMPPSEDLSLDQNRRVHRIKEVLRENPHFHWMRQYHDAVHGLGYRAVADRILKEVGTGPLTLVGGVGSGASTGALARYVRESLPDTPLVGVQPFGSVTFGSDGVDDPQIIIAGIGSSIPFGNVDHTLYDTLHWTSFDSALSGSVDLLRRHAVFAGLSAGAAYLAARWEAARTGRRVVFVAADTGHRYVDSVFAHHESALPIDDLAPTAIDDLAGLAPPWCRMEWGRRPAPEQAVHRAD
>NC_018524.1|WP_014911007.1|4409264_4409444_-|DUF397-domain-containing-protein
MTHQQRTWHKSSYSDGGGGNCVEVAEGPTTHLRDTQHRALAEMNLPAHEWSAFLTTLTR
>NC_018524.1|WP_014909902.1|4409488_4409665_-|DUF397-domain-containing-protein
MTSKITWHKSTYSAGGGNCVEVAEGATTHIRDTQHRAQAQLSVSGSEWTALLHALRSH
>NC_018524.1|WP_014913227.1|4409964_4410135_-|DUF397-domain-containing-protein
MSTWHKSSHSGGNGGDCVEVREHSNGADVRDTQNRELGHLGFEAKEWSALLNTLKK
>NC_018524.1|WP_081536538.1|4410131_4410944_-|helix-turn-helix-transcriptional-regulator
MTKKTLSQWVSFGEEVRSRRSELGLSQSELGKKIQVSGAMVGHIERATRPPSRAQVDKMEEVFATDGDLLRRWKYALKSHTVPDWFQNSLATEERAQSVFQYQPILIPGLLQTKQYAEVLIRAWQPAADDDKVAEMVETRTKRLPALLRRRPTLWFVVDEVVVTRSVGSSAIMAEQLKHVSDMVASGGIRFQVLPQRPLHPGICPPFRLMELPAGKSAVFVEHALGDEARSDVQEISQMRRLFGAMQADALSPAETTNYIRSIRKGLEAA
>NC_018524.1|WP_014911251.1|4411329_4411638_+|ATP-binding-protein
MAAAEIANRASLIAWELMDNAHQHSYSGAPDQTLTLMLERSRYLLSITVTDAGPTPGCKKLSFPEQKSHGGGLGRVASLSFYWDWDGCAGLPVTVKARIELP
>NC_018524.1|WP_041561938.1|4412027_4412288_+|hypothetical-protein
MTEQNAAAELSTLRLLGRLSVQQRLARVDHRLSLARLLVDGILDERSRVERQLREAEQAEQDAGTQELGVAVKRYLAMGGRTWTTS
>NC_018524.1|WP_014911605.1|4413447_4413654_+|DUF397-domain-containing-protein
MKIVQTQGRRSLTAGVWHKAEASQGASNCAAAKLIDGGNVLMGDTQNPDQVRLTLPGSAWDALVRTLA
>NC_018524.1|WP_014913498.1|4413836_4414358_+|helix-turn-helix-domain-containing-protein
MSAKSKEAQVDQDADSLCTESKKELGIHLKRLRQAAGLSGYRLSGVDQSTVSRIETGRIRPSHELLTRLLDAYEADQEGREQAYLLWDQAQLPLQTRRRQVEGTRAAWDQAARPACGPTLLAGASAAEDAARYLTRAQWAGNSPSRRNALLDDAEGRLVQVLAALHTARTRTR
>NC_018524.1|WP_017536469.1|4414410_4414602_+|helix-turn-helix-domain-containing-protein
MTQPDVDPMDLLTPQEVAQAFRVDPKTVRLWAQEGRLRWVRTLGGHRRYFKSDVQRLLTEPGR
>NC_018524.1|WP_041561939.1|4415170_4416490_-|YjiH-family-protein
MSEGTTVERTPGVWRLVVYSGIGIFMFFVPLTIGDRNAIPLDHLVGLVQKGLGPTLPYVIWLIIAAGTVVPFATGAWRRDRVRTVFALLNVVGLVAATMVVLEVGPAWFLQEDLAPFLFDSVAVNVGLLVPVGAVFLALLVGYGLLEFVGVLMQRVMRPLWRVPGRSAVDAAASFVGSYSLGLLITDRVYRSGRYTGREAAIIAVGFSTVSVTFMVVIANTLDLMGMWTTYFLLSLFVTYAVTAILVRVPPLSRIPDTPFPGATAHPEERIDERRLQAAWAEARRALRAAPPLARGVRTNLVEGVRMSMSILPSIMSVGTFGLILARYTPVFDLMGYLLLPFTWLVRLPEPAETAKALSAGIAEVFLPATMTAGAEDAVLRLVVGVVSVSAIVFFSALVPCVLATSIPLTVWNLVVIWFQRVALSVLITTPLAYLLVGA

Crispr_ID: NC_018524_20

• CRISPR_ID: NC_018524_20
• CRISPR_location: 4479476-4479558
• CRISPR_type: Orphan
• Repeat_type: NA
• Spacer_info: 1 spacers

Consensus repeat of NC_018524_20

Consensus_repeat	Method
TCGTCCTCCGACGACGATGACGA	CRISPRCasFinder

spacers of NC_018524_20

>20.1|4479499|37|NC_018524|CRISPRCasFinder
CGACTCCTCCTCGTACGGTTCTTCCTCCTACGGAGGC

CRISPR arrays and Neighbor proteins around NC_018524_20

CRISPR arrays

The CRISPR arrays of NC_018524_20

>merge|NC_018524|20|4479476-4479558|CRISPRCasFinder
TCCTCGTCCTCCGACGACGATGACGACTCCTCCTCGTACGGTTCTTCCTCCTACGGAGGCTCTTCGTCCTACGACGACGATGA

>NC_018524|20|19|4479476-4479558|CRISPRCasFinder
TCCTCGTCCTCCGACGACGATGA	CGACTCCTCCTCGTACGGTTCTTCCTCCTACGGAGGC
TCTTCGTCCTACGACGACGATGA

Neighbor Proteins Overview

Protein	Signature genes	Signature genes Name	Protein_function
NC_018524.1|WP_014912669.1|4470885_4471455_+|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl|CDD|224228
NC_018524.1|WP_148281645.1|4482373_4483696_+|MFS-transporter	unknown	unknown	gnl|CDD|340863
NC_018524.1|WP_014910376.1|4472636_4473032_-|VOC-family-protein	unknown	unknown	gnl|CDD|319925
NC_018524.1|WP_014908237.1|4485666_4486434_+|SDR-family-oxidoreductase	unknown	unknown	gnl|CDD|275120
NC_018524.1|WP_014909324.1|4467870_4468542_-|response-regulator-transcription-factor	unknown	unknown	gnl|CDD|225107
NC_018524.1|WP_017536006.1|4479619_4480252_-|MBL-fold-metallo-hydrolase	unknown	unknown	gnl|CDD|293792
NC_018524.1|WP_014912739.1|4487671_4489336_+|(2,3-dihydroxybenzoyl)adenylate-synthase	unknown	unknown	gnl|CDD|223952
NC_018524.1|WP_014912403.1|4483783_4484587_-|N-acetylmuramoyl-L-alanine-amidase	unknown	unknown	gnl|CDD|133475
NC_018524.1|WP_014912400.1|4481527_4482133_+|class-IV-adenylate-cyclase	unknown	unknown	gnl|CDD|143628
NC_018524.1|WP_014909596.1|4484859_4485216_-|DUF3817-domain-containing-protein	unknown	unknown	gnl|CDD|378962
NC_018524.1|WP_014911760.1|4480248_4481334_-|S-(hydroxymethyl)mycothiol-dehydrogenase	unknown	unknown	gnl|CDD|132492
NC_018524.1|WP_014909699.1|4476545_4477025_+|GNAT-family-N-acetyltransferase	unknown	unknown	gnl|CDD|366181
NC_018524.1|WP_014912257.1|4470229_4470397_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014908901.1|4466927_4467818_-|universal-stress-protein	unknown	unknown	gnl|CDD|366180
NC_018524.1|WP_014908325.1|4486504_4487668_+|isochorismate-synthase	unknown	unknown	gnl|CDD|235886
NC_018524.1|WP_014910334.1|4473137_4473902_+|haloacid-dehalogenase-like-hydrolase	unknown	unknown	gnl|CDD|319796
NC_018524.1|WP_014910738.1|4471543_4472578_+|zinc-binding-dehydrogenase	unknown	unknown	gnl|CDD|176234
NC_018524.1|WP_014913284.1|4469462_4470131_-|DNA-alkylation-repair-protein	unknown	unknown	gnl|CDD|227249
NC_018524.1|WP_041561946.1|4468639_4469344_-|pyridoxamine-5'-phosphate-oxidase-family-protein	unknown	unknown	gnl|CDD|378988
NC_018524.1|WP_014912861.1|4489339_4490005_+|isochorismatase-family-protein	unknown	unknown	gnl|CDD|238495

rpsblast for functional proteins

Protein	Function_ID	Function_description	E-value
NC_018524.1|WP_014912669.1|4470885_4471455_+|TetR/AcrR-family-transcriptional-regulator	gnl|CDD|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	5.93701e-09
NC_018524.1|WP_148281645.1|4482373_4483696_+|MFS-transporter	gnl|CDD|340863	cd06173, MFS_MefA_like, Macrolide efflux protein A and similar proteins of the Major Facilitator Superfamily of transporters. This family is composed of Streptococcus pyogenes macrolide efflux protein A (MefA) and similar transporters, many of which remain uncharacterized. Some members may be multidrug resistance (MDR) transporters, which are drug/H+ antiporters (DHAs) that mediate the efflux of a variety of drugs and toxic compounds, conferring resistance to these compounds. MefA confers resistance to 14-membered macrolides including erythromycin and to 15-membered macrolides. It functions as an efflux pump to regulate intracellular macrolide levels. The MefA-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	8.92701e-53
NC_018524.1|WP_014913284.1|4469462_4470131_-|DNA-alkylation-repair-protein	gnl|CDD|227249	COG4912, COG4912, Predicted DNA alkylation repair enzyme [DNA replication, recombination, and repair].	8.1953e-39
NC_018524.1|WP_014908237.1|4485666_4486434_+|SDR-family-oxidoreductase	gnl|CDD|275120	TIGR04316, 23-dihydro-23-dihydroxybenzoate_dehydrogenase, 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase. Members of this family are 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase (EC 1.3.1.28), the third enzyme in the biosynthesis of 2,3-dihydroxybenzoic acid (DHB) from chorismate. The first two enzymes are isochorismate synthase (EC 5.4.4.2) and isochorismatase (EC 3.3.2.1). Synthesis is often followed by adenylation by the enzyme DHBA-AMP ligase (EC 2.7.7.58) to activate (DHB) for a non-ribosomal peptide synthetase.	1.86526e-103
NC_018524.1|WP_014909324.1|4467870_4468542_-|response-regulator-transcription-factor	gnl|CDD|225107	COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription].	2.21798e-66
NC_018524.1|WP_017536006.1|4479619_4480252_-|MBL-fold-metallo-hydrolase	gnl|CDD|293792	cd06262, metallo-hydrolase-like_MBL-fold, mainly hydrolytic enzymes and related proteins which carry out various biological functions; MBL-fold metallohydrolase domain. Members of the MBL-fold metallohydrolase superfamily are mainly hydrolytic enzymes which carry out a variety of biological functions. The class B metal beta-lactamases (MBLs) for which this fold was named perform only a small fraction of the activities included in this superfamily. Activities carried out by superfamily members include class B beta-lactamases which can catalyze the hydrolysis of a wide range of beta-lactam antibiotics, hydroxyacylglutathione hydrolases (also called glyoxalase II) which hydrolyze S-d-lactoylglutathione to d-lactate in the second step of the glycoxlase system, AHL lactonases which catalyze the hydrolysis and opening of the homoserine lactone rings of acyl homoserine lactones (AHLs), persulfide dioxygenase which catalyze the oxidation of glutathione persulfide to glutathione and persulfite in the mitochondria, flavodiiron proteins which catalyze the reduction of oxygen and/or nitric oxide to water or nitrous oxide respectively, cleavage and polyadenylation specificity factors such as the Int9 and Int11 subunits of Integrator, Sdsa1-like and AtsA-like arylsulfatases, 5'-exonucleases human SNM1A and yeast Pso2p, ribonuclease J which has both 5'-3' exoribonucleolytic and endonucleolytic activity and ribonuclease Z which catalyzes the endonucleolytic removal of the 3' extension of the majority of tRNA precursors, cyclic nucleotide phosphodiesterases which decompose cyclic adenosine and guanosine 3', 5'-monophosphate (cAMP and cGMP) respectively, insecticide hydrolases, and proteins required for natural transformation competence. The diversity of biological roles is reflected in variations in the active site metallo-chemistry, for example classical members of the superfamily are di-, or less commonly mono-, zinc-ion-dependent hydrolases, human persulfide dioxygenase ETHE1 is a mono-iron binding member of the superfamily; Arabidopsis thaliana hydroxyacylglutathione hydrolases incorporates iron, manganese, and zinc in its dinuclear metal binding site, and flavodiiron proteins contains a diiron site.	1.20577e-51
NC_018524.1|WP_014912739.1|4487671_4489336_+|(2,3-dihydroxybenzoyl)adenylate-synthase	gnl|CDD|223952	COG1021, EntE, Peptide arylation enzymes [Secondary metabolites biosynthesis, transport, and catabolism].	0
NC_018524.1|WP_014912403.1|4483783_4484587_-|N-acetylmuramoyl-L-alanine-amidase	gnl|CDD|133475	cd06583, PGRP, Peptidoglycan recognition proteins (PGRPs) are pattern recognition receptors that bind, and in certain cases, hydrolyze peptidoglycans (PGNs) of bacterial cell walls. PGRPs have been divided into three classes: short PGRPs (PGRP-S), that are small (20 kDa) extracellular proteins; intermediate PGRPs (PGRP-I) that are 40-45 kDa and are predicted to be transmembrane proteins; and long PGRPs (PGRP-L), up to 90 kDa, which may be either intracellular or transmembrane. Several structures of PGRPs are known in insects and mammals, some bound with substrates like Muramyl Tripeptide (MTP) or Tracheal Cytotoxin (TCT). The substrate binding site is conserved in PGRP-LCx, PGRP-LE, and PGRP-Ialpha proteins. This family includes Zn-dependent N-Acetylmuramoyl-L-alanine Amidase, EC:3.5.1.28. This enzyme cleaves the amide bond between N-acetylmuramoyl and L-amino acids, preferentially D-lactyl-L-Ala, in bacterial cell walls. The structure for the bacteriophage T7 lysozyme shows that two of the conserved histidines and a cysteine are zinc binding residues. Site-directed mutagenesis of T7 lysozyme indicates that two conserved residues, a Tyr and a Lys, are important for amidase activity.	2.74537e-30
NC_018524.1|WP_014912400.1|4481527_4482133_+|class-IV-adenylate-cyclase	gnl|CDD|143628	cd07890, CYTH-like_AC_IV-like, Adenylyl cyclase (AC) class IV-like, a subgroup of the CYTH-like superfamily. This subgroup contains class IV ACs and similar proteins. AC catalyzes the conversion of ATP to 3',5'-cyclic AMP (cAMP) and PPi. cAMP is a key signaling molecule which conveys a variety of signals in different cell types. In prokaryotes, cAMP is a catabolite derepression signal which triggers the expression of metabolic pathways including the lactose operon. Six non-homologous classes of ACs have been identified (I-VI). Class IV ACs are found in this group. In bacteria, the gene encoding Class IV AC has been designated cyaB and the protein as AC2. AC-IV occurs in addition to AC-I in bacterial pathogens such as Yersinia pestis (plague disease). The role of AC-IV is unknown but it has been speculated that it may be a factor in pathogenesis, perhaps providing cAMP for a secondary internal signaling function, or for secretion and uptake into host cells, where it may disrupt normal cellular processes. This subgroup belongs to the CYTH/triphosphate tunnel metalloenzyme (TTM)-like superfamily, whose enzymes have a unique active site located within an eight-stranded beta barrel.	3.73289e-26
NC_018524.1|WP_014909596.1|4484859_4485216_-|DUF3817-domain-containing-protein	gnl|CDD|378962	pfam12823, DUF3817, Domain of unknown function (DUF3817). This domain is of unknown function. It is sometimes found adjacent to pfam07690 and pfam03176 which are both transporter domains.	9.1291e-26
NC_018524.1|WP_014911760.1|4480248_4481334_-|S-(hydroxymethyl)mycothiol-dehydrogenase	gnl|CDD|132492	TIGR03451, S-hydroxymethylmycothiol_dehydrogenase, S-(hydroxymethyl)mycothiol dehydrogenase. Members of this protein family are mycothiol-dependent formaldehyde dehydrogenase (EC 1.2.1.66). This protein is found, so far, only in the Actinobacteria (Mycobacterium sp., Streptomyces sp., Corynebacterium sp., and related species), where mycothione replaces glutathione. [Cellular processes, Detoxification].	0
NC_018524.1|WP_014909699.1|4476545_4477025_+|GNAT-family-N-acetyltransferase	gnl|CDD|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	7.54058e-10
NC_018524.1|WP_014910376.1|4472636_4473032_-|VOC-family-protein	gnl|CDD|319925	cd07264, VOC_like, uncharacterized subfamily of vicinal oxygen chelate (VOC) family. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	1.16034e-13
NC_018524.1|WP_014908901.1|4466927_4467818_-|universal-stress-protein	gnl|CDD|366180	pfam00582, Usp, Universal stress protein family. The universal stress protein UspA is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. UspA enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae UspA reveals an alpha/beta fold similar to that of the Methanococcus jannaschii MJ0577 protein, which binds ATP, though UspA lacks ATP-binding activity.	4.49347e-21
NC_018524.1|WP_014908325.1|4486504_4487668_+|isochorismate-synthase	gnl|CDD|235886	PRK06923, PRK06923, isochorismate synthase DhbC; Validated.	1.15495e-145
NC_018524.1|WP_014910334.1|4473137_4473902_+|haloacid-dehalogenase-like-hydrolase	gnl|CDD|319796	cd02612, HAD_PGPPase, phosphatidylglycerol-phosphate phosphatase, similar to Escherichia coli K-12 phosphatidylglycerol-phosphate phosphatase C. This family includes Escherichia coli K-12 phosphatidylglycerol-phosphate phosphatase C, PgpC (previously named yfhB) which catalyzes the dephosphorylation of phosphatidylglycerol-phosphate (PGP) to phosphatidylglycerol (PG). This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	5.62753e-24
NC_018524.1|WP_014910738.1|4471543_4472578_+|zinc-binding-dehydrogenase	gnl|CDD|176234	cd08273, MDR8, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines.	5.15583e-113
NC_018524.1|WP_041561946.1|4468639_4469344_-|pyridoxamine-5'-phosphate-oxidase-family-protein	gnl|CDD|378988	pfam12900, Pyridox_ox_2, Pyridoxamine 5'-phosphate oxidase. Pyridoxamine 5'-phosphate oxidase is a FMN flavoprotein that catalyzes the oxidation of pyridoxamine-5-P (PMP) and pyridoxine-5-P (PNP) to pyridoxal-5-P (PLP). This entry contains several pyridoxamine 5'-phosphate oxidases, and related proteins.	3.41362e-15
NC_018524.1|WP_014912861.1|4489339_4490005_+|isochorismatase-family-protein	gnl|CDD|238495	cd01013, isochorismatase, Isochorismatase, also known as 2,3 dihydro-2,3 dihydroxybenzoate synthase, catalyses the conversion of isochorismate, in the presence of water, to 2,3-dihydroxybenzoate and pyruvate, via the hydrolysis of a vinyl ether, an uncommon reaction in biological systems. Isochorismatase is part of the phenazine biosynthesis pathway. Phenazines are antimicrobial compounds that provide the competitive advantage for certain bacteria.	1.38709e-116

Protein sequences

>NC_018524.1|WP_014909699.1|4476545_4477025_+|GNAT-family-N-acetyltransferase
MNHPSLHAVEISPDNIDAALKVKVREDQNTFVAPVDRSLAEAYASRNTAWPRLIMDGDRPVGFVMASFDPDEKDVDFRCAIWRLNVAEGEQGKGYGRFAVETVLAEARRRGDKRITVSWVPGEGSPEGFYLGLGFRTTGRVDDGEIIAELFLDQETAEA
>NC_018524.1|WP_014910334.1|4473137_4473902_+|haloacid-dehalogenase-like-hydrolase
MNRALFDLDDTLIDHDSFTRFTFSLLKRSPLRMIGAVLIVPALLVLLSRGSWRVHAGSILLWLGTVGVADSGLERLVREHVAALGVGERIRPDAGRAVAAHLDAGEEVVVVTGCAERLAVPLCREIDPRIRVIGSTLRRRAGGWVALRHCHGRGKVEMLVEAGLAEDVVAAYGDGLSDVPMLDLAPTAVLVGLSESVERKARARLVGPERVLSVRWPARGEPVAGPRRPRLSGPFERRKKGVSRGRLVQKGPGG
>NC_018524.1|WP_014910376.1|4472636_4473032_-|VOC-family-protein
MDVLSSRVLIHPRDPVRSRSFYRDVLGLAVHREFGPPDAPGTVFFLGNGLLEVSGHSEEPSGTPSTALWLQVRDARAEYARVTALGGRGIRPPQKEFWGLVEAWIADPDGVRIVLVEVPVDHPLRKDQREF
>NC_018524.1|WP_014910738.1|4471543_4472578_+|zinc-binding-dehydrogenase
MTERHTLEIVLPDEVEPEGLLTRRRPIGPPGPGKALVRTEATGVSFAEQQMRRGKYFDQPPFPFVPGYDLVGTVEEVGPGTDAALVGRRVAAITKIGAWAERVVLPAADLVPVPAGLDPAEAEAVVVNGVTALRMLRGAGPVGAGDTVLVLGANGGVGTLLVQMARRAGAEVVGTASARHLEAVREMGAIPVDRRSPDLRAAIRAAAPNGVRAAFDHVGGPGIVDTFSHVVRGGALVSYGTAATRDVPGNPMLPVLLLFARLGWWNALPDGRRAYFFNLWKGHRNRERHRRELARDLGEVFDLLGHGDIRPTIAARMPLGEAGAAMALAESGTVVGKVVLVPEG
>NC_018524.1|WP_014912669.1|4470885_4471455_+|TetR/AcrR-family-transcriptional-regulator
MSREESTRSTAEARRAVILNEALHVFARSGYHTTPVTEVAEAAGISQAYVLRLFGTKLGLFTATLERCFERVEEALREGALGADGAPAPQVLEAMGDAYAELIADRDLLMIQVHAQSASAVPEIRETLRRGYADVVTLAHALSGGDRDQVQRFMAMGLLCHLVTALDLEEVDAPWTRTLTKGMTHAPRG
>NC_018524.1|WP_014912257.1|4470229_4470397_-|hypothetical-protein
MIESRGETYTITENPPASRWGMVALFLLWGGSLATLARNGRGEPNGSTPDPSPDH
>NC_018524.1|WP_014913284.1|4469462_4470131_-|DNA-alkylation-repair-protein
MAETVEGIRAELAALEDPKTRRVNERHGDDHGVKLSPLREIAKRVGKRQDLARELWASGDTAARLLSLLICRPRGFEAAELDAMLREARAPKAHAWLVGYVVAKGPHAEKLRRAWLADPDPVVASAGWALTAERVDRSPEGLDLPGLLDVIETRMKDAPDRLQWEMNHCLARIGIHHPEHRARAMEIGERLEVLKDYPTPPNCTSPFAPIWISEIVRRREKA
>NC_018524.1|WP_041561946.1|4468639_4469344_-|pyridoxamine-5'-phosphate-oxidase-family-protein
MGHQGAAIPDGGDLGHRAAARRRELGLTREQVAERADMDPGYVAYLEEHTPRMTRPALYRLAEALNTTQDHLLGTDTDLPPGAMATEVPLPRTTVLSSRRCLELIEPGGVGRVGLVTGESTPVILPVNYLFHEGAIVFRTKDDGVIGERLPQDIAFEVDRVDGVMSQGWSVLVRGRAEAVTDRALEEELRAHAPVRPWAGGERDLFVRVVPEEIGGREVSGRVPHAREVGPPER
>NC_018524.1|WP_014909324.1|4467870_4468542_-|response-regulator-transcription-factor
MSKENGATRVFLLDDHDVVRQGIMALLQDEEDIEVVGEAATASEALGRIPAARPDVAVLDVRLPDGNGVEVCRELQSRPDAPVCLMLTSYCDDEALYASVMAGAAGYVLKQIHGSDLVGAIRTVASGESLLDPHSTARILRRLREGSETEDPLPGFSDKERLVFELIGEGLTNRQIGERIFLAEKTVKNHVSSVLSKLGMRRRSQAAAHAARLRARSERGGSG
>NC_018524.1|WP_014908901.1|4466927_4467818_-|universal-stress-protein
MIGNTRGPVVAAVDGSPASDRALDWAADEARSRGLDLRLVHASGPPTHRPAPDGVGPRVVEEARRRASERAPDLPVEAVSLTGDREPVLSRESRSARALVLGARRMSATGEMAPGATTLALTASSSCPVVVVPETGPAPRTGRVMVGVDGSESARSAAEWAFAEAEARGADLLVVSASGGVPREDLGTPEGDVPVSEGFELPGDDALVAASVAESHRLLSESIAGERELRPDVRVEEIVEVGDAAGVLRSLAEGCDLTVVGSRGRGSLVGTLLGSVSRSVLSHSPRPVAVVRAERR
>NC_018524.1|WP_017536006.1|4479619_4480252_-|MBL-fold-metallo-hydrolase
MSNARVEHLTTSGVFSLDGGSWKVDNNVWLVGDDEEVVVIDAPHEAQAIIDAVNGRRVVAIVCTHGHNDHVNAALEVSDAVHGPVLLHPDDRVLWNMTNPERVPDGALADGQVITVAGIELRVIHTPGHAPGAVCLYSPELGALFSGDTLFQGGPGATGRSYSDFPTIIASIRDRLLTLPGDTVVRTGHGDPTTIGAEAPHLQEWIDRGH
>NC_018524.1|WP_014911760.1|4480248_4481334_-|S-(hydroxymethyl)mycothiol-dehydrogenase
MSQQVQGVISRAKGAPVELTTIVVPDPGPGEAVVRVLACGVCHTDLHYREGGINDEYPFLLGHEAAGIVESVGPNVTEIVPGDHVVLNWRAVCGHCRACRRGRPQYCFDTHNAEQSMTLEDGTELTPALGIGAFAEKTLVAAGQCTKVDPTASPAAAGLLGCGIMAGIGAAINTGGVTRGDSVAVIGCGGVGNAAVAGARLAGANRIIAVDLEERKLEWARGFGATHTVDARVSDPVEAIRDLTGGFGADVVIDAVGLPKTYEQAFYARDLAGTVVLVGVPTPEMRLELPLLDVFGRGGALKSSWYGDCLPSRDFPMLIDLYTQGRLDLDGFVTETIGIGDVEEAFGRMERGEVLRSVVLL
>NC_018524.1|WP_014912400.1|4481527_4482133_+|class-IV-adenylate-cyclase
MNVSMAPIEVERKRVLEDRAALEERLETAGLVAAGPIVEVDTYYSRPDVDFMETVECLRVREREGGCEITYKPASDATTRSAAGVIAKKETDVALADADQAARAHDLLEALGMVRLARVEKRRACYRDSGRPGLSVVVDTVVGAGSFIETEILSEGPFQEAVRRLEEAERLLGVDTLPVVTSPYRDLVMGVGASVPLDASG
>NC_018524.1|WP_148281645.1|4482373_4483696_+|MFS-transporter
MATRSPFPDVNMSAVSSTSSPPSDSGRRAAPLGRDFSLLWGASASANLADGLVRVALPLVAVELTRSPILVSGVAVTGTLAWLLVGLPAGALGDRLNRRVLALGAALTRTVLLGGVGLLLLTDHLTVGALFAAAFLLGVGEAFFDTSTPAMVPGLVPRRELSRAHGRRHAASMAGDDLVGPAAGGTLFAFSKAAPLLVSTVCHALSAILLWRVRYEPGPAPSEATERRVSLWGEILRGPALLFRERRIAVLALWGAGANFAGSLTFSVLALYLVAPGPVGLDTWGFGLLMASLGVGGIVGASYAGRLAARMGELRLLTLSCLLMAVDSVVLALTTRVWAISAGLVVGAAAAAVFGVMTITALQRRTPDSHLSRVSAGNRLIMMGGTALGGLTAGVLGESTGDLRVGFAVAAVLFVSLCAMRLAVPEADDEVGPPPSERTP
>NC_018524.1|WP_014912403.1|4483783_4484587_-|N-acetylmuramoyl-L-alanine-amidase
MEQNQGPDRRTLLRGAAVASGAAVIGASAASPAGASPTTSAAEPPMSFRADWNARPPSSPVQILQTPPTHVVVHHTATANSTDHSLDHALALSRSIQNFHMDTNGWIDVGQQFTISRGGHLVEGRDRAVPAVREGVHCVGTHVANNNNTCVGIENEGTYMEEGPTQELVDRLVETLAWLCGSYGLDPQTAILGHRDFNATACPGDVLYAMLPDLRNAVSSLMLAQGMEIGTRTVSAEDRPTYPEVPENEPEGEFLHGPARGPDDFSR
>NC_018524.1|WP_014909596.1|4484859_4485216_-|DUF3817-domain-containing-protein
MSLNSLTAPAFRVVAVFEAFTWAGLLVGMYFKYLGNGSELGVQIFGPLHGGAFMVYVAVTLFAAVRLRWGVWPTLVALAASIPPLGTLPADWWLHRTGRLAPGANTKNDRDRSPEPVS
>NC_018524.1|WP_014908237.1|4485666_4486434_+|SDR-family-oxidoreductase
MNGIDGAVAMVTGAAGGVGRAVALDLAGHGARVAAVDVDADGLDRTLRLLRERGHRAGAFIADVTDTTRVEGLFDEIEADLGPVTLAVNAAGTLVTGPVADCDERDWHRVMAVNATGVFAVGRAVARRMGPRGHGALVTVASNAAGIPRSGMAAYAASKAAAVALTKSLGLELAPLGVRCNVVSPGSTDTPMLRAMTPDPAALVHGDPGRFKVGIPLGRIGSPEDVAEAVRFLLSDAARHITMHELYVDGGATLR
>NC_018524.1|WP_014908325.1|4486504_4487668_+|isochorismate-synthase
MPEQRTAAPAASAGELLTAYRPGDTFFSTGSHALHGTGTLTTLDRAEDLTSVLAEAGEGAVAVGAIPFDVARPAHLVVPETVRWSPPAANTAPAERRWSPLAGEWRITPVPAPEAHVAAVERAVKLMAEDADLLKVVLARTLRVHGDRKVDVATVLANLLWRDPSAFVFATDLPARGSGTRSLIGASPELLVSKRGRRVLSNPLAGSAPRSADPTKDQKRAVDLLTSTKDRHEHAVVVEAVAEGLRPYCRRLTVPDEPELVKTATMWHLSTRVTGEAIDPDLPAHVPAMALHPTPAVCGTPRDRAFDTIVDLEPFDRGFYTGAVGHSDASGDGEWVVTIRCADVEGDTLDLYAGGGVMPESDPDAELAETSAKLRTLLLALGVDGAA
>NC_018524.1|WP_014912739.1|4487671_4489336_+|(2,3-dihydroxybenzoyl)adenylate-synthase
MNDRPGPRAVDPADWTPWPREYADTYRAAGLWTGETFPAFLRDRAARFGERTAVVDGDLRWTYAELDRRADALAAGLSRLGVRAGERVVVHLPNVASLFEVVFALFRLGALPVYALPAHRRSELLHLAGTAEAVALITTDLQGAFDCRPMAARVRAEVPSLEHVVVVGEAGDEEGFTALEALRAEPDTAILAEPDPGSVAFFQLSGGTTGLPKLIPRTHDDYLYSVRASADICGLDTDTVYLTALPAVHNFPMSSPGFLGVLHAGGTVVTAPDPSPATCLPLIEREHVTHTAVVPPVAMLWMDAVEHGSQGERDLSDLRVLQVGGATFPPEAARRVAPVLGCALQQVFGMAEGLVNYTRDGDPDEVVTGTQGRPISDHDEILIVDDRDHPVPDGEPGHLLTRGPYTIRGYYRAPEHNAVAFTDDGFYRTGDIVRRHPSGALVVAGRAKDQINRGGEKIGAEEIENHLLAHPAVHDASLVALPDPYLGERTHAYVIARGEAPTRGELLAFLRERGLAAYKIPDRVSFVDAFPATAVGKTSKRDLRAARTTSGTDH
>NC_018524.1|WP_014912861.1|4489339_4490005_+|isochorismatase-family-protein
MSLPTIAPYPLPTSEELPENRAHWPLEPERALLLVHDMQRYFVRPYAEGSQPIVGAVANIAALRSACRAAGVPVVYTAKPGDMTSEQRGLERDFWGAGMKAVAEHTDIVPELAPDGEDLLLTKWRYSAFAQTDLAERMAAQGRDQIVVTGVYAHIGCQLTAADAFMRDIRPFLIADALADFSADHHRSALNYAAGRCATVLSTRDALGFLDRGADSTGARP

Crispr_ID: NC_018524_21

• CRISPR_ID: NC_018524_21
• CRISPR_location: 4582146-4583149
• CRISPR_type: Orphan
• Repeat_type: I-E,II-B
• Spacer_info: 16 spacers
• Cas_protein_info: WYL

Consensus repeat of NC_018524_21

Consensus_repeat	Method
GGTCCATCCCCACGTGCGTGGGGCTCAG	PILER-CR
CTGAGCCCCACGCACGTGGGGATGGACCG	CRISPRCasFinder
CTGAGCCCCACGCACGTGGGGATGGACCG	CRT

spacers of NC_018524_21

>21.1|4582174|33|NC_018524|PILER-CR
GACTAAGAGCATTTGGAATGTCCCTGGATTCGG
>21.2|4582235|33|NC_018524|PILER-CR
GACACGGTGACTGGGCAGGGCTCTGCCCTGGTC
>21.3|4582296|33|NC_018524|PILER-CR
GGTGACGGTGTGTAACGTCCACTCCGTCCAGTC
>21.4|4582357|33|NC_018524|PILER-CR
TCCACGTGCGGTGGCCAGCTCCTCCCAGTTCGA
>21.5|4582418|33|NC_018524|PILER-CR
TCTGTGGGCTTGACCAGCAGGCCCTTGAAGATC
>21.6|4582479|33|NC_018524|PILER-CR
GAACTTCTCCAGCTCCTTGTGAGCGCTCTCCCG
>21.7|4582540|33|NC_018524|PILER-CR
TGTCGAGTGCCGTGGCCTCACGGTCGTCGGCGA
>21.8|4582601|33|NC_018524|PILER-CR
GGTGCTTGGACACCTTCATGGCCTTCCGGGCGA
>21.9|4582662|33|NC_018524|PILER-CR
GGGCTCGTCGACACACGTCAGCAGGGCAGCACG
>21.10|4582723|33|NC_018524|PILER-CR
GGTGGCGTTCTTGGTTTCTCTGAGCAACACCAC
>21.11|4582784|33|NC_018524|PILER-CR
GGTGCTTGCCTGGACGCACCCTCGCCTCCGAGC
>21.12|4582845|33|NC_018524|PILER-CR
GGAACGACGGCCGGGTCGTCGTGGTCCTGGCCG
>21.13|4582906|33|NC_018524|PILER-CR
GCAGGGGCAGTACGAGGAACTGACCCGCATCAT
>21.14|4582175|32|NC_018524|CRISPRCasFinder,CRT
ACTAAGAGCATTTGGAATGTCCCTGGATTCGG
>21.15|4582236|32|NC_018524|CRISPRCasFinder,CRT
ACACGGTGACTGGGCAGGGCTCTGCCCTGGTC
>21.16|4582297|32|NC_018524|CRISPRCasFinder,CRT
GTGACGGTGTGTAACGTCCACTCCGTCCAGTC
>21.17|4582358|32|NC_018524|CRISPRCasFinder,CRT
CCACGTGCGGTGGCCAGCTCCTCCCAGTTCGA
>21.18|4582419|32|NC_018524|CRISPRCasFinder,CRT
CTGTGGGCTTGACCAGCAGGCCCTTGAAGATC
>21.19|4582480|32|NC_018524|CRISPRCasFinder,CRT
AACTTCTCCAGCTCCTTGTGAGCGCTCTCCCG
>21.20|4582541|32|NC_018524|CRISPRCasFinder,CRT
GTCGAGTGCCGTGGCCTCACGGTCGTCGGCGA
>21.21|4582602|32|NC_018524|CRISPRCasFinder,CRT
GTGCTTGGACACCTTCATGGCCTTCCGGGCGA
>21.22|4582663|32|NC_018524|CRISPRCasFinder,CRT
GGCTCGTCGACACACGTCAGCAGGGCAGCACG
>21.23|4582724|32|NC_018524|CRISPRCasFinder,CRT
GTGGCGTTCTTGGTTTCTCTGAGCAACACCAC
>21.24|4582785|32|NC_018524|CRISPRCasFinder,CRT
GTGCTTGCCTGGACGCACCCTCGCCTCCGAGC
>21.25|4582846|32|NC_018524|CRISPRCasFinder,CRT
GAACGACGGCCGGGTCGTCGTGGTCCTGGCCG
>21.26|4582907|32|NC_018524|CRISPRCasFinder,CRT
CAGGGGCAGTACGAGGAACTGACCCGCATCAT
>21.27|4582968|32|NC_018524|CRISPRCasFinder,CRT
CCTTGTGCCAGGTCGCGGCGGTGGTGAGTGAC
>21.28|4583029|31|NC_018524|CRISPRCasFinder,CRT
ACCGATTTACCGGCCCCGAACCCATCGACAA
>21.29|4583089|32|NC_018524|CRISPRCasFinder,CRT
GACTGACCGTGATCCAGTTCGGGATCCGGGTC

CRISPR arrays and Neighbor proteins around NC_018524_21

CRISPR arrays

The CRISPR arrays of NC_018524_21

>merge|NC_018524|21|4582146-4583149|PILER-CR,CRISPRCasFinder,CRT
CTGAGCCCCACGCACGTGGGGATGGACCGACTAAGAGCATTTGGAATGTCCCTGGATTCGGCTGAGCCCCACGCACGTGGGGATGGACCGACACGGTGACTGGGCAGGGCTCTGCCCTGGTCCTGAGCCCCACGCACGTGGGGATGGACCGGTGACGGTGTGTAACGTCCACTCCGTCCAGTCCTGAGCCCCACGCACGTGGGGATGGACCTCCACGTGCGGTGGCCAGCTCCTCCCAGTTCGACTGAGCCCCACGCACGTGGGGATGGACCTCTGTGGGCTTGACCAGCAGGCCCTTGAAGATCCTGAGCCCCACGCACGTGGGGATGGACCGAACTTCTCCAGCTCCTTGTGAGCGCTCTCCCGCTGAGCCCCACGCACGTGGGGATGGACCTGTCGAGTGCCGTGGCCTCACGGTCGTCGGCGACTGAGCCCCACGCACGTGGGGATGGACCGGTGCTTGGACACCTTCATGGCCTTCCGGGCGACTGAGCCCCACGCACGTGGGGATGGACCGGGCTCGTCGACACACGTCAGCAGGGCAGCACGCTGAGCCCCACGCACGTGGGGATGGACCGGTGGCGTTCTTGGTTTCTCTGAGCAACACCACCTGAGCCCCACGCACGTGGGGATGGACCGGTGCTTGCCTGGACGCACCCTCGCCTCCGAGCCTGAGCCCCACGCACGTGGGGATGGACCGGAACGACGGCCGGGTCGTCGTGGTCCTGGCCGCTGAGCCCCACGCACGTGGGGATGGACCGCAGGGGCAGTACGAGGAACTGACCCGCATCATCTGAGCCCCACGCACGTGGGGATGGACCGCCTTGTGCCAGGTCGCGGCGGTGGTGAGTGACCTGAGCCCCACACACGTGGGGATGGACCGACCGATTTACCGGCCCCGAACCCATCGACAACTGAGCCCCAGGCGCGTGGGGATGGACCGGACTGACCGTGATCCAGTTCGGGATCCGGGTCCTGAGCCCCACGCACGTGGGGATTGGCCC

>NC_018524|21|12|4582146-4582966|PILER-CR
CTGAGCCCCACGCACGTGGGGATGGACC	GACTAAGAGCATTTGGAATGTCCCTGGATTCGG
CTGAGCCCCACGCACGTGGGGATGGACC	GACACGGTGACTGGGCAGGGCTCTGCCCTGGTC
CTGAGCCCCACGCACGTGGGGATGGACC	GGTGACGGTGTGTAACGTCCACTCCGTCCAGTC
CTGAGCCCCACGCACGTGGGGATGGACC	TCCACGTGCGGTGGCCAGCTCCTCCCAGTTCGA
CTGAGCCCCACGCACGTGGGGATGGACC	TCTGTGGGCTTGACCAGCAGGCCCTTGAAGATC
CTGAGCCCCACGCACGTGGGGATGGACC	GAACTTCTCCAGCTCCTTGTGAGCGCTCTCCCG
CTGAGCCCCACGCACGTGGGGATGGACC	TGTCGAGTGCCGTGGCCTCACGGTCGTCGGCGA
CTGAGCCCCACGCACGTGGGGATGGACC	GGTGCTTGGACACCTTCATGGCCTTCCGGGCGA
CTGAGCCCCACGCACGTGGGGATGGACC	GGGCTCGTCGACACACGTCAGCAGGGCAGCACG
CTGAGCCCCACGCACGTGGGGATGGACC	GGTGGCGTTCTTGGTTTCTCTGAGCAACACCAC
CTGAGCCCCACGCACGTGGGGATGGACC	GGTGCTTGCCTGGACGCACCCTCGCCTCCGAGC
CTGAGCCCCACGCACGTGGGGATGGACC	GGAACGACGGCCGGGTCGTCGTGGTCCTGGCCG
CTGAGCCCCACGCACGTGGGGATGGACC	GCAGGGGCAGTACGAGGAACTGACCCGCATCAT
CTGAGCCCCACGCACGTGGGGATGGACC

>NC_018524|21|20|4582146-4583149|CRISPRCasFinder
CTGAGCCCCACGCACGTGGGGATGGACCG	ACTAAGAGCATTTGGAATGTCCCTGGATTCGG
CTGAGCCCCACGCACGTGGGGATGGACCG	ACACGGTGACTGGGCAGGGCTCTGCCCTGGTC
CTGAGCCCCACGCACGTGGGGATGGACCG	GTGACGGTGTGTAACGTCCACTCCGTCCAGTC
CTGAGCCCCACGCACGTGGGGATGGACCT	CCACGTGCGGTGGCCAGCTCCTCCCAGTTCGA
CTGAGCCCCACGCACGTGGGGATGGACCT	CTGTGGGCTTGACCAGCAGGCCCTTGAAGATC
CTGAGCCCCACGCACGTGGGGATGGACCG	AACTTCTCCAGCTCCTTGTGAGCGCTCTCCCG
CTGAGCCCCACGCACGTGGGGATGGACCT	GTCGAGTGCCGTGGCCTCACGGTCGTCGGCGA
CTGAGCCCCACGCACGTGGGGATGGACCG	GTGCTTGGACACCTTCATGGCCTTCCGGGCGA
CTGAGCCCCACGCACGTGGGGATGGACCG	GGCTCGTCGACACACGTCAGCAGGGCAGCACG
CTGAGCCCCACGCACGTGGGGATGGACCG	GTGGCGTTCTTGGTTTCTCTGAGCAACACCAC
CTGAGCCCCACGCACGTGGGGATGGACCG	GTGCTTGCCTGGACGCACCCTCGCCTCCGAGC
CTGAGCCCCACGCACGTGGGGATGGACCG	GAACGACGGCCGGGTCGTCGTGGTCCTGGCCG
CTGAGCCCCACGCACGTGGGGATGGACCG	CAGGGGCAGTACGAGGAACTGACCCGCATCAT
CTGAGCCCCACGCACGTGGGGATGGACCG	CCTTGTGCCAGGTCGCGGCGGTGGTGAGTGAC
CTGAGCCCCACACACGTGGGGATGGACCG	ACCGATTTACCGGCCCCGAACCCATCGACAA
CTGAGCCCCAGGCGCGTGGGGATGGACCG	GACTGACCGTGATCCAGTTCGGGATCCGGGTC
CTGAGCCCCACGCACGTGGGGATTGGCCC

>NC_018524|21|12|4582146-4583149|CRT
CTGAGCCCCACGCACGTGGGGATGGACCG	ACTAAGAGCATTTGGAATGTCCCTGGATTCGG
CTGAGCCCCACGCACGTGGGGATGGACCG	ACACGGTGACTGGGCAGGGCTCTGCCCTGGTC
CTGAGCCCCACGCACGTGGGGATGGACCG	GTGACGGTGTGTAACGTCCACTCCGTCCAGTC
CTGAGCCCCACGCACGTGGGGATGGACCT	CCACGTGCGGTGGCCAGCTCCTCCCAGTTCGA
CTGAGCCCCACGCACGTGGGGATGGACCT	CTGTGGGCTTGACCAGCAGGCCCTTGAAGATC
CTGAGCCCCACGCACGTGGGGATGGACCG	AACTTCTCCAGCTCCTTGTGAGCGCTCTCCCG
CTGAGCCCCACGCACGTGGGGATGGACCT	GTCGAGTGCCGTGGCCTCACGGTCGTCGGCGA
CTGAGCCCCACGCACGTGGGGATGGACCG	GTGCTTGGACACCTTCATGGCCTTCCGGGCGA
CTGAGCCCCACGCACGTGGGGATGGACCG	GGCTCGTCGACACACGTCAGCAGGGCAGCACG
CTGAGCCCCACGCACGTGGGGATGGACCG	GTGGCGTTCTTGGTTTCTCTGAGCAACACCAC
CTGAGCCCCACGCACGTGGGGATGGACCG	GTGCTTGCCTGGACGCACCCTCGCCTCCGAGC
CTGAGCCCCACGCACGTGGGGATGGACCG	GAACGACGGCCGGGTCGTCGTGGTCCTGGCCG
CTGAGCCCCACGCACGTGGGGATGGACCG	CAGGGGCAGTACGAGGAACTGACCCGCATCAT
CTGAGCCCCACGCACGTGGGGATGGACCG	CCTTGTGCCAGGTCGCGGCGGTGGTGAGTGAC
CTGAGCCCCACACACGTGGGGATGGACCG	ACCGATTTACCGGCCCCGAACCCATCGACAA
CTGAGCCCCAGGCGCGTGGGGATGGACCG	GACTGACCGTGATCCAGTTCGGGATCCGGGTC
CTGAGCCCCACGCACGTGGGGATTGGCCC

Neighbor Proteins Overview

Protein	Signature genes	Signature genes Name	Protein_function
NC_018524.1|WP_014912244.1|4578435_4579053_-|GntR-family-transcriptional-regulator	unknown	unknown	gnl|CDD|224715
NC_018524.1|WP_014910693.1|4589205_4590099_+|LysR-family-transcriptional-regulator	unknown	unknown	gnl|CDD|223656
NC_018524.1|WP_014909082.1|4590315_4591158_+|aminoglycoside-3'-phosphotransferase	unknown	unknown	gnl|CDD|270699
NC_018524.1|WP_014908725.1|4584309_4584888_+|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl|CDD|224228
NC_018524.1|WP_187294482.1|4584967_4585552_+|GNAT-family-N-acetyltransferase	unknown	unknown	gnl|CDD|366181
NC_018524.1|WP_014913545.1|4587887_4588562_+|ATPase-AAA	unknown	unknown	gnl|CDD|213205
NC_018524.1|WP_014908768.1|4583229_4584099_-|alpha/beta-hydrolase	unknown	unknown	gnl|CDD|225375
NC_018524.1|WP_014909852.1|4586347_4586794_+|NUDIX-domain-containing-protein	unknown	unknown	gnl|CDD|240039
NC_018524.1|WP_148281710.1|4580675_4581173_+|AbrB-family-transcriptional-regulator	unknown	unknown	gnl|CDD|274421
NC_018524.1|WP_014910484.1|4574868_4576383_-|tripartite-tricarboxylate-transporter-permease	unknown	unknown	gnl|CDD|225870
NC_018524.1|WP_014913561.1|4585707_4586151_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_041561955.1|4576913_4577936_-|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl|CDD|270234
NC_018524.1|WP_014908620.1|4581169_4581712_+|AbrB-family-transcriptional-regulator	unknown	unknown	gnl|CDD|377472
NC_018524.1|WP_014909557.1|4579049_4580522_-|FAD-dependent-tricarballylate-dehydrogenase-TcuA	unknown	unknown	gnl|CDD|236214
NC_018524.1|WP_014913356.1|4573541_4573703_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014911968.1|4593535_4594234_-|YafY-family-transcriptional-regulator	WYL	COG2378_WYL_CAS-I:CAS-III	gnl|CDD|225253
NC_018524.1|WP_014912182.1|4588609_4589104_-|PACE-efflux-transporter	unknown	unknown	gnl|CDD|226610
NC_018524.1|WP_014909364.1|4576395_4576914_-|tripartite-tricarboxylate-transporter-TctB-family-protein	unknown	unknown	gnl|CDD|377815
NC_018524.1|WP_014913341.1|4574282_4574504_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_041561954.1|4571196_4572084_-|hypothetical-protein	unknown	unknown	unknown

HMMScan for Signature genes

Protein	Cas_name	Cas_description	E-value	Identity	Coverage
NC_018524.1|WP_014911968.1|4593535_4594234_-|YafY-family-transcriptional-regulator	WYL	COG2378_WYL_CAS-I:CAS-III	8.5e-51	168.0	0.0

rpsblast for functional proteins

Protein	Function_ID	Function_description	E-value
NC_018524.1|WP_014912244.1|4578435_4579053_-|GntR-family-transcriptional-regulator	gnl|CDD|224715	COG1802, GntR, Transcriptional regulators [Transcription].	4.41788e-38
NC_018524.1|WP_014910693.1|4589205_4590099_+|LysR-family-transcriptional-regulator	gnl|CDD|223656	COG0583, LysR, Transcriptional regulator [Transcription].	9.06008e-33
NC_018524.1|WP_014909082.1|4590315_4591158_+|aminoglycoside-3'-phosphotransferase	gnl|CDD|270699	cd05150, APH, Aminoglycoside 3'-phosphotransferase. APH catalyzes the transfer of the gamma-phosphoryl group from ATP to aminoglycoside antibiotics such as kanamycin, streptomycin, neomycin, and gentamicin, among others. The aminoglycoside antibiotics target the 30S ribosome and promote miscoding, leading to the production of defective proteins which insert into the bacterial membrane, resulting in membrane damage and the ultimate demise of the bacterium. Phosphorylation of the aminoglycoside antibiotics results in their inactivation, leading to bacterial antibiotic resistance. The APH gene is found on transposons and plasmids and is thought to have originated as a self-defense mechanism used by microorganisms that produce the antibiotics. The APH subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K).	9.80962e-82
NC_018524.1|WP_014908725.1|4584309_4584888_+|TetR/AcrR-family-transcriptional-regulator	gnl|CDD|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	6.78149e-06
NC_018524.1|WP_187294482.1|4584967_4585552_+|GNAT-family-N-acetyltransferase	gnl|CDD|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	1.44368e-22
NC_018524.1|WP_014913545.1|4587887_4588562_+|ATPase-AAA	gnl|CDD|213205	cd03238, ABC_UvrA, ATP-binding cassette domain of the excision repair protein UvrA. Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion. Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins. Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins, and UvrB having one ATP binding site that is structurally related to that of helicases.	5.08446e-05
NC_018524.1|WP_014908768.1|4583229_4584099_-|alpha/beta-hydrolase	gnl|CDD|225375	COG2819, COG2819, Predicted hydrolase of the alpha/beta superfamily [General function prediction only].	9.4993e-18
NC_018524.1|WP_014909852.1|4586347_4586794_+|NUDIX-domain-containing-protein	gnl|CDD|240039	cd04683, Nudix_Hydrolase_24, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.	3.33865e-48
NC_018524.1|WP_148281710.1|4580675_4581173_+|AbrB-family-transcriptional-regulator	gnl|CDD|274421	TIGR03082, Gneg_AbrB_dup, membrane protein AbrB duplication. The model describes a hydrophobic sequence region that is duplicated to form the AbrB protein of Escherichia coli (not to be confused with a Bacillus subtilis protein with the same gene symbol). In some species, notably the Cyanobacteria and Thermus thermophilus, proteins consist of a single copy rather than two copies. The member from Pseudomonas putida, PP_1415, was suggested to be an ammonia monooxygenase characteristic of heterotrophic nitrifiers, based on an experimental indication of such activity in the organism and a glimmer of local sequence similarity between parts of P. putida protein and an instance of the AmoA protein from Nitrosomonas europaea (; we do not believe the sequence similarity to be meaningful. The member from E. coli (b0715, ybgN) appears to be the largely uncharacterized AbrB (aidB regulator) protein of E. coli cited in Volkert, et al. (PMID 8002588), although we did not manage to trace the origin of association of the article to the sequence.	1.76823e-12
NC_018524.1|WP_014910484.1|4574868_4576383_-|tripartite-tricarboxylate-transporter-permease	gnl|CDD|225870	COG3333, COG3333, Uncharacterized protein conserved in bacteria [Function unknown].	2.42704e-149
NC_018524.1|WP_041561955.1|4576913_4577936_-|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl|CDD|270234	cd07012, PBP2_Bug_TTT, Bug (Bordetella uptake gene) protein family of periplasmic solute-binding receptors; contains the type 2 periplasmic binding fold. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) proteins present in a number of bacterial species, but mainly in proteobacteria. In eubacteria, at least three families of periplasmic binding-protein dependent transporters are known: the ATP-binding cassette (ABC) transporters, the tripartite ATP-independent periplasmic transporters, and the tripartite tricarboxylate transporters (TTT). Bug proteins are the PBP components of the TTT. Their expansive expansion in proteobacteria indicates a large functional diversity. The best studied examples are Bordetella pertussis BugD, which is an aspartic acid transporter, and BugE, which is glutamate transporter.	2.88137e-66
NC_018524.1|WP_014908620.1|4581169_4581712_+|AbrB-family-transcriptional-regulator	gnl|CDD|377472	pfam05145, AbrB, Transition state regulatory protein AbrB. Bacillus subtilis respond to a multitude of environmental stimuli by using transcription factors called transition state regulators (TSRs). They play an essential role in cell survival by regulating spore formation, competence, and biofilm development. AbrB is one of the most known TSRs, acting as a pleotropic regulator for over 60 different genes where it directly binds to their promoter or regulatory regions. Many other genes are indirectly controlled by AbrB since it is a regulator of other regulatory proteins, including ScoC, Abh, SinR and SigH. Hence, AbrB is considered a global regulatory protein controlling processes such as Bacillus subtilis growth and cell division as well as production of extracellular degradative enzymes, nitrogen utilization and amino acid metabolism, motility, synthesis of antibiotics and their resistant determinants, development of competence, transport systems, oxidative stress response, phosphate metabolism, cell surface components and sporulation. AbrB is a tetramer consisting of identical 94 residue monomers. Its DNA-binding function resides solely in the N-terminal domain (AbrBN) of 53 residues. Although it does not recognize a well-defined DNA base-pairing sequence, instead, it appears to target a very weak pseudo consensus nucleotide sequence, TGGNA-5bp-TGGNA, which allows it to be rather promiscuous in binding. The N-terminal domains of very similar sequences are present in two more Bacillus subtilis proteins, Abh and SpoVT. Mutagenesis studies suggest that the role of the C-terminal domain is in forming multimers.	3.17704e-21
NC_018524.1|WP_014909557.1|4579049_4580522_-|FAD-dependent-tricarballylate-dehydrogenase-TcuA	gnl|CDD|236214	PRK08274, PRK08274, FAD-dependent tricarballylate dehydrogenase TcuA.	0
NC_018524.1|WP_014911968.1|4593535_4594234_-|YafY-family-transcriptional-regulator	gnl|CDD|225253	COG2378, COG2378, Predicted transcriptional regulator [Transcription].	6.50312e-46
NC_018524.1|WP_014909364.1|4576395_4576914_-|tripartite-tricarboxylate-transporter-TctB-family-protein	gnl|CDD|377815	pfam07331, TctB, Tripartite tricarboxylate transporter TctB family. This family consists of several hypothetical bacterial proteins of around 150 residues in length. This family was formerly known as DUF1468.	2.67891e-10
NC_018524.1|WP_014912182.1|4588609_4589104_-|PACE-efflux-transporter	gnl|CDD|226610	COG4125, COG4125, Predicted membrane protein [Function unknown].	2.73247e-46

Protein sequences

>NC_018524.1|WP_014908620.1|4581169_4581712_+|AbrB-family-transcriptional-regulator
MNPLPLLAVMAGALGAALVFRWVRVPLWPLTGGLVGAAAVNLGFGLAAEVPTAIALTGQLLIGTAIGATIGSEVFRQFLRIIGPGTLAVTVVLGAGLLFGWLFATAGLMDPAEAMLALIPGGVGEMVAAAIALDLDSAQVVGVQMVRILTVLLSLPLVFRVSEWIHRRWIAGPGGETSGA
>NC_018524.1|WP_148281710.1|4580675_4581173_+|AbrB-family-transcriptional-regulator
MDVLRLLAGAAVVGSLLELLGVPAGMLLGSAIGAALANQKWTPRLRPTAFPRPLRYVGLLLVGLVSGVLLTMESLGSTASVALPVIAAYLGLAMVNLLVIALLMARYDVDPATAVLAVTPGGLAEVTSLAIDKGARMGVVMTVHAVRLLTIVFVFLPIVLAVVGS
>NC_018524.1|WP_014909557.1|4579049_4580522_-|FAD-dependent-tricarballylate-dehydrogenase-TcuA
MSTNTTDVLVVGAGNAAMCAAHAARERGKRVLVLEAAPKDRAGGNSYFTAGATRITHDGLESLADLIEADERHGATEVPPYSKEEYAADLKRVTDGRNDPEMTSILISNIADDMRWLKSKGLRYRLMYERQAYRRPDGGYLFWGGLHVGNVDGGEGLVRDHYRAAEESGIEILFGARALRLVQADGVVTGVVYERDGEEHTVRAEATILGSGGFEASKEMRAEHMGPQWHHAVTRGTPFNTGTMLNEALRIGAAKGGDWTSCHATQWDAGFADNESNYEVTNRLTRQSYPLGIIVNRDGRRFLDEGADFRNLTYAKYGKEVLMQPGAVAWQIFDAPLRPMLRPQEYEVPGVGEHVADSLEELARDAGIDADGLLETVRSFNDSIRTSVEFDPNVKDGRSADTVPPKSNWANPIAEGPFYAYPVTCGITFTFGGLKGDSQARVLDQNGAVIPGLYACGEALGGLFSGNYPGGSGLAAGIVFGRIAGRSAAS
>NC_018524.1|WP_014912244.1|4578435_4579053_-|GntR-family-transcriptional-regulator
MTSGTQVESVYQQLRTRILDGSLEQGYDLNERAVADLVGTSRTPVREAVARLLVDGLAERQGRRTRVTVWDGEKTGQLYEMRRILESEACRFAAMRRSENEVVQLEASLAEQSRLEDPSAAVRRELNYRFHLIIWRASGNPFLIEANQKHGVQSMSISPTTLRTDQRWSDSLEEHTRMVDHIRAHRADEAAEAMRHHIESAYRQR
>NC_018524.1|WP_041561955.1|4576913_4577936_-|tripartite-tricarboxylate-transporter-substrate-binding-protein
MYSPTSRPADSRTGKRNRRALMASMAVAPLILAGCGADDGEYPSDSIEYIVPYNPGGGADPVGRQFVQMLETELDANGNVINVPGGDEAVGITQLANADADGYTLGLGTSGGFVAQPLVTGEAQYETPADFTPLAKMSGTPYGLFVSPDSEYETLDDLIEAAKQNPGDIQISTPARMGNPAFVIYFLEEQADIEVSLVTTAGGTGEAALEVMSGRLDAVVGNASGQLGLVESGDLRALAYSGPEDYSDFLPDAVRFDEAGYEIPFTSDYMTMAPAGLDEDVASALREASDAIVTSEEWEEWARGQGTLPHVATGEELDTYLEDIKAGIEHGIELGNNREN
>NC_018524.1|WP_014909364.1|4576395_4576914_-|tripartite-tricarboxylate-transporter-TctB-family-protein
MSENTGHASEISTQGLKNDPKRLGRILFGALFLAVFVGYYIAGMDLDKGTLAQPGPGMIPGWIGIAGAAISLLVIVESLLGRSESGRIDFPRGRDLKDVLIFTSMVIVYYAVLIPTLGQYIASALFAVAFIRVVGRASWVKSIIIGVVMGIVLTLFFAEALGIRLPSGMILP
>NC_018524.1|WP_014910484.1|4574868_4576383_-|tripartite-tricarboxylate-transporter-permease
MGTIEGFLYGLELAVSPELLLAAFVGALAGTLIGILPGLGPVAGAALLLPLTFAYEPAVGMIMIAGIYIGTQFAGSMTSILLNMPGDAQSVVATFDGHPMMKNGRGGAALTIMTLGSFISGLIGLGIVLLVLPAVTGVAMRFGPAEFFALTAGGLLVLARISGGSLGSGLLPMIIGVALATVGLDVNTSTNRFTFGQVDLTLGVALASVAVGLYGLSELMFMLTGDAKRPKPKRFRIRELIPTKEELGRSITPWGRGSLIGFGFGLIPGPAAALSTFGSYKVEQSVSKHRKKLGTGAVEGVAGPEAANSSATIGSIVPVLMLGIPFSATLALMISAMTVQGVQPGPLLATQRPDLFWSVIASILIANVMLLLLNLPLIGVWIKLIMTPMRYMVPFIVIIASIGAYSINSNFIDLHIVLIAGVFGYFLRLLDFSPASLLVGLVLGSMIERYFVQGMVTYRGDLWAMVGASGISITIWALVAIVLFAGFLKPIWTTVKRKKREHVS
>NC_018524.1|WP_014913341.1|4574282_4574504_-|hypothetical-protein
MWSSTDTDGKIREGLIFLLSQGIIDDFQVRAGDDFPFRIQVPAGVVPMNEKQVRHFMLGAVAAHFGPIARARR
>NC_018524.1|WP_014913356.1|4573541_4573703_-|hypothetical-protein
MVVVSSLVVGLCSALLGMAAYIAAREGAKGRSESFLIAIGMAVAALAAVATVI
>NC_018524.1|WP_041561954.1|4571196_4572084_-|hypothetical-protein
MLLPPIGEHTLVRPHGTDGFSAQDGIDELCRSIRLLLHDLEQEGRTPMTVLDIAVRMGLSRGVVILVVAELLRRNLVRVSRQISTPSDPRTEVRDAWSDLSHCDPELRSAKVLVMGDPELSRTFIGSCSEVGPISHGEVIYVRNVGIPSSSPDAYSPPVTTRVSMGRIPLKGMSLHLLGGVDVDVNVFSTLWSTLVRDACAALIVTHADDLEGAAVALGFLAKHRVPALLVLHHVHETPDLEAVRTHLGLAEERTVLCDVRSRPATRAALGDVIDQRTLTVYDAHPIYPETGETA
>NC_018524.1|WP_014908768.1|4583229_4584099_-|alpha/beta-hydrolase
MSEILHGCLPDTEYLEVTARSGRRYGVWVTTPPGYADSTDPLPLIYVLDGNWSVGLTAPLIVTQADPYLTIAPYIQVSVGYAGEEAASWSSLRNRDLVPPGEPIGEETMATLTAARETGRMTQEQVDAYLAELTETRADVFLDFLTDELHPHLRSRLRVGESGHGLFGYSYGGLFALYAWLREAAPFASFGAGSPGVAGSDSRIFTLIDALPEPGEGSVGSRLHITLNEAELLGDVPFYRGMSRNVLTAVERLHAKGWAEHVSKALLRETHVTGLQASFLGYLKTCHKR
>NC_018524.1|WP_014908725.1|4584309_4584888_+|TetR/AcrR-family-transcriptional-regulator
MRSPVGEGKKRLLEALFDEFGENGPGPNLSMRQVAERLGVHHTLLTYHFGSRPGLLRAVLLEARRRDNVVIAATGDELGFVALCRAIWDFYSDPAHEDRIHAFFHLVGLAVYERDAFQELVVDIDDLARLLEAAALRDGATETDARQRSIIATAGLRGLLLQRLLTPTAEVDAAAERFIASLAAFEGEGRAV
>NC_018524.1|WP_187294482.1|4584967_4585552_+|GNAT-family-N-acetyltransferase
MTPPGSRSAQRETAGAITYRVAESESDRSAVIRGEFTSDTVFEVVVSEDGFGIRPTRLDATIHKVFPDDEPQDDEPSENGHRFVALDGDEVCGYVDTEYEPWNQRLVIADIEVAGAYRGRGIGRALMDHAIDRARERGAGHVWLEVTNMNAPAIRAYQRMGFTFCGLDTSLYSGTESEGETALYMSLFLAPAGE
>NC_018524.1|WP_014913561.1|4585707_4586151_-|hypothetical-protein
MTRIGITGHSNLTADSVPLVRRALAEALAPYKKDDLVGVSCLARGADQIFAEVVLEADGRLEVVLPSVDYREAKVKPYNLEQFDDLLMRSTLVRYMPHKTAGRQAYEDANETVLGGIDRLVAVWDGQPSGGKGGTGDAVEGYGAHRE
>NC_018524.1|WP_014909852.1|4586347_4586794_+|NUDIX-domain-containing-protein
MPERYRSIIDVHVILPRGEKILLLERRNTGYCDGMLHLPSGHLDEGEPIPHGAAREAREEVGVDIDPADLGLVAVVHHRQREDLARVGMFFLAEKWSGEPVVAEPDKAGELVWADPRALPSNTIPYPAEGIRAWVSGDRFVLHGWSAA
>NC_018524.1|WP_014913545.1|4587887_4588562_+|ATPase-AAA
MVQGRARDVPMVNDAMARGAVYPRRSLVLVAGVPGAGKSTLLKRLFGLRGDEDRTVLTADGVRVIDSLQSRYRLRSMLARVPYLLWRWVVHVLHLARVVAALRGGPVVVHECGTRRSVRVLLALLCRLRRYELHVLMIDATPQEAWRGQNSRGRQVTERSHRTHSRRWRRLRAAALHGPAAFARGARSLLALDRRRARELAWIRFGPGADARGPLRTVMESPSP
>NC_018524.1|WP_014912182.1|4588609_4589104_-|PACE-efflux-transporter
MQGLKRKLVYVGGYEVIGFIVGTAVMTALTGSGPGTTAPLAIMIATVAALWNMAFNYLFEAWERRQVSRERTVKRRILHAVAFQLTLVCYLIPLIAWWLDMSLLQAFLLDLVFIVYIPFYTFGYNWAFDKIFGLPSSAIADPVPEVEDGAAVSVEEPATTAERS
>NC_018524.1|WP_014910693.1|4589205_4590099_+|LysR-family-transcriptional-regulator
MGLSSDNIDLFLAVVDHGSFSAAARALNRVPSAVSMGIANIEAELGYPLFDRSRREPVPTARAQALVPHARLVASRLRLLQAHAVELSDDLESTLTIGVSAGVDHRPLLDAVAEIAARHPLLSVELADAPQDDVREQLHSGAVDLALMFARTRNDREEVFLNVAEETFVAVASASVETFGIPADLRRLEDLAGARQIVVSTLERPLTERRLVVSDAYWRVNSAETALGLVERGIGWANLPLPLVRGRAAAGAVRVMEFENLENGLAMPVQLVWLRGSPLRKAAGELVDRMGRDWRRG
>NC_018524.1|WP_014909082.1|4590315_4591158_+|aminoglycoside-3'-phosphotransferase
MADAWEVIGRALGAVRQESIGLGLSGARVLRMVDAQGVPVAVVKVVDHRMGHLVSEFEAETARLAWLRRLGVPVPEVLGSGVDEGESWLAMRALPGRPASDPWPAGEQDRVVDLLAHAARELHAASWEDTPFDRSLSSVLVEVRERVASGLVDRSWVIAGKEGPPAAVVLEELESLAGELGDGIPVVSHGDFCLPNVLIDETGTAGLVDVGRAGLADPHSDLADMTRSLRSHMNPQYGEVSAHRFLDAYGRDGIDPERLRLHDLLESFFWPVPEAHTPGG
>NC_018524.1|WP_014911968.1|4593535_4594234_-|YafY-family-transcriptional-regulator
MKRAERLHAISETLRRSGTRGVSAEWLAREFEVSVRTVKRDLDALKNSGAPIWSRPGPGGGYGLTTGASLPPISLSPVQAVALMAAVSAAPGAPYADLAAAGVRKIMDVLDPGTRARADELAHRVWVDAPPSSSRATRSALEEAMTEQRVIRIRYASREGTATTRDVEPVLFASTNGRWYLIGWCRLRDAMRWFAVSRIEQATVTKTACSGRTVHEVGEPPANARPVHGRGE

Crispr_ID: NC_018524_22

• CRISPR_ID: NC_018524_22
• CRISPR_location: 4591312-4591396
• CRISPR_type: Orphan
• Repeat_type: I-E
• Spacer_info: 1 spacers
• Cas_protein_info: WYL,csa3

Consensus repeat of NC_018524_22

Consensus_repeat	Method
CTGCTCCCCGCGCACGCGGGGATGACCCC	CRISPRCasFinder

spacers of NC_018524_22

>22.1|4591341|26|NC_018524|CRISPRCasFinder
GCCACAAAAGGTCCTCCGAGTCTTGC

CRISPR arrays and Neighbor proteins around NC_018524_22

CRISPR arrays

The CRISPR arrays of NC_018524_22

>merge|NC_018524|22|4591312-4591396|CRISPRCasFinder
CTGAGCTTCGCGTACGTGGGGCTGACCCCGCCACAAAAGGTCCTCCGAGTCTTGCCTGCTTCCTGCGTGCGCGAGGGCGATCCCA

>NC_018524|22|21|4591312-4591396|CRISPRCasFinder
CTGAGCTTCGCGTACGTGGGGCTGACCCC	GCCACAAAAGGTCCTCCGAGTCTTGC
CTGCTTCCTGCGTGCGCGAGGGCGATCCCA

Neighbor Proteins Overview

Protein	Signature genes	Signature genes Name	Protein_function
NC_018524.1|WP_014908725.1|4584309_4584888_+|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl|CDD|224228
NC_018524.1|WP_014910539.1|4599808_4600363_+|NUDIX-hydrolase	unknown	unknown	gnl|CDD|239516
NC_018524.1|WP_014910693.1|4589205_4590099_+|LysR-family-transcriptional-regulator	unknown	unknown	gnl|CDD|223656
NC_018524.1|WP_041561956.1|4596314_4596698_+|helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl|CDD|223713
NC_018524.1|WP_014909082.1|4590315_4591158_+|aminoglycoside-3'-phosphotransferase	unknown	unknown	gnl|CDD|270699
NC_018524.1|WP_081536576.1|4600339_4601488_-|hypothetical-protein	unknown	unknown	gnl|CDD|276809
NC_018524.1|WP_187294482.1|4584967_4585552_+|GNAT-family-N-acetyltransferase	unknown	unknown	gnl|CDD|366181
NC_018524.1|WP_014908768.1|4583229_4584099_-|alpha/beta-hydrolase	unknown	unknown	gnl|CDD|225375
NC_018524.1|WP_014912250.1|4594307_4595048_+|alpha/beta-hydrolase	unknown	unknown	gnl|CDD|223669
NC_018524.1|WP_014909852.1|4586347_4586794_+|NUDIX-domain-containing-protein	unknown	unknown	gnl|CDD|240039
NC_018524.1|WP_014908230.1|4603305_4603512_+|FxLD-family-lanthipeptide	unknown	unknown	gnl|CDD|275157
NC_018524.1|WP_051018317.1|4602071_4603295_+|methyltransferase,-FxLD-system	unknown	unknown	gnl|CDD|275158
NC_018524.1|WP_014913561.1|4585707_4586151_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014908620.1|4581169_4581712_+|AbrB-family-transcriptional-regulator	unknown	unknown	gnl|CDD|377472
NC_018524.1|WP_014911461.1|4595774_4596224_-|VOC-family-protein	unknown	unknown	gnl|CDD|319917
NC_018524.1|WP_014913538.1|4596694_4597813_+|ACR3-family-arsenite-efflux-transporter	unknown	unknown	gnl|CDD|213563
NC_018524.1|WP_014911968.1|4593535_4594234_-|YafY-family-transcriptional-regulator	WYL	COG2378_WYL_CAS-I:CAS-III	gnl|CDD|225253
NC_018524.1|WP_014913545.1|4587887_4588562_+|ATPase-AAA	unknown	unknown	gnl|CDD|213205
NC_018524.1|WP_014911262.1|4597805_4598222_+|arsenate-reductase-ArsC	unknown	unknown	gnl|CDD|319973
NC_018524.1|WP_014912182.1|4588609_4589104_-|PACE-efflux-transporter	unknown	unknown	gnl|CDD|226610

HMMScan for Signature genes

Protein	Cas_name	Cas_description	E-value	Identity	Coverage
NC_018524.1|WP_014911968.1|4593535_4594234_-|YafY-family-transcriptional-regulator	WYL	COG2378_WYL_CAS-I:CAS-III	8.5e-51	168.0	0.0
NC_018524.1|WP_041561956.1|4596314_4596698_+|helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	4.5e-23	76.6	0.1

rpsblast for functional proteins

Protein	Function_ID	Function_description	E-value
NC_018524.1|WP_014908725.1|4584309_4584888_+|TetR/AcrR-family-transcriptional-regulator	gnl|CDD|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	6.78149e-06
NC_018524.1|WP_014910539.1|4599808_4600363_+|NUDIX-hydrolase	gnl|CDD|239516	cd03424, ADPRase_NUDT5, ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate. Like other members of the Nudix hydrolase superfamily, it requires a divalent cation, such as Mg2+, for its activity. It also contains a highly conserved 23-residue Nudix motif (GX5EX7REUXEEXGU, where U = I, L or V) which functions as a metal binding site/catalytic site. In addition to the Nudix motif, there are additional conserved amino acid residues, distal from the signature sequence, that correlate with substrate specificity. In humans, there are four distinct ADPRase activities, three putative cytosolic enzymes (ADPRase-I, -II, and -Mn) and a single mitochondrial enzyme (ADPRase-m). Human ADPRase-II is also referred to as NUDT5. It lacks the N-terminal target sequence unique to mitochondrial ADPRase. The different cytosolic types are distinguished by their specificities for substrate and specific requirement for metal ions. NUDT5 forms a homodimer.	4.39346e-27
NC_018524.1|WP_014910693.1|4589205_4590099_+|LysR-family-transcriptional-regulator	gnl|CDD|223656	COG0583, LysR, Transcriptional regulator [Transcription].	9.06008e-33
NC_018524.1|WP_041561956.1|4596314_4596698_+|helix-turn-helix-transcriptional-regulator	gnl|CDD|223713	COG0640, ArsR, Predicted transcriptional regulators [Transcription].	4.27648e-20
NC_018524.1|WP_014909082.1|4590315_4591158_+|aminoglycoside-3'-phosphotransferase	gnl|CDD|270699	cd05150, APH, Aminoglycoside 3'-phosphotransferase. APH catalyzes the transfer of the gamma-phosphoryl group from ATP to aminoglycoside antibiotics such as kanamycin, streptomycin, neomycin, and gentamicin, among others. The aminoglycoside antibiotics target the 30S ribosome and promote miscoding, leading to the production of defective proteins which insert into the bacterial membrane, resulting in membrane damage and the ultimate demise of the bacterium. Phosphorylation of the aminoglycoside antibiotics results in their inactivation, leading to bacterial antibiotic resistance. The APH gene is found on transposons and plasmids and is thought to have originated as a self-defense mechanism used by microorganisms that produce the antibiotics. The APH subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K).	9.80962e-82
NC_018524.1|WP_081536576.1|4600339_4601488_-|hypothetical-protein	gnl|CDD|276809	sd00006, TPR, Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.	0.00137544
NC_018524.1|WP_187294482.1|4584967_4585552_+|GNAT-family-N-acetyltransferase	gnl|CDD|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	1.44368e-22
NC_018524.1|WP_014908768.1|4583229_4584099_-|alpha/beta-hydrolase	gnl|CDD|225375	COG2819, COG2819, Predicted hydrolase of the alpha/beta superfamily [General function prediction only].	9.4993e-18
NC_018524.1|WP_014912250.1|4594307_4595048_+|alpha/beta-hydrolase	gnl|CDD|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	5.06176e-07
NC_018524.1|WP_014909852.1|4586347_4586794_+|NUDIX-domain-containing-protein	gnl|CDD|240039	cd04683, Nudix_Hydrolase_24, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.	3.33865e-48
NC_018524.1|WP_014908230.1|4603305_4603512_+|FxLD-family-lanthipeptide	gnl|CDD|275157	TIGR04363, hypothetical_protein, FxLD family lantipeptide. Members of this protein family occur with a cassette of lanthionine-type peptide modification enzymes. Members are small (about 60 amino acids long), rich in Cys, and variable in copy number per genome (from one to three). These features suggest that members of this family are modified to become lantipeptides, although not necessarily a lantibiotic. There is no GlyGly cleavage motif to separate a leader peptide from core region.The considerable abundance in Streptomyces and relatively strong consideration hints at a non-antibiotic function. The motif FxLD in the N-terminal region is nearly invariant.	0.00561373
NC_018524.1|WP_051018317.1|4602071_4603295_+|methyltransferase,-FxLD-system	gnl|CDD|275158	TIGR04364, methyltran_FxLD, methyltransferase, FxLD system. Members of this family resemble occur regularly in the vicinity of lantibiotic biosynthesis enzymes and their probable target, the FxLD family of putative ribosomal natural product precursor (TIGR04363). Members resemble protein-L-isoaspartate O-methyltransferase (TIGR00080) and a predicted methyltranserase, TIGR04188, of another putative peptide modification system.	3.02023e-139
NC_018524.1|WP_014908620.1|4581169_4581712_+|AbrB-family-transcriptional-regulator	gnl|CDD|377472	pfam05145, AbrB, Transition state regulatory protein AbrB. Bacillus subtilis respond to a multitude of environmental stimuli by using transcription factors called transition state regulators (TSRs). They play an essential role in cell survival by regulating spore formation, competence, and biofilm development. AbrB is one of the most known TSRs, acting as a pleotropic regulator for over 60 different genes where it directly binds to their promoter or regulatory regions. Many other genes are indirectly controlled by AbrB since it is a regulator of other regulatory proteins, including ScoC, Abh, SinR and SigH. Hence, AbrB is considered a global regulatory protein controlling processes such as Bacillus subtilis growth and cell division as well as production of extracellular degradative enzymes, nitrogen utilization and amino acid metabolism, motility, synthesis of antibiotics and their resistant determinants, development of competence, transport systems, oxidative stress response, phosphate metabolism, cell surface components and sporulation. AbrB is a tetramer consisting of identical 94 residue monomers. Its DNA-binding function resides solely in the N-terminal domain (AbrBN) of 53 residues. Although it does not recognize a well-defined DNA base-pairing sequence, instead, it appears to target a very weak pseudo consensus nucleotide sequence, TGGNA-5bp-TGGNA, which allows it to be rather promiscuous in binding. The N-terminal domains of very similar sequences are present in two more Bacillus subtilis proteins, Abh and SpoVT. Mutagenesis studies suggest that the role of the C-terminal domain is in forming multimers.	3.17704e-21
NC_018524.1|WP_014911461.1|4595774_4596224_-|VOC-family-protein	gnl|CDD|319917	cd07254, VOC_like, uncharacterized subfamily of vicinal oxygen chelate (VOC) family. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	6.65854e-46
NC_018524.1|WP_014913538.1|4596694_4597813_+|ACR3-family-arsenite-efflux-transporter	gnl|CDD|213563	TIGR00832, Uncharacterized_transporter_slr0944, arsenical-resistance protein. The Arsenical Resistance-3 (ACR3) Family (TC 2.A.59) The first protein of the ACR3 family functionally characterized was the ACR3 protein of Saccharomyces cerevisiae. It is present in the yeast plasma membrane and pumps arsenite out of the cell in response to the pmf. Similar proteins are found in bacteria, often as part of a four gene operon with an regulatory protein ArsR, a protein of unknown function ArsH, and an arsenate reductase that converts arsenate to arsenite to facilitate transport. [Cellular processes, Detoxification, Transport and binding proteins, Anions].	1.05948e-142
NC_018524.1|WP_014911968.1|4593535_4594234_-|YafY-family-transcriptional-regulator	gnl|CDD|225253	COG2378, COG2378, Predicted transcriptional regulator [Transcription].	6.50312e-46
NC_018524.1|WP_014913545.1|4587887_4588562_+|ATPase-AAA	gnl|CDD|213205	cd03238, ABC_UvrA, ATP-binding cassette domain of the excision repair protein UvrA. Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion. Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins. Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins, and UvrB having one ATP binding site that is structurally related to that of helicases.	5.08446e-05
NC_018524.1|WP_014911262.1|4597805_4598222_+|arsenate-reductase-ArsC	gnl|CDD|319973	cd16345, LMWP_ArsC, Arsenate reductase of the LMWP family. Arsenate reductase plays an important role in the reduction of intracellular arsenate to arsenite, an important step in arsenic detoxification. The reduction involves three different thiolate nucleophiles. In arsenate reductases of the LMWP family, reduction can be coupled with thioredoxin (Trx)/thioredoxin reductase (TrxR) or glutathione (GSH)/glutaredoxin (Grx).	3.31843e-50
NC_018524.1|WP_014912182.1|4588609_4589104_-|PACE-efflux-transporter	gnl|CDD|226610	COG4125, COG4125, Predicted membrane protein [Function unknown].	2.73247e-46

Protein sequences

>NC_018524.1|WP_014909082.1|4590315_4591158_+|aminoglycoside-3'-phosphotransferase
MADAWEVIGRALGAVRQESIGLGLSGARVLRMVDAQGVPVAVVKVVDHRMGHLVSEFEAETARLAWLRRLGVPVPEVLGSGVDEGESWLAMRALPGRPASDPWPAGEQDRVVDLLAHAARELHAASWEDTPFDRSLSSVLVEVRERVASGLVDRSWVIAGKEGPPAAVVLEELESLAGELGDGIPVVSHGDFCLPNVLIDETGTAGLVDVGRAGLADPHSDLADMTRSLRSHMNPQYGEVSAHRFLDAYGRDGIDPERLRLHDLLESFFWPVPEAHTPGG
>NC_018524.1|WP_014910693.1|4589205_4590099_+|LysR-family-transcriptional-regulator
MGLSSDNIDLFLAVVDHGSFSAAARALNRVPSAVSMGIANIEAELGYPLFDRSRREPVPTARAQALVPHARLVASRLRLLQAHAVELSDDLESTLTIGVSAGVDHRPLLDAVAEIAARHPLLSVELADAPQDDVREQLHSGAVDLALMFARTRNDREEVFLNVAEETFVAVASASVETFGIPADLRRLEDLAGARQIVVSTLERPLTERRLVVSDAYWRVNSAETALGLVERGIGWANLPLPLVRGRAAAGAVRVMEFENLENGLAMPVQLVWLRGSPLRKAAGELVDRMGRDWRRG
>NC_018524.1|WP_014912182.1|4588609_4589104_-|PACE-efflux-transporter
MQGLKRKLVYVGGYEVIGFIVGTAVMTALTGSGPGTTAPLAIMIATVAALWNMAFNYLFEAWERRQVSRERTVKRRILHAVAFQLTLVCYLIPLIAWWLDMSLLQAFLLDLVFIVYIPFYTFGYNWAFDKIFGLPSSAIADPVPEVEDGAAVSVEEPATTAERS
>NC_018524.1|WP_014913545.1|4587887_4588562_+|ATPase-AAA
MVQGRARDVPMVNDAMARGAVYPRRSLVLVAGVPGAGKSTLLKRLFGLRGDEDRTVLTADGVRVIDSLQSRYRLRSMLARVPYLLWRWVVHVLHLARVVAALRGGPVVVHECGTRRSVRVLLALLCRLRRYELHVLMIDATPQEAWRGQNSRGRQVTERSHRTHSRRWRRLRAAALHGPAAFARGARSLLALDRRRARELAWIRFGPGADARGPLRTVMESPSP
>NC_018524.1|WP_014909852.1|4586347_4586794_+|NUDIX-domain-containing-protein
MPERYRSIIDVHVILPRGEKILLLERRNTGYCDGMLHLPSGHLDEGEPIPHGAAREAREEVGVDIDPADLGLVAVVHHRQREDLARVGMFFLAEKWSGEPVVAEPDKAGELVWADPRALPSNTIPYPAEGIRAWVSGDRFVLHGWSAA
>NC_018524.1|WP_014913561.1|4585707_4586151_-|hypothetical-protein
MTRIGITGHSNLTADSVPLVRRALAEALAPYKKDDLVGVSCLARGADQIFAEVVLEADGRLEVVLPSVDYREAKVKPYNLEQFDDLLMRSTLVRYMPHKTAGRQAYEDANETVLGGIDRLVAVWDGQPSGGKGGTGDAVEGYGAHRE
>NC_018524.1|WP_187294482.1|4584967_4585552_+|GNAT-family-N-acetyltransferase
MTPPGSRSAQRETAGAITYRVAESESDRSAVIRGEFTSDTVFEVVVSEDGFGIRPTRLDATIHKVFPDDEPQDDEPSENGHRFVALDGDEVCGYVDTEYEPWNQRLVIADIEVAGAYRGRGIGRALMDHAIDRARERGAGHVWLEVTNMNAPAIRAYQRMGFTFCGLDTSLYSGTESEGETALYMSLFLAPAGE
>NC_018524.1|WP_014908725.1|4584309_4584888_+|TetR/AcrR-family-transcriptional-regulator
MRSPVGEGKKRLLEALFDEFGENGPGPNLSMRQVAERLGVHHTLLTYHFGSRPGLLRAVLLEARRRDNVVIAATGDELGFVALCRAIWDFYSDPAHEDRIHAFFHLVGLAVYERDAFQELVVDIDDLARLLEAAALRDGATETDARQRSIIATAGLRGLLLQRLLTPTAEVDAAAERFIASLAAFEGEGRAV
>NC_018524.1|WP_014908768.1|4583229_4584099_-|alpha/beta-hydrolase
MSEILHGCLPDTEYLEVTARSGRRYGVWVTTPPGYADSTDPLPLIYVLDGNWSVGLTAPLIVTQADPYLTIAPYIQVSVGYAGEEAASWSSLRNRDLVPPGEPIGEETMATLTAARETGRMTQEQVDAYLAELTETRADVFLDFLTDELHPHLRSRLRVGESGHGLFGYSYGGLFALYAWLREAAPFASFGAGSPGVAGSDSRIFTLIDALPEPGEGSVGSRLHITLNEAELLGDVPFYRGMSRNVLTAVERLHAKGWAEHVSKALLRETHVTGLQASFLGYLKTCHKR
>NC_018524.1|WP_014908620.1|4581169_4581712_+|AbrB-family-transcriptional-regulator
MNPLPLLAVMAGALGAALVFRWVRVPLWPLTGGLVGAAAVNLGFGLAAEVPTAIALTGQLLIGTAIGATIGSEVFRQFLRIIGPGTLAVTVVLGAGLLFGWLFATAGLMDPAEAMLALIPGGVGEMVAAAIALDLDSAQVVGVQMVRILTVLLSLPLVFRVSEWIHRRWIAGPGGETSGA
>NC_018524.1|WP_014911968.1|4593535_4594234_-|YafY-family-transcriptional-regulator
MKRAERLHAISETLRRSGTRGVSAEWLAREFEVSVRTVKRDLDALKNSGAPIWSRPGPGGGYGLTTGASLPPISLSPVQAVALMAAVSAAPGAPYADLAAAGVRKIMDVLDPGTRARADELAHRVWVDAPPSSSRATRSALEEAMTEQRVIRIRYASREGTATTRDVEPVLFASTNGRWYLIGWCRLRDAMRWFAVSRIEQATVTKTACSGRTVHEVGEPPANARPVHGRGE
>NC_018524.1|WP_014912250.1|4594307_4595048_+|alpha/beta-hydrolase
MATTTNSPTIVLIAGHWLGAWAWDEVLEHLETDHVRAVAVTLPGLDGDDPARSTRTLDDQVEAIEGLLARLDVSEERPATLVAHSGANGPVSLLLDRRPELVRRVVWVDSGPMANGSAFAPDFPEEVEELPLPPFDVLAEQASLDGLSTEVLERFRSRAVPEPGPVLRQTVELTNDARRTVPTTLVCCSISSEQVLEMAQGGHPMFAEVANLETLDIIDLPTGHWPMWSRPGDLAEVIRSAASRAG
>NC_018524.1|WP_014911461.1|4595774_4596224_-|VOC-family-protein
MSRVQLALNVADLEASVVFYSTLFGVEPAKRRPGYANFAISEPPLKLVLIEGEPDQETRLDHLGVEVEATEQVNAATQRFKDSGLATFEENDTSCCYAVQDKVWVHGPGKEPWEVYVVKSDSDQRGAAPREVNTGVAGEASGCCATAQV
>NC_018524.1|WP_041561956.1|4596314_4596698_+|helix-turn-helix-transcriptional-regulator
MSNQEVGATDLQGAVADCCPRLLKEPLEDGESVELARVFKALGDPVRLRLLSMIATCDGDEVCVCDLTPAFDLSQPTISHHLKLLREAGLISSVRRGTWVYYRLIPETTDRLAAILTRSMKSEEAGS
>NC_018524.1|WP_014913538.1|4596694_4597813_+|ACR3-family-arsenite-efflux-transporter
MSAPASTDPNAGVVGRLSALDRFLTVWILAAMVAGLALGRLVPGLGEALSGVGVAGVSLPIAVGLLVMMFPPLAKVRYDRLGAVTGDRRMLITSLAVNWLAGPALMFALAWAFLPDLPEYRTGLIIVGLARCIAMVIVWNDLACGDREAAAVLVALNSLFQVVAFGALGWFYLSALPGWLGLGQAALEVSFVDISVSVVIFLGVPLLAGYLTRRLGERARGREWYETRLLPKLGPWGLYGLLFTIVMLFALQGEAITSRPWDVARIALPLLLYFVIMWAGTLALGRALGMGYPRSVTLAFTAAGNNFELAIAVAIASFGAASGQALAGVVGPLIEVPVLIALVYVALAARRWFPGEGAAEVSTATTKETTGD
>NC_018524.1|WP_014911262.1|4597805_4598222_+|arsenate-reductase-ArsC
MTDRSEAVIPRVLFVCVHNAGRSQMAAAFLEHLGGDRVEVRSAGSAPADEVNPAVVEAMGEVGIDITAGTPKLLTPDAVRASDVVVTMGCGDACPFFPGKRYLDWELPDPAGRGVEAVRPILDRIKRHVEDLLRELVP
>NC_018524.1|WP_014910539.1|4599808_4600363_+|NUDIX-hydrolase
MGHTESSEDDNGRWIVHGERAIYDSRWVRLGKADITTPSGSRFEHHTVTLPSAAVIAIVDRAGEHVLMSYRHRFVPDAWGWELPGGLLDPEETPEQTAVREALEETGHRVGSVEHVATFEPMIGTVRSPHHVFVGRDADLVADPTEFDEGVYEWVPLAEIRGLISTGHVQSSGTLIALLHILAS
>NC_018524.1|WP_081536576.1|4600339_4601488_-|hypothetical-protein
MRQAWETRDAATVVRLVLWNSELSQTKLSQILGISQSTISEAVSGKSQIARQSSRNAIFEGLDILRPPLPPKVATALTATPQATEPSGEAQERLEIASIDQALIGLFEARTQNLRLIDRKLGAHYLLAQSQAHVQQMHDLLRRSLPGPVRRGLARALAEAASLTGWQALDSGRSATAWRYYEIAKAAARESEDKAVLAHVSAEQSYVLLDNGYERGALATLRAARDDAGASLPSLLSSWMWAAEGEVCATLGEEPEAKRALERAFALLPPEPQDPSLPFLMLDRTHLLRWRGHCLARLGDSEAIEDLTRALDCIVPLELGRAEAGLRTDLALAYTVHGDTTQAHRQAARAAELSDQSGSVRQRSRLARLLPQRTTSRSEDVE
>NC_018524.1|WP_051018317.1|4602071_4603295_+|methyltransferase,-FxLD-system
MVDALVEERADLGMEKLPEQVEEALRAVPREVFVPGLPLVEAYDRHQAIVTKHDEAKRVALSSVSAPSIIALMLQRADIRPGHRVLEIGSGGYNAALISHLVGETGQVTSIDIDPDVIARAERCLKEAGVDQVHLAVTDGEHGFASRAPYDRIIVTAGAWDLSPSWEEQLAVGGRVVVPMRVRGLTRCLTLERAEEPGHWRSLAADMCGFVRMQGVGEHWERMPLLHQEEGSQVGLRLEDGPQVDVDALRRALTQDGETVWAGVCVRADEPTDALDLYLASAADGWALLTAQRGAITSKLIRPVVLMGTPAMVDEEGESFSYRALRRSPDDEELYEFGAVEHGPAGRRVAQNMVDLIGVWDREHRGGPGPRIDLVPIDTAAEDLPTGRVVSKRHTHMILNWTANPFE
>NC_018524.1|WP_014908230.1|4603305_4603512_+|FxLD-family-lanthipeptide
MSALTATPTPAGLIATGRDRALSLDGDLFDLDLRVQVPVTDESLWSMTNDGCGQTCETACTQSCTDNG

Crispr_ID: NC_018524_24

• CRISPR_ID: NC_018524_24
• CRISPR_location: 4593160-4593371
• CRISPR_type: Orphan
• Repeat_type: I-E
• Spacer_info: 3 spacers
• Cas_protein_info: WYL,csa3

Consensus repeat of NC_018524_24

Consensus_repeat	Method
CTGCTCCCCGCGCACGCGGGGATGACCCC	CRISPRCasFinder
CTGCTCCCCGCGCACGCGGGGATGACCCC	CRT

spacers of NC_018524_24

>24.1|4593189|32|NC_018524|CRISPRCasFinder,CRT
GCTATGGCCGCCATTCTCGCGGCCGCTGGGAT
>24.2|4593250|32|NC_018524|CRISPRCasFinder,CRT
GCGGGGGGCTTGAACGAAGGCCTTGCGCAGAG
>24.3|4593311|32|NC_018524|CRISPRCasFinder,CRT
ACGAGGACGCCGGCCGAGGTCTTGCAACACAA

CRISPR arrays and Neighbor proteins around NC_018524_24

CRISPR arrays

The CRISPR arrays of NC_018524_24

>merge|NC_018524|24|4593160-4593371|CRISPRCasFinder,CRT
CTGCTCCCCGCGCACGCGGGGATGACCCCGCTATGGCCGCCATTCTCGCGGCCGCTGGGATCTGCTCCCCGCGCACGCGGGGATGACCCCGCGGGGGGCTTGAACGAAGGCCTTGCGCAGAGCTGCTCCCCGCGCACGCGGGGATGACCCGACGAGGACGCCGGCCGAGGTCTTGCAACACAACTGCTCCCCGCGCCTGCGGGGATCCCCCC

>NC_018524|24|23|4593160-4593371|CRISPRCasFinder
CTGCTCCCCGCGCACGCGGGGATGACCCC	GCTATGGCCGCCATTCTCGCGGCCGCTGGGAT
CTGCTCCCCGCGCACGCGGGGATGACCCC	GCGGGGGGCTTGAACGAAGGCCTTGCGCAGAG
CTGCTCCCCGCGCACGCGGGGATGACCCG	ACGAGGACGCCGGCCGAGGTCTTGCAACACAA
CTGCTCCCCGCGCCTGCGGGGATCCCCCC

>NC_018524|24|14|4593160-4593371|CRT
CTGCTCCCCGCGCACGCGGGGATGACCCC	GCTATGGCCGCCATTCTCGCGGCCGCTGGGAT
CTGCTCCCCGCGCACGCGGGGATGACCCC	GCGGGGGGCTTGAACGAAGGCCTTGCGCAGAG
CTGCTCCCCGCGCACGCGGGGATGACCCG	ACGAGGACGCCGGCCGAGGTCTTGCAACACAA
CTGCTCCCCGCGCCTGCGGGGATCCCCCC

Neighbor Proteins Overview

Protein	Signature genes	Signature genes Name	Protein_function
NC_018524.1|WP_014908725.1|4584309_4584888_+|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl|CDD|224228
NC_018524.1|WP_014910539.1|4599808_4600363_+|NUDIX-hydrolase	unknown	unknown	gnl|CDD|239516
NC_018524.1|WP_014910693.1|4589205_4590099_+|LysR-family-transcriptional-regulator	unknown	unknown	gnl|CDD|223656
NC_018524.1|WP_041561956.1|4596314_4596698_+|helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl|CDD|223713
NC_018524.1|WP_014909082.1|4590315_4591158_+|aminoglycoside-3'-phosphotransferase	unknown	unknown	gnl|CDD|270699
NC_018524.1|WP_081536576.1|4600339_4601488_-|hypothetical-protein	unknown	unknown	gnl|CDD|276809
NC_018524.1|WP_187294482.1|4584967_4585552_+|GNAT-family-N-acetyltransferase	unknown	unknown	gnl|CDD|366181
NC_018524.1|WP_014908768.1|4583229_4584099_-|alpha/beta-hydrolase	unknown	unknown	gnl|CDD|225375
NC_018524.1|WP_014912250.1|4594307_4595048_+|alpha/beta-hydrolase	unknown	unknown	gnl|CDD|223669
NC_018524.1|WP_014909852.1|4586347_4586794_+|NUDIX-domain-containing-protein	unknown	unknown	gnl|CDD|240039
NC_018524.1|WP_014908230.1|4603305_4603512_+|FxLD-family-lanthipeptide	unknown	unknown	gnl|CDD|275157
NC_018524.1|WP_051018317.1|4602071_4603295_+|methyltransferase,-FxLD-system	unknown	unknown	gnl|CDD|275158
NC_018524.1|WP_014913561.1|4585707_4586151_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014908620.1|4581169_4581712_+|AbrB-family-transcriptional-regulator	unknown	unknown	gnl|CDD|377472
NC_018524.1|WP_014911461.1|4595774_4596224_-|VOC-family-protein	unknown	unknown	gnl|CDD|319917
NC_018524.1|WP_014913538.1|4596694_4597813_+|ACR3-family-arsenite-efflux-transporter	unknown	unknown	gnl|CDD|213563
NC_018524.1|WP_014911968.1|4593535_4594234_-|YafY-family-transcriptional-regulator	WYL	COG2378_WYL_CAS-I:CAS-III	gnl|CDD|225253
NC_018524.1|WP_014913545.1|4587887_4588562_+|ATPase-AAA	unknown	unknown	gnl|CDD|213205
NC_018524.1|WP_014911262.1|4597805_4598222_+|arsenate-reductase-ArsC	unknown	unknown	gnl|CDD|319973
NC_018524.1|WP_014912182.1|4588609_4589104_-|PACE-efflux-transporter	unknown	unknown	gnl|CDD|226610

HMMScan for Signature genes

Protein	Cas_name	Cas_description	E-value	Identity	Coverage
NC_018524.1|WP_014911968.1|4593535_4594234_-|YafY-family-transcriptional-regulator	WYL	COG2378_WYL_CAS-I:CAS-III	8.5e-51	168.0	0.0
NC_018524.1|WP_041561956.1|4596314_4596698_+|helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	4.5e-23	76.6	0.1

rpsblast for functional proteins

Protein	Function_ID	Function_description	E-value
NC_018524.1|WP_014908725.1|4584309_4584888_+|TetR/AcrR-family-transcriptional-regulator	gnl|CDD|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	6.78149e-06
NC_018524.1|WP_014910539.1|4599808_4600363_+|NUDIX-hydrolase	gnl|CDD|239516	cd03424, ADPRase_NUDT5, ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate. Like other members of the Nudix hydrolase superfamily, it requires a divalent cation, such as Mg2+, for its activity. It also contains a highly conserved 23-residue Nudix motif (GX5EX7REUXEEXGU, where U = I, L or V) which functions as a metal binding site/catalytic site. In addition to the Nudix motif, there are additional conserved amino acid residues, distal from the signature sequence, that correlate with substrate specificity. In humans, there are four distinct ADPRase activities, three putative cytosolic enzymes (ADPRase-I, -II, and -Mn) and a single mitochondrial enzyme (ADPRase-m). Human ADPRase-II is also referred to as NUDT5. It lacks the N-terminal target sequence unique to mitochondrial ADPRase. The different cytosolic types are distinguished by their specificities for substrate and specific requirement for metal ions. NUDT5 forms a homodimer.	4.39346e-27
NC_018524.1|WP_014910693.1|4589205_4590099_+|LysR-family-transcriptional-regulator	gnl|CDD|223656	COG0583, LysR, Transcriptional regulator [Transcription].	9.06008e-33
NC_018524.1|WP_041561956.1|4596314_4596698_+|helix-turn-helix-transcriptional-regulator	gnl|CDD|223713	COG0640, ArsR, Predicted transcriptional regulators [Transcription].	4.27648e-20
NC_018524.1|WP_014909082.1|4590315_4591158_+|aminoglycoside-3'-phosphotransferase	gnl|CDD|270699	cd05150, APH, Aminoglycoside 3'-phosphotransferase. APH catalyzes the transfer of the gamma-phosphoryl group from ATP to aminoglycoside antibiotics such as kanamycin, streptomycin, neomycin, and gentamicin, among others. The aminoglycoside antibiotics target the 30S ribosome and promote miscoding, leading to the production of defective proteins which insert into the bacterial membrane, resulting in membrane damage and the ultimate demise of the bacterium. Phosphorylation of the aminoglycoside antibiotics results in their inactivation, leading to bacterial antibiotic resistance. The APH gene is found on transposons and plasmids and is thought to have originated as a self-defense mechanism used by microorganisms that produce the antibiotics. The APH subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K).	9.80962e-82
NC_018524.1|WP_081536576.1|4600339_4601488_-|hypothetical-protein	gnl|CDD|276809	sd00006, TPR, Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.	0.00137544
NC_018524.1|WP_187294482.1|4584967_4585552_+|GNAT-family-N-acetyltransferase	gnl|CDD|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	1.44368e-22
NC_018524.1|WP_014908768.1|4583229_4584099_-|alpha/beta-hydrolase	gnl|CDD|225375	COG2819, COG2819, Predicted hydrolase of the alpha/beta superfamily [General function prediction only].	9.4993e-18
NC_018524.1|WP_014912250.1|4594307_4595048_+|alpha/beta-hydrolase	gnl|CDD|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	5.06176e-07
NC_018524.1|WP_014909852.1|4586347_4586794_+|NUDIX-domain-containing-protein	gnl|CDD|240039	cd04683, Nudix_Hydrolase_24, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.	3.33865e-48
NC_018524.1|WP_014908230.1|4603305_4603512_+|FxLD-family-lanthipeptide	gnl|CDD|275157	TIGR04363, hypothetical_protein, FxLD family lantipeptide. Members of this protein family occur with a cassette of lanthionine-type peptide modification enzymes. Members are small (about 60 amino acids long), rich in Cys, and variable in copy number per genome (from one to three). These features suggest that members of this family are modified to become lantipeptides, although not necessarily a lantibiotic. There is no GlyGly cleavage motif to separate a leader peptide from core region.The considerable abundance in Streptomyces and relatively strong consideration hints at a non-antibiotic function. The motif FxLD in the N-terminal region is nearly invariant.	0.00561373
NC_018524.1|WP_051018317.1|4602071_4603295_+|methyltransferase,-FxLD-system	gnl|CDD|275158	TIGR04364, methyltran_FxLD, methyltransferase, FxLD system. Members of this family resemble occur regularly in the vicinity of lantibiotic biosynthesis enzymes and their probable target, the FxLD family of putative ribosomal natural product precursor (TIGR04363). Members resemble protein-L-isoaspartate O-methyltransferase (TIGR00080) and a predicted methyltranserase, TIGR04188, of another putative peptide modification system.	3.02023e-139
NC_018524.1|WP_014908620.1|4581169_4581712_+|AbrB-family-transcriptional-regulator	gnl|CDD|377472	pfam05145, AbrB, Transition state regulatory protein AbrB. Bacillus subtilis respond to a multitude of environmental stimuli by using transcription factors called transition state regulators (TSRs). They play an essential role in cell survival by regulating spore formation, competence, and biofilm development. AbrB is one of the most known TSRs, acting as a pleotropic regulator for over 60 different genes where it directly binds to their promoter or regulatory regions. Many other genes are indirectly controlled by AbrB since it is a regulator of other regulatory proteins, including ScoC, Abh, SinR and SigH. Hence, AbrB is considered a global regulatory protein controlling processes such as Bacillus subtilis growth and cell division as well as production of extracellular degradative enzymes, nitrogen utilization and amino acid metabolism, motility, synthesis of antibiotics and their resistant determinants, development of competence, transport systems, oxidative stress response, phosphate metabolism, cell surface components and sporulation. AbrB is a tetramer consisting of identical 94 residue monomers. Its DNA-binding function resides solely in the N-terminal domain (AbrBN) of 53 residues. Although it does not recognize a well-defined DNA base-pairing sequence, instead, it appears to target a very weak pseudo consensus nucleotide sequence, TGGNA-5bp-TGGNA, which allows it to be rather promiscuous in binding. The N-terminal domains of very similar sequences are present in two more Bacillus subtilis proteins, Abh and SpoVT. Mutagenesis studies suggest that the role of the C-terminal domain is in forming multimers.	3.17704e-21
NC_018524.1|WP_014911461.1|4595774_4596224_-|VOC-family-protein	gnl|CDD|319917	cd07254, VOC_like, uncharacterized subfamily of vicinal oxygen chelate (VOC) family. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	6.65854e-46
NC_018524.1|WP_014913538.1|4596694_4597813_+|ACR3-family-arsenite-efflux-transporter	gnl|CDD|213563	TIGR00832, Uncharacterized_transporter_slr0944, arsenical-resistance protein. The Arsenical Resistance-3 (ACR3) Family (TC 2.A.59) The first protein of the ACR3 family functionally characterized was the ACR3 protein of Saccharomyces cerevisiae. It is present in the yeast plasma membrane and pumps arsenite out of the cell in response to the pmf. Similar proteins are found in bacteria, often as part of a four gene operon with an regulatory protein ArsR, a protein of unknown function ArsH, and an arsenate reductase that converts arsenate to arsenite to facilitate transport. [Cellular processes, Detoxification, Transport and binding proteins, Anions].	1.05948e-142
NC_018524.1|WP_014911968.1|4593535_4594234_-|YafY-family-transcriptional-regulator	gnl|CDD|225253	COG2378, COG2378, Predicted transcriptional regulator [Transcription].	6.50312e-46
NC_018524.1|WP_014913545.1|4587887_4588562_+|ATPase-AAA	gnl|CDD|213205	cd03238, ABC_UvrA, ATP-binding cassette domain of the excision repair protein UvrA. Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion. Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins. Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins, and UvrB having one ATP binding site that is structurally related to that of helicases.	5.08446e-05
NC_018524.1|WP_014911262.1|4597805_4598222_+|arsenate-reductase-ArsC	gnl|CDD|319973	cd16345, LMWP_ArsC, Arsenate reductase of the LMWP family. Arsenate reductase plays an important role in the reduction of intracellular arsenate to arsenite, an important step in arsenic detoxification. The reduction involves three different thiolate nucleophiles. In arsenate reductases of the LMWP family, reduction can be coupled with thioredoxin (Trx)/thioredoxin reductase (TrxR) or glutathione (GSH)/glutaredoxin (Grx).	3.31843e-50
NC_018524.1|WP_014912182.1|4588609_4589104_-|PACE-efflux-transporter	gnl|CDD|226610	COG4125, COG4125, Predicted membrane protein [Function unknown].	2.73247e-46

Protein sequences

>NC_018524.1|WP_014909082.1|4590315_4591158_+|aminoglycoside-3'-phosphotransferase
MADAWEVIGRALGAVRQESIGLGLSGARVLRMVDAQGVPVAVVKVVDHRMGHLVSEFEAETARLAWLRRLGVPVPEVLGSGVDEGESWLAMRALPGRPASDPWPAGEQDRVVDLLAHAARELHAASWEDTPFDRSLSSVLVEVRERVASGLVDRSWVIAGKEGPPAAVVLEELESLAGELGDGIPVVSHGDFCLPNVLIDETGTAGLVDVGRAGLADPHSDLADMTRSLRSHMNPQYGEVSAHRFLDAYGRDGIDPERLRLHDLLESFFWPVPEAHTPGG
>NC_018524.1|WP_014910693.1|4589205_4590099_+|LysR-family-transcriptional-regulator
MGLSSDNIDLFLAVVDHGSFSAAARALNRVPSAVSMGIANIEAELGYPLFDRSRREPVPTARAQALVPHARLVASRLRLLQAHAVELSDDLESTLTIGVSAGVDHRPLLDAVAEIAARHPLLSVELADAPQDDVREQLHSGAVDLALMFARTRNDREEVFLNVAEETFVAVASASVETFGIPADLRRLEDLAGARQIVVSTLERPLTERRLVVSDAYWRVNSAETALGLVERGIGWANLPLPLVRGRAAAGAVRVMEFENLENGLAMPVQLVWLRGSPLRKAAGELVDRMGRDWRRG
>NC_018524.1|WP_014912182.1|4588609_4589104_-|PACE-efflux-transporter
MQGLKRKLVYVGGYEVIGFIVGTAVMTALTGSGPGTTAPLAIMIATVAALWNMAFNYLFEAWERRQVSRERTVKRRILHAVAFQLTLVCYLIPLIAWWLDMSLLQAFLLDLVFIVYIPFYTFGYNWAFDKIFGLPSSAIADPVPEVEDGAAVSVEEPATTAERS
>NC_018524.1|WP_014913545.1|4587887_4588562_+|ATPase-AAA
MVQGRARDVPMVNDAMARGAVYPRRSLVLVAGVPGAGKSTLLKRLFGLRGDEDRTVLTADGVRVIDSLQSRYRLRSMLARVPYLLWRWVVHVLHLARVVAALRGGPVVVHECGTRRSVRVLLALLCRLRRYELHVLMIDATPQEAWRGQNSRGRQVTERSHRTHSRRWRRLRAAALHGPAAFARGARSLLALDRRRARELAWIRFGPGADARGPLRTVMESPSP
>NC_018524.1|WP_014909852.1|4586347_4586794_+|NUDIX-domain-containing-protein
MPERYRSIIDVHVILPRGEKILLLERRNTGYCDGMLHLPSGHLDEGEPIPHGAAREAREEVGVDIDPADLGLVAVVHHRQREDLARVGMFFLAEKWSGEPVVAEPDKAGELVWADPRALPSNTIPYPAEGIRAWVSGDRFVLHGWSAA
>NC_018524.1|WP_014913561.1|4585707_4586151_-|hypothetical-protein
MTRIGITGHSNLTADSVPLVRRALAEALAPYKKDDLVGVSCLARGADQIFAEVVLEADGRLEVVLPSVDYREAKVKPYNLEQFDDLLMRSTLVRYMPHKTAGRQAYEDANETVLGGIDRLVAVWDGQPSGGKGGTGDAVEGYGAHRE
>NC_018524.1|WP_187294482.1|4584967_4585552_+|GNAT-family-N-acetyltransferase
MTPPGSRSAQRETAGAITYRVAESESDRSAVIRGEFTSDTVFEVVVSEDGFGIRPTRLDATIHKVFPDDEPQDDEPSENGHRFVALDGDEVCGYVDTEYEPWNQRLVIADIEVAGAYRGRGIGRALMDHAIDRARERGAGHVWLEVTNMNAPAIRAYQRMGFTFCGLDTSLYSGTESEGETALYMSLFLAPAGE
>NC_018524.1|WP_014908725.1|4584309_4584888_+|TetR/AcrR-family-transcriptional-regulator
MRSPVGEGKKRLLEALFDEFGENGPGPNLSMRQVAERLGVHHTLLTYHFGSRPGLLRAVLLEARRRDNVVIAATGDELGFVALCRAIWDFYSDPAHEDRIHAFFHLVGLAVYERDAFQELVVDIDDLARLLEAAALRDGATETDARQRSIIATAGLRGLLLQRLLTPTAEVDAAAERFIASLAAFEGEGRAV
>NC_018524.1|WP_014908768.1|4583229_4584099_-|alpha/beta-hydrolase
MSEILHGCLPDTEYLEVTARSGRRYGVWVTTPPGYADSTDPLPLIYVLDGNWSVGLTAPLIVTQADPYLTIAPYIQVSVGYAGEEAASWSSLRNRDLVPPGEPIGEETMATLTAARETGRMTQEQVDAYLAELTETRADVFLDFLTDELHPHLRSRLRVGESGHGLFGYSYGGLFALYAWLREAAPFASFGAGSPGVAGSDSRIFTLIDALPEPGEGSVGSRLHITLNEAELLGDVPFYRGMSRNVLTAVERLHAKGWAEHVSKALLRETHVTGLQASFLGYLKTCHKR
>NC_018524.1|WP_014908620.1|4581169_4581712_+|AbrB-family-transcriptional-regulator
MNPLPLLAVMAGALGAALVFRWVRVPLWPLTGGLVGAAAVNLGFGLAAEVPTAIALTGQLLIGTAIGATIGSEVFRQFLRIIGPGTLAVTVVLGAGLLFGWLFATAGLMDPAEAMLALIPGGVGEMVAAAIALDLDSAQVVGVQMVRILTVLLSLPLVFRVSEWIHRRWIAGPGGETSGA
>NC_018524.1|WP_014911968.1|4593535_4594234_-|YafY-family-transcriptional-regulator
MKRAERLHAISETLRRSGTRGVSAEWLAREFEVSVRTVKRDLDALKNSGAPIWSRPGPGGGYGLTTGASLPPISLSPVQAVALMAAVSAAPGAPYADLAAAGVRKIMDVLDPGTRARADELAHRVWVDAPPSSSRATRSALEEAMTEQRVIRIRYASREGTATTRDVEPVLFASTNGRWYLIGWCRLRDAMRWFAVSRIEQATVTKTACSGRTVHEVGEPPANARPVHGRGE
>NC_018524.1|WP_014912250.1|4594307_4595048_+|alpha/beta-hydrolase
MATTTNSPTIVLIAGHWLGAWAWDEVLEHLETDHVRAVAVTLPGLDGDDPARSTRTLDDQVEAIEGLLARLDVSEERPATLVAHSGANGPVSLLLDRRPELVRRVVWVDSGPMANGSAFAPDFPEEVEELPLPPFDVLAEQASLDGLSTEVLERFRSRAVPEPGPVLRQTVELTNDARRTVPTTLVCCSISSEQVLEMAQGGHPMFAEVANLETLDIIDLPTGHWPMWSRPGDLAEVIRSAASRAG
>NC_018524.1|WP_014911461.1|4595774_4596224_-|VOC-family-protein
MSRVQLALNVADLEASVVFYSTLFGVEPAKRRPGYANFAISEPPLKLVLIEGEPDQETRLDHLGVEVEATEQVNAATQRFKDSGLATFEENDTSCCYAVQDKVWVHGPGKEPWEVYVVKSDSDQRGAAPREVNTGVAGEASGCCATAQV
>NC_018524.1|WP_041561956.1|4596314_4596698_+|helix-turn-helix-transcriptional-regulator
MSNQEVGATDLQGAVADCCPRLLKEPLEDGESVELARVFKALGDPVRLRLLSMIATCDGDEVCVCDLTPAFDLSQPTISHHLKLLREAGLISSVRRGTWVYYRLIPETTDRLAAILTRSMKSEEAGS
>NC_018524.1|WP_014913538.1|4596694_4597813_+|ACR3-family-arsenite-efflux-transporter
MSAPASTDPNAGVVGRLSALDRFLTVWILAAMVAGLALGRLVPGLGEALSGVGVAGVSLPIAVGLLVMMFPPLAKVRYDRLGAVTGDRRMLITSLAVNWLAGPALMFALAWAFLPDLPEYRTGLIIVGLARCIAMVIVWNDLACGDREAAAVLVALNSLFQVVAFGALGWFYLSALPGWLGLGQAALEVSFVDISVSVVIFLGVPLLAGYLTRRLGERARGREWYETRLLPKLGPWGLYGLLFTIVMLFALQGEAITSRPWDVARIALPLLLYFVIMWAGTLALGRALGMGYPRSVTLAFTAAGNNFELAIAVAIASFGAASGQALAGVVGPLIEVPVLIALVYVALAARRWFPGEGAAEVSTATTKETTGD
>NC_018524.1|WP_014911262.1|4597805_4598222_+|arsenate-reductase-ArsC
MTDRSEAVIPRVLFVCVHNAGRSQMAAAFLEHLGGDRVEVRSAGSAPADEVNPAVVEAMGEVGIDITAGTPKLLTPDAVRASDVVVTMGCGDACPFFPGKRYLDWELPDPAGRGVEAVRPILDRIKRHVEDLLRELVP
>NC_018524.1|WP_014910539.1|4599808_4600363_+|NUDIX-hydrolase
MGHTESSEDDNGRWIVHGERAIYDSRWVRLGKADITTPSGSRFEHHTVTLPSAAVIAIVDRAGEHVLMSYRHRFVPDAWGWELPGGLLDPEETPEQTAVREALEETGHRVGSVEHVATFEPMIGTVRSPHHVFVGRDADLVADPTEFDEGVYEWVPLAEIRGLISTGHVQSSGTLIALLHILAS
>NC_018524.1|WP_081536576.1|4600339_4601488_-|hypothetical-protein
MRQAWETRDAATVVRLVLWNSELSQTKLSQILGISQSTISEAVSGKSQIARQSSRNAIFEGLDILRPPLPPKVATALTATPQATEPSGEAQERLEIASIDQALIGLFEARTQNLRLIDRKLGAHYLLAQSQAHVQQMHDLLRRSLPGPVRRGLARALAEAASLTGWQALDSGRSATAWRYYEIAKAAARESEDKAVLAHVSAEQSYVLLDNGYERGALATLRAARDDAGASLPSLLSSWMWAAEGEVCATLGEEPEAKRALERAFALLPPEPQDPSLPFLMLDRTHLLRWRGHCLARLGDSEAIEDLTRALDCIVPLELGRAEAGLRTDLALAYTVHGDTTQAHRQAARAAELSDQSGSVRQRSRLARLLPQRTTSRSEDVE
>NC_018524.1|WP_051018317.1|4602071_4603295_+|methyltransferase,-FxLD-system
MVDALVEERADLGMEKLPEQVEEALRAVPREVFVPGLPLVEAYDRHQAIVTKHDEAKRVALSSVSAPSIIALMLQRADIRPGHRVLEIGSGGYNAALISHLVGETGQVTSIDIDPDVIARAERCLKEAGVDQVHLAVTDGEHGFASRAPYDRIIVTAGAWDLSPSWEEQLAVGGRVVVPMRVRGLTRCLTLERAEEPGHWRSLAADMCGFVRMQGVGEHWERMPLLHQEEGSQVGLRLEDGPQVDVDALRRALTQDGETVWAGVCVRADEPTDALDLYLASAADGWALLTAQRGAITSKLIRPVVLMGTPAMVDEEGESFSYRALRRSPDDEELYEFGAVEHGPAGRRVAQNMVDLIGVWDREHRGGPGPRIDLVPIDTAAEDLPTGRVVSKRHTHMILNWTANPFE
>NC_018524.1|WP_014908230.1|4603305_4603512_+|FxLD-family-lanthipeptide
MSALTATPTPAGLIATGRDRALSLDGDLFDLDLRVQVPVTDESLWSMTNDGCGQTCETACTQSCTDNG

Crispr_ID: NC_018524_23

• CRISPR_ID: NC_018524_23
• CRISPR_location: 4591563-4592152
• CRISPR_type: Orphan
• Repeat_type: I-E
• Spacer_info: 9 spacers
• Cas_protein_info: WYL,csa3

Consensus repeat of NC_018524_23

Consensus_repeat	Method
GGGGTCATCCCCGCGTGCGCGGGGAGCAG	PILER-CR
CTGCTCCCCGCGCACGCGGGGATGACCCC	CRISPRCasFinder
CTGCTCCCCGCGCACGCGGGGATGACCCC	CRT

spacers of NC_018524_23

>23.1|4591592|40|NC_018524|PILER-CR,CRISPRCasFinder,CRT
ATCTTGATGGGCGTCGCGTGCCGGTCGGCGTCAGCGATCC
>23.2|4591661|33|NC_018524|PILER-CR,CRISPRCasFinder,CRT
ATCGCCGACCAGAACCTCAAGTACACCGGAGTC
>23.3|4591723|33|NC_018524|PILER-CR,CRISPRCasFinder,CRT
CGTTTCCCTAGGGGTCTAGGGAAATAACTTGGG
>23.4|4591785|33|NC_018524|PILER-CR,CRISPRCasFinder,CRT
CCCCGAAAAGGGGGTGCTGGAATTTCCCTCTCG
>23.5|4591847|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT
ACCGACTTGCCGGTGAACGCCCCGTCGGGGCC
>23.6|4591908|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT
CGGGAAATAACGGTGATCTTCGACGAGTACTC
>23.7|4591969|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT
GCGTAGGTGGTCAGCTCTGCGTCGGGGTCGGC
>23.8|4592030|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT
ACAAAGGCCTCCCCCAGCTTCTTGATCTGTCG
>23.9|4592091|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT
GCTCGTCGAAGGCGGGGTTCGCGCCAACGACC

CRISPR arrays and Neighbor proteins around NC_018524_23

CRISPR arrays

The CRISPR arrays of NC_018524_23

>merge|NC_018524|23|4591563-4592152|PILER-CR,CRISPRCasFinder,CRT
CTGCTCCCCGCGCACGCGGGGATGACCCCATCTTGATGGGCGTCGCGTGCCGGTCGGCGTCAGCGATCCCTGCTCCCCGCGCACGCGGGGATGACCCCATCGCCGACCAGAACCTCAAGTACACCGGAGTCCTGCTCCCCGCGCACGCGGGGATGACCCCCGTTTCCCTAGGGGTCTAGGGAAATAACTTGGGCTGCTCCCCGCGCACGCGGGGATGACCCCCCCCGAAAAGGGGGTGCTGGAATTTCCCTCTCGCTGCTCCCCGCGCACGCGGGGATGACCCCACCGACTTGCCGGTGAACGCCCCGTCGGGGCCCTGCTCCCCGCGCACGCGGGGATGACCCCCGGGAAATAACGGTGATCTTCGACGAGTACTCCTGCTCCCCGCGCACGCGGGGATGACCCCGCGTAGGTGGTCAGCTCTGCGTCGGGGTCGGCCTGCTCCCCGCGCACGCGGGGATGACCCCACAAAGGCCTCCCCCAGCTTCTTGATCTGTCGCTGCTCCCCGCGCACGCGGGGATGACCCCGCTCGTCGAAGGCGGGGTTCGCGCCAACGACCCTGCTCCCCGCGCACGCGGGGATGACCCCG

>NC_018524|23|13|4591563-4592151|PILER-CR
CTGCTCCCCGCGCACGCGGGGATGACCCC	ATCTTGATGGGCGTCGCGTGCCGGTCGGCGTCAGCGATCC
CTGCTCCCCGCGCACGCGGGGATGACCCC	ATCGCCGACCAGAACCTCAAGTACACCGGAGTC
CTGCTCCCCGCGCACGCGGGGATGACCCC	CGTTTCCCTAGGGGTCTAGGGAAATAACTTGGG
CTGCTCCCCGCGCACGCGGGGATGACCCC	CCCCGAAAAGGGGGTGCTGGAATTTCCCTCTCG
CTGCTCCCCGCGCACGCGGGGATGACCCC	ACCGACTTGCCGGTGAACGCCCCGTCGGGGCC
CTGCTCCCCGCGCACGCGGGGATGACCCC	CGGGAAATAACGGTGATCTTCGACGAGTACTC
CTGCTCCCCGCGCACGCGGGGATGACCCC	GCGTAGGTGGTCAGCTCTGCGTCGGGGTCGGC
CTGCTCCCCGCGCACGCGGGGATGACCCC	ACAAAGGCCTCCCCCAGCTTCTTGATCTGTCG
CTGCTCCCCGCGCACGCGGGGATGACCCC	GCTCGTCGAAGGCGGGGTTCGCGCCAACGACC
CTGCTCCCCGCGCACGCGGGGATGACCCC

>NC_018524|23|22|4591563-4592152|CRISPRCasFinder
CTGCTCCCCGCGCACGCGGGGATGACCCC	ATCTTGATGGGCGTCGCGTGCCGGTCGGCGTCAGCGATCC
CTGCTCCCCGCGCACGCGGGGATGACCCC	ATCGCCGACCAGAACCTCAAGTACACCGGAGTC
CTGCTCCCCGCGCACGCGGGGATGACCCC	CGTTTCCCTAGGGGTCTAGGGAAATAACTTGGG
CTGCTCCCCGCGCACGCGGGGATGACCCC	CCCCGAAAAGGGGGTGCTGGAATTTCCCTCTCG
CTGCTCCCCGCGCACGCGGGGATGACCCC	ACCGACTTGCCGGTGAACGCCCCGTCGGGGCC
CTGCTCCCCGCGCACGCGGGGATGACCCC	CGGGAAATAACGGTGATCTTCGACGAGTACTC
CTGCTCCCCGCGCACGCGGGGATGACCCC	GCGTAGGTGGTCAGCTCTGCGTCGGGGTCGGC
CTGCTCCCCGCGCACGCGGGGATGACCCC	ACAAAGGCCTCCCCCAGCTTCTTGATCTGTCG
CTGCTCCCCGCGCACGCGGGGATGACCCC	GCTCGTCGAAGGCGGGGTTCGCGCCAACGACC
CTGCTCCCCGCGCACGCGGGGATGACCCCG

>NC_018524|23|13|4591563-4592151|CRT
CTGCTCCCCGCGCACGCGGGGATGACCCC	ATCTTGATGGGCGTCGCGTGCCGGTCGGCGTCAGCGATCC
CTGCTCCCCGCGCACGCGGGGATGACCCC	ATCGCCGACCAGAACCTCAAGTACACCGGAGTC
CTGCTCCCCGCGCACGCGGGGATGACCCC	CGTTTCCCTAGGGGTCTAGGGAAATAACTTGGG
CTGCTCCCCGCGCACGCGGGGATGACCCC	CCCCGAAAAGGGGGTGCTGGAATTTCCCTCTCG
CTGCTCCCCGCGCACGCGGGGATGACCCC	ACCGACTTGCCGGTGAACGCCCCGTCGGGGCC
CTGCTCCCCGCGCACGCGGGGATGACCCC	CGGGAAATAACGGTGATCTTCGACGAGTACTC
CTGCTCCCCGCGCACGCGGGGATGACCCC	GCGTAGGTGGTCAGCTCTGCGTCGGGGTCGGC
CTGCTCCCCGCGCACGCGGGGATGACCCC	ACAAAGGCCTCCCCCAGCTTCTTGATCTGTCG
CTGCTCCCCGCGCACGCGGGGATGACCCC	GCTCGTCGAAGGCGGGGTTCGCGCCAACGACC
CTGCTCCCCGCGCACGCGGGGATGACCCC

Neighbor Proteins Overview

Protein	Signature genes	Signature genes Name	Protein_function
NC_018524.1|WP_014908725.1|4584309_4584888_+|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl|CDD|224228
NC_018524.1|WP_014910539.1|4599808_4600363_+|NUDIX-hydrolase	unknown	unknown	gnl|CDD|239516
NC_018524.1|WP_014910693.1|4589205_4590099_+|LysR-family-transcriptional-regulator	unknown	unknown	gnl|CDD|223656
NC_018524.1|WP_041561956.1|4596314_4596698_+|helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl|CDD|223713
NC_018524.1|WP_014909082.1|4590315_4591158_+|aminoglycoside-3'-phosphotransferase	unknown	unknown	gnl|CDD|270699
NC_018524.1|WP_081536576.1|4600339_4601488_-|hypothetical-protein	unknown	unknown	gnl|CDD|276809
NC_018524.1|WP_187294482.1|4584967_4585552_+|GNAT-family-N-acetyltransferase	unknown	unknown	gnl|CDD|366181
NC_018524.1|WP_014908768.1|4583229_4584099_-|alpha/beta-hydrolase	unknown	unknown	gnl|CDD|225375
NC_018524.1|WP_014912250.1|4594307_4595048_+|alpha/beta-hydrolase	unknown	unknown	gnl|CDD|223669
NC_018524.1|WP_014909852.1|4586347_4586794_+|NUDIX-domain-containing-protein	unknown	unknown	gnl|CDD|240039
NC_018524.1|WP_014908230.1|4603305_4603512_+|FxLD-family-lanthipeptide	unknown	unknown	gnl|CDD|275157
NC_018524.1|WP_051018317.1|4602071_4603295_+|methyltransferase,-FxLD-system	unknown	unknown	gnl|CDD|275158
NC_018524.1|WP_014913561.1|4585707_4586151_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014908620.1|4581169_4581712_+|AbrB-family-transcriptional-regulator	unknown	unknown	gnl|CDD|377472
NC_018524.1|WP_014911461.1|4595774_4596224_-|VOC-family-protein	unknown	unknown	gnl|CDD|319917
NC_018524.1|WP_014913538.1|4596694_4597813_+|ACR3-family-arsenite-efflux-transporter	unknown	unknown	gnl|CDD|213563
NC_018524.1|WP_014911968.1|4593535_4594234_-|YafY-family-transcriptional-regulator	WYL	COG2378_WYL_CAS-I:CAS-III	gnl|CDD|225253
NC_018524.1|WP_014913545.1|4587887_4588562_+|ATPase-AAA	unknown	unknown	gnl|CDD|213205
NC_018524.1|WP_014911262.1|4597805_4598222_+|arsenate-reductase-ArsC	unknown	unknown	gnl|CDD|319973
NC_018524.1|WP_014912182.1|4588609_4589104_-|PACE-efflux-transporter	unknown	unknown	gnl|CDD|226610

HMMScan for Signature genes

Protein	Cas_name	Cas_description	E-value	Identity	Coverage
NC_018524.1|WP_014911968.1|4593535_4594234_-|YafY-family-transcriptional-regulator	WYL	COG2378_WYL_CAS-I:CAS-III	8.5e-51	168.0	0.0
NC_018524.1|WP_041561956.1|4596314_4596698_+|helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	4.5e-23	76.6	0.1

rpsblast for functional proteins

Protein	Function_ID	Function_description	E-value
NC_018524.1|WP_014908725.1|4584309_4584888_+|TetR/AcrR-family-transcriptional-regulator	gnl|CDD|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	6.78149e-06
NC_018524.1|WP_014910539.1|4599808_4600363_+|NUDIX-hydrolase	gnl|CDD|239516	cd03424, ADPRase_NUDT5, ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate. Like other members of the Nudix hydrolase superfamily, it requires a divalent cation, such as Mg2+, for its activity. It also contains a highly conserved 23-residue Nudix motif (GX5EX7REUXEEXGU, where U = I, L or V) which functions as a metal binding site/catalytic site. In addition to the Nudix motif, there are additional conserved amino acid residues, distal from the signature sequence, that correlate with substrate specificity. In humans, there are four distinct ADPRase activities, three putative cytosolic enzymes (ADPRase-I, -II, and -Mn) and a single mitochondrial enzyme (ADPRase-m). Human ADPRase-II is also referred to as NUDT5. It lacks the N-terminal target sequence unique to mitochondrial ADPRase. The different cytosolic types are distinguished by their specificities for substrate and specific requirement for metal ions. NUDT5 forms a homodimer.	4.39346e-27
NC_018524.1|WP_014910693.1|4589205_4590099_+|LysR-family-transcriptional-regulator	gnl|CDD|223656	COG0583, LysR, Transcriptional regulator [Transcription].	9.06008e-33
NC_018524.1|WP_041561956.1|4596314_4596698_+|helix-turn-helix-transcriptional-regulator	gnl|CDD|223713	COG0640, ArsR, Predicted transcriptional regulators [Transcription].	4.27648e-20
NC_018524.1|WP_014909082.1|4590315_4591158_+|aminoglycoside-3'-phosphotransferase	gnl|CDD|270699	cd05150, APH, Aminoglycoside 3'-phosphotransferase. APH catalyzes the transfer of the gamma-phosphoryl group from ATP to aminoglycoside antibiotics such as kanamycin, streptomycin, neomycin, and gentamicin, among others. The aminoglycoside antibiotics target the 30S ribosome and promote miscoding, leading to the production of defective proteins which insert into the bacterial membrane, resulting in membrane damage and the ultimate demise of the bacterium. Phosphorylation of the aminoglycoside antibiotics results in their inactivation, leading to bacterial antibiotic resistance. The APH gene is found on transposons and plasmids and is thought to have originated as a self-defense mechanism used by microorganisms that produce the antibiotics. The APH subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K).	9.80962e-82
NC_018524.1|WP_081536576.1|4600339_4601488_-|hypothetical-protein	gnl|CDD|276809	sd00006, TPR, Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.	0.00137544
NC_018524.1|WP_187294482.1|4584967_4585552_+|GNAT-family-N-acetyltransferase	gnl|CDD|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	1.44368e-22
NC_018524.1|WP_014908768.1|4583229_4584099_-|alpha/beta-hydrolase	gnl|CDD|225375	COG2819, COG2819, Predicted hydrolase of the alpha/beta superfamily [General function prediction only].	9.4993e-18
NC_018524.1|WP_014912250.1|4594307_4595048_+|alpha/beta-hydrolase	gnl|CDD|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	5.06176e-07
NC_018524.1|WP_014909852.1|4586347_4586794_+|NUDIX-domain-containing-protein	gnl|CDD|240039	cd04683, Nudix_Hydrolase_24, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.	3.33865e-48
NC_018524.1|WP_014908230.1|4603305_4603512_+|FxLD-family-lanthipeptide	gnl|CDD|275157	TIGR04363, hypothetical_protein, FxLD family lantipeptide. Members of this protein family occur with a cassette of lanthionine-type peptide modification enzymes. Members are small (about 60 amino acids long), rich in Cys, and variable in copy number per genome (from one to three). These features suggest that members of this family are modified to become lantipeptides, although not necessarily a lantibiotic. There is no GlyGly cleavage motif to separate a leader peptide from core region.The considerable abundance in Streptomyces and relatively strong consideration hints at a non-antibiotic function. The motif FxLD in the N-terminal region is nearly invariant.	0.00561373
NC_018524.1|WP_051018317.1|4602071_4603295_+|methyltransferase,-FxLD-system	gnl|CDD|275158	TIGR04364, methyltran_FxLD, methyltransferase, FxLD system. Members of this family resemble occur regularly in the vicinity of lantibiotic biosynthesis enzymes and their probable target, the FxLD family of putative ribosomal natural product precursor (TIGR04363). Members resemble protein-L-isoaspartate O-methyltransferase (TIGR00080) and a predicted methyltranserase, TIGR04188, of another putative peptide modification system.	3.02023e-139
NC_018524.1|WP_014908620.1|4581169_4581712_+|AbrB-family-transcriptional-regulator	gnl|CDD|377472	pfam05145, AbrB, Transition state regulatory protein AbrB. Bacillus subtilis respond to a multitude of environmental stimuli by using transcription factors called transition state regulators (TSRs). They play an essential role in cell survival by regulating spore formation, competence, and biofilm development. AbrB is one of the most known TSRs, acting as a pleotropic regulator for over 60 different genes where it directly binds to their promoter or regulatory regions. Many other genes are indirectly controlled by AbrB since it is a regulator of other regulatory proteins, including ScoC, Abh, SinR and SigH. Hence, AbrB is considered a global regulatory protein controlling processes such as Bacillus subtilis growth and cell division as well as production of extracellular degradative enzymes, nitrogen utilization and amino acid metabolism, motility, synthesis of antibiotics and their resistant determinants, development of competence, transport systems, oxidative stress response, phosphate metabolism, cell surface components and sporulation. AbrB is a tetramer consisting of identical 94 residue monomers. Its DNA-binding function resides solely in the N-terminal domain (AbrBN) of 53 residues. Although it does not recognize a well-defined DNA base-pairing sequence, instead, it appears to target a very weak pseudo consensus nucleotide sequence, TGGNA-5bp-TGGNA, which allows it to be rather promiscuous in binding. The N-terminal domains of very similar sequences are present in two more Bacillus subtilis proteins, Abh and SpoVT. Mutagenesis studies suggest that the role of the C-terminal domain is in forming multimers.	3.17704e-21
NC_018524.1|WP_014911461.1|4595774_4596224_-|VOC-family-protein	gnl|CDD|319917	cd07254, VOC_like, uncharacterized subfamily of vicinal oxygen chelate (VOC) family. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	6.65854e-46
NC_018524.1|WP_014913538.1|4596694_4597813_+|ACR3-family-arsenite-efflux-transporter	gnl|CDD|213563	TIGR00832, Uncharacterized_transporter_slr0944, arsenical-resistance protein. The Arsenical Resistance-3 (ACR3) Family (TC 2.A.59) The first protein of the ACR3 family functionally characterized was the ACR3 protein of Saccharomyces cerevisiae. It is present in the yeast plasma membrane and pumps arsenite out of the cell in response to the pmf. Similar proteins are found in bacteria, often as part of a four gene operon with an regulatory protein ArsR, a protein of unknown function ArsH, and an arsenate reductase that converts arsenate to arsenite to facilitate transport. [Cellular processes, Detoxification, Transport and binding proteins, Anions].	1.05948e-142
NC_018524.1|WP_014911968.1|4593535_4594234_-|YafY-family-transcriptional-regulator	gnl|CDD|225253	COG2378, COG2378, Predicted transcriptional regulator [Transcription].	6.50312e-46
NC_018524.1|WP_014913545.1|4587887_4588562_+|ATPase-AAA	gnl|CDD|213205	cd03238, ABC_UvrA, ATP-binding cassette domain of the excision repair protein UvrA. Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion. Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins. Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins, and UvrB having one ATP binding site that is structurally related to that of helicases.	5.08446e-05
NC_018524.1|WP_014911262.1|4597805_4598222_+|arsenate-reductase-ArsC	gnl|CDD|319973	cd16345, LMWP_ArsC, Arsenate reductase of the LMWP family. Arsenate reductase plays an important role in the reduction of intracellular arsenate to arsenite, an important step in arsenic detoxification. The reduction involves three different thiolate nucleophiles. In arsenate reductases of the LMWP family, reduction can be coupled with thioredoxin (Trx)/thioredoxin reductase (TrxR) or glutathione (GSH)/glutaredoxin (Grx).	3.31843e-50
NC_018524.1|WP_014912182.1|4588609_4589104_-|PACE-efflux-transporter	gnl|CDD|226610	COG4125, COG4125, Predicted membrane protein [Function unknown].	2.73247e-46

Protein sequences

>NC_018524.1|WP_014909082.1|4590315_4591158_+|aminoglycoside-3'-phosphotransferase
MADAWEVIGRALGAVRQESIGLGLSGARVLRMVDAQGVPVAVVKVVDHRMGHLVSEFEAETARLAWLRRLGVPVPEVLGSGVDEGESWLAMRALPGRPASDPWPAGEQDRVVDLLAHAARELHAASWEDTPFDRSLSSVLVEVRERVASGLVDRSWVIAGKEGPPAAVVLEELESLAGELGDGIPVVSHGDFCLPNVLIDETGTAGLVDVGRAGLADPHSDLADMTRSLRSHMNPQYGEVSAHRFLDAYGRDGIDPERLRLHDLLESFFWPVPEAHTPGG
>NC_018524.1|WP_014910693.1|4589205_4590099_+|LysR-family-transcriptional-regulator
MGLSSDNIDLFLAVVDHGSFSAAARALNRVPSAVSMGIANIEAELGYPLFDRSRREPVPTARAQALVPHARLVASRLRLLQAHAVELSDDLESTLTIGVSAGVDHRPLLDAVAEIAARHPLLSVELADAPQDDVREQLHSGAVDLALMFARTRNDREEVFLNVAEETFVAVASASVETFGIPADLRRLEDLAGARQIVVSTLERPLTERRLVVSDAYWRVNSAETALGLVERGIGWANLPLPLVRGRAAAGAVRVMEFENLENGLAMPVQLVWLRGSPLRKAAGELVDRMGRDWRRG
>NC_018524.1|WP_014912182.1|4588609_4589104_-|PACE-efflux-transporter
MQGLKRKLVYVGGYEVIGFIVGTAVMTALTGSGPGTTAPLAIMIATVAALWNMAFNYLFEAWERRQVSRERTVKRRILHAVAFQLTLVCYLIPLIAWWLDMSLLQAFLLDLVFIVYIPFYTFGYNWAFDKIFGLPSSAIADPVPEVEDGAAVSVEEPATTAERS
>NC_018524.1|WP_014913545.1|4587887_4588562_+|ATPase-AAA
MVQGRARDVPMVNDAMARGAVYPRRSLVLVAGVPGAGKSTLLKRLFGLRGDEDRTVLTADGVRVIDSLQSRYRLRSMLARVPYLLWRWVVHVLHLARVVAALRGGPVVVHECGTRRSVRVLLALLCRLRRYELHVLMIDATPQEAWRGQNSRGRQVTERSHRTHSRRWRRLRAAALHGPAAFARGARSLLALDRRRARELAWIRFGPGADARGPLRTVMESPSP
>NC_018524.1|WP_014909852.1|4586347_4586794_+|NUDIX-domain-containing-protein
MPERYRSIIDVHVILPRGEKILLLERRNTGYCDGMLHLPSGHLDEGEPIPHGAAREAREEVGVDIDPADLGLVAVVHHRQREDLARVGMFFLAEKWSGEPVVAEPDKAGELVWADPRALPSNTIPYPAEGIRAWVSGDRFVLHGWSAA
>NC_018524.1|WP_014913561.1|4585707_4586151_-|hypothetical-protein
MTRIGITGHSNLTADSVPLVRRALAEALAPYKKDDLVGVSCLARGADQIFAEVVLEADGRLEVVLPSVDYREAKVKPYNLEQFDDLLMRSTLVRYMPHKTAGRQAYEDANETVLGGIDRLVAVWDGQPSGGKGGTGDAVEGYGAHRE
>NC_018524.1|WP_187294482.1|4584967_4585552_+|GNAT-family-N-acetyltransferase
MTPPGSRSAQRETAGAITYRVAESESDRSAVIRGEFTSDTVFEVVVSEDGFGIRPTRLDATIHKVFPDDEPQDDEPSENGHRFVALDGDEVCGYVDTEYEPWNQRLVIADIEVAGAYRGRGIGRALMDHAIDRARERGAGHVWLEVTNMNAPAIRAYQRMGFTFCGLDTSLYSGTESEGETALYMSLFLAPAGE
>NC_018524.1|WP_014908725.1|4584309_4584888_+|TetR/AcrR-family-transcriptional-regulator
MRSPVGEGKKRLLEALFDEFGENGPGPNLSMRQVAERLGVHHTLLTYHFGSRPGLLRAVLLEARRRDNVVIAATGDELGFVALCRAIWDFYSDPAHEDRIHAFFHLVGLAVYERDAFQELVVDIDDLARLLEAAALRDGATETDARQRSIIATAGLRGLLLQRLLTPTAEVDAAAERFIASLAAFEGEGRAV
>NC_018524.1|WP_014908768.1|4583229_4584099_-|alpha/beta-hydrolase
MSEILHGCLPDTEYLEVTARSGRRYGVWVTTPPGYADSTDPLPLIYVLDGNWSVGLTAPLIVTQADPYLTIAPYIQVSVGYAGEEAASWSSLRNRDLVPPGEPIGEETMATLTAARETGRMTQEQVDAYLAELTETRADVFLDFLTDELHPHLRSRLRVGESGHGLFGYSYGGLFALYAWLREAAPFASFGAGSPGVAGSDSRIFTLIDALPEPGEGSVGSRLHITLNEAELLGDVPFYRGMSRNVLTAVERLHAKGWAEHVSKALLRETHVTGLQASFLGYLKTCHKR
>NC_018524.1|WP_014908620.1|4581169_4581712_+|AbrB-family-transcriptional-regulator
MNPLPLLAVMAGALGAALVFRWVRVPLWPLTGGLVGAAAVNLGFGLAAEVPTAIALTGQLLIGTAIGATIGSEVFRQFLRIIGPGTLAVTVVLGAGLLFGWLFATAGLMDPAEAMLALIPGGVGEMVAAAIALDLDSAQVVGVQMVRILTVLLSLPLVFRVSEWIHRRWIAGPGGETSGA
>NC_018524.1|WP_014911968.1|4593535_4594234_-|YafY-family-transcriptional-regulator
MKRAERLHAISETLRRSGTRGVSAEWLAREFEVSVRTVKRDLDALKNSGAPIWSRPGPGGGYGLTTGASLPPISLSPVQAVALMAAVSAAPGAPYADLAAAGVRKIMDVLDPGTRARADELAHRVWVDAPPSSSRATRSALEEAMTEQRVIRIRYASREGTATTRDVEPVLFASTNGRWYLIGWCRLRDAMRWFAVSRIEQATVTKTACSGRTVHEVGEPPANARPVHGRGE
>NC_018524.1|WP_014912250.1|4594307_4595048_+|alpha/beta-hydrolase
MATTTNSPTIVLIAGHWLGAWAWDEVLEHLETDHVRAVAVTLPGLDGDDPARSTRTLDDQVEAIEGLLARLDVSEERPATLVAHSGANGPVSLLLDRRPELVRRVVWVDSGPMANGSAFAPDFPEEVEELPLPPFDVLAEQASLDGLSTEVLERFRSRAVPEPGPVLRQTVELTNDARRTVPTTLVCCSISSEQVLEMAQGGHPMFAEVANLETLDIIDLPTGHWPMWSRPGDLAEVIRSAASRAG
>NC_018524.1|WP_014911461.1|4595774_4596224_-|VOC-family-protein
MSRVQLALNVADLEASVVFYSTLFGVEPAKRRPGYANFAISEPPLKLVLIEGEPDQETRLDHLGVEVEATEQVNAATQRFKDSGLATFEENDTSCCYAVQDKVWVHGPGKEPWEVYVVKSDSDQRGAAPREVNTGVAGEASGCCATAQV
>NC_018524.1|WP_041561956.1|4596314_4596698_+|helix-turn-helix-transcriptional-regulator
MSNQEVGATDLQGAVADCCPRLLKEPLEDGESVELARVFKALGDPVRLRLLSMIATCDGDEVCVCDLTPAFDLSQPTISHHLKLLREAGLISSVRRGTWVYYRLIPETTDRLAAILTRSMKSEEAGS
>NC_018524.1|WP_014913538.1|4596694_4597813_+|ACR3-family-arsenite-efflux-transporter
MSAPASTDPNAGVVGRLSALDRFLTVWILAAMVAGLALGRLVPGLGEALSGVGVAGVSLPIAVGLLVMMFPPLAKVRYDRLGAVTGDRRMLITSLAVNWLAGPALMFALAWAFLPDLPEYRTGLIIVGLARCIAMVIVWNDLACGDREAAAVLVALNSLFQVVAFGALGWFYLSALPGWLGLGQAALEVSFVDISVSVVIFLGVPLLAGYLTRRLGERARGREWYETRLLPKLGPWGLYGLLFTIVMLFALQGEAITSRPWDVARIALPLLLYFVIMWAGTLALGRALGMGYPRSVTLAFTAAGNNFELAIAVAIASFGAASGQALAGVVGPLIEVPVLIALVYVALAARRWFPGEGAAEVSTATTKETTGD
>NC_018524.1|WP_014911262.1|4597805_4598222_+|arsenate-reductase-ArsC
MTDRSEAVIPRVLFVCVHNAGRSQMAAAFLEHLGGDRVEVRSAGSAPADEVNPAVVEAMGEVGIDITAGTPKLLTPDAVRASDVVVTMGCGDACPFFPGKRYLDWELPDPAGRGVEAVRPILDRIKRHVEDLLRELVP
>NC_018524.1|WP_014910539.1|4599808_4600363_+|NUDIX-hydrolase
MGHTESSEDDNGRWIVHGERAIYDSRWVRLGKADITTPSGSRFEHHTVTLPSAAVIAIVDRAGEHVLMSYRHRFVPDAWGWELPGGLLDPEETPEQTAVREALEETGHRVGSVEHVATFEPMIGTVRSPHHVFVGRDADLVADPTEFDEGVYEWVPLAEIRGLISTGHVQSSGTLIALLHILAS
>NC_018524.1|WP_081536576.1|4600339_4601488_-|hypothetical-protein
MRQAWETRDAATVVRLVLWNSELSQTKLSQILGISQSTISEAVSGKSQIARQSSRNAIFEGLDILRPPLPPKVATALTATPQATEPSGEAQERLEIASIDQALIGLFEARTQNLRLIDRKLGAHYLLAQSQAHVQQMHDLLRRSLPGPVRRGLARALAEAASLTGWQALDSGRSATAWRYYEIAKAAARESEDKAVLAHVSAEQSYVLLDNGYERGALATLRAARDDAGASLPSLLSSWMWAAEGEVCATLGEEPEAKRALERAFALLPPEPQDPSLPFLMLDRTHLLRWRGHCLARLGDSEAIEDLTRALDCIVPLELGRAEAGLRTDLALAYTVHGDTTQAHRQAARAAELSDQSGSVRQRSRLARLLPQRTTSRSEDVE
>NC_018524.1|WP_051018317.1|4602071_4603295_+|methyltransferase,-FxLD-system
MVDALVEERADLGMEKLPEQVEEALRAVPREVFVPGLPLVEAYDRHQAIVTKHDEAKRVALSSVSAPSIIALMLQRADIRPGHRVLEIGSGGYNAALISHLVGETGQVTSIDIDPDVIARAERCLKEAGVDQVHLAVTDGEHGFASRAPYDRIIVTAGAWDLSPSWEEQLAVGGRVVVPMRVRGLTRCLTLERAEEPGHWRSLAADMCGFVRMQGVGEHWERMPLLHQEEGSQVGLRLEDGPQVDVDALRRALTQDGETVWAGVCVRADEPTDALDLYLASAADGWALLTAQRGAITSKLIRPVVLMGTPAMVDEEGESFSYRALRRSPDDEELYEFGAVEHGPAGRRVAQNMVDLIGVWDREHRGGPGPRIDLVPIDTAAEDLPTGRVVSKRHTHMILNWTANPFE
>NC_018524.1|WP_014908230.1|4603305_4603512_+|FxLD-family-lanthipeptide
MSALTATPTPAGLIATGRDRALSLDGDLFDLDLRVQVPVTDESLWSMTNDGCGQTCETACTQSCTDNG

Crispr_ID: NC_018524_25

• CRISPR_ID: NC_018524_25
• CRISPR_location: 4595354-4595625
• CRISPR_type: Orphan
• Repeat_type: NA:I-E
• Spacer_info: 4 spacers
• Cas_protein_info: WYL,csa3

Consensus repeat of NC_018524_25

Consensus_repeat	Method
CTGC--------TCCCCGCGCACGCGGGGATG	PILER-CR
CTGCTCCCCGCGCACGCGGGGATGACCCC	CRISPRCasFinder
CTGCTCCCCGCGCACGCGGGGATG	CRT

spacers of NC_018524_25

>25.1|4595378|37|NC_018524|PILER-CR,CRT
GACCCCGCCGTGTGTGGGCCGCGCTCGGCCCGATCCG
>25.2|4595439|36|NC_018524|PILER-CR,CRT
ACCCCCCCACGACGAGCGAAGTCCCCGTGCAGGTGC
>25.3|4595499|37|NC_018524|PILER-CR,CRT
ACCCCGCTACGCGGAACCTCGCGCACATCTGATGTGT
>25.4|4595560|37|NC_018524|PILER-CR,CRT
GACCCGTCGCCAAGCTGGATGCCAGCCGCCACGCGGT
>25.5|4595383|32|NC_018524|CRISPRCasFinder
CGCCGTGTGTGGGCCGCGCTCGGCCCGATCCG
>25.6|4595444|31|NC_018524|CRISPRCasFinder
CCCACGACGAGCGAAGTCCCCGTGCAGGTGC
>25.7|4595504|32|NC_018524|CRISPRCasFinder
GCTACGCGGAACCTCGCGCACATCTGATGTGT
>25.8|4595565|32|NC_018524|CRISPRCasFinder
GTCGCCAAGCTGGATGCCAGCCGCCACGCGGT

CRISPR arrays and Neighbor proteins around NC_018524_25

CRISPR arrays

The CRISPR arrays of NC_018524_25

>merge|NC_018524|25|4595354-4595625|PILER-CR,CRISPRCasFinder,CRT
CTGCTCCCCGCGCACGCGGGGATGGACCCCGCCGTGTGTGGGCCGCGCTCGGCCCGATCCGCTGCTCCCCGCGCACGCGGGGATGACCCCCCCACGACGAGCGAAGTCCCCGTGCAGGTGCCTGCTCCCCGCGCACGCGGGGATGACCCCGCTACGCGGAACCTCGCGCACATCTGATGTGTCTGCTCCCCGCGCACGCGGGGATGGACCCGTCGCCAAGCTGGATGCCAGCCGCCACGCGGTCTGCTCCCCGCGTACGCGGGGATGGGCCG

>NC_018524|25|14|4595354-4595620|PILER-CR
CTGCTCCCCGCGCACGCGGGGATG	GACCCCGCCGTGTGTGGGCCGCGCTCGGCCCGATCCG
CTGCTCCCCGCGCACGCGGGGATG	ACCCCCCCACGACGAGCGAAGTCCCCGTGCAGGTGC
CTGCTCCCCGCGCACGCGGGGATG	ACCCCGCTACGCGGAACCTCGCGCACATCTGATGTGT
CTGCTCCCCGCGCACGCGGGGATG	GACCCGTCGCCAAGCTGGATGCCAGCCGCCACGCGGT
CTGCTCCCCGCGTACGCGGGGATG

>NC_018524|25|24|4595354-4595625|CRISPRCasFinder
CTGCTCCCCGCGCACGCGGGGATGGACCC	CGCCGTGTGTGGGCCGCGCTCGGCCCGATCCG
CTGCTCCCCGCGCACGCGGGGATGACCCC	CCCACGACGAGCGAAGTCCCCGTGCAGGTGC
CTGCTCCCCGCGCACGCGGGGATGACCCC	GCTACGCGGAACCTCGCGCACATCTGATGTGT
CTGCTCCCCGCGCACGCGGGGATGGACCC	GTCGCCAAGCTGGATGCCAGCCGCCACGCGGT
CTGCTCCCCGCGTACGCGGGGATGGGCCG

>NC_018524|25|15|4595354-4595620|CRT
CTGCTCCCCGCGCACGCGGGGATG	GACCCCGCCGTGTGTGGGCCGCGCTCGGCCCGATCCG
CTGCTCCCCGCGCACGCGGGGATG	ACCCCCCCACGACGAGCGAAGTCCCCGTGCAGGTGC
CTGCTCCCCGCGCACGCGGGGATG	ACCCCGCTACGCGGAACCTCGCGCACATCTGATGTGT
CTGCTCCCCGCGCACGCGGGGATG	GACCCGTCGCCAAGCTGGATGCCAGCCGCCACGCGGT
CTGCTCCCCGCGTACGCGGGGATG

Neighbor Proteins Overview

Protein	Signature genes	Signature genes Name	Protein_function
NC_018524.1|WP_014908725.1|4584309_4584888_+|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl|CDD|224228
NC_018524.1|WP_014910539.1|4599808_4600363_+|NUDIX-hydrolase	unknown	unknown	gnl|CDD|239516
NC_018524.1|WP_014910693.1|4589205_4590099_+|LysR-family-transcriptional-regulator	unknown	unknown	gnl|CDD|223656
NC_018524.1|WP_041561956.1|4596314_4596698_+|helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl|CDD|223713
NC_018524.1|WP_014909082.1|4590315_4591158_+|aminoglycoside-3'-phosphotransferase	unknown	unknown	gnl|CDD|270699
NC_018524.1|WP_081536576.1|4600339_4601488_-|hypothetical-protein	unknown	unknown	gnl|CDD|276809
NC_018524.1|WP_187294482.1|4584967_4585552_+|GNAT-family-N-acetyltransferase	unknown	unknown	gnl|CDD|366181
NC_018524.1|WP_014912250.1|4594307_4595048_+|alpha/beta-hydrolase	unknown	unknown	gnl|CDD|223669
NC_018524.1|WP_014909852.1|4586347_4586794_+|NUDIX-domain-containing-protein	unknown	unknown	gnl|CDD|240039
NC_018524.1|WP_014908230.1|4603305_4603512_+|FxLD-family-lanthipeptide	unknown	unknown	gnl|CDD|275157
NC_018524.1|WP_041561960.1|4606509_4607646_+|lanthionine-synthetase-C-family-protein	unknown	unknown	gnl|CDD|271201
NC_018524.1|WP_051018317.1|4602071_4603295_+|methyltransferase,-FxLD-system	unknown	unknown	gnl|CDD|275158
NC_018524.1|WP_014913561.1|4585707_4586151_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014910064.1|4609006_4609183_-|DUF397-domain-containing-protein	unknown	unknown	gnl|CDD|377231
NC_018524.1|WP_014911461.1|4595774_4596224_-|VOC-family-protein	unknown	unknown	gnl|CDD|319917
NC_018524.1|WP_014913538.1|4596694_4597813_+|ACR3-family-arsenite-efflux-transporter	unknown	unknown	gnl|CDD|213563
NC_018524.1|WP_014911968.1|4593535_4594234_-|YafY-family-transcriptional-regulator	WYL	COG2378_WYL_CAS-I:CAS-III	gnl|CDD|225253
NC_018524.1|WP_014913545.1|4587887_4588562_+|ATPase-AAA	unknown	unknown	gnl|CDD|213205
NC_018524.1|WP_014911262.1|4597805_4598222_+|arsenate-reductase-ArsC	unknown	unknown	gnl|CDD|319973
NC_018524.1|WP_014912182.1|4588609_4589104_-|PACE-efflux-transporter	unknown	unknown	gnl|CDD|226610

HMMScan for Signature genes

Protein	Cas_name	Cas_description	E-value	Identity	Coverage
NC_018524.1|WP_014911968.1|4593535_4594234_-|YafY-family-transcriptional-regulator	WYL	COG2378_WYL_CAS-I:CAS-III	8.5e-51	168.0	0.0
NC_018524.1|WP_041561956.1|4596314_4596698_+|helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	4.5e-23	76.6	0.1

rpsblast for functional proteins

Protein	Function_ID	Function_description	E-value
NC_018524.1|WP_014908725.1|4584309_4584888_+|TetR/AcrR-family-transcriptional-regulator	gnl|CDD|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	6.78149e-06
NC_018524.1|WP_014910539.1|4599808_4600363_+|NUDIX-hydrolase	gnl|CDD|239516	cd03424, ADPRase_NUDT5, ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate. Like other members of the Nudix hydrolase superfamily, it requires a divalent cation, such as Mg2+, for its activity. It also contains a highly conserved 23-residue Nudix motif (GX5EX7REUXEEXGU, where U = I, L or V) which functions as a metal binding site/catalytic site. In addition to the Nudix motif, there are additional conserved amino acid residues, distal from the signature sequence, that correlate with substrate specificity. In humans, there are four distinct ADPRase activities, three putative cytosolic enzymes (ADPRase-I, -II, and -Mn) and a single mitochondrial enzyme (ADPRase-m). Human ADPRase-II is also referred to as NUDT5. It lacks the N-terminal target sequence unique to mitochondrial ADPRase. The different cytosolic types are distinguished by their specificities for substrate and specific requirement for metal ions. NUDT5 forms a homodimer.	4.39346e-27
NC_018524.1|WP_014910693.1|4589205_4590099_+|LysR-family-transcriptional-regulator	gnl|CDD|223656	COG0583, LysR, Transcriptional regulator [Transcription].	9.06008e-33
NC_018524.1|WP_041561956.1|4596314_4596698_+|helix-turn-helix-transcriptional-regulator	gnl|CDD|223713	COG0640, ArsR, Predicted transcriptional regulators [Transcription].	4.27648e-20
NC_018524.1|WP_014909082.1|4590315_4591158_+|aminoglycoside-3'-phosphotransferase	gnl|CDD|270699	cd05150, APH, Aminoglycoside 3'-phosphotransferase. APH catalyzes the transfer of the gamma-phosphoryl group from ATP to aminoglycoside antibiotics such as kanamycin, streptomycin, neomycin, and gentamicin, among others. The aminoglycoside antibiotics target the 30S ribosome and promote miscoding, leading to the production of defective proteins which insert into the bacterial membrane, resulting in membrane damage and the ultimate demise of the bacterium. Phosphorylation of the aminoglycoside antibiotics results in their inactivation, leading to bacterial antibiotic resistance. The APH gene is found on transposons and plasmids and is thought to have originated as a self-defense mechanism used by microorganisms that produce the antibiotics. The APH subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K).	9.80962e-82
NC_018524.1|WP_081536576.1|4600339_4601488_-|hypothetical-protein	gnl|CDD|276809	sd00006, TPR, Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.	0.00137544
NC_018524.1|WP_187294482.1|4584967_4585552_+|GNAT-family-N-acetyltransferase	gnl|CDD|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	1.44368e-22
NC_018524.1|WP_014912250.1|4594307_4595048_+|alpha/beta-hydrolase	gnl|CDD|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	5.06176e-07
NC_018524.1|WP_014909852.1|4586347_4586794_+|NUDIX-domain-containing-protein	gnl|CDD|240039	cd04683, Nudix_Hydrolase_24, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.	3.33865e-48
NC_018524.1|WP_014908230.1|4603305_4603512_+|FxLD-family-lanthipeptide	gnl|CDD|275157	TIGR04363, hypothetical_protein, FxLD family lantipeptide. Members of this protein family occur with a cassette of lanthionine-type peptide modification enzymes. Members are small (about 60 amino acids long), rich in Cys, and variable in copy number per genome (from one to three). These features suggest that members of this family are modified to become lantipeptides, although not necessarily a lantibiotic. There is no GlyGly cleavage motif to separate a leader peptide from core region.The considerable abundance in Streptomyces and relatively strong consideration hints at a non-antibiotic function. The motif FxLD in the N-terminal region is nearly invariant.	0.00561373
NC_018524.1|WP_041561960.1|4606509_4607646_+|lanthionine-synthetase-C-family-protein	gnl|CDD|271201	cd04793, LanC, Cyclases involved in the biosynthesis of lantibiotics. LanC is the cyclase enzyme of the lanthionine synthetase. Lanthinoine is a lantibiotic, a unique class of peptide antibiotics. They are ribosomally synthesized as precursor peptides and then post-translationally modified to contain thioether cross-links called lanthionines (Lans) or methyllanthionines (MeLans) in addition to 2,3-didehydroalanine (Dha) and (Z)-2,3-didehydrobutyrine (Dhb). These unusual amino acids are introduced by the dehydration of serine and threonine residues, followed by thioether formation via addition of cysteine thiols, catalysed by LanB and LanC or LanM. LanC, the cyclase component, is a zinc metalloprotein, whose bound metal has been proposed to activate the thiol substrate for nucleophilic addition. Also contains SpaC (the cyclase involved in the biosynthesis of subtilin), NisC, and homologs.	4.30675e-94
NC_018524.1|WP_051018317.1|4602071_4603295_+|methyltransferase,-FxLD-system	gnl|CDD|275158	TIGR04364, methyltran_FxLD, methyltransferase, FxLD system. Members of this family resemble occur regularly in the vicinity of lantibiotic biosynthesis enzymes and their probable target, the FxLD family of putative ribosomal natural product precursor (TIGR04363). Members resemble protein-L-isoaspartate O-methyltransferase (TIGR00080) and a predicted methyltranserase, TIGR04188, of another putative peptide modification system.	3.02023e-139
NC_018524.1|WP_014910064.1|4609006_4609183_-|DUF397-domain-containing-protein	gnl|CDD|377231	pfam04149, DUF397, Domain of unknown function (DUF397). The function of this family is unknown.	7.2666e-13
NC_018524.1|WP_014911461.1|4595774_4596224_-|VOC-family-protein	gnl|CDD|319917	cd07254, VOC_like, uncharacterized subfamily of vicinal oxygen chelate (VOC) family. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	6.65854e-46
NC_018524.1|WP_014913538.1|4596694_4597813_+|ACR3-family-arsenite-efflux-transporter	gnl|CDD|213563	TIGR00832, Uncharacterized_transporter_slr0944, arsenical-resistance protein. The Arsenical Resistance-3 (ACR3) Family (TC 2.A.59) The first protein of the ACR3 family functionally characterized was the ACR3 protein of Saccharomyces cerevisiae. It is present in the yeast plasma membrane and pumps arsenite out of the cell in response to the pmf. Similar proteins are found in bacteria, often as part of a four gene operon with an regulatory protein ArsR, a protein of unknown function ArsH, and an arsenate reductase that converts arsenate to arsenite to facilitate transport. [Cellular processes, Detoxification, Transport and binding proteins, Anions].	1.05948e-142
NC_018524.1|WP_014911968.1|4593535_4594234_-|YafY-family-transcriptional-regulator	gnl|CDD|225253	COG2378, COG2378, Predicted transcriptional regulator [Transcription].	6.50312e-46
NC_018524.1|WP_014913545.1|4587887_4588562_+|ATPase-AAA	gnl|CDD|213205	cd03238, ABC_UvrA, ATP-binding cassette domain of the excision repair protein UvrA. Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion. Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins. Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins, and UvrB having one ATP binding site that is structurally related to that of helicases.	5.08446e-05
NC_018524.1|WP_014911262.1|4597805_4598222_+|arsenate-reductase-ArsC	gnl|CDD|319973	cd16345, LMWP_ArsC, Arsenate reductase of the LMWP family. Arsenate reductase plays an important role in the reduction of intracellular arsenate to arsenite, an important step in arsenic detoxification. The reduction involves three different thiolate nucleophiles. In arsenate reductases of the LMWP family, reduction can be coupled with thioredoxin (Trx)/thioredoxin reductase (TrxR) or glutathione (GSH)/glutaredoxin (Grx).	3.31843e-50
NC_018524.1|WP_014912182.1|4588609_4589104_-|PACE-efflux-transporter	gnl|CDD|226610	COG4125, COG4125, Predicted membrane protein [Function unknown].	2.73247e-46

Protein sequences

>NC_018524.1|WP_014912250.1|4594307_4595048_+|alpha/beta-hydrolase
MATTTNSPTIVLIAGHWLGAWAWDEVLEHLETDHVRAVAVTLPGLDGDDPARSTRTLDDQVEAIEGLLARLDVSEERPATLVAHSGANGPVSLLLDRRPELVRRVVWVDSGPMANGSAFAPDFPEEVEELPLPPFDVLAEQASLDGLSTEVLERFRSRAVPEPGPVLRQTVELTNDARRTVPTTLVCCSISSEQVLEMAQGGHPMFAEVANLETLDIIDLPTGHWPMWSRPGDLAEVIRSAASRAG
>NC_018524.1|WP_014911968.1|4593535_4594234_-|YafY-family-transcriptional-regulator
MKRAERLHAISETLRRSGTRGVSAEWLAREFEVSVRTVKRDLDALKNSGAPIWSRPGPGGGYGLTTGASLPPISLSPVQAVALMAAVSAAPGAPYADLAAAGVRKIMDVLDPGTRARADELAHRVWVDAPPSSSRATRSALEEAMTEQRVIRIRYASREGTATTRDVEPVLFASTNGRWYLIGWCRLRDAMRWFAVSRIEQATVTKTACSGRTVHEVGEPPANARPVHGRGE
>NC_018524.1|WP_014909082.1|4590315_4591158_+|aminoglycoside-3'-phosphotransferase
MADAWEVIGRALGAVRQESIGLGLSGARVLRMVDAQGVPVAVVKVVDHRMGHLVSEFEAETARLAWLRRLGVPVPEVLGSGVDEGESWLAMRALPGRPASDPWPAGEQDRVVDLLAHAARELHAASWEDTPFDRSLSSVLVEVRERVASGLVDRSWVIAGKEGPPAAVVLEELESLAGELGDGIPVVSHGDFCLPNVLIDETGTAGLVDVGRAGLADPHSDLADMTRSLRSHMNPQYGEVSAHRFLDAYGRDGIDPERLRLHDLLESFFWPVPEAHTPGG
>NC_018524.1|WP_014910693.1|4589205_4590099_+|LysR-family-transcriptional-regulator
MGLSSDNIDLFLAVVDHGSFSAAARALNRVPSAVSMGIANIEAELGYPLFDRSRREPVPTARAQALVPHARLVASRLRLLQAHAVELSDDLESTLTIGVSAGVDHRPLLDAVAEIAARHPLLSVELADAPQDDVREQLHSGAVDLALMFARTRNDREEVFLNVAEETFVAVASASVETFGIPADLRRLEDLAGARQIVVSTLERPLTERRLVVSDAYWRVNSAETALGLVERGIGWANLPLPLVRGRAAAGAVRVMEFENLENGLAMPVQLVWLRGSPLRKAAGELVDRMGRDWRRG
>NC_018524.1|WP_014912182.1|4588609_4589104_-|PACE-efflux-transporter
MQGLKRKLVYVGGYEVIGFIVGTAVMTALTGSGPGTTAPLAIMIATVAALWNMAFNYLFEAWERRQVSRERTVKRRILHAVAFQLTLVCYLIPLIAWWLDMSLLQAFLLDLVFIVYIPFYTFGYNWAFDKIFGLPSSAIADPVPEVEDGAAVSVEEPATTAERS
>NC_018524.1|WP_014913545.1|4587887_4588562_+|ATPase-AAA
MVQGRARDVPMVNDAMARGAVYPRRSLVLVAGVPGAGKSTLLKRLFGLRGDEDRTVLTADGVRVIDSLQSRYRLRSMLARVPYLLWRWVVHVLHLARVVAALRGGPVVVHECGTRRSVRVLLALLCRLRRYELHVLMIDATPQEAWRGQNSRGRQVTERSHRTHSRRWRRLRAAALHGPAAFARGARSLLALDRRRARELAWIRFGPGADARGPLRTVMESPSP
>NC_018524.1|WP_014909852.1|4586347_4586794_+|NUDIX-domain-containing-protein
MPERYRSIIDVHVILPRGEKILLLERRNTGYCDGMLHLPSGHLDEGEPIPHGAAREAREEVGVDIDPADLGLVAVVHHRQREDLARVGMFFLAEKWSGEPVVAEPDKAGELVWADPRALPSNTIPYPAEGIRAWVSGDRFVLHGWSAA
>NC_018524.1|WP_014913561.1|4585707_4586151_-|hypothetical-protein
MTRIGITGHSNLTADSVPLVRRALAEALAPYKKDDLVGVSCLARGADQIFAEVVLEADGRLEVVLPSVDYREAKVKPYNLEQFDDLLMRSTLVRYMPHKTAGRQAYEDANETVLGGIDRLVAVWDGQPSGGKGGTGDAVEGYGAHRE
>NC_018524.1|WP_187294482.1|4584967_4585552_+|GNAT-family-N-acetyltransferase
MTPPGSRSAQRETAGAITYRVAESESDRSAVIRGEFTSDTVFEVVVSEDGFGIRPTRLDATIHKVFPDDEPQDDEPSENGHRFVALDGDEVCGYVDTEYEPWNQRLVIADIEVAGAYRGRGIGRALMDHAIDRARERGAGHVWLEVTNMNAPAIRAYQRMGFTFCGLDTSLYSGTESEGETALYMSLFLAPAGE
>NC_018524.1|WP_014908725.1|4584309_4584888_+|TetR/AcrR-family-transcriptional-regulator
MRSPVGEGKKRLLEALFDEFGENGPGPNLSMRQVAERLGVHHTLLTYHFGSRPGLLRAVLLEARRRDNVVIAATGDELGFVALCRAIWDFYSDPAHEDRIHAFFHLVGLAVYERDAFQELVVDIDDLARLLEAAALRDGATETDARQRSIIATAGLRGLLLQRLLTPTAEVDAAAERFIASLAAFEGEGRAV
>NC_018524.1|WP_014911461.1|4595774_4596224_-|VOC-family-protein
MSRVQLALNVADLEASVVFYSTLFGVEPAKRRPGYANFAISEPPLKLVLIEGEPDQETRLDHLGVEVEATEQVNAATQRFKDSGLATFEENDTSCCYAVQDKVWVHGPGKEPWEVYVVKSDSDQRGAAPREVNTGVAGEASGCCATAQV
>NC_018524.1|WP_041561956.1|4596314_4596698_+|helix-turn-helix-transcriptional-regulator
MSNQEVGATDLQGAVADCCPRLLKEPLEDGESVELARVFKALGDPVRLRLLSMIATCDGDEVCVCDLTPAFDLSQPTISHHLKLLREAGLISSVRRGTWVYYRLIPETTDRLAAILTRSMKSEEAGS
>NC_018524.1|WP_014913538.1|4596694_4597813_+|ACR3-family-arsenite-efflux-transporter
MSAPASTDPNAGVVGRLSALDRFLTVWILAAMVAGLALGRLVPGLGEALSGVGVAGVSLPIAVGLLVMMFPPLAKVRYDRLGAVTGDRRMLITSLAVNWLAGPALMFALAWAFLPDLPEYRTGLIIVGLARCIAMVIVWNDLACGDREAAAVLVALNSLFQVVAFGALGWFYLSALPGWLGLGQAALEVSFVDISVSVVIFLGVPLLAGYLTRRLGERARGREWYETRLLPKLGPWGLYGLLFTIVMLFALQGEAITSRPWDVARIALPLLLYFVIMWAGTLALGRALGMGYPRSVTLAFTAAGNNFELAIAVAIASFGAASGQALAGVVGPLIEVPVLIALVYVALAARRWFPGEGAAEVSTATTKETTGD
>NC_018524.1|WP_014911262.1|4597805_4598222_+|arsenate-reductase-ArsC
MTDRSEAVIPRVLFVCVHNAGRSQMAAAFLEHLGGDRVEVRSAGSAPADEVNPAVVEAMGEVGIDITAGTPKLLTPDAVRASDVVVTMGCGDACPFFPGKRYLDWELPDPAGRGVEAVRPILDRIKRHVEDLLRELVP
>NC_018524.1|WP_014910539.1|4599808_4600363_+|NUDIX-hydrolase
MGHTESSEDDNGRWIVHGERAIYDSRWVRLGKADITTPSGSRFEHHTVTLPSAAVIAIVDRAGEHVLMSYRHRFVPDAWGWELPGGLLDPEETPEQTAVREALEETGHRVGSVEHVATFEPMIGTVRSPHHVFVGRDADLVADPTEFDEGVYEWVPLAEIRGLISTGHVQSSGTLIALLHILAS
>NC_018524.1|WP_081536576.1|4600339_4601488_-|hypothetical-protein
MRQAWETRDAATVVRLVLWNSELSQTKLSQILGISQSTISEAVSGKSQIARQSSRNAIFEGLDILRPPLPPKVATALTATPQATEPSGEAQERLEIASIDQALIGLFEARTQNLRLIDRKLGAHYLLAQSQAHVQQMHDLLRRSLPGPVRRGLARALAEAASLTGWQALDSGRSATAWRYYEIAKAAARESEDKAVLAHVSAEQSYVLLDNGYERGALATLRAARDDAGASLPSLLSSWMWAAEGEVCATLGEEPEAKRALERAFALLPPEPQDPSLPFLMLDRTHLLRWRGHCLARLGDSEAIEDLTRALDCIVPLELGRAEAGLRTDLALAYTVHGDTTQAHRQAARAAELSDQSGSVRQRSRLARLLPQRTTSRSEDVE
>NC_018524.1|WP_051018317.1|4602071_4603295_+|methyltransferase,-FxLD-system
MVDALVEERADLGMEKLPEQVEEALRAVPREVFVPGLPLVEAYDRHQAIVTKHDEAKRVALSSVSAPSIIALMLQRADIRPGHRVLEIGSGGYNAALISHLVGETGQVTSIDIDPDVIARAERCLKEAGVDQVHLAVTDGEHGFASRAPYDRIIVTAGAWDLSPSWEEQLAVGGRVVVPMRVRGLTRCLTLERAEEPGHWRSLAADMCGFVRMQGVGEHWERMPLLHQEEGSQVGLRLEDGPQVDVDALRRALTQDGETVWAGVCVRADEPTDALDLYLASAADGWALLTAQRGAITSKLIRPVVLMGTPAMVDEEGESFSYRALRRSPDDEELYEFGAVEHGPAGRRVAQNMVDLIGVWDREHRGGPGPRIDLVPIDTAAEDLPTGRVVSKRHTHMILNWTANPFE
>NC_018524.1|WP_014908230.1|4603305_4603512_+|FxLD-family-lanthipeptide
MSALTATPTPAGLIATGRDRALSLDGDLFDLDLRVQVPVTDESLWSMTNDGCGQTCETACTQSCTDNG
>NC_018524.1|WP_041561960.1|4606509_4607646_+|lanthionine-synthetase-C-family-protein
MPSSESLPTRPTTPRVNGRSPLSLAKGDLGIALAHSIQGSSPTIVHTWLSAALRDATGRAGLFHGLPAVAFVLAHTSSEHYRQARATVRDHLRRMTVHRLKAAHGRIDRGDLTSFAEYDLVSGLTGVGVAVWALDPDSPLLERVLSYLVRLTRPVGHEGRSFPGWWTRHGPLGHRDPDFPHGHANIGMAHGLGGILSLLSLAYRDGRTVPAHREALETLIATLDEKRRHDEAGSWWPRWFTTGGSPTDVRPGPPSWCYGAPGLIRAQHLAALALGDEPRRRDIEDTLIRTLTDQPALDRIADASLCHGWAGLVLLVRAVAADSPEPQRFTPPLEDLITRLADGVNHLSEPGLLEGRAGARLALEGSGSTHWTRLLLLT
>NC_018524.1|WP_014910064.1|4609006_4609183_-|DUF397-domain-containing-protein
MMNEHWKKSTYSGGSGSCVEARATAQGAAIRDTQHRHLAELSLPNAEWTALLHALRTR

Crispr_ID: NC_018524_26

• CRISPR_ID: NC_018524_26
• CRISPR_location: 4598543-4599632
• CRISPR_type: Orphan
• Repeat_type: A:N
• Spacer_info: 17 spacers
• Cas_protein_info: csa3,WYL

Consensus repeat of NC_018524_26

Consensus_repeat	Method
CTGC--------TCCCCGCGCACGCGGGGATG	PILER-CR
CTGCTCCCCGCGCACGCGGGGATGACCCC	CRISPRCasFinder
CTGCTCCCCGCGCACGCGGGGATGNNCCC	CRT

spacers of NC_018524_26

>26.1|4598567|37|NC_018524|PILER-CR
ACCCCCGTAGGTGAGGCGTCCGGCCGTCGGGCGCCTC
>26.2|4598628|37|NC_018524|PILER-CR
ACCCCTTGTTCGCCTGCTCGGCGGTGAGCTTCACGAC
>26.3|4598689|37|NC_018524|PILER-CR
ACCCCCGACAGAAACGACAGGAACCAGATGAACCCTC
>26.4|4598750|37|NC_018524|PILER-CR
ACCCCGACCCCGCGTTCACCGATGCCGTGACCGATTG
>26.5|4598811|37|NC_018524|PILER-CR
ACCCTCGGTAGTGTCCGCCGTCTCCCGGGGGGTGGCT
>26.6|4598872|37|NC_018524|PILER-CR
ACCCCCACCAGACGCCGTGCTCGTCCGGCTGGCCGAA
>26.7|4598933|37|NC_018524|PILER-CR
GACCCGGCGGCAGGCCGGTACGGTGCCGCCATGGATC
>26.8|4598994|37|NC_018524|PILER-CR
GACCCCGCGTTCGCGGCTGGACACGCTCACGATCATC
>26.9|4599055|37|NC_018524|PILER-CR
GACCCCAGGCCCTGGAGGACAGCCGGTCCGCCCGCGC
>26.10|4599116|37|NC_018524|PILER-CR
GACCCAAGCCCTACAAGCTCTCGGTGTCATGGCTGCC
>26.11|4599177|37|NC_018524|PILER-CR
GACCCACGGAGCTCGTCGAGCTCGACATCGCGGGCTC
>26.12|4599238|37|NC_018524|PILER-CR
ACCCGACCTCGAACTCGCGGCGCTCGCGGCCGTCACG
>26.13|4599299|38|NC_018524|PILER-CR
ACCCCGACCTCACCAGGAAGGACCACCACTGATGAGCC
>26.14|4599361|37|NC_018524|PILER-CR
ACCCCTGGGGTGAGATCCTCCCGTCCTAGTCAGGATG
>26.15|4598572|32|NC_018524|CRISPRCasFinder,CRT
CGTAGGTGAGGCGTCCGGCCGTCGGGCGCCTC
>26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT
TTGTTCGCCTGCTCGGCGGTGAGCTTCACGAC
>26.17|4598694|32|NC_018524|CRISPRCasFinder,CRT
CGACAGAAACGACAGGAACCAGATGAACCCTC
>26.18|4598755|32|NC_018524|CRISPRCasFinder,CRT
GACCCCGCGTTCACCGATGCCGTGACCGATTG
>26.19|4598816|32|NC_018524|CRISPRCasFinder,CRT
CGGTAGTGTCCGCCGTCTCCCGGGGGGTGGCT
>26.20|4598877|32|NC_018524|CRISPRCasFinder,CRT
CACCAGACGCCGTGCTCGTCCGGCTGGCCGAA
>26.21|4598938|32|NC_018524|CRISPRCasFinder,CRT
GGCGGCAGGCCGGTACGGTGCCGCCATGGATC
>26.22|4598999|32|NC_018524|CRISPRCasFinder,CRT
CGCGTTCGCGGCTGGACACGCTCACGATCATC
>26.23|4599060|32|NC_018524|CRISPRCasFinder,CRT
CAGGCCCTGGAGGACAGCCGGTCCGCCCGCGC
>26.24|4599121|32|NC_018524|CRISPRCasFinder,CRT
AAGCCCTACAAGCTCTCGGTGTCATGGCTGCC
>26.25|4599182|32|NC_018524|CRISPRCasFinder,CRT
ACGGAGCTCGTCGAGCTCGACATCGCGGGCTC
>26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT
ACCTCGAACTCGCGGCGCTCGCGGCCGTCACG
>26.27|4599304|33|NC_018524|CRISPRCasFinder,CRT
GACCTCACCAGGAAGGACCACCACTGATGAGCC
>26.28|4599366|32|NC_018524|CRISPRCasFinder,CRT
TGGGGTGAGATCCTCCCGTCCTAGTCAGGATG
>26.29|4599427|32|NC_018524|CRISPRCasFinder,CRT
CTCAGAGCAGCGGTACCAAACCTGAGCACCGA
>26.30|4599488|55|NC_018524|CRISPRCasFinder,CRT
GCCCGTCCGGTCAGGGCGCTCCTTCCGCACGGGGCACCGGCCCGTGACCATCAAA
>26.31|4599572|32|NC_018524|CRISPRCasFinder,CRT
TGGAGCGTCCGGTGCGGGGGTCTACGCGACGC

CRISPR arrays and Neighbor proteins around NC_018524_26

CRISPR arrays

The CRISPR arrays of NC_018524_26

>merge|NC_018524|26|4598543-4599632|PILER-CR,CRISPRCasFinder,CRT
CTGCTCCCCGCGCACGCGGGGATGACCCCCGTAGGTGAGGCGTCCGGCCGTCGGGCGCCTCCTGCTCCCCGCGCACGCGGGGATGACCCCTTGTTCGCCTGCTCGGCGGTGAGCTTCACGACCTGCTCCCCGCGCACGCGGGGATGACCCCCGACAGAAACGACAGGAACCAGATGAACCCTCCTGCTCCCCGCGCACGCGGGGATGACCCCGACCCCGCGTTCACCGATGCCGTGACCGATTGCTGCTCCCCGCGCACGCGGGGATGACCCTCGGTAGTGTCCGCCGTCTCCCGGGGGGTGGCTCTGCTCCCCGCGCACGCGGGGATGACCCCCACCAGACGCCGTGCTCGTCCGGCTGGCCGAACTGCTCCCCGCGCACGCGGGGATGGACCCGGCGGCAGGCCGGTACGGTGCCGCCATGGATCCTGCTCCCCGCGCACGCGGGGATGGACCCCGCGTTCGCGGCTGGACACGCTCACGATCATCCTGCTCCCCGCGCACGCGGGGATGGACCCCAGGCCCTGGAGGACAGCCGGTCCGCCCGCGCCTGCTCCCCGCGCACGCGGGGATGGACCCAAGCCCTACAAGCTCTCGGTGTCATGGCTGCCCTGCTCCCCGCGCACGCGGGGATGGACCCACGGAGCTCGTCGAGCTCGACATCGCGGGCTCCTGCTCCCCGCGCACGCGGGGATGACCCGACCTCGAACTCGCGGCGCTCGCGGCCGTCACGCTGCTCCCCGCGCACGCGGGGATGACCCCGACCTCACCAGGAAGGACCACCACTGATGAGCCCTGCTCCCCGCGCACGCGGGGATGACCCCTGGGGTGAGATCCTCCCGTCCTAGTCAGGATGCTGCTCCCCGCGCACGCGGGGATGACCCCCTCAGAGCAGCGGTACCAAACCTGAGCACCGACTGCTCCCCGCGCACGCGGGGATGACCCCGCCCGTCCGGTCAGGGCGCTCCTTCCGCACGGGGCACCGGCCCGTGACCATCAAACTGCTCCCCGCGCACGCGGGGATGACCCGTGGAGCGTCCGGTGCGGGGGTCTACGCGACGCCTGCTCCCCGCGCACGCGGGGATGGACTG

>NC_018524|26|15|4598543-4599421|PILER-CR
CTGCTCCCCGCGCACGCGGGGATG	ACCCCCGTAGGTGAGGCGTCCGGCCGTCGGGCGCCTC
CTGCTCCCCGCGCACGCGGGGATG	ACCCCTTGTTCGCCTGCTCGGCGGTGAGCTTCACGAC
CTGCTCCCCGCGCACGCGGGGATG	ACCCCCGACAGAAACGACAGGAACCAGATGAACCCTC
CTGCTCCCCGCGCACGCGGGGATG	ACCCCGACCCCGCGTTCACCGATGCCGTGACCGATTG
CTGCTCCCCGCGCACGCGGGGATG	ACCCTCGGTAGTGTCCGCCGTCTCCCGGGGGGTGGCT
CTGCTCCCCGCGCACGCGGGGATG	ACCCCCACCAGACGCCGTGCTCGTCCGGCTGGCCGAA
CTGCTCCCCGCGCACGCGGGGATG	GACCCGGCGGCAGGCCGGTACGGTGCCGCCATGGATC
CTGCTCCCCGCGCACGCGGGGATG	GACCCCGCGTTCGCGGCTGGACACGCTCACGATCATC
CTGCTCCCCGCGCACGCGGGGATG	GACCCCAGGCCCTGGAGGACAGCCGGTCCGCCCGCGC
CTGCTCCCCGCGCACGCGGGGATG	GACCCAAGCCCTACAAGCTCTCGGTGTCATGGCTGCC
CTGCTCCCCGCGCACGCGGGGATG	GACCCACGGAGCTCGTCGAGCTCGACATCGCGGGCTC
CTGCTCCCCGCGCACGCGGGGATG	ACCCGACCTCGAACTCGCGGCGCTCGCGGCCGTCACG
CTGCTCCCCGCGCACGCGGGGATG	ACCCCGACCTCACCAGGAAGGACCACCACTGATGAGCC
CTGCTCCCCGCGCACGCGGGGATG	ACCCCTGGGGTGAGATCCTCCCGTCCTAGTCAGGATG
CTGCTCCCCGCGCACGCGGGGATG

>NC_018524|26|25|4598543-4599632|CRISPRCasFinder
CTGCTCCCCGCGCACGCGGGGATGACCCC	CGTAGGTGAGGCGTCCGGCCGTCGGGCGCCTC
CTGCTCCCCGCGCACGCGGGGATGACCCC	TTGTTCGCCTGCTCGGCGGTGAGCTTCACGAC
CTGCTCCCCGCGCACGCGGGGATGACCCC	CGACAGAAACGACAGGAACCAGATGAACCCTC
CTGCTCCCCGCGCACGCGGGGATGACCCC	GACCCCGCGTTCACCGATGCCGTGACCGATTG
CTGCTCCCCGCGCACGCGGGGATGACCCT	CGGTAGTGTCCGCCGTCTCCCGGGGGGTGGCT
CTGCTCCCCGCGCACGCGGGGATGACCCC	CACCAGACGCCGTGCTCGTCCGGCTGGCCGAA
CTGCTCCCCGCGCACGCGGGGATGGACCC	GGCGGCAGGCCGGTACGGTGCCGCCATGGATC
CTGCTCCCCGCGCACGCGGGGATGGACCC	CGCGTTCGCGGCTGGACACGCTCACGATCATC
CTGCTCCCCGCGCACGCGGGGATGGACCC	CAGGCCCTGGAGGACAGCCGGTCCGCCCGCGC
CTGCTCCCCGCGCACGCGGGGATGGACCC	AAGCCCTACAAGCTCTCGGTGTCATGGCTGCC
CTGCTCCCCGCGCACGCGGGGATGGACCC	ACGGAGCTCGTCGAGCTCGACATCGCGGGCTC
CTGCTCCCCGCGCACGCGGGGATGACCCG	ACCTCGAACTCGCGGCGCTCGCGGCCGTCACG
CTGCTCCCCGCGCACGCGGGGATGACCCC	GACCTCACCAGGAAGGACCACCACTGATGAGCC
CTGCTCCCCGCGCACGCGGGGATGACCCC	TGGGGTGAGATCCTCCCGTCCTAGTCAGGATG
CTGCTCCCCGCGCACGCGGGGATGACCCC	CTCAGAGCAGCGGTACCAAACCTGAGCACCGA
CTGCTCCCCGCGCACGCGGGGATGACCCC	GCCCGTCCGGTCAGGGCGCTCCTTCCGCACGGGGCACCGGCCCGTGACCATCAAA
CTGCTCCCCGCGCACGCGGGGATGACCCG	TGGAGCGTCCGGTGCGGGGGTCTACGCGACGC
CTGCTCCCCGCGCACGCGGGGATGGACTG

>NC_018524|26|16|4598543-4599632|CRT
CTGCTCCCCGCGCACGCGGGGATGACCCC	CGTAGGTGAGGCGTCCGGCCGTCGGGCGCCTC
CTGCTCCCCGCGCACGCGGGGATGACCCC	TTGTTCGCCTGCTCGGCGGTGAGCTTCACGAC
CTGCTCCCCGCGCACGCGGGGATGACCCC	CGACAGAAACGACAGGAACCAGATGAACCCTC
CTGCTCCCCGCGCACGCGGGGATGACCCC	GACCCCGCGTTCACCGATGCCGTGACCGATTG
CTGCTCCCCGCGCACGCGGGGATGACCCT	CGGTAGTGTCCGCCGTCTCCCGGGGGGTGGCT
CTGCTCCCCGCGCACGCGGGGATGACCCC	CACCAGACGCCGTGCTCGTCCGGCTGGCCGAA
CTGCTCCCCGCGCACGCGGGGATGGACCC	GGCGGCAGGCCGGTACGGTGCCGCCATGGATC
CTGCTCCCCGCGCACGCGGGGATGGACCC	CGCGTTCGCGGCTGGACACGCTCACGATCATC
CTGCTCCCCGCGCACGCGGGGATGGACCC	CAGGCCCTGGAGGACAGCCGGTCCGCCCGCGC
CTGCTCCCCGCGCACGCGGGGATGGACCC	AAGCCCTACAAGCTCTCGGTGTCATGGCTGCC
CTGCTCCCCGCGCACGCGGGGATGGACCC	ACGGAGCTCGTCGAGCTCGACATCGCGGGCTC
CTGCTCCCCGCGCACGCGGGGATGACCCG	ACCTCGAACTCGCGGCGCTCGCGGCCGTCACG
CTGCTCCCCGCGCACGCGGGGATGACCCC	GACCTCACCAGGAAGGACCACCACTGATGAGCC
CTGCTCCCCGCGCACGCGGGGATGACCCC	TGGGGTGAGATCCTCCCGTCCTAGTCAGGATG
CTGCTCCCCGCGCACGCGGGGATGACCCC	CTCAGAGCAGCGGTACCAAACCTGAGCACCGA
CTGCTCCCCGCGCACGCGGGGATGACCCC	GCCCGTCCGGTCAGGGCGCTCCTTCCGCACGGGGCACCGGCCCGTGACCATCAAA
CTGCTCCCCGCGCACGCGGGGATGACCCG	TGGAGCGTCCGGTGCGGGGGTCTACGCGACGC
CTGCTCCCCGCGCACGCGGGGATGGACTG

Neighbor Proteins Overview

Protein	Signature genes	Signature genes Name	Protein_function
NC_018524.1|WP_081536576.1|4600339_4601488_-|hypothetical-protein	unknown	unknown	gnl|CDD|276809
NC_018524.1|WP_041562252.1|4611362_4611671_+|ATP-binding-protein	unknown	unknown	gnl|CDD|340413
NC_018524.1|WP_014910539.1|4599808_4600363_+|NUDIX-hydrolase	unknown	unknown	gnl|CDD|239516
NC_018524.1|WP_014913538.1|4596694_4597813_+|ACR3-family-arsenite-efflux-transporter	unknown	unknown	gnl|CDD|213563
NC_018524.1|WP_041561956.1|4596314_4596698_+|helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl|CDD|223713
NC_018524.1|WP_014909082.1|4590315_4591158_+|aminoglycoside-3'-phosphotransferase	unknown	unknown	gnl|CDD|270699
NC_018524.1|WP_014910064.1|4609006_4609183_-|DUF397-domain-containing-protein	unknown	unknown	gnl|CDD|377231
NC_018524.1|WP_014912250.1|4594307_4595048_+|alpha/beta-hydrolase	unknown	unknown	gnl|CDD|223669
NC_018524.1|WP_014910597.1|4609282_4609459_-|DUF397-domain-containing-protein	unknown	unknown	gnl|CDD|377231
NC_018524.1|WP_014908230.1|4603305_4603512_+|FxLD-family-lanthipeptide	unknown	unknown	gnl|CDD|275157
NC_018524.1|WP_041561960.1|4606509_4607646_+|lanthionine-synthetase-C-family-protein	unknown	unknown	gnl|CDD|271201
NC_018524.1|WP_051018317.1|4602071_4603295_+|methyltransferase,-FxLD-system	unknown	unknown	gnl|CDD|275158
NC_018524.1|WP_041561961.1|4609927_4610689_-|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl|CDD|238045
NC_018524.1|WP_014911461.1|4595774_4596224_-|VOC-family-protein	unknown	unknown	gnl|CDD|319917
NC_018524.1|WP_014910693.1|4589205_4590099_+|LysR-family-transcriptional-regulator	unknown	unknown	gnl|CDD|223656
NC_018524.1|WP_014911262.1|4597805_4598222_+|arsenate-reductase-ArsC	unknown	unknown	gnl|CDD|319973
NC_018524.1|WP_014913545.1|4587887_4588562_+|ATPase-AAA	unknown	unknown	gnl|CDD|213205
NC_018524.1|WP_014911968.1|4593535_4594234_-|YafY-family-transcriptional-regulator	WYL	COG2378_WYL_CAS-I:CAS-III	gnl|CDD|225253
NC_018524.1|WP_014909802.1|4609757_4609931_-|DUF397-domain-containing-protein	unknown	unknown	gnl|CDD|377231
NC_018524.1|WP_014912182.1|4588609_4589104_-|PACE-efflux-transporter	unknown	unknown	gnl|CDD|226610

HMMScan for Signature genes

Protein	Cas_name	Cas_description	E-value	Identity	Coverage
NC_018524.1|WP_014911968.1|4593535_4594234_-|YafY-family-transcriptional-regulator	WYL	COG2378_WYL_CAS-I:CAS-III	8.5e-51	168.0	0.0
NC_018524.1|WP_041561956.1|4596314_4596698_+|helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	4.5e-23	76.6	0.1

rpsblast for functional proteins

Protein	Function_ID	Function_description	E-value
NC_018524.1|WP_081536576.1|4600339_4601488_-|hypothetical-protein	gnl|CDD|276809	sd00006, TPR, Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.	0.00137544
NC_018524.1|WP_041562252.1|4611362_4611671_+|ATP-binding-protein	gnl|CDD|340413	cd16936, HATPase_RsbW-like, Histidine kinase-like ATPase domain of RsbW, an anti sigma-B factor and serine-protein kinase involved in regulating sigma-B during stress in Bacilli, and related domains. This family includes histidine kinase-like ATPase (HATPase) domain of RsbW, an anti sigma-B factor as well as a serine-protein kinase involved in regulating sigma-B during stress in Bacilli. The alternative sigma factor sigma-B is an important regulator of the general stress response of Bacillus cereus and B. subtilis. RsbW is an anti-sigma factor while RsbV is an anti-sigma factor antagonist (anti-anti-sigma factor). RsbW can also act as a kinase on RsbV. In a partner-switching mechanism, RsbW, RsbV, and sigma-B participate as follows: in non-stressed cells, sigma-B is present in an inactive form complexed with RsbW; in this form, sigma-B is unable to bind to RNA polymerase. Under stress, RsbV binds to RsbW, forming an RsbV-RsbW complex, and sigma-B is released to bind to RNA polymerase. RsbW may then act as a kinase on RsbV, phosphorylating a serine residue; RsbW is then released to bind to sigma-B, hence blocking its ability to bind RNA polymerase. A phosphatase then dephosphorylates RsbV so that it can again form a complex with RsbW, leading to the release of sigma-B.	5.76437e-06
NC_018524.1|WP_014910539.1|4599808_4600363_+|NUDIX-hydrolase	gnl|CDD|239516	cd03424, ADPRase_NUDT5, ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate. Like other members of the Nudix hydrolase superfamily, it requires a divalent cation, such as Mg2+, for its activity. It also contains a highly conserved 23-residue Nudix motif (GX5EX7REUXEEXGU, where U = I, L or V) which functions as a metal binding site/catalytic site. In addition to the Nudix motif, there are additional conserved amino acid residues, distal from the signature sequence, that correlate with substrate specificity. In humans, there are four distinct ADPRase activities, three putative cytosolic enzymes (ADPRase-I, -II, and -Mn) and a single mitochondrial enzyme (ADPRase-m). Human ADPRase-II is also referred to as NUDT5. It lacks the N-terminal target sequence unique to mitochondrial ADPRase. The different cytosolic types are distinguished by their specificities for substrate and specific requirement for metal ions. NUDT5 forms a homodimer.	4.39346e-27
NC_018524.1|WP_014913538.1|4596694_4597813_+|ACR3-family-arsenite-efflux-transporter	gnl|CDD|213563	TIGR00832, Uncharacterized_transporter_slr0944, arsenical-resistance protein. The Arsenical Resistance-3 (ACR3) Family (TC 2.A.59) The first protein of the ACR3 family functionally characterized was the ACR3 protein of Saccharomyces cerevisiae. It is present in the yeast plasma membrane and pumps arsenite out of the cell in response to the pmf. Similar proteins are found in bacteria, often as part of a four gene operon with an regulatory protein ArsR, a protein of unknown function ArsH, and an arsenate reductase that converts arsenate to arsenite to facilitate transport. [Cellular processes, Detoxification, Transport and binding proteins, Anions].	1.05948e-142
NC_018524.1|WP_041561956.1|4596314_4596698_+|helix-turn-helix-transcriptional-regulator	gnl|CDD|223713	COG0640, ArsR, Predicted transcriptional regulators [Transcription].	4.27648e-20
NC_018524.1|WP_014909082.1|4590315_4591158_+|aminoglycoside-3'-phosphotransferase	gnl|CDD|270699	cd05150, APH, Aminoglycoside 3'-phosphotransferase. APH catalyzes the transfer of the gamma-phosphoryl group from ATP to aminoglycoside antibiotics such as kanamycin, streptomycin, neomycin, and gentamicin, among others. The aminoglycoside antibiotics target the 30S ribosome and promote miscoding, leading to the production of defective proteins which insert into the bacterial membrane, resulting in membrane damage and the ultimate demise of the bacterium. Phosphorylation of the aminoglycoside antibiotics results in their inactivation, leading to bacterial antibiotic resistance. The APH gene is found on transposons and plasmids and is thought to have originated as a self-defense mechanism used by microorganisms that produce the antibiotics. The APH subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K).	9.80962e-82
NC_018524.1|WP_014910064.1|4609006_4609183_-|DUF397-domain-containing-protein	gnl|CDD|377231	pfam04149, DUF397, Domain of unknown function (DUF397). The function of this family is unknown.	7.2666e-13
NC_018524.1|WP_014912250.1|4594307_4595048_+|alpha/beta-hydrolase	gnl|CDD|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	5.06176e-07
NC_018524.1|WP_014910597.1|4609282_4609459_-|DUF397-domain-containing-protein	gnl|CDD|377231	pfam04149, DUF397, Domain of unknown function (DUF397). The function of this family is unknown.	9.95809e-14
NC_018524.1|WP_014908230.1|4603305_4603512_+|FxLD-family-lanthipeptide	gnl|CDD|275157	TIGR04363, hypothetical_protein, FxLD family lantipeptide. Members of this protein family occur with a cassette of lanthionine-type peptide modification enzymes. Members are small (about 60 amino acids long), rich in Cys, and variable in copy number per genome (from one to three). These features suggest that members of this family are modified to become lantipeptides, although not necessarily a lantibiotic. There is no GlyGly cleavage motif to separate a leader peptide from core region.The considerable abundance in Streptomyces and relatively strong consideration hints at a non-antibiotic function. The motif FxLD in the N-terminal region is nearly invariant.	0.00561373
NC_018524.1|WP_041561960.1|4606509_4607646_+|lanthionine-synthetase-C-family-protein	gnl|CDD|271201	cd04793, LanC, Cyclases involved in the biosynthesis of lantibiotics. LanC is the cyclase enzyme of the lanthionine synthetase. Lanthinoine is a lantibiotic, a unique class of peptide antibiotics. They are ribosomally synthesized as precursor peptides and then post-translationally modified to contain thioether cross-links called lanthionines (Lans) or methyllanthionines (MeLans) in addition to 2,3-didehydroalanine (Dha) and (Z)-2,3-didehydrobutyrine (Dhb). These unusual amino acids are introduced by the dehydration of serine and threonine residues, followed by thioether formation via addition of cysteine thiols, catalysed by LanB and LanC or LanM. LanC, the cyclase component, is a zinc metalloprotein, whose bound metal has been proposed to activate the thiol substrate for nucleophilic addition. Also contains SpaC (the cyclase involved in the biosynthesis of subtilin), NisC, and homologs.	4.30675e-94
NC_018524.1|WP_051018317.1|4602071_4603295_+|methyltransferase,-FxLD-system	gnl|CDD|275158	TIGR04364, methyltran_FxLD, methyltransferase, FxLD system. Members of this family resemble occur regularly in the vicinity of lantibiotic biosynthesis enzymes and their probable target, the FxLD family of putative ribosomal natural product precursor (TIGR04363). Members resemble protein-L-isoaspartate O-methyltransferase (TIGR00080) and a predicted methyltranserase, TIGR04188, of another putative peptide modification system.	3.02023e-139
NC_018524.1|WP_041561961.1|4609927_4610689_-|helix-turn-helix-transcriptional-regulator	gnl|CDD|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	9.36486e-09
NC_018524.1|WP_014911461.1|4595774_4596224_-|VOC-family-protein	gnl|CDD|319917	cd07254, VOC_like, uncharacterized subfamily of vicinal oxygen chelate (VOC) family. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	6.65854e-46
NC_018524.1|WP_014910693.1|4589205_4590099_+|LysR-family-transcriptional-regulator	gnl|CDD|223656	COG0583, LysR, Transcriptional regulator [Transcription].	9.06008e-33
NC_018524.1|WP_014911262.1|4597805_4598222_+|arsenate-reductase-ArsC	gnl|CDD|319973	cd16345, LMWP_ArsC, Arsenate reductase of the LMWP family. Arsenate reductase plays an important role in the reduction of intracellular arsenate to arsenite, an important step in arsenic detoxification. The reduction involves three different thiolate nucleophiles. In arsenate reductases of the LMWP family, reduction can be coupled with thioredoxin (Trx)/thioredoxin reductase (TrxR) or glutathione (GSH)/glutaredoxin (Grx).	3.31843e-50
NC_018524.1|WP_014913545.1|4587887_4588562_+|ATPase-AAA	gnl|CDD|213205	cd03238, ABC_UvrA, ATP-binding cassette domain of the excision repair protein UvrA. Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion. Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins. Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins, and UvrB having one ATP binding site that is structurally related to that of helicases.	5.08446e-05
NC_018524.1|WP_014911968.1|4593535_4594234_-|YafY-family-transcriptional-regulator	gnl|CDD|225253	COG2378, COG2378, Predicted transcriptional regulator [Transcription].	6.50312e-46
NC_018524.1|WP_014909802.1|4609757_4609931_-|DUF397-domain-containing-protein	gnl|CDD|377231	pfam04149, DUF397, Domain of unknown function (DUF397). The function of this family is unknown.	5.20705e-14
NC_018524.1|WP_014912182.1|4588609_4589104_-|PACE-efflux-transporter	gnl|CDD|226610	COG4125, COG4125, Predicted membrane protein [Function unknown].	2.73247e-46

Protein sequences

>NC_018524.1|WP_014911262.1|4597805_4598222_+|arsenate-reductase-ArsC
MTDRSEAVIPRVLFVCVHNAGRSQMAAAFLEHLGGDRVEVRSAGSAPADEVNPAVVEAMGEVGIDITAGTPKLLTPDAVRASDVVVTMGCGDACPFFPGKRYLDWELPDPAGRGVEAVRPILDRIKRHVEDLLRELVP
>NC_018524.1|WP_014913538.1|4596694_4597813_+|ACR3-family-arsenite-efflux-transporter
MSAPASTDPNAGVVGRLSALDRFLTVWILAAMVAGLALGRLVPGLGEALSGVGVAGVSLPIAVGLLVMMFPPLAKVRYDRLGAVTGDRRMLITSLAVNWLAGPALMFALAWAFLPDLPEYRTGLIIVGLARCIAMVIVWNDLACGDREAAAVLVALNSLFQVVAFGALGWFYLSALPGWLGLGQAALEVSFVDISVSVVIFLGVPLLAGYLTRRLGERARGREWYETRLLPKLGPWGLYGLLFTIVMLFALQGEAITSRPWDVARIALPLLLYFVIMWAGTLALGRALGMGYPRSVTLAFTAAGNNFELAIAVAIASFGAASGQALAGVVGPLIEVPVLIALVYVALAARRWFPGEGAAEVSTATTKETTGD
>NC_018524.1|WP_041561956.1|4596314_4596698_+|helix-turn-helix-transcriptional-regulator
MSNQEVGATDLQGAVADCCPRLLKEPLEDGESVELARVFKALGDPVRLRLLSMIATCDGDEVCVCDLTPAFDLSQPTISHHLKLLREAGLISSVRRGTWVYYRLIPETTDRLAAILTRSMKSEEAGS
>NC_018524.1|WP_014911461.1|4595774_4596224_-|VOC-family-protein
MSRVQLALNVADLEASVVFYSTLFGVEPAKRRPGYANFAISEPPLKLVLIEGEPDQETRLDHLGVEVEATEQVNAATQRFKDSGLATFEENDTSCCYAVQDKVWVHGPGKEPWEVYVVKSDSDQRGAAPREVNTGVAGEASGCCATAQV
>NC_018524.1|WP_014912250.1|4594307_4595048_+|alpha/beta-hydrolase
MATTTNSPTIVLIAGHWLGAWAWDEVLEHLETDHVRAVAVTLPGLDGDDPARSTRTLDDQVEAIEGLLARLDVSEERPATLVAHSGANGPVSLLLDRRPELVRRVVWVDSGPMANGSAFAPDFPEEVEELPLPPFDVLAEQASLDGLSTEVLERFRSRAVPEPGPVLRQTVELTNDARRTVPTTLVCCSISSEQVLEMAQGGHPMFAEVANLETLDIIDLPTGHWPMWSRPGDLAEVIRSAASRAG
>NC_018524.1|WP_014911968.1|4593535_4594234_-|YafY-family-transcriptional-regulator
MKRAERLHAISETLRRSGTRGVSAEWLAREFEVSVRTVKRDLDALKNSGAPIWSRPGPGGGYGLTTGASLPPISLSPVQAVALMAAVSAAPGAPYADLAAAGVRKIMDVLDPGTRARADELAHRVWVDAPPSSSRATRSALEEAMTEQRVIRIRYASREGTATTRDVEPVLFASTNGRWYLIGWCRLRDAMRWFAVSRIEQATVTKTACSGRTVHEVGEPPANARPVHGRGE
>NC_018524.1|WP_014909082.1|4590315_4591158_+|aminoglycoside-3'-phosphotransferase
MADAWEVIGRALGAVRQESIGLGLSGARVLRMVDAQGVPVAVVKVVDHRMGHLVSEFEAETARLAWLRRLGVPVPEVLGSGVDEGESWLAMRALPGRPASDPWPAGEQDRVVDLLAHAARELHAASWEDTPFDRSLSSVLVEVRERVASGLVDRSWVIAGKEGPPAAVVLEELESLAGELGDGIPVVSHGDFCLPNVLIDETGTAGLVDVGRAGLADPHSDLADMTRSLRSHMNPQYGEVSAHRFLDAYGRDGIDPERLRLHDLLESFFWPVPEAHTPGG
>NC_018524.1|WP_014910693.1|4589205_4590099_+|LysR-family-transcriptional-regulator
MGLSSDNIDLFLAVVDHGSFSAAARALNRVPSAVSMGIANIEAELGYPLFDRSRREPVPTARAQALVPHARLVASRLRLLQAHAVELSDDLESTLTIGVSAGVDHRPLLDAVAEIAARHPLLSVELADAPQDDVREQLHSGAVDLALMFARTRNDREEVFLNVAEETFVAVASASVETFGIPADLRRLEDLAGARQIVVSTLERPLTERRLVVSDAYWRVNSAETALGLVERGIGWANLPLPLVRGRAAAGAVRVMEFENLENGLAMPVQLVWLRGSPLRKAAGELVDRMGRDWRRG
>NC_018524.1|WP_014912182.1|4588609_4589104_-|PACE-efflux-transporter
MQGLKRKLVYVGGYEVIGFIVGTAVMTALTGSGPGTTAPLAIMIATVAALWNMAFNYLFEAWERRQVSRERTVKRRILHAVAFQLTLVCYLIPLIAWWLDMSLLQAFLLDLVFIVYIPFYTFGYNWAFDKIFGLPSSAIADPVPEVEDGAAVSVEEPATTAERS
>NC_018524.1|WP_014913545.1|4587887_4588562_+|ATPase-AAA
MVQGRARDVPMVNDAMARGAVYPRRSLVLVAGVPGAGKSTLLKRLFGLRGDEDRTVLTADGVRVIDSLQSRYRLRSMLARVPYLLWRWVVHVLHLARVVAALRGGPVVVHECGTRRSVRVLLALLCRLRRYELHVLMIDATPQEAWRGQNSRGRQVTERSHRTHSRRWRRLRAAALHGPAAFARGARSLLALDRRRARELAWIRFGPGADARGPLRTVMESPSP
>NC_018524.1|WP_014910539.1|4599808_4600363_+|NUDIX-hydrolase
MGHTESSEDDNGRWIVHGERAIYDSRWVRLGKADITTPSGSRFEHHTVTLPSAAVIAIVDRAGEHVLMSYRHRFVPDAWGWELPGGLLDPEETPEQTAVREALEETGHRVGSVEHVATFEPMIGTVRSPHHVFVGRDADLVADPTEFDEGVYEWVPLAEIRGLISTGHVQSSGTLIALLHILAS
>NC_018524.1|WP_081536576.1|4600339_4601488_-|hypothetical-protein
MRQAWETRDAATVVRLVLWNSELSQTKLSQILGISQSTISEAVSGKSQIARQSSRNAIFEGLDILRPPLPPKVATALTATPQATEPSGEAQERLEIASIDQALIGLFEARTQNLRLIDRKLGAHYLLAQSQAHVQQMHDLLRRSLPGPVRRGLARALAEAASLTGWQALDSGRSATAWRYYEIAKAAARESEDKAVLAHVSAEQSYVLLDNGYERGALATLRAARDDAGASLPSLLSSWMWAAEGEVCATLGEEPEAKRALERAFALLPPEPQDPSLPFLMLDRTHLLRWRGHCLARLGDSEAIEDLTRALDCIVPLELGRAEAGLRTDLALAYTVHGDTTQAHRQAARAAELSDQSGSVRQRSRLARLLPQRTTSRSEDVE
>NC_018524.1|WP_051018317.1|4602071_4603295_+|methyltransferase,-FxLD-system
MVDALVEERADLGMEKLPEQVEEALRAVPREVFVPGLPLVEAYDRHQAIVTKHDEAKRVALSSVSAPSIIALMLQRADIRPGHRVLEIGSGGYNAALISHLVGETGQVTSIDIDPDVIARAERCLKEAGVDQVHLAVTDGEHGFASRAPYDRIIVTAGAWDLSPSWEEQLAVGGRVVVPMRVRGLTRCLTLERAEEPGHWRSLAADMCGFVRMQGVGEHWERMPLLHQEEGSQVGLRLEDGPQVDVDALRRALTQDGETVWAGVCVRADEPTDALDLYLASAADGWALLTAQRGAITSKLIRPVVLMGTPAMVDEEGESFSYRALRRSPDDEELYEFGAVEHGPAGRRVAQNMVDLIGVWDREHRGGPGPRIDLVPIDTAAEDLPTGRVVSKRHTHMILNWTANPFE
>NC_018524.1|WP_014908230.1|4603305_4603512_+|FxLD-family-lanthipeptide
MSALTATPTPAGLIATGRDRALSLDGDLFDLDLRVQVPVTDESLWSMTNDGCGQTCETACTQSCTDNG
>NC_018524.1|WP_041561960.1|4606509_4607646_+|lanthionine-synthetase-C-family-protein
MPSSESLPTRPTTPRVNGRSPLSLAKGDLGIALAHSIQGSSPTIVHTWLSAALRDATGRAGLFHGLPAVAFVLAHTSSEHYRQARATVRDHLRRMTVHRLKAAHGRIDRGDLTSFAEYDLVSGLTGVGVAVWALDPDSPLLERVLSYLVRLTRPVGHEGRSFPGWWTRHGPLGHRDPDFPHGHANIGMAHGLGGILSLLSLAYRDGRTVPAHREALETLIATLDEKRRHDEAGSWWPRWFTTGGSPTDVRPGPPSWCYGAPGLIRAQHLAALALGDEPRRRDIEDTLIRTLTDQPALDRIADASLCHGWAGLVLLVRAVAADSPEPQRFTPPLEDLITRLADGVNHLSEPGLLEGRAGARLALEGSGSTHWTRLLLLT
>NC_018524.1|WP_014910064.1|4609006_4609183_-|DUF397-domain-containing-protein
MMNEHWKKSTYSGGSGSCVEARATAQGAAIRDTQHRHLAELSLPNAEWTALLHALRTR
>NC_018524.1|WP_014910597.1|4609282_4609459_-|DUF397-domain-containing-protein
MTSETPWHKSTYSGARGDCVEVAEGPTTGVRDTQNRAQAQLSISGSEWTALLSTLRTN
>NC_018524.1|WP_014909802.1|4609757_4609931_-|DUF397-domain-containing-protein
MNTDWHKSTYSNTGGNCVEARAHGSGAEVRDSQNPNDGSLELPAREWNALLNTLHAS
>NC_018524.1|WP_041561961.1|4609927_4610689_-|helix-turn-helix-transcriptional-regulator
MKLPPFHELLKLKCDLAGLTQAQLAGRMGCSTATVSRWANGHAAPHRETAELLDKQLNANNELIAAWEQVKSTKITPEWAESLNNLEAEALHVQVASPALVPGYLQSLRYAAEVFRAWSPSAPDEEIQELARIRVDQLEQMPSLRVTAVFPVLGLTAFDAEVQKDQARHLLKLVQAGRVRVHLVPEGSLLLSVTSPVLVFQLKSGARVMSSDHLDGNFIYDVVRTERLAPLVAGAMAEALPARLSIEVLKGLT
>NC_018524.1|WP_041562252.1|4611362_4611671_+|ATP-binding-protein
MAAVEVANRASLIAWELMDNAHQHSYSGAPDQTLTLMLERSRYLLSITVTDAGPTPGCKRLSFPEQKSHGGGLGRVASLSFYWDWDGCAGLPVTVKARIELP

Crispr_ID: NC_018524_27

• CRISPR_ID: NC_018524_27
• CRISPR_location: 4607961-4608112
• CRISPR_type: Orphan
• Repeat_type: A:N
• Spacer_info: 2 spacers
• Cas_protein_info: csa3

Consensus repeat of NC_018524_27

Consensus_repeat	Method
GTGAGCCCCACGCACGTGGGGATGGACCG	CRISPRCasFinder

spacers of NC_018524_27

>27.1|4607990|32|NC_018524|CRISPRCasFinder
GCTCGCCAGTCCCGGTCGTGGTGGGTGTCCTC
>27.2|4608051|32|NC_018524|CRISPRCasFinder
ACCATGCCCTCGTACTCTCGGGCTACCTCCTC

CRISPR arrays and Neighbor proteins around NC_018524_27

CRISPR arrays

The CRISPR arrays of NC_018524_27

>merge|NC_018524|27|4607961-4608112|CRISPRCasFinder
CTGCTCCCCGCGCACGCGGGGATGGACCCGCTCGCCAGTCCCGGTCGTGGTGGGTGTCCTCCTGCTCCCCGCGCACGCGGGGATGGACCCACCATGCCCTCGTACTCTCGGGCTACCTCCTCCTGCTCCCCGCGCACGTGGGGATGGCTCGA

>NC_018524|27|26|4607961-4608112|CRISPRCasFinder
CTGCTCCCCGCGCACGCGGGGATGGACCC	GCTCGCCAGTCCCGGTCGTGGTGGGTGTCCTC
CTGCTCCCCGCGCACGCGGGGATGGACCC	ACCATGCCCTCGTACTCTCGGGCTACCTCCTC
CTGCTCCCCGCGCACGTGGGGATGGCTCGA

Neighbor Proteins Overview

Protein	Signature genes	Signature genes Name	Protein_function
NC_018524.1|WP_014912250.1|4594307_4595048_+|alpha/beta-hydrolase	unknown	unknown	gnl|CDD|223669
NC_018524.1|WP_081536576.1|4600339_4601488_-|hypothetical-protein	unknown	unknown	gnl|CDD|276809
NC_018524.1|WP_041562252.1|4611362_4611671_+|ATP-binding-protein	unknown	unknown	gnl|CDD|340413
NC_018524.1|WP_014910539.1|4599808_4600363_+|NUDIX-hydrolase	unknown	unknown	gnl|CDD|239516
NC_018524.1|WP_014913538.1|4596694_4597813_+|ACR3-family-arsenite-efflux-transporter	unknown	unknown	gnl|CDD|213563
NC_018524.1|WP_014908230.1|4603305_4603512_+|FxLD-family-lanthipeptide	unknown	unknown	gnl|CDD|275157
NC_018524.1|WP_041561956.1|4596314_4596698_+|helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl|CDD|223713
NC_018524.1|WP_041562253.1|4613864_4614392_+|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl|CDD|238045
NC_018524.1|WP_014910083.1|4613353_4613560_+|DUF397-domain-containing-protein	unknown	unknown	gnl|CDD|377231
NC_018524.1|WP_014910064.1|4609006_4609183_-|DUF397-domain-containing-protein	unknown	unknown	gnl|CDD|377231
NC_018524.1|WP_014910597.1|4609282_4609459_-|DUF397-domain-containing-protein	unknown	unknown	gnl|CDD|377231
NC_018524.1|WP_041561960.1|4606509_4607646_+|lanthionine-synthetase-C-family-protein	unknown	unknown	gnl|CDD|271201
NC_018524.1|WP_051018317.1|4602071_4603295_+|methyltransferase,-FxLD-system	unknown	unknown	gnl|CDD|275158
NC_018524.1|WP_051018391.1|4612331_4613216_+|SAM-dependent-methyltransferase	unknown	unknown	gnl|CDD|252734
NC_018524.1|WP_041561961.1|4609927_4610689_-|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl|CDD|238045
NC_018524.1|WP_014911461.1|4595774_4596224_-|VOC-family-protein	unknown	unknown	gnl|CDD|319917
NC_018524.1|WP_014909802.1|4609757_4609931_-|DUF397-domain-containing-protein	unknown	unknown	gnl|CDD|377231
NC_018524.1|WP_014911262.1|4597805_4598222_+|arsenate-reductase-ArsC	unknown	unknown	gnl|CDD|319973
NC_018524.1|WP_014912359.1|4612047_4612308_+|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_017536469.1|4614481_4614673_+|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl|CDD|133390

HMMScan for Signature genes

Protein	Cas_name	Cas_description	E-value	Identity	Coverage
NC_018524.1|WP_041561956.1|4596314_4596698_+|helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	4.5e-23	76.6	0.1

rpsblast for functional proteins

Protein	Function_ID	Function_description	E-value
NC_018524.1|WP_014912250.1|4594307_4595048_+|alpha/beta-hydrolase	gnl|CDD|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	5.06176e-07
NC_018524.1|WP_081536576.1|4600339_4601488_-|hypothetical-protein	gnl|CDD|276809	sd00006, TPR, Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.	0.00137544
NC_018524.1|WP_041562252.1|4611362_4611671_+|ATP-binding-protein	gnl|CDD|340413	cd16936, HATPase_RsbW-like, Histidine kinase-like ATPase domain of RsbW, an anti sigma-B factor and serine-protein kinase involved in regulating sigma-B during stress in Bacilli, and related domains. This family includes histidine kinase-like ATPase (HATPase) domain of RsbW, an anti sigma-B factor as well as a serine-protein kinase involved in regulating sigma-B during stress in Bacilli. The alternative sigma factor sigma-B is an important regulator of the general stress response of Bacillus cereus and B. subtilis. RsbW is an anti-sigma factor while RsbV is an anti-sigma factor antagonist (anti-anti-sigma factor). RsbW can also act as a kinase on RsbV. In a partner-switching mechanism, RsbW, RsbV, and sigma-B participate as follows: in non-stressed cells, sigma-B is present in an inactive form complexed with RsbW; in this form, sigma-B is unable to bind to RNA polymerase. Under stress, RsbV binds to RsbW, forming an RsbV-RsbW complex, and sigma-B is released to bind to RNA polymerase. RsbW may then act as a kinase on RsbV, phosphorylating a serine residue; RsbW is then released to bind to sigma-B, hence blocking its ability to bind RNA polymerase. A phosphatase then dephosphorylates RsbV so that it can again form a complex with RsbW, leading to the release of sigma-B.	5.76437e-06
NC_018524.1|WP_014910539.1|4599808_4600363_+|NUDIX-hydrolase	gnl|CDD|239516	cd03424, ADPRase_NUDT5, ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate. Like other members of the Nudix hydrolase superfamily, it requires a divalent cation, such as Mg2+, for its activity. It also contains a highly conserved 23-residue Nudix motif (GX5EX7REUXEEXGU, where U = I, L or V) which functions as a metal binding site/catalytic site. In addition to the Nudix motif, there are additional conserved amino acid residues, distal from the signature sequence, that correlate with substrate specificity. In humans, there are four distinct ADPRase activities, three putative cytosolic enzymes (ADPRase-I, -II, and -Mn) and a single mitochondrial enzyme (ADPRase-m). Human ADPRase-II is also referred to as NUDT5. It lacks the N-terminal target sequence unique to mitochondrial ADPRase. The different cytosolic types are distinguished by their specificities for substrate and specific requirement for metal ions. NUDT5 forms a homodimer.	4.39346e-27
NC_018524.1|WP_014913538.1|4596694_4597813_+|ACR3-family-arsenite-efflux-transporter	gnl|CDD|213563	TIGR00832, Uncharacterized_transporter_slr0944, arsenical-resistance protein. The Arsenical Resistance-3 (ACR3) Family (TC 2.A.59) The first protein of the ACR3 family functionally characterized was the ACR3 protein of Saccharomyces cerevisiae. It is present in the yeast plasma membrane and pumps arsenite out of the cell in response to the pmf. Similar proteins are found in bacteria, often as part of a four gene operon with an regulatory protein ArsR, a protein of unknown function ArsH, and an arsenate reductase that converts arsenate to arsenite to facilitate transport. [Cellular processes, Detoxification, Transport and binding proteins, Anions].	1.05948e-142
NC_018524.1|WP_014908230.1|4603305_4603512_+|FxLD-family-lanthipeptide	gnl|CDD|275157	TIGR04363, hypothetical_protein, FxLD family lantipeptide. Members of this protein family occur with a cassette of lanthionine-type peptide modification enzymes. Members are small (about 60 amino acids long), rich in Cys, and variable in copy number per genome (from one to three). These features suggest that members of this family are modified to become lantipeptides, although not necessarily a lantibiotic. There is no GlyGly cleavage motif to separate a leader peptide from core region.The considerable abundance in Streptomyces and relatively strong consideration hints at a non-antibiotic function. The motif FxLD in the N-terminal region is nearly invariant.	0.00561373
NC_018524.1|WP_041561956.1|4596314_4596698_+|helix-turn-helix-transcriptional-regulator	gnl|CDD|223713	COG0640, ArsR, Predicted transcriptional regulators [Transcription].	4.27648e-20
NC_018524.1|WP_041562253.1|4613864_4614392_+|helix-turn-helix-transcriptional-regulator	gnl|CDD|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	3.65598e-07
NC_018524.1|WP_014910083.1|4613353_4613560_+|DUF397-domain-containing-protein	gnl|CDD|377231	pfam04149, DUF397, Domain of unknown function (DUF397). The function of this family is unknown.	1.99961e-05
NC_018524.1|WP_014910064.1|4609006_4609183_-|DUF397-domain-containing-protein	gnl|CDD|377231	pfam04149, DUF397, Domain of unknown function (DUF397). The function of this family is unknown.	7.2666e-13
NC_018524.1|WP_014910597.1|4609282_4609459_-|DUF397-domain-containing-protein	gnl|CDD|377231	pfam04149, DUF397, Domain of unknown function (DUF397). The function of this family is unknown.	9.95809e-14
NC_018524.1|WP_041561960.1|4606509_4607646_+|lanthionine-synthetase-C-family-protein	gnl|CDD|271201	cd04793, LanC, Cyclases involved in the biosynthesis of lantibiotics. LanC is the cyclase enzyme of the lanthionine synthetase. Lanthinoine is a lantibiotic, a unique class of peptide antibiotics. They are ribosomally synthesized as precursor peptides and then post-translationally modified to contain thioether cross-links called lanthionines (Lans) or methyllanthionines (MeLans) in addition to 2,3-didehydroalanine (Dha) and (Z)-2,3-didehydrobutyrine (Dhb). These unusual amino acids are introduced by the dehydration of serine and threonine residues, followed by thioether formation via addition of cysteine thiols, catalysed by LanB and LanC or LanM. LanC, the cyclase component, is a zinc metalloprotein, whose bound metal has been proposed to activate the thiol substrate for nucleophilic addition. Also contains SpaC (the cyclase involved in the biosynthesis of subtilin), NisC, and homologs.	4.30675e-94
NC_018524.1|WP_051018317.1|4602071_4603295_+|methyltransferase,-FxLD-system	gnl|CDD|275158	TIGR04364, methyltran_FxLD, methyltransferase, FxLD system. Members of this family resemble occur regularly in the vicinity of lantibiotic biosynthesis enzymes and their probable target, the FxLD family of putative ribosomal natural product precursor (TIGR04363). Members resemble protein-L-isoaspartate O-methyltransferase (TIGR00080) and a predicted methyltranserase, TIGR04188, of another putative peptide modification system.	3.02023e-139
NC_018524.1|WP_051018391.1|4612331_4613216_+|SAM-dependent-methyltransferase	gnl|CDD|252734	pfam04672, Methyltransf_19, S-adenosyl methyltransferase. This family contains a SAM (S-adenosyl methyltransferase) domain, with a central beta sheet with 3 alpha-helices on both sides. Crystal packing analysis of the structure Structure 3giw suggests that a monomer is the solution state oligomeric form. An unidentified ligand (UNL, cyan) was found at the putative active site surrounded by the residues His57, His170, Phe171, Tyr216 and Met22. The UNL is likely to be a phenylalanine or phenylalanine-like molecule. (details derived from TOPSAN).	2.83107e-15
NC_018524.1|WP_041561961.1|4609927_4610689_-|helix-turn-helix-transcriptional-regulator	gnl|CDD|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	9.36486e-09
NC_018524.1|WP_014911461.1|4595774_4596224_-|VOC-family-protein	gnl|CDD|319917	cd07254, VOC_like, uncharacterized subfamily of vicinal oxygen chelate (VOC) family. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	6.65854e-46
NC_018524.1|WP_014909802.1|4609757_4609931_-|DUF397-domain-containing-protein	gnl|CDD|377231	pfam04149, DUF397, Domain of unknown function (DUF397). The function of this family is unknown.	5.20705e-14
NC_018524.1|WP_014911262.1|4597805_4598222_+|arsenate-reductase-ArsC	gnl|CDD|319973	cd16345, LMWP_ArsC, Arsenate reductase of the LMWP family. Arsenate reductase plays an important role in the reduction of intracellular arsenate to arsenite, an important step in arsenic detoxification. The reduction involves three different thiolate nucleophiles. In arsenate reductases of the LMWP family, reduction can be coupled with thioredoxin (Trx)/thioredoxin reductase (TrxR) or glutathione (GSH)/glutaredoxin (Grx).	3.31843e-50
NC_018524.1|WP_017536469.1|4614481_4614673_+|helix-turn-helix-domain-containing-protein	gnl|CDD|133390	cd04762, HTH_MerR-trunc, Helix-Turn-Helix DNA binding domain of truncated MerR-like proteins. Proteins in this family mostly have a truncated helix-turn-helix (HTH) MerR-like domain. They lack a portion of the C-terminal region, called Wing 2 and the long dimerization helix that is typically present in MerR-like proteins. These truncated domains are found in response regulator receiver (REC) domain proteins (i.e., CheY), cytosine-C5 specific DNA methylases, IS607 transposase-like proteins, and RacA, a bacterial protein that anchors chromosomes to cell poles.	2.52461e-14

Protein sequences

>NC_018524.1|WP_041561960.1|4606509_4607646_+|lanthionine-synthetase-C-family-protein
MPSSESLPTRPTTPRVNGRSPLSLAKGDLGIALAHSIQGSSPTIVHTWLSAALRDATGRAGLFHGLPAVAFVLAHTSSEHYRQARATVRDHLRRMTVHRLKAAHGRIDRGDLTSFAEYDLVSGLTGVGVAVWALDPDSPLLERVLSYLVRLTRPVGHEGRSFPGWWTRHGPLGHRDPDFPHGHANIGMAHGLGGILSLLSLAYRDGRTVPAHREALETLIATLDEKRRHDEAGSWWPRWFTTGGSPTDVRPGPPSWCYGAPGLIRAQHLAALALGDEPRRRDIEDTLIRTLTDQPALDRIADASLCHGWAGLVLLVRAVAADSPEPQRFTPPLEDLITRLADGVNHLSEPGLLEGRAGARLALEGSGSTHWTRLLLLT
>NC_018524.1|WP_014908230.1|4603305_4603512_+|FxLD-family-lanthipeptide
MSALTATPTPAGLIATGRDRALSLDGDLFDLDLRVQVPVTDESLWSMTNDGCGQTCETACTQSCTDNG
>NC_018524.1|WP_051018317.1|4602071_4603295_+|methyltransferase,-FxLD-system
MVDALVEERADLGMEKLPEQVEEALRAVPREVFVPGLPLVEAYDRHQAIVTKHDEAKRVALSSVSAPSIIALMLQRADIRPGHRVLEIGSGGYNAALISHLVGETGQVTSIDIDPDVIARAERCLKEAGVDQVHLAVTDGEHGFASRAPYDRIIVTAGAWDLSPSWEEQLAVGGRVVVPMRVRGLTRCLTLERAEEPGHWRSLAADMCGFVRMQGVGEHWERMPLLHQEEGSQVGLRLEDGPQVDVDALRRALTQDGETVWAGVCVRADEPTDALDLYLASAADGWALLTAQRGAITSKLIRPVVLMGTPAMVDEEGESFSYRALRRSPDDEELYEFGAVEHGPAGRRVAQNMVDLIGVWDREHRGGPGPRIDLVPIDTAAEDLPTGRVVSKRHTHMILNWTANPFE
>NC_018524.1|WP_081536576.1|4600339_4601488_-|hypothetical-protein
MRQAWETRDAATVVRLVLWNSELSQTKLSQILGISQSTISEAVSGKSQIARQSSRNAIFEGLDILRPPLPPKVATALTATPQATEPSGEAQERLEIASIDQALIGLFEARTQNLRLIDRKLGAHYLLAQSQAHVQQMHDLLRRSLPGPVRRGLARALAEAASLTGWQALDSGRSATAWRYYEIAKAAARESEDKAVLAHVSAEQSYVLLDNGYERGALATLRAARDDAGASLPSLLSSWMWAAEGEVCATLGEEPEAKRALERAFALLPPEPQDPSLPFLMLDRTHLLRWRGHCLARLGDSEAIEDLTRALDCIVPLELGRAEAGLRTDLALAYTVHGDTTQAHRQAARAAELSDQSGSVRQRSRLARLLPQRTTSRSEDVE
>NC_018524.1|WP_014910539.1|4599808_4600363_+|NUDIX-hydrolase
MGHTESSEDDNGRWIVHGERAIYDSRWVRLGKADITTPSGSRFEHHTVTLPSAAVIAIVDRAGEHVLMSYRHRFVPDAWGWELPGGLLDPEETPEQTAVREALEETGHRVGSVEHVATFEPMIGTVRSPHHVFVGRDADLVADPTEFDEGVYEWVPLAEIRGLISTGHVQSSGTLIALLHILAS
>NC_018524.1|WP_014911262.1|4597805_4598222_+|arsenate-reductase-ArsC
MTDRSEAVIPRVLFVCVHNAGRSQMAAAFLEHLGGDRVEVRSAGSAPADEVNPAVVEAMGEVGIDITAGTPKLLTPDAVRASDVVVTMGCGDACPFFPGKRYLDWELPDPAGRGVEAVRPILDRIKRHVEDLLRELVP
>NC_018524.1|WP_014913538.1|4596694_4597813_+|ACR3-family-arsenite-efflux-transporter
MSAPASTDPNAGVVGRLSALDRFLTVWILAAMVAGLALGRLVPGLGEALSGVGVAGVSLPIAVGLLVMMFPPLAKVRYDRLGAVTGDRRMLITSLAVNWLAGPALMFALAWAFLPDLPEYRTGLIIVGLARCIAMVIVWNDLACGDREAAAVLVALNSLFQVVAFGALGWFYLSALPGWLGLGQAALEVSFVDISVSVVIFLGVPLLAGYLTRRLGERARGREWYETRLLPKLGPWGLYGLLFTIVMLFALQGEAITSRPWDVARIALPLLLYFVIMWAGTLALGRALGMGYPRSVTLAFTAAGNNFELAIAVAIASFGAASGQALAGVVGPLIEVPVLIALVYVALAARRWFPGEGAAEVSTATTKETTGD
>NC_018524.1|WP_041561956.1|4596314_4596698_+|helix-turn-helix-transcriptional-regulator
MSNQEVGATDLQGAVADCCPRLLKEPLEDGESVELARVFKALGDPVRLRLLSMIATCDGDEVCVCDLTPAFDLSQPTISHHLKLLREAGLISSVRRGTWVYYRLIPETTDRLAAILTRSMKSEEAGS
>NC_018524.1|WP_014911461.1|4595774_4596224_-|VOC-family-protein
MSRVQLALNVADLEASVVFYSTLFGVEPAKRRPGYANFAISEPPLKLVLIEGEPDQETRLDHLGVEVEATEQVNAATQRFKDSGLATFEENDTSCCYAVQDKVWVHGPGKEPWEVYVVKSDSDQRGAAPREVNTGVAGEASGCCATAQV
>NC_018524.1|WP_014912250.1|4594307_4595048_+|alpha/beta-hydrolase
MATTTNSPTIVLIAGHWLGAWAWDEVLEHLETDHVRAVAVTLPGLDGDDPARSTRTLDDQVEAIEGLLARLDVSEERPATLVAHSGANGPVSLLLDRRPELVRRVVWVDSGPMANGSAFAPDFPEEVEELPLPPFDVLAEQASLDGLSTEVLERFRSRAVPEPGPVLRQTVELTNDARRTVPTTLVCCSISSEQVLEMAQGGHPMFAEVANLETLDIIDLPTGHWPMWSRPGDLAEVIRSAASRAG
>NC_018524.1|WP_014910064.1|4609006_4609183_-|DUF397-domain-containing-protein
MMNEHWKKSTYSGGSGSCVEARATAQGAAIRDTQHRHLAELSLPNAEWTALLHALRTR
>NC_018524.1|WP_014910597.1|4609282_4609459_-|DUF397-domain-containing-protein
MTSETPWHKSTYSGARGDCVEVAEGPTTGVRDTQNRAQAQLSISGSEWTALLSTLRTN
>NC_018524.1|WP_014909802.1|4609757_4609931_-|DUF397-domain-containing-protein
MNTDWHKSTYSNTGGNCVEARAHGSGAEVRDSQNPNDGSLELPAREWNALLNTLHAS
>NC_018524.1|WP_041561961.1|4609927_4610689_-|helix-turn-helix-transcriptional-regulator
MKLPPFHELLKLKCDLAGLTQAQLAGRMGCSTATVSRWANGHAAPHRETAELLDKQLNANNELIAAWEQVKSTKITPEWAESLNNLEAEALHVQVASPALVPGYLQSLRYAAEVFRAWSPSAPDEEIQELARIRVDQLEQMPSLRVTAVFPVLGLTAFDAEVQKDQARHLLKLVQAGRVRVHLVPEGSLLLSVTSPVLVFQLKSGARVMSSDHLDGNFIYDVVRTERLAPLVAGAMAEALPARLSIEVLKGLT
>NC_018524.1|WP_041562252.1|4611362_4611671_+|ATP-binding-protein
MAAVEVANRASLIAWELMDNAHQHSYSGAPDQTLTLMLERSRYLLSITVTDAGPTPGCKRLSFPEQKSHGGGLGRVASLSFYWDWDGCAGLPVTVKARIELP
>NC_018524.1|WP_014912359.1|4612047_4612308_+|hypothetical-protein
MTEQNAAAELSALRLLGRLSVRQRLARVDHRLSLARLLVDGILDERSRVERQLREAERAEQDAGTQELGVAIRRYLDQGGRTWTTS
>NC_018524.1|WP_051018391.1|4612331_4613216_+|SAM-dependent-methyltransferase
MTWGAARSGTLLDREEWALTNAARTFDYLDYGKDSWSQDRHVAVKMAEASPGLAGQMLVHRKAREGVVDAVCRSFSRVIDLGCGLPTMRRAPHERGRVLWGSRARTVYVDHDLAALAAVRAWWEHPAQVRGGNVRVLDLDLRYPENLASALEEHLDLSVPVGVLSTLTLDHLEDTEVTGLVEALASRLAPGSGWGITHLSGMVGAAEVYTDQAQEQGADTRLVARDPDGLRKVFEAAGWGRWRGLSPRELGGGEPPIAALTTLARSDRASRTAAPDRSERTVLPVRPARSTGVD
>NC_018524.1|WP_014910083.1|4613353_4613560_+|DUF397-domain-containing-protein
MHIVQTQGRKSLTAGVWHKAEASQGATNCAAAKLIDGGNVLMGDTQNPDQVRLTLPGSAWDALVRTLT
>NC_018524.1|WP_041562253.1|4613864_4614392_+|helix-turn-helix-transcriptional-regulator
MSVESKEAQVDQDADSLCVESKKALGVHLKRLRKAAGLSGYRLSGVDQSTVSRIETGRIRPSHELLTRLLDAYEADQEGREQAYLLWDQAQLPLQTRRRQVEGTRAAWDQAARPACGPTLLAGASAAEDAARYLTRAQWAGNSPARRDALLDDAEGRLVQVLAALHAARTRTSAR
>NC_018524.1|WP_017536469.1|4614481_4614673_+|helix-turn-helix-domain-containing-protein
MTQPDVDPMDLLTPQEVAQAFRVDPKTVRLWAQEGRLRWVRTLGGHRRYFKSDVQRLLTEPGR

Crispr_ID: NC_018524_28

• CRISPR_ID: NC_018524_28
• CRISPR_location: 4608629-4608902
• CRISPR_type: Orphan
• Repeat_type: A:N
• Spacer_info: 4 spacers
• Cas_protein_info: csa3

Consensus repeat of NC_018524_28

Consensus_repeat	Method
CGGTCCATCCCCACGTGCGTGGGGCTCAC	PILER-CR
GTGAGCCCCACGCACGTGGGGATGGACCG	CRISPRCasFinder
GTGAGCCCCACGCACGTGGGGATGGACCG	CRT

spacers of NC_018524_28

>28.1|4608658|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT
CCACCGCCCGGGAGGCCGCCCACCGGGCCGCA
>28.2|4608719|33|NC_018524|PILER-CR,CRISPRCasFinder,CRT
GGTCGTAGCCTACCGACGCTGCCGAGCCCCGGA
>28.3|4608781|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT
TCGGGCTGAGCGAGCTCTTCCGTTGGAGTGAA
>28.4|4608842|32|NC_018524|CRISPRCasFinder,CRT
CCGGAACCGGCACGAGCACCTGCTCCGGTTCC

CRISPR arrays and Neighbor proteins around NC_018524_28

CRISPR arrays

The CRISPR arrays of NC_018524_28

>merge|NC_018524|28|4608629-4608902|PILER-CR,CRISPRCasFinder,CRT
GTGAGCCCCACGCACGTGGGGATGGACCGCCACCGCCCGGGAGGCCGCCCACCGGGCCGCAGTGAGCCCCACGCACGTGGGGATGGACCGGGTCGTAGCCTACCGACGCTGCCGAGCCCCGGAGTGAGCCCCACGCACGTGGGGATGGACCGTCGGGCTGAGCGAGCTCTTCCGTTGGAGTGAAGTGAGCCCCACGCACGTGGGGATGGACCGCCGGAACCGGCACGAGCACCTGCTCCGGTTCCGTGAGCCCCACGCACGTGGGGATGGAACC

>NC_018524|28|16|4608629-4608841|PILER-CR
GTGAGCCCCACGCACGTGGGGATGGACCG	CCACCGCCCGGGAGGCCGCCCACCGGGCCGCA
GTGAGCCCCACGCACGTGGGGATGGACCG	GGTCGTAGCCTACCGACGCTGCCGAGCCCCGGA
GTGAGCCCCACGCACGTGGGGATGGACCG	TCGGGCTGAGCGAGCTCTTCCGTTGGAGTGAA
GTGAGCCCCACGCACGTGGGGATGGACCG

>NC_018524|28|27|4608629-4608902|CRISPRCasFinder
GTGAGCCCCACGCACGTGGGGATGGACCG	CCACCGCCCGGGAGGCCGCCCACCGGGCCGCA
GTGAGCCCCACGCACGTGGGGATGGACCG	GGTCGTAGCCTACCGACGCTGCCGAGCCCCGGA
GTGAGCCCCACGCACGTGGGGATGGACCG	TCGGGCTGAGCGAGCTCTTCCGTTGGAGTGAA
GTGAGCCCCACGCACGTGGGGATGGACCG	CCGGAACCGGCACGAGCACCTGCTCCGGTTCC
GTGAGCCCCACGCACGTGGGGATGGAACC

>NC_018524|28|17|4608629-4608902|CRT
GTGAGCCCCACGCACGTGGGGATGGACCG	CCACCGCCCGGGAGGCCGCCCACCGGGCCGCA
GTGAGCCCCACGCACGTGGGGATGGACCG	GGTCGTAGCCTACCGACGCTGCCGAGCCCCGGA
GTGAGCCCCACGCACGTGGGGATGGACCG	TCGGGCTGAGCGAGCTCTTCCGTTGGAGTGAA
GTGAGCCCCACGCACGTGGGGATGGACCG	CCGGAACCGGCACGAGCACCTGCTCCGGTTCC
GTGAGCCCCACGCACGTGGGGATGGAACC

Neighbor Proteins Overview

Protein	Signature genes	Signature genes Name	Protein_function
NC_018524.1|WP_014912250.1|4594307_4595048_+|alpha/beta-hydrolase	unknown	unknown	gnl|CDD|223669
NC_018524.1|WP_081536576.1|4600339_4601488_-|hypothetical-protein	unknown	unknown	gnl|CDD|276809
NC_018524.1|WP_041562252.1|4611362_4611671_+|ATP-binding-protein	unknown	unknown	gnl|CDD|340413
NC_018524.1|WP_014910539.1|4599808_4600363_+|NUDIX-hydrolase	unknown	unknown	gnl|CDD|239516
NC_018524.1|WP_014913538.1|4596694_4597813_+|ACR3-family-arsenite-efflux-transporter	unknown	unknown	gnl|CDD|213563
NC_018524.1|WP_014908230.1|4603305_4603512_+|FxLD-family-lanthipeptide	unknown	unknown	gnl|CDD|275157
NC_018524.1|WP_041561956.1|4596314_4596698_+|helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl|CDD|223713
NC_018524.1|WP_041562253.1|4613864_4614392_+|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl|CDD|238045
NC_018524.1|WP_014910083.1|4613353_4613560_+|DUF397-domain-containing-protein	unknown	unknown	gnl|CDD|377231
NC_018524.1|WP_014910064.1|4609006_4609183_-|DUF397-domain-containing-protein	unknown	unknown	gnl|CDD|377231
NC_018524.1|WP_014910597.1|4609282_4609459_-|DUF397-domain-containing-protein	unknown	unknown	gnl|CDD|377231
NC_018524.1|WP_041561960.1|4606509_4607646_+|lanthionine-synthetase-C-family-protein	unknown	unknown	gnl|CDD|271201
NC_018524.1|WP_051018317.1|4602071_4603295_+|methyltransferase,-FxLD-system	unknown	unknown	gnl|CDD|275158
NC_018524.1|WP_051018391.1|4612331_4613216_+|SAM-dependent-methyltransferase	unknown	unknown	gnl|CDD|252734
NC_018524.1|WP_041561961.1|4609927_4610689_-|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl|CDD|238045
NC_018524.1|WP_014911461.1|4595774_4596224_-|VOC-family-protein	unknown	unknown	gnl|CDD|319917
NC_018524.1|WP_014909802.1|4609757_4609931_-|DUF397-domain-containing-protein	unknown	unknown	gnl|CDD|377231
NC_018524.1|WP_014911262.1|4597805_4598222_+|arsenate-reductase-ArsC	unknown	unknown	gnl|CDD|319973
NC_018524.1|WP_014912359.1|4612047_4612308_+|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_017536469.1|4614481_4614673_+|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl|CDD|133390

HMMScan for Signature genes

Protein	Cas_name	Cas_description	E-value	Identity	Coverage
NC_018524.1|WP_041561956.1|4596314_4596698_+|helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	4.5e-23	76.6	0.1

rpsblast for functional proteins

Protein	Function_ID	Function_description	E-value
NC_018524.1|WP_014912250.1|4594307_4595048_+|alpha/beta-hydrolase	gnl|CDD|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	5.06176e-07
NC_018524.1|WP_081536576.1|4600339_4601488_-|hypothetical-protein	gnl|CDD|276809	sd00006, TPR, Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.	0.00137544
NC_018524.1|WP_041562252.1|4611362_4611671_+|ATP-binding-protein	gnl|CDD|340413	cd16936, HATPase_RsbW-like, Histidine kinase-like ATPase domain of RsbW, an anti sigma-B factor and serine-protein kinase involved in regulating sigma-B during stress in Bacilli, and related domains. This family includes histidine kinase-like ATPase (HATPase) domain of RsbW, an anti sigma-B factor as well as a serine-protein kinase involved in regulating sigma-B during stress in Bacilli. The alternative sigma factor sigma-B is an important regulator of the general stress response of Bacillus cereus and B. subtilis. RsbW is an anti-sigma factor while RsbV is an anti-sigma factor antagonist (anti-anti-sigma factor). RsbW can also act as a kinase on RsbV. In a partner-switching mechanism, RsbW, RsbV, and sigma-B participate as follows: in non-stressed cells, sigma-B is present in an inactive form complexed with RsbW; in this form, sigma-B is unable to bind to RNA polymerase. Under stress, RsbV binds to RsbW, forming an RsbV-RsbW complex, and sigma-B is released to bind to RNA polymerase. RsbW may then act as a kinase on RsbV, phosphorylating a serine residue; RsbW is then released to bind to sigma-B, hence blocking its ability to bind RNA polymerase. A phosphatase then dephosphorylates RsbV so that it can again form a complex with RsbW, leading to the release of sigma-B.	5.76437e-06
NC_018524.1|WP_014910539.1|4599808_4600363_+|NUDIX-hydrolase	gnl|CDD|239516	cd03424, ADPRase_NUDT5, ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate. Like other members of the Nudix hydrolase superfamily, it requires a divalent cation, such as Mg2+, for its activity. It also contains a highly conserved 23-residue Nudix motif (GX5EX7REUXEEXGU, where U = I, L or V) which functions as a metal binding site/catalytic site. In addition to the Nudix motif, there are additional conserved amino acid residues, distal from the signature sequence, that correlate with substrate specificity. In humans, there are four distinct ADPRase activities, three putative cytosolic enzymes (ADPRase-I, -II, and -Mn) and a single mitochondrial enzyme (ADPRase-m). Human ADPRase-II is also referred to as NUDT5. It lacks the N-terminal target sequence unique to mitochondrial ADPRase. The different cytosolic types are distinguished by their specificities for substrate and specific requirement for metal ions. NUDT5 forms a homodimer.	4.39346e-27
NC_018524.1|WP_014913538.1|4596694_4597813_+|ACR3-family-arsenite-efflux-transporter	gnl|CDD|213563	TIGR00832, Uncharacterized_transporter_slr0944, arsenical-resistance protein. The Arsenical Resistance-3 (ACR3) Family (TC 2.A.59) The first protein of the ACR3 family functionally characterized was the ACR3 protein of Saccharomyces cerevisiae. It is present in the yeast plasma membrane and pumps arsenite out of the cell in response to the pmf. Similar proteins are found in bacteria, often as part of a four gene operon with an regulatory protein ArsR, a protein of unknown function ArsH, and an arsenate reductase that converts arsenate to arsenite to facilitate transport. [Cellular processes, Detoxification, Transport and binding proteins, Anions].	1.05948e-142
NC_018524.1|WP_014908230.1|4603305_4603512_+|FxLD-family-lanthipeptide	gnl|CDD|275157	TIGR04363, hypothetical_protein, FxLD family lantipeptide. Members of this protein family occur with a cassette of lanthionine-type peptide modification enzymes. Members are small (about 60 amino acids long), rich in Cys, and variable in copy number per genome (from one to three). These features suggest that members of this family are modified to become lantipeptides, although not necessarily a lantibiotic. There is no GlyGly cleavage motif to separate a leader peptide from core region.The considerable abundance in Streptomyces and relatively strong consideration hints at a non-antibiotic function. The motif FxLD in the N-terminal region is nearly invariant.	0.00561373
NC_018524.1|WP_041561956.1|4596314_4596698_+|helix-turn-helix-transcriptional-regulator	gnl|CDD|223713	COG0640, ArsR, Predicted transcriptional regulators [Transcription].	4.27648e-20
NC_018524.1|WP_041562253.1|4613864_4614392_+|helix-turn-helix-transcriptional-regulator	gnl|CDD|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	3.65598e-07
NC_018524.1|WP_014910083.1|4613353_4613560_+|DUF397-domain-containing-protein	gnl|CDD|377231	pfam04149, DUF397, Domain of unknown function (DUF397). The function of this family is unknown.	1.99961e-05
NC_018524.1|WP_014910064.1|4609006_4609183_-|DUF397-domain-containing-protein	gnl|CDD|377231	pfam04149, DUF397, Domain of unknown function (DUF397). The function of this family is unknown.	7.2666e-13
NC_018524.1|WP_014910597.1|4609282_4609459_-|DUF397-domain-containing-protein	gnl|CDD|377231	pfam04149, DUF397, Domain of unknown function (DUF397). The function of this family is unknown.	9.95809e-14
NC_018524.1|WP_041561960.1|4606509_4607646_+|lanthionine-synthetase-C-family-protein	gnl|CDD|271201	cd04793, LanC, Cyclases involved in the biosynthesis of lantibiotics. LanC is the cyclase enzyme of the lanthionine synthetase. Lanthinoine is a lantibiotic, a unique class of peptide antibiotics. They are ribosomally synthesized as precursor peptides and then post-translationally modified to contain thioether cross-links called lanthionines (Lans) or methyllanthionines (MeLans) in addition to 2,3-didehydroalanine (Dha) and (Z)-2,3-didehydrobutyrine (Dhb). These unusual amino acids are introduced by the dehydration of serine and threonine residues, followed by thioether formation via addition of cysteine thiols, catalysed by LanB and LanC or LanM. LanC, the cyclase component, is a zinc metalloprotein, whose bound metal has been proposed to activate the thiol substrate for nucleophilic addition. Also contains SpaC (the cyclase involved in the biosynthesis of subtilin), NisC, and homologs.	4.30675e-94
NC_018524.1|WP_051018317.1|4602071_4603295_+|methyltransferase,-FxLD-system	gnl|CDD|275158	TIGR04364, methyltran_FxLD, methyltransferase, FxLD system. Members of this family resemble occur regularly in the vicinity of lantibiotic biosynthesis enzymes and their probable target, the FxLD family of putative ribosomal natural product precursor (TIGR04363). Members resemble protein-L-isoaspartate O-methyltransferase (TIGR00080) and a predicted methyltranserase, TIGR04188, of another putative peptide modification system.	3.02023e-139
NC_018524.1|WP_051018391.1|4612331_4613216_+|SAM-dependent-methyltransferase	gnl|CDD|252734	pfam04672, Methyltransf_19, S-adenosyl methyltransferase. This family contains a SAM (S-adenosyl methyltransferase) domain, with a central beta sheet with 3 alpha-helices on both sides. Crystal packing analysis of the structure Structure 3giw suggests that a monomer is the solution state oligomeric form. An unidentified ligand (UNL, cyan) was found at the putative active site surrounded by the residues His57, His170, Phe171, Tyr216 and Met22. The UNL is likely to be a phenylalanine or phenylalanine-like molecule. (details derived from TOPSAN).	2.83107e-15
NC_018524.1|WP_041561961.1|4609927_4610689_-|helix-turn-helix-transcriptional-regulator	gnl|CDD|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	9.36486e-09
NC_018524.1|WP_014911461.1|4595774_4596224_-|VOC-family-protein	gnl|CDD|319917	cd07254, VOC_like, uncharacterized subfamily of vicinal oxygen chelate (VOC) family. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	6.65854e-46
NC_018524.1|WP_014909802.1|4609757_4609931_-|DUF397-domain-containing-protein	gnl|CDD|377231	pfam04149, DUF397, Domain of unknown function (DUF397). The function of this family is unknown.	5.20705e-14
NC_018524.1|WP_014911262.1|4597805_4598222_+|arsenate-reductase-ArsC	gnl|CDD|319973	cd16345, LMWP_ArsC, Arsenate reductase of the LMWP family. Arsenate reductase plays an important role in the reduction of intracellular arsenate to arsenite, an important step in arsenic detoxification. The reduction involves three different thiolate nucleophiles. In arsenate reductases of the LMWP family, reduction can be coupled with thioredoxin (Trx)/thioredoxin reductase (TrxR) or glutathione (GSH)/glutaredoxin (Grx).	3.31843e-50
NC_018524.1|WP_017536469.1|4614481_4614673_+|helix-turn-helix-domain-containing-protein	gnl|CDD|133390	cd04762, HTH_MerR-trunc, Helix-Turn-Helix DNA binding domain of truncated MerR-like proteins. Proteins in this family mostly have a truncated helix-turn-helix (HTH) MerR-like domain. They lack a portion of the C-terminal region, called Wing 2 and the long dimerization helix that is typically present in MerR-like proteins. These truncated domains are found in response regulator receiver (REC) domain proteins (i.e., CheY), cytosine-C5 specific DNA methylases, IS607 transposase-like proteins, and RacA, a bacterial protein that anchors chromosomes to cell poles.	2.52461e-14

Protein sequences

>NC_018524.1|WP_041561960.1|4606509_4607646_+|lanthionine-synthetase-C-family-protein
MPSSESLPTRPTTPRVNGRSPLSLAKGDLGIALAHSIQGSSPTIVHTWLSAALRDATGRAGLFHGLPAVAFVLAHTSSEHYRQARATVRDHLRRMTVHRLKAAHGRIDRGDLTSFAEYDLVSGLTGVGVAVWALDPDSPLLERVLSYLVRLTRPVGHEGRSFPGWWTRHGPLGHRDPDFPHGHANIGMAHGLGGILSLLSLAYRDGRTVPAHREALETLIATLDEKRRHDEAGSWWPRWFTTGGSPTDVRPGPPSWCYGAPGLIRAQHLAALALGDEPRRRDIEDTLIRTLTDQPALDRIADASLCHGWAGLVLLVRAVAADSPEPQRFTPPLEDLITRLADGVNHLSEPGLLEGRAGARLALEGSGSTHWTRLLLLT
>NC_018524.1|WP_014908230.1|4603305_4603512_+|FxLD-family-lanthipeptide
MSALTATPTPAGLIATGRDRALSLDGDLFDLDLRVQVPVTDESLWSMTNDGCGQTCETACTQSCTDNG
>NC_018524.1|WP_051018317.1|4602071_4603295_+|methyltransferase,-FxLD-system
MVDALVEERADLGMEKLPEQVEEALRAVPREVFVPGLPLVEAYDRHQAIVTKHDEAKRVALSSVSAPSIIALMLQRADIRPGHRVLEIGSGGYNAALISHLVGETGQVTSIDIDPDVIARAERCLKEAGVDQVHLAVTDGEHGFASRAPYDRIIVTAGAWDLSPSWEEQLAVGGRVVVPMRVRGLTRCLTLERAEEPGHWRSLAADMCGFVRMQGVGEHWERMPLLHQEEGSQVGLRLEDGPQVDVDALRRALTQDGETVWAGVCVRADEPTDALDLYLASAADGWALLTAQRGAITSKLIRPVVLMGTPAMVDEEGESFSYRALRRSPDDEELYEFGAVEHGPAGRRVAQNMVDLIGVWDREHRGGPGPRIDLVPIDTAAEDLPTGRVVSKRHTHMILNWTANPFE
>NC_018524.1|WP_081536576.1|4600339_4601488_-|hypothetical-protein
MRQAWETRDAATVVRLVLWNSELSQTKLSQILGISQSTISEAVSGKSQIARQSSRNAIFEGLDILRPPLPPKVATALTATPQATEPSGEAQERLEIASIDQALIGLFEARTQNLRLIDRKLGAHYLLAQSQAHVQQMHDLLRRSLPGPVRRGLARALAEAASLTGWQALDSGRSATAWRYYEIAKAAARESEDKAVLAHVSAEQSYVLLDNGYERGALATLRAARDDAGASLPSLLSSWMWAAEGEVCATLGEEPEAKRALERAFALLPPEPQDPSLPFLMLDRTHLLRWRGHCLARLGDSEAIEDLTRALDCIVPLELGRAEAGLRTDLALAYTVHGDTTQAHRQAARAAELSDQSGSVRQRSRLARLLPQRTTSRSEDVE
>NC_018524.1|WP_014910539.1|4599808_4600363_+|NUDIX-hydrolase
MGHTESSEDDNGRWIVHGERAIYDSRWVRLGKADITTPSGSRFEHHTVTLPSAAVIAIVDRAGEHVLMSYRHRFVPDAWGWELPGGLLDPEETPEQTAVREALEETGHRVGSVEHVATFEPMIGTVRSPHHVFVGRDADLVADPTEFDEGVYEWVPLAEIRGLISTGHVQSSGTLIALLHILAS
>NC_018524.1|WP_014911262.1|4597805_4598222_+|arsenate-reductase-ArsC
MTDRSEAVIPRVLFVCVHNAGRSQMAAAFLEHLGGDRVEVRSAGSAPADEVNPAVVEAMGEVGIDITAGTPKLLTPDAVRASDVVVTMGCGDACPFFPGKRYLDWELPDPAGRGVEAVRPILDRIKRHVEDLLRELVP
>NC_018524.1|WP_014913538.1|4596694_4597813_+|ACR3-family-arsenite-efflux-transporter
MSAPASTDPNAGVVGRLSALDRFLTVWILAAMVAGLALGRLVPGLGEALSGVGVAGVSLPIAVGLLVMMFPPLAKVRYDRLGAVTGDRRMLITSLAVNWLAGPALMFALAWAFLPDLPEYRTGLIIVGLARCIAMVIVWNDLACGDREAAAVLVALNSLFQVVAFGALGWFYLSALPGWLGLGQAALEVSFVDISVSVVIFLGVPLLAGYLTRRLGERARGREWYETRLLPKLGPWGLYGLLFTIVMLFALQGEAITSRPWDVARIALPLLLYFVIMWAGTLALGRALGMGYPRSVTLAFTAAGNNFELAIAVAIASFGAASGQALAGVVGPLIEVPVLIALVYVALAARRWFPGEGAAEVSTATTKETTGD
>NC_018524.1|WP_041561956.1|4596314_4596698_+|helix-turn-helix-transcriptional-regulator
MSNQEVGATDLQGAVADCCPRLLKEPLEDGESVELARVFKALGDPVRLRLLSMIATCDGDEVCVCDLTPAFDLSQPTISHHLKLLREAGLISSVRRGTWVYYRLIPETTDRLAAILTRSMKSEEAGS
>NC_018524.1|WP_014911461.1|4595774_4596224_-|VOC-family-protein
MSRVQLALNVADLEASVVFYSTLFGVEPAKRRPGYANFAISEPPLKLVLIEGEPDQETRLDHLGVEVEATEQVNAATQRFKDSGLATFEENDTSCCYAVQDKVWVHGPGKEPWEVYVVKSDSDQRGAAPREVNTGVAGEASGCCATAQV
>NC_018524.1|WP_014912250.1|4594307_4595048_+|alpha/beta-hydrolase
MATTTNSPTIVLIAGHWLGAWAWDEVLEHLETDHVRAVAVTLPGLDGDDPARSTRTLDDQVEAIEGLLARLDVSEERPATLVAHSGANGPVSLLLDRRPELVRRVVWVDSGPMANGSAFAPDFPEEVEELPLPPFDVLAEQASLDGLSTEVLERFRSRAVPEPGPVLRQTVELTNDARRTVPTTLVCCSISSEQVLEMAQGGHPMFAEVANLETLDIIDLPTGHWPMWSRPGDLAEVIRSAASRAG
>NC_018524.1|WP_014910064.1|4609006_4609183_-|DUF397-domain-containing-protein
MMNEHWKKSTYSGGSGSCVEARATAQGAAIRDTQHRHLAELSLPNAEWTALLHALRTR
>NC_018524.1|WP_014910597.1|4609282_4609459_-|DUF397-domain-containing-protein
MTSETPWHKSTYSGARGDCVEVAEGPTTGVRDTQNRAQAQLSISGSEWTALLSTLRTN
>NC_018524.1|WP_014909802.1|4609757_4609931_-|DUF397-domain-containing-protein
MNTDWHKSTYSNTGGNCVEARAHGSGAEVRDSQNPNDGSLELPAREWNALLNTLHAS
>NC_018524.1|WP_041561961.1|4609927_4610689_-|helix-turn-helix-transcriptional-regulator
MKLPPFHELLKLKCDLAGLTQAQLAGRMGCSTATVSRWANGHAAPHRETAELLDKQLNANNELIAAWEQVKSTKITPEWAESLNNLEAEALHVQVASPALVPGYLQSLRYAAEVFRAWSPSAPDEEIQELARIRVDQLEQMPSLRVTAVFPVLGLTAFDAEVQKDQARHLLKLVQAGRVRVHLVPEGSLLLSVTSPVLVFQLKSGARVMSSDHLDGNFIYDVVRTERLAPLVAGAMAEALPARLSIEVLKGLT
>NC_018524.1|WP_041562252.1|4611362_4611671_+|ATP-binding-protein
MAAVEVANRASLIAWELMDNAHQHSYSGAPDQTLTLMLERSRYLLSITVTDAGPTPGCKRLSFPEQKSHGGGLGRVASLSFYWDWDGCAGLPVTVKARIELP
>NC_018524.1|WP_014912359.1|4612047_4612308_+|hypothetical-protein
MTEQNAAAELSALRLLGRLSVRQRLARVDHRLSLARLLVDGILDERSRVERQLREAERAEQDAGTQELGVAIRRYLDQGGRTWTTS
>NC_018524.1|WP_051018391.1|4612331_4613216_+|SAM-dependent-methyltransferase
MTWGAARSGTLLDREEWALTNAARTFDYLDYGKDSWSQDRHVAVKMAEASPGLAGQMLVHRKAREGVVDAVCRSFSRVIDLGCGLPTMRRAPHERGRVLWGSRARTVYVDHDLAALAAVRAWWEHPAQVRGGNVRVLDLDLRYPENLASALEEHLDLSVPVGVLSTLTLDHLEDTEVTGLVEALASRLAPGSGWGITHLSGMVGAAEVYTDQAQEQGADTRLVARDPDGLRKVFEAAGWGRWRGLSPRELGGGEPPIAALTTLARSDRASRTAAPDRSERTVLPVRPARSTGVD
>NC_018524.1|WP_014910083.1|4613353_4613560_+|DUF397-domain-containing-protein
MHIVQTQGRKSLTAGVWHKAEASQGATNCAAAKLIDGGNVLMGDTQNPDQVRLTLPGSAWDALVRTLT
>NC_018524.1|WP_041562253.1|4613864_4614392_+|helix-turn-helix-transcriptional-regulator
MSVESKEAQVDQDADSLCVESKKALGVHLKRLRKAAGLSGYRLSGVDQSTVSRIETGRIRPSHELLTRLLDAYEADQEGREQAYLLWDQAQLPLQTRRRQVEGTRAAWDQAARPACGPTLLAGASAAEDAARYLTRAQWAGNSPARRDALLDDAEGRLVQVLAALHAARTRTSAR
>NC_018524.1|WP_017536469.1|4614481_4614673_+|helix-turn-helix-domain-containing-protein
MTQPDVDPMDLLTPQEVAQAFRVDPKTVRLWAQEGRLRWVRTLGGHRRYFKSDVQRLLTEPGR

Crispr_ID: NC_018524_29

• CRISPR_ID: NC_018524_29
• CRISPR_location: 4636713-4636803
• CRISPR_type: Orphan
• Repeat_type: A:N
• Spacer_info: 1 spacers

Consensus repeat of NC_018524_29

Consensus_repeat	Method
CTGAGCCCCACGCACGTGGGGATGGACCG	CRISPRCasFinder

spacers of NC_018524_29

>29.1|4636742|32|NC_018524|CRISPRCasFinder
GCCCCCGTATTGGGGAAGAGAAGCTCGTCCTT

CRISPR arrays and Neighbor proteins around NC_018524_29

CRISPR arrays

The CRISPR arrays of NC_018524_29

>merge|NC_018524|29|4636713-4636803|CRISPRCasFinder
CTGAGCCCCACGCACGTGGGGATGGACCGGCCCCCGTATTGGGGAAGAGAAGCTCGTCCTTGTGAACCCCACGCACGTGGGGATGGGCCGA

>NC_018524|29|28|4636713-4636803|CRISPRCasFinder
CTGAGCCCCACGCACGTGGGGATGGACCG	GCCCCCGTATTGGGGAAGAGAAGCTCGTCCTT
GTGAACCCCACGCACGTGGGGATGGGCCGA

Neighbor Proteins Overview

Protein	Signature genes	Signature genes Name	Protein_function
NC_018524.1|WP_041562254.1|4633627_4634350_-|MerR-family-transcriptional-regulator	unknown	unknown	gnl|CDD|133378
NC_018524.1|WP_014909688.1|4643044_4644397_+|malonyl-CoA-decarboxylase-family-protein	unknown	unknown	gnl|CDD|368376
NC_018524.1|WP_041561964.1|4626960_4630476_-|LamG-domain-containing-protein	unknown	unknown	gnl|CDD|379155
NC_018524.1|WP_041561965.1|4638182_4638758_-|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl|CDD|379883
NC_018524.1|WP_014910610.1|4646456_4647221_+|malonate-transporter-subunit-MadM	unknown	unknown	gnl|CDD|129890
NC_018524.1|WP_148281648.1|4617526_4617844_-|SUKH-3-domain-containing-protein	unknown	unknown	unknown
NC_018524.1|WP_014908166.1|4640259_4640469_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_041561962.1|4617954_4618392_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014912726.1|4646056_4646455_+|malonate-transporter-subunit-MadL	unknown	unknown	gnl|CDD|367674
NC_018524.1|WP_014913370.1|4638881_4640273_-|Asp-tRNA(Asn)/Glu-tRNA(Gln)-amidotransferase-GatCAB-subunit-A	unknown	unknown	gnl|CDD|223232
NC_018524.1|WP_014911767.1|4630847_4631522_+|SMI1/KNR4-family-protein	unknown	unknown	gnl|CDD|379650
NC_018524.1|WP_014908697.1|4640767_4641661_+|MBL-fold-metallo-hydrolase	unknown	unknown	gnl|CDD|293835
NC_018524.1|WP_014911271.1|4636865_4637378_-|flavofamily-protein	unknown	unknown	gnl|CDD|376786
NC_018524.1|WP_014908829.1|4642247_4642925_-|GntR-family-transcriptional-regulator	unknown	unknown	gnl|CDD|224715
NC_018524.1|WP_014912615.1|4615370_4616384_-|esterase	unknown	unknown	gnl|CDD|223700
NC_018524.1|WP_014908562.1|4634607_4636512_+|S9-family-peptidase	unknown	unknown	gnl|CDD|224423
NC_018524.1|WP_041561966.1|4644438_4645959_+|AMP-binding-protein	unknown	unknown	gnl|CDD|181011
NC_018524.1|WP_014909387.1|4617335_4617575_-|SUKH-3-immunity-family-protein	unknown	unknown	unknown
NC_018524.1|WP_148281650.1|4632245_4632866_+|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_148281649.1|4619074_4619485_-|hypothetical-protein	unknown	unknown	unknown

rpsblast for functional proteins

Protein	Function_ID	Function_description	E-value
NC_018524.1|WP_041562254.1|4633627_4634350_-|MerR-family-transcriptional-regulator	gnl|CDD|133378	cd00592, HTH_MerR-like, Helix-Turn-Helix DNA binding domain of MerR-like transcription regulators. Helix-turn-helix (HTH) MerR-like transcription regulator, N-terminal domain. The MerR family transcription regulators have been shown to mediate responses to stress including exposure to heavy metals, drugs, or oxygen radicals in eubacterial and some archaeal species. They regulate transcription of multidrug/metal ion transporter genes and oxidative stress regulons by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.	2.2323e-20
NC_018524.1|WP_014909688.1|4643044_4644397_+|malonyl-CoA-decarboxylase-family-protein	gnl|CDD|368376	pfam05292, MCD, Malonyl-CoA decarboxylase C-terminal domain. This family consists of several eukaryotic malonyl-CoA decarboxylase (MLYCD) proteins. Malonyl-CoA, in addition to being an intermediate in the de novo synthesis of fatty acids, is an inhibitor of carnitine palmitoyltransferase I, the enzyme that regulates the transfer of long-chain fatty acyl-CoA into mitochondria, where they are oxidized. After exercise, malonyl-CoA decarboxylase participates with acetyl-CoA carboxylase in regulating the concentration of malonyl-CoA in liver and adipose tissue, as well as in muscle. Malonyl-CoA decarboxylase is regulated by AMP-activated protein kinase (AMPK).	6.42138e-97
NC_018524.1|WP_041561965.1|4638182_4638758_-|TetR/AcrR-family-transcriptional-regulator	gnl|CDD|379883	pfam16859, TetR_C_11, Bacterial transcriptional repressor C-terminal. This family of bacterial transcriptional repressors is characterized by the short approximately 50 amino acid stretch of residues constituting the helix-turn-helix DNA binding motif, around the YRFhY motif. The target proteins that are repressed are involved in the transcriptional control of multi-drug efflux pumps, pathways for the biosynthesis of antibiotics, response to osmotic stress and toxic chemicals, control of catabolic pathways, differentiation processes, and pathogenicity. Another target protein is BetI, an osmoprotectant which controls the choline-glycine betaine pathway in E.coli.	2.65102e-13
NC_018524.1|WP_014910610.1|4646456_4647221_+|malonate-transporter-subunit-MadM	gnl|CDD|129890	TIGR00808, malonate_transporter, malonate transporter, MadM subunit. The MSS family includes the monobasic malonate:Na+ symporter of Malonomonas rubra. It consists of two integral membrane proteins, MadL and MadM.The transporter is believed to catalyze the electroneutral reversible uptake of H+-malonate with one Na+, and both subunits have been shown to be essential for activity. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids].	1.12926e-96
NC_018524.1|WP_014908829.1|4642247_4642925_-|GntR-family-transcriptional-regulator	gnl|CDD|224715	COG1802, GntR, Transcriptional regulators [Transcription].	7.32022e-41
NC_018524.1|WP_014912726.1|4646056_4646455_+|malonate-transporter-subunit-MadL	gnl|CDD|367674	pfam03817, MadL, Malonate transporter MadL subunit.	6.23245e-53
NC_018524.1|WP_014913370.1|4638881_4640273_-|Asp-tRNA(Asn)/Glu-tRNA(Gln)-amidotransferase-GatCAB-subunit-A	gnl|CDD|223232	COG0154, GatA, Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit and related amidases [Translation, ribosomal structure and biogenesis].	1.74368e-157
NC_018524.1|WP_014911767.1|4630847_4631522_+|SMI1/KNR4-family-protein	gnl|CDD|379650	pfam14568, SUKH_6, SMI1-KNR4 cell-wall. Members of this family are related to the SMI1/KNR4-like or SUKH superfamily of proteins.	6.1302e-07
NC_018524.1|WP_014908697.1|4640767_4641661_+|MBL-fold-metallo-hydrolase	gnl|CDD|293835	cd16277, metallo-hydrolase-like_MBL-fold, uncharacterized subgroup of the MBL-fold_metallo-hydrolase superfamily; MBL-fold metallo hydrolase domain. Members of the MBL-fold metallohydrolase superfamily are mainly hydrolytic enzymes which carry out a variety of biological functions. The class B metal beta-lactamases (MBLs) for which this fold was named perform only a small fraction of the activities included in this superfamily.Activities carried out by superfamily members include class B beta-lactamases, hydroxyacylglutathione hydrolases, AHL (acyl homoserine lactone) lactonases, persulfide dioxygenases, flavodiiron proteins, cleavage and polyadenylation specificity factors such as the Int9 and Int11 subunits of Integrator, Sdsa1-like and AtsA-like arylsulfatases, 5'-exonucleases human SNM1A and yeast Pso2p, ribonuclease J and ribonuclease Z, cyclic nucleotide phosphodiesterases, insecticide hydrolases, and proteins required for natural transformation competence. Classical members of the superfamily are di-, or less commonly mono-, zinc-ion-dependent hydrolases, however the diversity of biological roles is reflected in variations in the active site metallo-chemistry.	8.91932e-101
NC_018524.1|WP_014911271.1|4636865_4637378_-|flavofamily-protein	gnl|CDD|376786	pfam02441, Flavoprotein, Flavoprotein. This family contains diverse flavoprotein enzymes. This family includes epidermin biosynthesis protein, EpiD, which has been shown to be a flavoprotein that binds FMN. This enzyme catalyzes the removal of two reducing equivalents from the cysteine residue of the C-terminal meso-lanthionine of epidermin to form a --C==C-- double bond. This family also includes the B chain of dipicolinate synthase a small polar molecule that accumulates to high concentrations in bacterial endospores, and is thought to play a role in spore heat resistance, or the maintenance of heat resistance. dipicolinate synthase catalyzes the formation of dipicolinic acid from dihydroxydipicolinic acid. This family also includes phenyl-acrylic acid decarboxylase (EC:4.1.1.-).	5.35238e-06
NC_018524.1|WP_014912615.1|4615370_4616384_-|esterase	gnl|CDD|223700	COG0627, COG0627, Predicted esterase [General function prediction only].	1.74392e-40
NC_018524.1|WP_014908562.1|4634607_4636512_+|S9-family-peptidase	gnl|CDD|224423	COG1506, DAP2, Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism].	6.39072e-82
NC_018524.1|WP_041561964.1|4626960_4630476_-|LamG-domain-containing-protein	gnl|CDD|379155	pfam13385, Laminin_G_3, Concanavalin A-like lectin/glucanases superfamily. This domain belongs to the Concanavalin A-like lectin/glucanases superfamily.	3.95831e-25
NC_018524.1|WP_041561966.1|4644438_4645959_+|AMP-binding-protein	gnl|CDD|181011	PRK07514, PRK07514, malonyl-CoA synthase; Validated.	0

Protein sequences

>NC_018524.1|WP_014908562.1|4634607_4636512_+|S9-family-peptidase
MSSADHGTRPRRIEIEELFADPSFANPKISPDGTRMAYLAPEYGRRNVWVRGIDQDHDQARCVTHDDRRGITTYLWSDDPRWLLYLQDTDGNEDWHLYRVDLDDPDAPAVDLTPLPEGSRVFGAEELPSHPGHVLVTMNRRPMSLDLFRVEVATGEITLHHEQAGPTENVLLDHDGRPAFASHLEEDGTLEFSAIDPDTGDHKSLIRLGGAEYPLGVHPQLVTPDGTGLVIGAYHESDHLRLVRIDRETGETTVLAALEDQSLDIMGTMVPGVLPPTVYTHRRTGEILAARFVGSRPHIEVLDDDFAEVYAKLSTLSDGVLGTLSSDDTGRHWIATFVHDRDPAVAWYYDHETGQSRRLFRPYPHLDPADLAPMEAVEFPARDGLPLHGLLTLPVGVAPERLPLVLLVHGGPWTHDTWGYNPQAQLLANRGHAVLQVNFRGSTGYGRRHTTAAIGQFAGAMHDDLLDAVDWAVDQGYADPDRIGIMGGSYGGYAALVGVTFTPDRFAAAVDIVGIADLASFMRNLPPFSRPYLMTSWYAYVGDPDVPEQEVDMLERSPISRVDKITTPLLVAHGANDVRVMQGESDKIVASLEERGVPVEYLLAEDEGHGFANPENEIRLQEAILRHFEEHLGK
>NC_018524.1|WP_041562254.1|4633627_4634350_-|MerR-family-transcriptional-regulator
MAWSTRELAALAGTTIKTIRHYHSIGLIEEPERALNGYKRYDTNHLVRLLQIRRLRDLGMSLSQIALLDGPEEGFVDTVRALDDELAASIERQRAIRAELAPLLRHRTSADVPAGFEEVASHLSDADRAMIMISARLFTEEFIQDIRDMSATHAEVDAEFNALPADADEETVRDLAERMAPSVRSIREEYPSVENPGLFVRDRERDAMITVAQALVDLYNPAQLAALREVHGLLAEEREG
>NC_018524.1|WP_148281650.1|4632245_4632866_+|hypothetical-protein
MQTSIATLAQVIPAIYIAFTIYLQYSLKSMFDTKPLVDQEVKIREREAALERADRGITALRARKIDPESIPGRHEEVKRLASARFYALEELVQLRKELCALRFGYIFMVYSMTVVSLLVSLAAVVEFYLLYLLFHQWTQVVPVLFAVAALMALLGIYSIGESVARFGDPNRRICQVNVHGEIAFGVCLVGGIGLLLAAAISVALIA
>NC_018524.1|WP_014911767.1|4630847_4631522_+|SMI1/KNR4-family-protein
MRTTRWSQVRERIQDLASVGREHDAFEARNRYGAKGHSLPLAAPLSETEIAEVETQWGVSLPDDYRGFLLEVGAGGAGPGYGLNVLSRAATGWAWDGDEDQPRHAGLSSPFVTARERVRLLAEHEDQEPERAEFATREAFDAAYNEWRDADDRLFDRLADGAVCLSHEGCGHFHWLVVTGPERGNMWVDGFPAEGGFRPLGTSGERVGFADWYLDWIATSEALQ
>NC_018524.1|WP_041561964.1|4626960_4630476_-|LamG-domain-containing-protein
MPRAVRASTAALLAATLLTPFLHSTVHADETPVPPAAENAAATADPSEQAAIIRARESGEPVEIAGATTETTRHLANPDGSFTMEQNAHPVRVREDDGWTPVDTDLVVDSRGRVRPKAVVADILFSGGGDAVLAKIGLGSNSVELSWHEDLPEPVLEGDQATYPDVLPDVDLVLTAGVDGFGQVLVVHTPEAARHELLNDLELGLATEGVTMRLGEHGNLDAIGHKGQESVFSAVAPAMWDSSGEEEMAEDATVMAPTGARTALLDVDLAPDRIRLVPDTAMLTDKATLYPVYIDPSVAVSRVGRAYVNRNYPTQSYWNYATSHAPGVGYEPAQGNTKRAFWRFSVDSRTRNADITRATFRTKVTHAYGCSNAQVQLWRTDAITSSTTWNSQTSAWRTRLDTRTINAGRSNCPGGASPTVEFNATAGYVWSRDAGNATTTLGLRGNETRSSSNWDWRRFASNPTLQVDYNNPPETPTRLSDSHGGECATDPDNPRLINQTRPTFTAYVRDRDSTSAGRQKVKTRFAWWVDGERVGDVDTAMTDVAVWSSGSFQSVRSGTLPENVLITYRANANDGISWSGWSTRCYLMVSTDRPEQGPEVTSTDYPAGDVFHGSPGLPGEFTFSNNGVEDATGYKYALNDDSCVHDIEPSSPGGSVTLTLTPRQEGPNRIYARTVDAFGNSSDCVLAYTFLVAPPSDPVAHLAFDEGQGDRAVDTIDPERGATLSEGVDWVRGRVGTVDNPDTDPTPRLNGTAVHTSGYTDGDPGPYDQINADYPAVDTSGTFSVSAWVKLDRAHAHHTAVAQEGEEQSAFHLGYQGNTGEWVFKMSPEDQYWDGSREWAVLTSSAPAETGVWTHLVGTHDSQTGELVLYVDGVRQGSATHTGPWEATGPLTVGRALFQGIGNYYWPGAVDDVKVWDRLVLDQTVTDTEQHSEIWRLANRPLAPEGHWSLDEYQGTTVADSTDHGLTATLHADPETAWDQAENDITFSPGVRLNGDDEYIQATGPAVRTDRSFTTAAWVRLDETGQSINTSALSQSGRFQSGFHLGYQGSNGNWTFKMAPHDDAPTDGSAGWTYAYSTTPARLGEWVHLAGVYDHTNGELVLYVNGFEESRVRVDHAWHADGPVRIGSGQHRGNNTYFWTGDLDDAHTYQGVLNERELSQVYAGQIPVPRL
>NC_018524.1|WP_148281649.1|4619074_4619485_-|hypothetical-protein
MASVGVSLSNLKHTEIGLVNFENEWSTLRSDNAQDAVQALSSDILFAEENFFNKFRGINDVVEYLERTRCDQFQLRQLAVGQALTGRKEAALMTLGEYFEIVKKEPPLVADQARLFITSFSEYFDIEEEDWKHSLH
>NC_018524.1|WP_041561962.1|4617954_4618392_-|hypothetical-protein
MPEFVDFDDLLQMEVLLRASMEFKFGISGDPEIFHESPVYASALNHVRESLISGLRSSSTPGRAQGYVELYRLSRFEQLWEGVARRASSHPRWHELGTHEMRQHVETIAAPLTVDDEMMEIIKTETEKIISRDTQRERSRPEAYP
>NC_018524.1|WP_148281648.1|4617526_4617844_-|SUKH-3-domain-containing-protein
MDISESMENFSSELVMALQNEGWSPGREVDVTRWVEYLKLEGYHSIPPREFFWSPSGDFPSLPSTERTRTSRTASHSPSIPWPAGPDTATWPLNWRTCWADPSIR
>NC_018524.1|WP_014909387.1|4617335_4617575_-|SUKH-3-immunity-family-protein
MATELENVLGGSFYPIGEWLSYANTFISEDGKIVSTGMGWIWGLGENLADSLESAIFANRPLKCLHSDPGLEPWPPTTR
>NC_018524.1|WP_014912615.1|4615370_4616384_-|esterase
MSPNPPSRRTLFKNVGGLSLGMAVASGGLLATTSPARAETTARPLPSPDHAGLRLVAHNEDDPRMWYYRFETDEVAWDPAINVLVPRGYRDDGRTYPVLYLLHGGGPGQDFISWDKTGIRELSEDKQIIIVMPDGGPCGWYSNPVTSNVGPRNWETFHMSQVLPWVDANFRTFAEFDGRAVAGFSMGGFGALKYAAKYYGHFASVSSYSGPASTRRDFGLVTHWANFTSGAFELGGGTVYGVPWDEGRVSADNPVENVERYRGKRVFMVAGDSPDPFDLFDRMNEEQVLAGQREFRALLDGAGIPHESHEVGGGHFVRPELVRADLDGMIGRLRPAG
>NC_018524.1|WP_014911271.1|4636865_4637378_-|flavofamily-protein
MTDQRPLYLLLSGASTSGHEPVNGLVELLQNQGRDVTVLSTPMGARFHDLDALADLTGEPVRTEFRLPGMGRSMPPGAAVVACPWSFNSTNKTALGLTDTFAAALACEMIGRGVPTIIVPKAGDALAGHPAFRRSLQELEAMPSVSVLRSEEKSLPSWEEVAEAVAKATA
>NC_018524.1|WP_041561965.1|4638182_4638758_-|TetR/AcrR-family-transcriptional-regulator
MSRKQMVRPGGRSARVQASVHSAVRELLAEVGRDALTVPMVAQRAEVTPSTIYRRWGDLTELLSDVAVERLRPEGEPEDHGDLRADLTAWAEQFLDEMGSGSGRAYIRDALLGDPDGGNAGRCSAYAAEQIDTILSRASGRGENTPALEETMDGIVAPIMYRILFRPAGLETAYARRLVADLLDAYEKSAR
>NC_018524.1|WP_014913370.1|4638881_4640273_-|Asp-tRNA(Asn)/Glu-tRNA(Gln)-amidotransferase-GatCAB-subunit-A
MRPYESTLAATATLIRERRLSPVELVDSVLERIERIEPHLEAYVMVAAEQARHAAREAEREISQGEYRGPLHGVPVGLKDLIDVAGMPTTASSRVRTDHRATADSTVAARLRSAGAVLVGKTHTHEFAYGLTTPQTGNAWDRSRVAGGSSGGSAVAVAAGEATFSLGTDTGGSIRVPSALNGVVGLKPTYGLVPRHGITPLSWSLDHVGPITRTVEDAALVLNALTGHDPRDPASLDTLPVDHRPETDPDLSGVRVGVPSHYYFEHVDPEVAAAVHHAIAGMEELGARLVEVEIPMTRYVQATQWGLMVPEATTYHERTLRTVPELYQEDVRILLEAGELMSAGDHLRAQRARTLMRDAWNRLLEEVDMVASPTVPMTAVPATQESVAWPDGTTESVSDAYVRLSAPANITGLPALSVPVGHDTAGMPIGMQLIGRPLDERTLLRAGHAYERARPARALAPVG
>NC_018524.1|WP_014908166.1|4640259_4640469_-|hypothetical-protein
MSSTELTPPEAARWAARAGLPLPHDRHAAVAATADHIHTVVSVLRELDFGDTPPASTYRVEQEKPDATV
>NC_018524.1|WP_014908697.1|4640767_4641661_+|MBL-fold-metallo-hydrolase
MRTPSTTPSWSVGDVIVHRVDEVPLPPAAGPWLLPDATPDLVLGQDWLRPHFADHDGVLHIDSHSFAFVVDGSRVLVDTGIGNGKQRANPAWHDLRTDYLERLTEAGFPPETIDLVILTHLHADHVGWNTRQVDGAWVPTFPNARYLTSRTEREFWAGQDMDEARRQMFRDSVIPIEEAGLLDLVDVPAGGARISPGLRLIPTPGHTPGHVAVELAVQGETALITGDCVHHPIQLAHPGIGACVDIDPRRSEATRRALLASLAATDTLLLGTHFAPPTVGRVVTDGDAYRLLPVSAD
>NC_018524.1|WP_014908829.1|4642247_4642925_-|GntR-family-transcriptional-regulator
MARVPESQRVRDALENAVVEGRYRPGERLDPARLELEFGCSRTPIREALQALERSGLVQIRSKQGTYVTELGVSELAERFEVMAELEGMAARLCARRIERESIERLEDTLRACERYATAGDADGYYYANADFHGVVSEACGNEYLRQQAHALKRALQPYRRLQLRVPDRMRRSLAEHRAIADAIVGGDAEAAENAARDHVLVQVKEFSQLVRTWRHLTDSARDAG
>NC_018524.1|WP_014909688.1|4643044_4644397_+|malonyl-CoA-decarboxylase-family-protein
MRPDGARETGPVRPAKEGHDGGPQTADTSGPSALDRLLTDCEILMGDVGEASVRAVAARALAAYDELDDPGRTAFFTHVIKDHGVDPDRVRAAFHRWDEAGNSGSGGEEELVELFDAVEPARQRLLRRMNHASDATLALVGMRADLRRLMRRHPELRPLDHDLHHLLASWFNRGFLRLAEVTPDSPRRLHDHLLRYERVHPMADRDALRRRLEPADRRIYAFFHPATGDVPLIFVEVALVRGTPGDITPLLEPGPALDPREADTAALYSINNALDGLTGISFGDLLIKQVIEQVRDRLPHLEHFVTLSPIPGFRRWLDERAESEADLRELVRDLDAADGPADLDPADTARIRPRLLPVLARYIAAEKRDDGRPLDPVARFHLGNGAAAWRLDWPANPSERAWRQSYGAMVNYRYEPDKLERRHEDFVRRRTVALDGPLREALPDAPDSDT
>NC_018524.1|WP_041561966.1|4644438_4645959_+|AMP-binding-protein
MAPFTAIHRSFAEQARRRPDRTLFELPGGGNITYGQTEETVRRIAARLLADGVTPGDRVAMQVEKSPEAVALYLATLRVGGVFLPLNTAYTDAEMTYFLGDAQPRVLVCSPDRRAEHTGREAEGLVVETLGTSGDGTLLEGDGHHDGDHDASAEDPAAILYTSGTTGRSKGAVLTHGNLASNCEALLQAWRYTSEDRLIHALPIFHVHGLFVAVNMTLAAGASMHYLSGFDTDAVIDLLPRATVLMGVPTFYTRLLRSDRLTSESCASMRLFVSGSAPLLASDAEAFQARTGHAILERYGMTETGMNTTNPYEGPRKPGTVGRPLPGVEVRVADRETGGKLSDGEVGIVEVRGPNVFSGYWRMPEKTAAEFREDGFFITGDLGRVDEDGHLCIVGRDKDLVISGGYNVYPKEVEELLDAHPGVLESAVIGVPHPDLGEAVAAVVVPRPGRELQAEELLESISGDLARFKRPRAVRVVEALPRNVMGKVQKAELRERYTDLFTGADA
>NC_018524.1|WP_014912726.1|4646056_4646455_+|malonate-transporter-subunit-MadL
MVLYGVAALAVCLLSGALVGELLGAAVGVDANVGGVGFAMIMLVVVSDRLRRNGKLPEATEQGVLFWSAMYIPVVIAMASTQNVVKAIAGGPMAITAGLAALAVGAALVPVLSRIGEPAEPLPPLVEEERGA
>NC_018524.1|WP_014910610.1|4646456_4647221_+|malonate-transporter-subunit-MadM
MDRIIGVFESNDLLVAFVVVGGLMVVSGWLSKKLTRGWLHGSAIAIILGLALAYWGGWVTGGEHGLADIAVFSGLGLMGGAMLRDFAIVSTAYGVDLREIKRAGLVGVLSLVLGVLVSFAVGAAIAAAFGYTDAASMATIGAGAATYIVGPVTGTAVGASSEVIALSVAAGLVKSVVVMVGTPLIAPLIGLNNPKSAMVYGGLMGTTSGVAGGLAATDKRLVPYGAMTATFYTGVGCLLGPSLLYVVLRFLVGG

Crispr_ID: NC_018524_30

• CRISPR_ID: NC_018524_30
• CRISPR_location: 4637701-4638156
• CRISPR_type: Orphan
• Repeat_type: A:N
• Spacer_info: 7 spacers

Consensus repeat of NC_018524_30

Consensus_repeat	Method
CGGTCCATCCCCACGTGCGTGGGGCTCAG	PILER-CR
CTGAGCCCCACGCACGTGGGGATGGACCG	CRISPRCasFinder
CTGAGCCCCACGCACGTGGGGATGGACCG	CRT

spacers of NC_018524_30

>30.1|4637730|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT
CTCCTCTTCCGAGTAGGCGGGCCAATTCGCGC
>30.2|4637791|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT
GAGGGCAGTCGATGATGATCTCGTCGAACTCT
>30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT
CCTCGGGGCCGGCGGTGATCGCCCCGGCCCGC
>30.4|4637913|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT
CCCGGGACGTGGCGCACGTGGTAGCTAATCTG
>30.5|4637974|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT
TCGTGGTACATCAGCTCCCCGCTCACCTCCAG
>30.6|4638035|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT
CAACGTGCTGTTGTAGTTCAGCTCGGCGTTGA
>30.7|4638096|32|NC_018524|CRISPRCasFinder,CRT
GTCACACCGATGTTCTCTCGGCCGGCCTGGTA

CRISPR arrays and Neighbor proteins around NC_018524_30

CRISPR arrays

The CRISPR arrays of NC_018524_30

>merge|NC_018524|30|4637701-4638156|PILER-CR,CRISPRCasFinder,CRT
CTGAGCCCCACGCACGTGGGTATGGACCGCTCCTCTTCCGAGTAGGCGGGCCAATTCGCGCCTGAGCCCCACGCACGTGGGGATGGACCGGAGGGCAGTCGATGATGATCTCGTCGAACTCTCTGAGCCCCACGCACGTGGGGATGGACCGCCTCGGGGCCGGCGGTGATCGCCCCGGCCCGCCTGAGCCCCACGCACGTGGGGATGGACCGCCCGGGACGTGGCGCACGTGGTAGCTAATCTGCTGAGCCCCACGCACGTGGGGGTGGACCGTCGTGGTACATCAGCTCCCCGCTCACCTCCAGCTGAGCCCCACGCACGTGGGGATGAACCGCAACGTGCTGTTGTAGTTCAGCTCGGCGTTGACTGAGCCCCACGCACGTGGGGATGGACCGGTCACACCGATGTTCTCTCGGCCGGCCTGGTAGTGAGCCCCACGTACGTGGGGATGCCGGG

>NC_018524|30|17|4637701-4638095|PILER-CR
CTGAGCCCCACGCACGTGGGTATGGACCG	CTCCTCTTCCGAGTAGGCGGGCCAATTCGCGC
CTGAGCCCCACGCACGTGGGGATGGACCG	GAGGGCAGTCGATGATGATCTCGTCGAACTCT
CTGAGCCCCACGCACGTGGGGATGGACCG	CCTCGGGGCCGGCGGTGATCGCCCCGGCCCGC
CTGAGCCCCACGCACGTGGGGATGGACCG	CCCGGGACGTGGCGCACGTGGTAGCTAATCTG
CTGAGCCCCACGCACGTGGGGGTGGACCG	TCGTGGTACATCAGCTCCCCGCTCACCTCCAG
CTGAGCCCCACGCACGTGGGGATGAACCG	CAACGTGCTGTTGTAGTTCAGCTCGGCGTTGA
CTGAGCCCCACGCACGTGGGGATGGACCG

>NC_018524|30|29|4637701-4638156|CRISPRCasFinder
CTGAGCCCCACGCACGTGGGTATGGACCG	CTCCTCTTCCGAGTAGGCGGGCCAATTCGCGC
CTGAGCCCCACGCACGTGGGGATGGACCG	GAGGGCAGTCGATGATGATCTCGTCGAACTCT
CTGAGCCCCACGCACGTGGGGATGGACCG	CCTCGGGGCCGGCGGTGATCGCCCCGGCCCGC
CTGAGCCCCACGCACGTGGGGATGGACCG	CCCGGGACGTGGCGCACGTGGTAGCTAATCTG
CTGAGCCCCACGCACGTGGGGGTGGACCG	TCGTGGTACATCAGCTCCCCGCTCACCTCCAG
CTGAGCCCCACGCACGTGGGGATGAACCG	CAACGTGCTGTTGTAGTTCAGCTCGGCGTTGA
CTGAGCCCCACGCACGTGGGGATGGACCG	GTCACACCGATGTTCTCTCGGCCGGCCTGGTA
GTGAGCCCCACGTACGTGGGGATGCCGGG

>NC_018524|30|18|4637701-4638156|CRT
CTGAGCCCCACGCACGTGGGTATGGACCG	CTCCTCTTCCGAGTAGGCGGGCCAATTCGCGC
CTGAGCCCCACGCACGTGGGGATGGACCG	GAGGGCAGTCGATGATGATCTCGTCGAACTCT
CTGAGCCCCACGCACGTGGGGATGGACCG	CCTCGGGGCCGGCGGTGATCGCCCCGGCCCGC
CTGAGCCCCACGCACGTGGGGATGGACCG	CCCGGGACGTGGCGCACGTGGTAGCTAATCTG
CTGAGCCCCACGCACGTGGGGGTGGACCG	TCGTGGTACATCAGCTCCCCGCTCACCTCCAG
CTGAGCCCCACGCACGTGGGGATGAACCG	CAACGTGCTGTTGTAGTTCAGCTCGGCGTTGA
CTGAGCCCCACGCACGTGGGGATGGACCG	GTCACACCGATGTTCTCTCGGCCGGCCTGGTA
GTGAGCCCCACGTACGTGGGGATGCCGGG

Neighbor Proteins Overview

Protein	Signature genes	Signature genes Name	Protein_function
NC_018524.1|WP_041562254.1|4633627_4634350_-|MerR-family-transcriptional-regulator	unknown	unknown	gnl|CDD|133378
NC_018524.1|WP_014909688.1|4643044_4644397_+|malonyl-CoA-decarboxylase-family-protein	unknown	unknown	gnl|CDD|368376
NC_018524.1|WP_041561964.1|4626960_4630476_-|LamG-domain-containing-protein	unknown	unknown	gnl|CDD|379155
NC_018524.1|WP_041561965.1|4638182_4638758_-|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl|CDD|379883
NC_018524.1|WP_014910610.1|4646456_4647221_+|malonate-transporter-subunit-MadM	unknown	unknown	gnl|CDD|129890
NC_018524.1|WP_148281648.1|4617526_4617844_-|SUKH-3-domain-containing-protein	unknown	unknown	unknown
NC_018524.1|WP_014908166.1|4640259_4640469_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_041561962.1|4617954_4618392_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014913370.1|4638881_4640273_-|Asp-tRNA(Asn)/Glu-tRNA(Gln)-amidotransferase-GatCAB-subunit-A	unknown	unknown	gnl|CDD|223232
NC_018524.1|WP_014911767.1|4630847_4631522_+|SMI1/KNR4-family-protein	unknown	unknown	gnl|CDD|379650
NC_018524.1|WP_014908697.1|4640767_4641661_+|MBL-fold-metallo-hydrolase	unknown	unknown	gnl|CDD|293835
NC_018524.1|WP_014911271.1|4636865_4637378_-|flavofamily-protein	unknown	unknown	gnl|CDD|376786
NC_018524.1|WP_014908829.1|4642247_4642925_-|GntR-family-transcriptional-regulator	unknown	unknown	gnl|CDD|224715
NC_018524.1|WP_014912726.1|4646056_4646455_+|malonate-transporter-subunit-MadL	unknown	unknown	gnl|CDD|367674
NC_018524.1|WP_014908562.1|4634607_4636512_+|S9-family-peptidase	unknown	unknown	gnl|CDD|224423
NC_018524.1|WP_041561966.1|4644438_4645959_+|AMP-binding-protein	unknown	unknown	gnl|CDD|181011
NC_018524.1|WP_014909387.1|4617335_4617575_-|SUKH-3-immunity-family-protein	unknown	unknown	unknown
NC_018524.1|WP_081536579.1|4647624_4648038_+|spore-associated-protein-A	unknown	unknown	unknown
NC_018524.1|WP_148281650.1|4632245_4632866_+|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_148281649.1|4619074_4619485_-|hypothetical-protein	unknown	unknown	unknown

rpsblast for functional proteins

Protein	Function_ID	Function_description	E-value
NC_018524.1|WP_041562254.1|4633627_4634350_-|MerR-family-transcriptional-regulator	gnl|CDD|133378	cd00592, HTH_MerR-like, Helix-Turn-Helix DNA binding domain of MerR-like transcription regulators. Helix-turn-helix (HTH) MerR-like transcription regulator, N-terminal domain. The MerR family transcription regulators have been shown to mediate responses to stress including exposure to heavy metals, drugs, or oxygen radicals in eubacterial and some archaeal species. They regulate transcription of multidrug/metal ion transporter genes and oxidative stress regulons by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.	2.2323e-20
NC_018524.1|WP_014909688.1|4643044_4644397_+|malonyl-CoA-decarboxylase-family-protein	gnl|CDD|368376	pfam05292, MCD, Malonyl-CoA decarboxylase C-terminal domain. This family consists of several eukaryotic malonyl-CoA decarboxylase (MLYCD) proteins. Malonyl-CoA, in addition to being an intermediate in the de novo synthesis of fatty acids, is an inhibitor of carnitine palmitoyltransferase I, the enzyme that regulates the transfer of long-chain fatty acyl-CoA into mitochondria, where they are oxidized. After exercise, malonyl-CoA decarboxylase participates with acetyl-CoA carboxylase in regulating the concentration of malonyl-CoA in liver and adipose tissue, as well as in muscle. Malonyl-CoA decarboxylase is regulated by AMP-activated protein kinase (AMPK).	6.42138e-97
NC_018524.1|WP_041561965.1|4638182_4638758_-|TetR/AcrR-family-transcriptional-regulator	gnl|CDD|379883	pfam16859, TetR_C_11, Bacterial transcriptional repressor C-terminal. This family of bacterial transcriptional repressors is characterized by the short approximately 50 amino acid stretch of residues constituting the helix-turn-helix DNA binding motif, around the YRFhY motif. The target proteins that are repressed are involved in the transcriptional control of multi-drug efflux pumps, pathways for the biosynthesis of antibiotics, response to osmotic stress and toxic chemicals, control of catabolic pathways, differentiation processes, and pathogenicity. Another target protein is BetI, an osmoprotectant which controls the choline-glycine betaine pathway in E.coli.	2.65102e-13
NC_018524.1|WP_014910610.1|4646456_4647221_+|malonate-transporter-subunit-MadM	gnl|CDD|129890	TIGR00808, malonate_transporter, malonate transporter, MadM subunit. The MSS family includes the monobasic malonate:Na+ symporter of Malonomonas rubra. It consists of two integral membrane proteins, MadL and MadM.The transporter is believed to catalyze the electroneutral reversible uptake of H+-malonate with one Na+, and both subunits have been shown to be essential for activity. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids].	1.12926e-96
NC_018524.1|WP_014908829.1|4642247_4642925_-|GntR-family-transcriptional-regulator	gnl|CDD|224715	COG1802, GntR, Transcriptional regulators [Transcription].	7.32022e-41
NC_018524.1|WP_014913370.1|4638881_4640273_-|Asp-tRNA(Asn)/Glu-tRNA(Gln)-amidotransferase-GatCAB-subunit-A	gnl|CDD|223232	COG0154, GatA, Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit and related amidases [Translation, ribosomal structure and biogenesis].	1.74368e-157
NC_018524.1|WP_014911767.1|4630847_4631522_+|SMI1/KNR4-family-protein	gnl|CDD|379650	pfam14568, SUKH_6, SMI1-KNR4 cell-wall. Members of this family are related to the SMI1/KNR4-like or SUKH superfamily of proteins.	6.1302e-07
NC_018524.1|WP_014908697.1|4640767_4641661_+|MBL-fold-metallo-hydrolase	gnl|CDD|293835	cd16277, metallo-hydrolase-like_MBL-fold, uncharacterized subgroup of the MBL-fold_metallo-hydrolase superfamily; MBL-fold metallo hydrolase domain. Members of the MBL-fold metallohydrolase superfamily are mainly hydrolytic enzymes which carry out a variety of biological functions. The class B metal beta-lactamases (MBLs) for which this fold was named perform only a small fraction of the activities included in this superfamily.Activities carried out by superfamily members include class B beta-lactamases, hydroxyacylglutathione hydrolases, AHL (acyl homoserine lactone) lactonases, persulfide dioxygenases, flavodiiron proteins, cleavage and polyadenylation specificity factors such as the Int9 and Int11 subunits of Integrator, Sdsa1-like and AtsA-like arylsulfatases, 5'-exonucleases human SNM1A and yeast Pso2p, ribonuclease J and ribonuclease Z, cyclic nucleotide phosphodiesterases, insecticide hydrolases, and proteins required for natural transformation competence. Classical members of the superfamily are di-, or less commonly mono-, zinc-ion-dependent hydrolases, however the diversity of biological roles is reflected in variations in the active site metallo-chemistry.	8.91932e-101
NC_018524.1|WP_014911271.1|4636865_4637378_-|flavofamily-protein	gnl|CDD|376786	pfam02441, Flavoprotein, Flavoprotein. This family contains diverse flavoprotein enzymes. This family includes epidermin biosynthesis protein, EpiD, which has been shown to be a flavoprotein that binds FMN. This enzyme catalyzes the removal of two reducing equivalents from the cysteine residue of the C-terminal meso-lanthionine of epidermin to form a --C==C-- double bond. This family also includes the B chain of dipicolinate synthase a small polar molecule that accumulates to high concentrations in bacterial endospores, and is thought to play a role in spore heat resistance, or the maintenance of heat resistance. dipicolinate synthase catalyzes the formation of dipicolinic acid from dihydroxydipicolinic acid. This family also includes phenyl-acrylic acid decarboxylase (EC:4.1.1.-).	5.35238e-06
NC_018524.1|WP_014912726.1|4646056_4646455_+|malonate-transporter-subunit-MadL	gnl|CDD|367674	pfam03817, MadL, Malonate transporter MadL subunit.	6.23245e-53
NC_018524.1|WP_014908562.1|4634607_4636512_+|S9-family-peptidase	gnl|CDD|224423	COG1506, DAP2, Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism].	6.39072e-82
NC_018524.1|WP_041561964.1|4626960_4630476_-|LamG-domain-containing-protein	gnl|CDD|379155	pfam13385, Laminin_G_3, Concanavalin A-like lectin/glucanases superfamily. This domain belongs to the Concanavalin A-like lectin/glucanases superfamily.	3.95831e-25
NC_018524.1|WP_041561966.1|4644438_4645959_+|AMP-binding-protein	gnl|CDD|181011	PRK07514, PRK07514, malonyl-CoA synthase; Validated.	0

Protein sequences

>NC_018524.1|WP_014911271.1|4636865_4637378_-|flavofamily-protein
MTDQRPLYLLLSGASTSGHEPVNGLVELLQNQGRDVTVLSTPMGARFHDLDALADLTGEPVRTEFRLPGMGRSMPPGAAVVACPWSFNSTNKTALGLTDTFAAALACEMIGRGVPTIIVPKAGDALAGHPAFRRSLQELEAMPSVSVLRSEEKSLPSWEEVAEAVAKATA
>NC_018524.1|WP_014908562.1|4634607_4636512_+|S9-family-peptidase
MSSADHGTRPRRIEIEELFADPSFANPKISPDGTRMAYLAPEYGRRNVWVRGIDQDHDQARCVTHDDRRGITTYLWSDDPRWLLYLQDTDGNEDWHLYRVDLDDPDAPAVDLTPLPEGSRVFGAEELPSHPGHVLVTMNRRPMSLDLFRVEVATGEITLHHEQAGPTENVLLDHDGRPAFASHLEEDGTLEFSAIDPDTGDHKSLIRLGGAEYPLGVHPQLVTPDGTGLVIGAYHESDHLRLVRIDRETGETTVLAALEDQSLDIMGTMVPGVLPPTVYTHRRTGEILAARFVGSRPHIEVLDDDFAEVYAKLSTLSDGVLGTLSSDDTGRHWIATFVHDRDPAVAWYYDHETGQSRRLFRPYPHLDPADLAPMEAVEFPARDGLPLHGLLTLPVGVAPERLPLVLLVHGGPWTHDTWGYNPQAQLLANRGHAVLQVNFRGSTGYGRRHTTAAIGQFAGAMHDDLLDAVDWAVDQGYADPDRIGIMGGSYGGYAALVGVTFTPDRFAAAVDIVGIADLASFMRNLPPFSRPYLMTSWYAYVGDPDVPEQEVDMLERSPISRVDKITTPLLVAHGANDVRVMQGESDKIVASLEERGVPVEYLLAEDEGHGFANPENEIRLQEAILRHFEEHLGK
>NC_018524.1|WP_041562254.1|4633627_4634350_-|MerR-family-transcriptional-regulator
MAWSTRELAALAGTTIKTIRHYHSIGLIEEPERALNGYKRYDTNHLVRLLQIRRLRDLGMSLSQIALLDGPEEGFVDTVRALDDELAASIERQRAIRAELAPLLRHRTSADVPAGFEEVASHLSDADRAMIMISARLFTEEFIQDIRDMSATHAEVDAEFNALPADADEETVRDLAERMAPSVRSIREEYPSVENPGLFVRDRERDAMITVAQALVDLYNPAQLAALREVHGLLAEEREG
>NC_018524.1|WP_148281650.1|4632245_4632866_+|hypothetical-protein
MQTSIATLAQVIPAIYIAFTIYLQYSLKSMFDTKPLVDQEVKIREREAALERADRGITALRARKIDPESIPGRHEEVKRLASARFYALEELVQLRKELCALRFGYIFMVYSMTVVSLLVSLAAVVEFYLLYLLFHQWTQVVPVLFAVAALMALLGIYSIGESVARFGDPNRRICQVNVHGEIAFGVCLVGGIGLLLAAAISVALIA
>NC_018524.1|WP_014911767.1|4630847_4631522_+|SMI1/KNR4-family-protein
MRTTRWSQVRERIQDLASVGREHDAFEARNRYGAKGHSLPLAAPLSETEIAEVETQWGVSLPDDYRGFLLEVGAGGAGPGYGLNVLSRAATGWAWDGDEDQPRHAGLSSPFVTARERVRLLAEHEDQEPERAEFATREAFDAAYNEWRDADDRLFDRLADGAVCLSHEGCGHFHWLVVTGPERGNMWVDGFPAEGGFRPLGTSGERVGFADWYLDWIATSEALQ
>NC_018524.1|WP_041561964.1|4626960_4630476_-|LamG-domain-containing-protein
MPRAVRASTAALLAATLLTPFLHSTVHADETPVPPAAENAAATADPSEQAAIIRARESGEPVEIAGATTETTRHLANPDGSFTMEQNAHPVRVREDDGWTPVDTDLVVDSRGRVRPKAVVADILFSGGGDAVLAKIGLGSNSVELSWHEDLPEPVLEGDQATYPDVLPDVDLVLTAGVDGFGQVLVVHTPEAARHELLNDLELGLATEGVTMRLGEHGNLDAIGHKGQESVFSAVAPAMWDSSGEEEMAEDATVMAPTGARTALLDVDLAPDRIRLVPDTAMLTDKATLYPVYIDPSVAVSRVGRAYVNRNYPTQSYWNYATSHAPGVGYEPAQGNTKRAFWRFSVDSRTRNADITRATFRTKVTHAYGCSNAQVQLWRTDAITSSTTWNSQTSAWRTRLDTRTINAGRSNCPGGASPTVEFNATAGYVWSRDAGNATTTLGLRGNETRSSSNWDWRRFASNPTLQVDYNNPPETPTRLSDSHGGECATDPDNPRLINQTRPTFTAYVRDRDSTSAGRQKVKTRFAWWVDGERVGDVDTAMTDVAVWSSGSFQSVRSGTLPENVLITYRANANDGISWSGWSTRCYLMVSTDRPEQGPEVTSTDYPAGDVFHGSPGLPGEFTFSNNGVEDATGYKYALNDDSCVHDIEPSSPGGSVTLTLTPRQEGPNRIYARTVDAFGNSSDCVLAYTFLVAPPSDPVAHLAFDEGQGDRAVDTIDPERGATLSEGVDWVRGRVGTVDNPDTDPTPRLNGTAVHTSGYTDGDPGPYDQINADYPAVDTSGTFSVSAWVKLDRAHAHHTAVAQEGEEQSAFHLGYQGNTGEWVFKMSPEDQYWDGSREWAVLTSSAPAETGVWTHLVGTHDSQTGELVLYVDGVRQGSATHTGPWEATGPLTVGRALFQGIGNYYWPGAVDDVKVWDRLVLDQTVTDTEQHSEIWRLANRPLAPEGHWSLDEYQGTTVADSTDHGLTATLHADPETAWDQAENDITFSPGVRLNGDDEYIQATGPAVRTDRSFTTAAWVRLDETGQSINTSALSQSGRFQSGFHLGYQGSNGNWTFKMAPHDDAPTDGSAGWTYAYSTTPARLGEWVHLAGVYDHTNGELVLYVNGFEESRVRVDHAWHADGPVRIGSGQHRGNNTYFWTGDLDDAHTYQGVLNERELSQVYAGQIPVPRL
>NC_018524.1|WP_148281649.1|4619074_4619485_-|hypothetical-protein
MASVGVSLSNLKHTEIGLVNFENEWSTLRSDNAQDAVQALSSDILFAEENFFNKFRGINDVVEYLERTRCDQFQLRQLAVGQALTGRKEAALMTLGEYFEIVKKEPPLVADQARLFITSFSEYFDIEEEDWKHSLH
>NC_018524.1|WP_041561962.1|4617954_4618392_-|hypothetical-protein
MPEFVDFDDLLQMEVLLRASMEFKFGISGDPEIFHESPVYASALNHVRESLISGLRSSSTPGRAQGYVELYRLSRFEQLWEGVARRASSHPRWHELGTHEMRQHVETIAAPLTVDDEMMEIIKTETEKIISRDTQRERSRPEAYP
>NC_018524.1|WP_148281648.1|4617526_4617844_-|SUKH-3-domain-containing-protein
MDISESMENFSSELVMALQNEGWSPGREVDVTRWVEYLKLEGYHSIPPREFFWSPSGDFPSLPSTERTRTSRTASHSPSIPWPAGPDTATWPLNWRTCWADPSIR
>NC_018524.1|WP_014909387.1|4617335_4617575_-|SUKH-3-immunity-family-protein
MATELENVLGGSFYPIGEWLSYANTFISEDGKIVSTGMGWIWGLGENLADSLESAIFANRPLKCLHSDPGLEPWPPTTR
>NC_018524.1|WP_041561965.1|4638182_4638758_-|TetR/AcrR-family-transcriptional-regulator
MSRKQMVRPGGRSARVQASVHSAVRELLAEVGRDALTVPMVAQRAEVTPSTIYRRWGDLTELLSDVAVERLRPEGEPEDHGDLRADLTAWAEQFLDEMGSGSGRAYIRDALLGDPDGGNAGRCSAYAAEQIDTILSRASGRGENTPALEETMDGIVAPIMYRILFRPAGLETAYARRLVADLLDAYEKSAR
>NC_018524.1|WP_014913370.1|4638881_4640273_-|Asp-tRNA(Asn)/Glu-tRNA(Gln)-amidotransferase-GatCAB-subunit-A
MRPYESTLAATATLIRERRLSPVELVDSVLERIERIEPHLEAYVMVAAEQARHAAREAEREISQGEYRGPLHGVPVGLKDLIDVAGMPTTASSRVRTDHRATADSTVAARLRSAGAVLVGKTHTHEFAYGLTTPQTGNAWDRSRVAGGSSGGSAVAVAAGEATFSLGTDTGGSIRVPSALNGVVGLKPTYGLVPRHGITPLSWSLDHVGPITRTVEDAALVLNALTGHDPRDPASLDTLPVDHRPETDPDLSGVRVGVPSHYYFEHVDPEVAAAVHHAIAGMEELGARLVEVEIPMTRYVQATQWGLMVPEATTYHERTLRTVPELYQEDVRILLEAGELMSAGDHLRAQRARTLMRDAWNRLLEEVDMVASPTVPMTAVPATQESVAWPDGTTESVSDAYVRLSAPANITGLPALSVPVGHDTAGMPIGMQLIGRPLDERTLLRAGHAYERARPARALAPVG
>NC_018524.1|WP_014908166.1|4640259_4640469_-|hypothetical-protein
MSSTELTPPEAARWAARAGLPLPHDRHAAVAATADHIHTVVSVLRELDFGDTPPASTYRVEQEKPDATV
>NC_018524.1|WP_014908697.1|4640767_4641661_+|MBL-fold-metallo-hydrolase
MRTPSTTPSWSVGDVIVHRVDEVPLPPAAGPWLLPDATPDLVLGQDWLRPHFADHDGVLHIDSHSFAFVVDGSRVLVDTGIGNGKQRANPAWHDLRTDYLERLTEAGFPPETIDLVILTHLHADHVGWNTRQVDGAWVPTFPNARYLTSRTEREFWAGQDMDEARRQMFRDSVIPIEEAGLLDLVDVPAGGARISPGLRLIPTPGHTPGHVAVELAVQGETALITGDCVHHPIQLAHPGIGACVDIDPRRSEATRRALLASLAATDTLLLGTHFAPPTVGRVVTDGDAYRLLPVSAD
>NC_018524.1|WP_014908829.1|4642247_4642925_-|GntR-family-transcriptional-regulator
MARVPESQRVRDALENAVVEGRYRPGERLDPARLELEFGCSRTPIREALQALERSGLVQIRSKQGTYVTELGVSELAERFEVMAELEGMAARLCARRIERESIERLEDTLRACERYATAGDADGYYYANADFHGVVSEACGNEYLRQQAHALKRALQPYRRLQLRVPDRMRRSLAEHRAIADAIVGGDAEAAENAARDHVLVQVKEFSQLVRTWRHLTDSARDAG
>NC_018524.1|WP_014909688.1|4643044_4644397_+|malonyl-CoA-decarboxylase-family-protein
MRPDGARETGPVRPAKEGHDGGPQTADTSGPSALDRLLTDCEILMGDVGEASVRAVAARALAAYDELDDPGRTAFFTHVIKDHGVDPDRVRAAFHRWDEAGNSGSGGEEELVELFDAVEPARQRLLRRMNHASDATLALVGMRADLRRLMRRHPELRPLDHDLHHLLASWFNRGFLRLAEVTPDSPRRLHDHLLRYERVHPMADRDALRRRLEPADRRIYAFFHPATGDVPLIFVEVALVRGTPGDITPLLEPGPALDPREADTAALYSINNALDGLTGISFGDLLIKQVIEQVRDRLPHLEHFVTLSPIPGFRRWLDERAESEADLRELVRDLDAADGPADLDPADTARIRPRLLPVLARYIAAEKRDDGRPLDPVARFHLGNGAAAWRLDWPANPSERAWRQSYGAMVNYRYEPDKLERRHEDFVRRRTVALDGPLREALPDAPDSDT
>NC_018524.1|WP_041561966.1|4644438_4645959_+|AMP-binding-protein
MAPFTAIHRSFAEQARRRPDRTLFELPGGGNITYGQTEETVRRIAARLLADGVTPGDRVAMQVEKSPEAVALYLATLRVGGVFLPLNTAYTDAEMTYFLGDAQPRVLVCSPDRRAEHTGREAEGLVVETLGTSGDGTLLEGDGHHDGDHDASAEDPAAILYTSGTTGRSKGAVLTHGNLASNCEALLQAWRYTSEDRLIHALPIFHVHGLFVAVNMTLAAGASMHYLSGFDTDAVIDLLPRATVLMGVPTFYTRLLRSDRLTSESCASMRLFVSGSAPLLASDAEAFQARTGHAILERYGMTETGMNTTNPYEGPRKPGTVGRPLPGVEVRVADRETGGKLSDGEVGIVEVRGPNVFSGYWRMPEKTAAEFREDGFFITGDLGRVDEDGHLCIVGRDKDLVISGGYNVYPKEVEELLDAHPGVLESAVIGVPHPDLGEAVAAVVVPRPGRELQAEELLESISGDLARFKRPRAVRVVEALPRNVMGKVQKAELRERYTDLFTGADA
>NC_018524.1|WP_014912726.1|4646056_4646455_+|malonate-transporter-subunit-MadL
MVLYGVAALAVCLLSGALVGELLGAAVGVDANVGGVGFAMIMLVVVSDRLRRNGKLPEATEQGVLFWSAMYIPVVIAMASTQNVVKAIAGGPMAITAGLAALAVGAALVPVLSRIGEPAEPLPPLVEEERGA
>NC_018524.1|WP_014910610.1|4646456_4647221_+|malonate-transporter-subunit-MadM
MDRIIGVFESNDLLVAFVVVGGLMVVSGWLSKKLTRGWLHGSAIAIILGLALAYWGGWVTGGEHGLADIAVFSGLGLMGGAMLRDFAIVSTAYGVDLREIKRAGLVGVLSLVLGVLVSFAVGAAIAAAFGYTDAASMATIGAGAATYIVGPVTGTAVGASSEVIALSVAAGLVKSVVVMVGTPLIAPLIGLNNPKSAMVYGGLMGTTSGVAGGLAATDKRLVPYGAMTATFYTGVGCLLGPSLLYVVLRFLVGG
>NC_018524.1|WP_081536579.1|4647624_4648038_+|spore-associated-protein-A
MRAARKSLTAAVVVALLSAIAVGLSPSAASAAPYNGACGTGYNVLDSRDIIGATVYVTYNPSNGYNCAATIRDSSGAAINMGAAIKRSSASTWVVDDGSYTTYAGPVYVHAPGQCIDWAGYYGPTSNEVRVFNDFCN

Crispr_ID: NC_018524_31

• CRISPR_ID: NC_018524_31
• CRISPR_location: 4641884-4642217
• CRISPR_type: Orphan
• Repeat_type: A:N
• Spacer_info: 5 spacers

Consensus repeat of NC_018524_31

Consensus_repeat	Method
CGGTCCATCCCCACGTGCGTGGGGCTCAC	PILER-CR
GTGAGCCCCACGCACGTGGGGATGGACCG	CRISPRCasFinder
GTGAGCCCCACGCACGTGGGGATGGACCG	CRT

spacers of NC_018524_31

>31.1|4641913|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT
GGCTCGTCCGGATCGAGAGGGGGACCGGCACC
>31.2|4641974|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT
GAGAAACACTATGGTTTCCAACCCGTTCGGAG
>31.3|4642035|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT
CCGTCCCCGCGTGGCAGAACGGCGAACTGATC
>31.4|4642096|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT
CGGATCGCGTAGGTGTTGCGAGCCTTCATCCC
>31.5|4642157|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT
AAGACCACCGAGAAGGGGTAGTGGCACGAGTA

CRISPR arrays and Neighbor proteins around NC_018524_31

CRISPR arrays

The CRISPR arrays of NC_018524_31

>merge|NC_018524|31|4641884-4642217|PILER-CR,CRISPRCasFinder,CRT
GTGAGCCCCACGCACGTGGGGATGGACCGGGCTCGTCCGGATCGAGAGGGGGACCGGCACCGTGAGCCCCACGCACGTGGGGATGGACCGGAGAAACACTATGGTTTCCAACCCGTTCGGAGGTGAGCCCCACGCACGTGGGGATGGACCGCCGTCCCCGCGTGGCAGAACGGCGAACTGATCGTGAGCCCCACGCACGTGGGGATGGACCGCGGATCGCGTAGGTGTTGCGAGCCTTCATCCCGTGAGCCCCATGCACGTGGGGATGGACCGAAGACCACCGAGAAGGGGTAGTGGCACGAGTAGTGAGCCCCACGCATGTGGGGATGGACCA

>NC_018524|31|18|4641884-4642217|PILER-CR
GTGAGCCCCACGCACGTGGGGATGGACCG	GGCTCGTCCGGATCGAGAGGGGGACCGGCACC
GTGAGCCCCACGCACGTGGGGATGGACCG	GAGAAACACTATGGTTTCCAACCCGTTCGGAG
GTGAGCCCCACGCACGTGGGGATGGACCG	CCGTCCCCGCGTGGCAGAACGGCGAACTGATC
GTGAGCCCCACGCACGTGGGGATGGACCG	CGGATCGCGTAGGTGTTGCGAGCCTTCATCCC
GTGAGCCCCATGCACGTGGGGATGGACCG	AAGACCACCGAGAAGGGGTAGTGGCACGAGTA
GTGAGCCCCACGCATGTGGGGATGGACCA

>NC_018524|31|30|4641884-4642217|CRISPRCasFinder
GTGAGCCCCACGCACGTGGGGATGGACCG	GGCTCGTCCGGATCGAGAGGGGGACCGGCACC
GTGAGCCCCACGCACGTGGGGATGGACCG	GAGAAACACTATGGTTTCCAACCCGTTCGGAG
GTGAGCCCCACGCACGTGGGGATGGACCG	CCGTCCCCGCGTGGCAGAACGGCGAACTGATC
GTGAGCCCCACGCACGTGGGGATGGACCG	CGGATCGCGTAGGTGTTGCGAGCCTTCATCCC
GTGAGCCCCATGCACGTGGGGATGGACCG	AAGACCACCGAGAAGGGGTAGTGGCACGAGTA
GTGAGCCCCACGCATGTGGGGATGGACCA

>NC_018524|31|19|4641884-4642217|CRT
GTGAGCCCCACGCACGTGGGGATGGACCG	GGCTCGTCCGGATCGAGAGGGGGACCGGCACC
GTGAGCCCCACGCACGTGGGGATGGACCG	GAGAAACACTATGGTTTCCAACCCGTTCGGAG
GTGAGCCCCACGCACGTGGGGATGGACCG	CCGTCCCCGCGTGGCAGAACGGCGAACTGATC
GTGAGCCCCACGCACGTGGGGATGGACCG	CGGATCGCGTAGGTGTTGCGAGCCTTCATCCC
GTGAGCCCCATGCACGTGGGGATGGACCG	AAGACCACCGAGAAGGGGTAGTGGCACGAGTA
GTGAGCCCCACGCATGTGGGGATGGACCA

Neighbor Proteins Overview

Protein	Signature genes	Signature genes Name	Protein_function
NC_018524.1|WP_014909560.1|4653592_4654399_-|NAD(P)H-dependent-oxidoreductase	unknown	unknown	gnl|CDD|376808
NC_018524.1|WP_041562254.1|4633627_4634350_-|MerR-family-transcriptional-regulator	unknown	unknown	gnl|CDD|133378
NC_018524.1|WP_014909688.1|4643044_4644397_+|malonyl-CoA-decarboxylase-family-protein	unknown	unknown	gnl|CDD|368376
NC_018524.1|WP_041561965.1|4638182_4638758_-|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl|CDD|379883
NC_018524.1|WP_014910610.1|4646456_4647221_+|malonate-transporter-subunit-MadM	unknown	unknown	gnl|CDD|129890
NC_018524.1|WP_014908829.1|4642247_4642925_-|GntR-family-transcriptional-regulator	unknown	unknown	gnl|CDD|224715
NC_018524.1|WP_014908166.1|4640259_4640469_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_041561967.1|4648390_4649356_+|phosphotransferase	unknown	unknown	gnl|CDD|270690
NC_018524.1|WP_014908898.1|4650855_4652172_+|phytase	unknown	unknown	gnl|CDD|226698
NC_018524.1|WP_014913370.1|4638881_4640273_-|Asp-tRNA(Asn)/Glu-tRNA(Gln)-amidotransferase-GatCAB-subunit-A	unknown	unknown	gnl|CDD|223232
NC_018524.1|WP_014911767.1|4630847_4631522_+|SMI1/KNR4-family-protein	unknown	unknown	gnl|CDD|379650
NC_018524.1|WP_014908697.1|4640767_4641661_+|MBL-fold-metallo-hydrolase	unknown	unknown	gnl|CDD|293835
NC_018524.1|WP_014911271.1|4636865_4637378_-|flavofamily-protein	unknown	unknown	gnl|CDD|376786
NC_018524.1|WP_014912726.1|4646056_4646455_+|malonate-transporter-subunit-MadL	unknown	unknown	gnl|CDD|367674
NC_018524.1|WP_014910850.1|4649613_4650567_+|GNAT-family-N-acetyltransferase	unknown	unknown	gnl|CDD|366181
NC_018524.1|WP_014908562.1|4634607_4636512_+|S9-family-peptidase	unknown	unknown	gnl|CDD|224423
NC_018524.1|WP_041561964.1|4626960_4630476_-|LamG-domain-containing-protein	unknown	unknown	gnl|CDD|379155
NC_018524.1|WP_081536579.1|4647624_4648038_+|spore-associated-protein-A	unknown	unknown	unknown
NC_018524.1|WP_148281650.1|4632245_4632866_+|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_041561966.1|4644438_4645959_+|AMP-binding-protein	unknown	unknown	gnl|CDD|181011

rpsblast for functional proteins

Protein	Function_ID	Function_description	E-value
NC_018524.1|WP_041562254.1|4633627_4634350_-|MerR-family-transcriptional-regulator	gnl|CDD|133378	cd00592, HTH_MerR-like, Helix-Turn-Helix DNA binding domain of MerR-like transcription regulators. Helix-turn-helix (HTH) MerR-like transcription regulator, N-terminal domain. The MerR family transcription regulators have been shown to mediate responses to stress including exposure to heavy metals, drugs, or oxygen radicals in eubacterial and some archaeal species. They regulate transcription of multidrug/metal ion transporter genes and oxidative stress regulons by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.	2.2323e-20
NC_018524.1|WP_014909688.1|4643044_4644397_+|malonyl-CoA-decarboxylase-family-protein	gnl|CDD|368376	pfam05292, MCD, Malonyl-CoA decarboxylase C-terminal domain. This family consists of several eukaryotic malonyl-CoA decarboxylase (MLYCD) proteins. Malonyl-CoA, in addition to being an intermediate in the de novo synthesis of fatty acids, is an inhibitor of carnitine palmitoyltransferase I, the enzyme that regulates the transfer of long-chain fatty acyl-CoA into mitochondria, where they are oxidized. After exercise, malonyl-CoA decarboxylase participates with acetyl-CoA carboxylase in regulating the concentration of malonyl-CoA in liver and adipose tissue, as well as in muscle. Malonyl-CoA decarboxylase is regulated by AMP-activated protein kinase (AMPK).	6.42138e-97
NC_018524.1|WP_041561965.1|4638182_4638758_-|TetR/AcrR-family-transcriptional-regulator	gnl|CDD|379883	pfam16859, TetR_C_11, Bacterial transcriptional repressor C-terminal. This family of bacterial transcriptional repressors is characterized by the short approximately 50 amino acid stretch of residues constituting the helix-turn-helix DNA binding motif, around the YRFhY motif. The target proteins that are repressed are involved in the transcriptional control of multi-drug efflux pumps, pathways for the biosynthesis of antibiotics, response to osmotic stress and toxic chemicals, control of catabolic pathways, differentiation processes, and pathogenicity. Another target protein is BetI, an osmoprotectant which controls the choline-glycine betaine pathway in E.coli.	2.65102e-13
NC_018524.1|WP_014910610.1|4646456_4647221_+|malonate-transporter-subunit-MadM	gnl|CDD|129890	TIGR00808, malonate_transporter, malonate transporter, MadM subunit. The MSS family includes the monobasic malonate:Na+ symporter of Malonomonas rubra. It consists of two integral membrane proteins, MadL and MadM.The transporter is believed to catalyze the electroneutral reversible uptake of H+-malonate with one Na+, and both subunits have been shown to be essential for activity. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids].	1.12926e-96
NC_018524.1|WP_014908829.1|4642247_4642925_-|GntR-family-transcriptional-regulator	gnl|CDD|224715	COG1802, GntR, Transcriptional regulators [Transcription].	7.32022e-41
NC_018524.1|WP_014909560.1|4653592_4654399_-|NAD(P)H-dependent-oxidoreductase	gnl|CDD|376808	pfam02525, Flavodoxin_2, Flavodoxin-like fold. This family consists of a domain with a flavodoxin-like fold. The family includes bacterial and eukaryotic NAD(P)H dehydrogenase (quinone) EC:1.6.99.2. These enzymes catalyze the NAD(P)H-dependent two-electron reductions of quinones and protect cells against damage by free radicals and reactive oxygen species. This enzyme uses a FAD co-factor. The equation for this reaction is:- NAD(P)H + acceptor <=> NAD(P)(+) + reduced acceptor. This enzyme is also involved in the bioactivation of prodrugs used in chemotherapy. The family also includes acyl carrier protein phosphodiesterase EC:3.1.4.14. This enzyme converts holo-ACP to apo-ACP by hydrolytic cleavage of the phosphopantetheine residue from ACP. This family is related to pfam03358 and pfam00258.	7.9304e-48
NC_018524.1|WP_014908898.1|4650855_4652172_+|phytase	gnl|CDD|226698	COG4247, Phy, 3-phytase (myo-inositol-hexaphosphate 3-phosphohydrolase) [Lipid metabolism].	1.8029e-71
NC_018524.1|WP_014913370.1|4638881_4640273_-|Asp-tRNA(Asn)/Glu-tRNA(Gln)-amidotransferase-GatCAB-subunit-A	gnl|CDD|223232	COG0154, GatA, Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit and related amidases [Translation, ribosomal structure and biogenesis].	1.74368e-157
NC_018524.1|WP_014911767.1|4630847_4631522_+|SMI1/KNR4-family-protein	gnl|CDD|379650	pfam14568, SUKH_6, SMI1-KNR4 cell-wall. Members of this family are related to the SMI1/KNR4-like or SUKH superfamily of proteins.	6.1302e-07
NC_018524.1|WP_014908697.1|4640767_4641661_+|MBL-fold-metallo-hydrolase	gnl|CDD|293835	cd16277, metallo-hydrolase-like_MBL-fold, uncharacterized subgroup of the MBL-fold_metallo-hydrolase superfamily; MBL-fold metallo hydrolase domain. Members of the MBL-fold metallohydrolase superfamily are mainly hydrolytic enzymes which carry out a variety of biological functions. The class B metal beta-lactamases (MBLs) for which this fold was named perform only a small fraction of the activities included in this superfamily.Activities carried out by superfamily members include class B beta-lactamases, hydroxyacylglutathione hydrolases, AHL (acyl homoserine lactone) lactonases, persulfide dioxygenases, flavodiiron proteins, cleavage and polyadenylation specificity factors such as the Int9 and Int11 subunits of Integrator, Sdsa1-like and AtsA-like arylsulfatases, 5'-exonucleases human SNM1A and yeast Pso2p, ribonuclease J and ribonuclease Z, cyclic nucleotide phosphodiesterases, insecticide hydrolases, and proteins required for natural transformation competence. Classical members of the superfamily are di-, or less commonly mono-, zinc-ion-dependent hydrolases, however the diversity of biological roles is reflected in variations in the active site metallo-chemistry.	8.91932e-101
NC_018524.1|WP_014911271.1|4636865_4637378_-|flavofamily-protein	gnl|CDD|376786	pfam02441, Flavoprotein, Flavoprotein. This family contains diverse flavoprotein enzymes. This family includes epidermin biosynthesis protein, EpiD, which has been shown to be a flavoprotein that binds FMN. This enzyme catalyzes the removal of two reducing equivalents from the cysteine residue of the C-terminal meso-lanthionine of epidermin to form a --C==C-- double bond. This family also includes the B chain of dipicolinate synthase a small polar molecule that accumulates to high concentrations in bacterial endospores, and is thought to play a role in spore heat resistance, or the maintenance of heat resistance. dipicolinate synthase catalyzes the formation of dipicolinic acid from dihydroxydipicolinic acid. This family also includes phenyl-acrylic acid decarboxylase (EC:4.1.1.-).	5.35238e-06
NC_018524.1|WP_014912726.1|4646056_4646455_+|malonate-transporter-subunit-MadL	gnl|CDD|367674	pfam03817, MadL, Malonate transporter MadL subunit.	6.23245e-53
NC_018524.1|WP_014910850.1|4649613_4650567_+|GNAT-family-N-acetyltransferase	gnl|CDD|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	6.27546e-06
NC_018524.1|WP_014908562.1|4634607_4636512_+|S9-family-peptidase	gnl|CDD|224423	COG1506, DAP2, Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism].	6.39072e-82
NC_018524.1|WP_041561964.1|4626960_4630476_-|LamG-domain-containing-protein	gnl|CDD|379155	pfam13385, Laminin_G_3, Concanavalin A-like lectin/glucanases superfamily. This domain belongs to the Concanavalin A-like lectin/glucanases superfamily.	3.95831e-25
NC_018524.1|WP_041561967.1|4648390_4649356_+|phosphotransferase	gnl|CDD|270690	cd05120, APH_ChoK_like, Aminoglycoside 3'-phosphotransferase and Choline Kinase family. This family is composed of APH, ChoK, ethanolamine kinase (ETNK), macrolide 2'-phosphotransferase (MPH2'), an unusual homoserine kinase, and uncharacterized proteins with similarity to the N-terminal domain of acyl-CoA dehydrogenase 10 (ACAD10). The members of this family catalyze the transfer of the gamma-phosphoryl group from ATP (or CTP) to small molecule substrates such as aminoglycosides, macrolides, choline, ethanolamine, and homoserine. Phosphorylation of the antibiotics, aminoglycosides and macrolides, leads to their inactivation and to bacterial antibiotic resistance. Phosphorylation of choline, ethanolamine, and homoserine serves as precursors to the synthesis of important biological compounds, such as the major phospholipids, phosphatidylcholine and phosphatidylethanolamine and the amino acids, threonine, methionine, and isoleucine. The APH/ChoK family is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K).	9.56822e-05
NC_018524.1|WP_041561966.1|4644438_4645959_+|AMP-binding-protein	gnl|CDD|181011	PRK07514, PRK07514, malonyl-CoA synthase; Validated.	0

Protein sequences

>NC_018524.1|WP_014908697.1|4640767_4641661_+|MBL-fold-metallo-hydrolase
MRTPSTTPSWSVGDVIVHRVDEVPLPPAAGPWLLPDATPDLVLGQDWLRPHFADHDGVLHIDSHSFAFVVDGSRVLVDTGIGNGKQRANPAWHDLRTDYLERLTEAGFPPETIDLVILTHLHADHVGWNTRQVDGAWVPTFPNARYLTSRTEREFWAGQDMDEARRQMFRDSVIPIEEAGLLDLVDVPAGGARISPGLRLIPTPGHTPGHVAVELAVQGETALITGDCVHHPIQLAHPGIGACVDIDPRRSEATRRALLASLAATDTLLLGTHFAPPTVGRVVTDGDAYRLLPVSAD
>NC_018524.1|WP_014908166.1|4640259_4640469_-|hypothetical-protein
MSSTELTPPEAARWAARAGLPLPHDRHAAVAATADHIHTVVSVLRELDFGDTPPASTYRVEQEKPDATV
>NC_018524.1|WP_014913370.1|4638881_4640273_-|Asp-tRNA(Asn)/Glu-tRNA(Gln)-amidotransferase-GatCAB-subunit-A
MRPYESTLAATATLIRERRLSPVELVDSVLERIERIEPHLEAYVMVAAEQARHAAREAEREISQGEYRGPLHGVPVGLKDLIDVAGMPTTASSRVRTDHRATADSTVAARLRSAGAVLVGKTHTHEFAYGLTTPQTGNAWDRSRVAGGSSGGSAVAVAAGEATFSLGTDTGGSIRVPSALNGVVGLKPTYGLVPRHGITPLSWSLDHVGPITRTVEDAALVLNALTGHDPRDPASLDTLPVDHRPETDPDLSGVRVGVPSHYYFEHVDPEVAAAVHHAIAGMEELGARLVEVEIPMTRYVQATQWGLMVPEATTYHERTLRTVPELYQEDVRILLEAGELMSAGDHLRAQRARTLMRDAWNRLLEEVDMVASPTVPMTAVPATQESVAWPDGTTESVSDAYVRLSAPANITGLPALSVPVGHDTAGMPIGMQLIGRPLDERTLLRAGHAYERARPARALAPVG
>NC_018524.1|WP_041561965.1|4638182_4638758_-|TetR/AcrR-family-transcriptional-regulator
MSRKQMVRPGGRSARVQASVHSAVRELLAEVGRDALTVPMVAQRAEVTPSTIYRRWGDLTELLSDVAVERLRPEGEPEDHGDLRADLTAWAEQFLDEMGSGSGRAYIRDALLGDPDGGNAGRCSAYAAEQIDTILSRASGRGENTPALEETMDGIVAPIMYRILFRPAGLETAYARRLVADLLDAYEKSAR
>NC_018524.1|WP_014911271.1|4636865_4637378_-|flavofamily-protein
MTDQRPLYLLLSGASTSGHEPVNGLVELLQNQGRDVTVLSTPMGARFHDLDALADLTGEPVRTEFRLPGMGRSMPPGAAVVACPWSFNSTNKTALGLTDTFAAALACEMIGRGVPTIIVPKAGDALAGHPAFRRSLQELEAMPSVSVLRSEEKSLPSWEEVAEAVAKATA
>NC_018524.1|WP_014908562.1|4634607_4636512_+|S9-family-peptidase
MSSADHGTRPRRIEIEELFADPSFANPKISPDGTRMAYLAPEYGRRNVWVRGIDQDHDQARCVTHDDRRGITTYLWSDDPRWLLYLQDTDGNEDWHLYRVDLDDPDAPAVDLTPLPEGSRVFGAEELPSHPGHVLVTMNRRPMSLDLFRVEVATGEITLHHEQAGPTENVLLDHDGRPAFASHLEEDGTLEFSAIDPDTGDHKSLIRLGGAEYPLGVHPQLVTPDGTGLVIGAYHESDHLRLVRIDRETGETTVLAALEDQSLDIMGTMVPGVLPPTVYTHRRTGEILAARFVGSRPHIEVLDDDFAEVYAKLSTLSDGVLGTLSSDDTGRHWIATFVHDRDPAVAWYYDHETGQSRRLFRPYPHLDPADLAPMEAVEFPARDGLPLHGLLTLPVGVAPERLPLVLLVHGGPWTHDTWGYNPQAQLLANRGHAVLQVNFRGSTGYGRRHTTAAIGQFAGAMHDDLLDAVDWAVDQGYADPDRIGIMGGSYGGYAALVGVTFTPDRFAAAVDIVGIADLASFMRNLPPFSRPYLMTSWYAYVGDPDVPEQEVDMLERSPISRVDKITTPLLVAHGANDVRVMQGESDKIVASLEERGVPVEYLLAEDEGHGFANPENEIRLQEAILRHFEEHLGK
>NC_018524.1|WP_041562254.1|4633627_4634350_-|MerR-family-transcriptional-regulator
MAWSTRELAALAGTTIKTIRHYHSIGLIEEPERALNGYKRYDTNHLVRLLQIRRLRDLGMSLSQIALLDGPEEGFVDTVRALDDELAASIERQRAIRAELAPLLRHRTSADVPAGFEEVASHLSDADRAMIMISARLFTEEFIQDIRDMSATHAEVDAEFNALPADADEETVRDLAERMAPSVRSIREEYPSVENPGLFVRDRERDAMITVAQALVDLYNPAQLAALREVHGLLAEEREG
>NC_018524.1|WP_148281650.1|4632245_4632866_+|hypothetical-protein
MQTSIATLAQVIPAIYIAFTIYLQYSLKSMFDTKPLVDQEVKIREREAALERADRGITALRARKIDPESIPGRHEEVKRLASARFYALEELVQLRKELCALRFGYIFMVYSMTVVSLLVSLAAVVEFYLLYLLFHQWTQVVPVLFAVAALMALLGIYSIGESVARFGDPNRRICQVNVHGEIAFGVCLVGGIGLLLAAAISVALIA
>NC_018524.1|WP_014911767.1|4630847_4631522_+|SMI1/KNR4-family-protein
MRTTRWSQVRERIQDLASVGREHDAFEARNRYGAKGHSLPLAAPLSETEIAEVETQWGVSLPDDYRGFLLEVGAGGAGPGYGLNVLSRAATGWAWDGDEDQPRHAGLSSPFVTARERVRLLAEHEDQEPERAEFATREAFDAAYNEWRDADDRLFDRLADGAVCLSHEGCGHFHWLVVTGPERGNMWVDGFPAEGGFRPLGTSGERVGFADWYLDWIATSEALQ
>NC_018524.1|WP_041561964.1|4626960_4630476_-|LamG-domain-containing-protein
MPRAVRASTAALLAATLLTPFLHSTVHADETPVPPAAENAAATADPSEQAAIIRARESGEPVEIAGATTETTRHLANPDGSFTMEQNAHPVRVREDDGWTPVDTDLVVDSRGRVRPKAVVADILFSGGGDAVLAKIGLGSNSVELSWHEDLPEPVLEGDQATYPDVLPDVDLVLTAGVDGFGQVLVVHTPEAARHELLNDLELGLATEGVTMRLGEHGNLDAIGHKGQESVFSAVAPAMWDSSGEEEMAEDATVMAPTGARTALLDVDLAPDRIRLVPDTAMLTDKATLYPVYIDPSVAVSRVGRAYVNRNYPTQSYWNYATSHAPGVGYEPAQGNTKRAFWRFSVDSRTRNADITRATFRTKVTHAYGCSNAQVQLWRTDAITSSTTWNSQTSAWRTRLDTRTINAGRSNCPGGASPTVEFNATAGYVWSRDAGNATTTLGLRGNETRSSSNWDWRRFASNPTLQVDYNNPPETPTRLSDSHGGECATDPDNPRLINQTRPTFTAYVRDRDSTSAGRQKVKTRFAWWVDGERVGDVDTAMTDVAVWSSGSFQSVRSGTLPENVLITYRANANDGISWSGWSTRCYLMVSTDRPEQGPEVTSTDYPAGDVFHGSPGLPGEFTFSNNGVEDATGYKYALNDDSCVHDIEPSSPGGSVTLTLTPRQEGPNRIYARTVDAFGNSSDCVLAYTFLVAPPSDPVAHLAFDEGQGDRAVDTIDPERGATLSEGVDWVRGRVGTVDNPDTDPTPRLNGTAVHTSGYTDGDPGPYDQINADYPAVDTSGTFSVSAWVKLDRAHAHHTAVAQEGEEQSAFHLGYQGNTGEWVFKMSPEDQYWDGSREWAVLTSSAPAETGVWTHLVGTHDSQTGELVLYVDGVRQGSATHTGPWEATGPLTVGRALFQGIGNYYWPGAVDDVKVWDRLVLDQTVTDTEQHSEIWRLANRPLAPEGHWSLDEYQGTTVADSTDHGLTATLHADPETAWDQAENDITFSPGVRLNGDDEYIQATGPAVRTDRSFTTAAWVRLDETGQSINTSALSQSGRFQSGFHLGYQGSNGNWTFKMAPHDDAPTDGSAGWTYAYSTTPARLGEWVHLAGVYDHTNGELVLYVNGFEESRVRVDHAWHADGPVRIGSGQHRGNNTYFWTGDLDDAHTYQGVLNERELSQVYAGQIPVPRL
>NC_018524.1|WP_014908829.1|4642247_4642925_-|GntR-family-transcriptional-regulator
MARVPESQRVRDALENAVVEGRYRPGERLDPARLELEFGCSRTPIREALQALERSGLVQIRSKQGTYVTELGVSELAERFEVMAELEGMAARLCARRIERESIERLEDTLRACERYATAGDADGYYYANADFHGVVSEACGNEYLRQQAHALKRALQPYRRLQLRVPDRMRRSLAEHRAIADAIVGGDAEAAENAARDHVLVQVKEFSQLVRTWRHLTDSARDAG
>NC_018524.1|WP_014909688.1|4643044_4644397_+|malonyl-CoA-decarboxylase-family-protein
MRPDGARETGPVRPAKEGHDGGPQTADTSGPSALDRLLTDCEILMGDVGEASVRAVAARALAAYDELDDPGRTAFFTHVIKDHGVDPDRVRAAFHRWDEAGNSGSGGEEELVELFDAVEPARQRLLRRMNHASDATLALVGMRADLRRLMRRHPELRPLDHDLHHLLASWFNRGFLRLAEVTPDSPRRLHDHLLRYERVHPMADRDALRRRLEPADRRIYAFFHPATGDVPLIFVEVALVRGTPGDITPLLEPGPALDPREADTAALYSINNALDGLTGISFGDLLIKQVIEQVRDRLPHLEHFVTLSPIPGFRRWLDERAESEADLRELVRDLDAADGPADLDPADTARIRPRLLPVLARYIAAEKRDDGRPLDPVARFHLGNGAAAWRLDWPANPSERAWRQSYGAMVNYRYEPDKLERRHEDFVRRRTVALDGPLREALPDAPDSDT
>NC_018524.1|WP_041561966.1|4644438_4645959_+|AMP-binding-protein
MAPFTAIHRSFAEQARRRPDRTLFELPGGGNITYGQTEETVRRIAARLLADGVTPGDRVAMQVEKSPEAVALYLATLRVGGVFLPLNTAYTDAEMTYFLGDAQPRVLVCSPDRRAEHTGREAEGLVVETLGTSGDGTLLEGDGHHDGDHDASAEDPAAILYTSGTTGRSKGAVLTHGNLASNCEALLQAWRYTSEDRLIHALPIFHVHGLFVAVNMTLAAGASMHYLSGFDTDAVIDLLPRATVLMGVPTFYTRLLRSDRLTSESCASMRLFVSGSAPLLASDAEAFQARTGHAILERYGMTETGMNTTNPYEGPRKPGTVGRPLPGVEVRVADRETGGKLSDGEVGIVEVRGPNVFSGYWRMPEKTAAEFREDGFFITGDLGRVDEDGHLCIVGRDKDLVISGGYNVYPKEVEELLDAHPGVLESAVIGVPHPDLGEAVAAVVVPRPGRELQAEELLESISGDLARFKRPRAVRVVEALPRNVMGKVQKAELRERYTDLFTGADA
>NC_018524.1|WP_014912726.1|4646056_4646455_+|malonate-transporter-subunit-MadL
MVLYGVAALAVCLLSGALVGELLGAAVGVDANVGGVGFAMIMLVVVSDRLRRNGKLPEATEQGVLFWSAMYIPVVIAMASTQNVVKAIAGGPMAITAGLAALAVGAALVPVLSRIGEPAEPLPPLVEEERGA
>NC_018524.1|WP_014910610.1|4646456_4647221_+|malonate-transporter-subunit-MadM
MDRIIGVFESNDLLVAFVVVGGLMVVSGWLSKKLTRGWLHGSAIAIILGLALAYWGGWVTGGEHGLADIAVFSGLGLMGGAMLRDFAIVSTAYGVDLREIKRAGLVGVLSLVLGVLVSFAVGAAIAAAFGYTDAASMATIGAGAATYIVGPVTGTAVGASSEVIALSVAAGLVKSVVVMVGTPLIAPLIGLNNPKSAMVYGGLMGTTSGVAGGLAATDKRLVPYGAMTATFYTGVGCLLGPSLLYVVLRFLVGG
>NC_018524.1|WP_081536579.1|4647624_4648038_+|spore-associated-protein-A
MRAARKSLTAAVVVALLSAIAVGLSPSAASAAPYNGACGTGYNVLDSRDIIGATVYVTYNPSNGYNCAATIRDSSGAAINMGAAIKRSSASTWVVDDGSYTTYAGPVYVHAPGQCIDWAGYYGPTSNEVRVFNDFCN
>NC_018524.1|WP_041561967.1|4648390_4649356_+|phosphotransferase
MMPEPGATSHPLDRHRDPSDAAFVRGLAAEVAARYGGELTRMRRANGYSNATWVGDGIAVRIAHTPVGMVREAALVRALPREVAHPEILGEGVAEGHGWIVTAEVHGENLYEAWPTLTPVEQRQAIQQLWARAQIVHDASPSLKTHVAAHGGFVPSTLGDAAASAGRAGAALGLSDTRQSRLHEIIEGYFRAASLVEQVVDHGDLALMNALWDGEVVALLDFEFAVLGPVEIDLCRLVYEACVSVEGEYVDSEAGAAALEIAAHHMDPIHGRALIRGAAVLDQLRDLDIWLTQGGGEDWNPGRLLTDLIDDEGGYLAPLLG
>NC_018524.1|WP_014910850.1|4649613_4650567_+|GNAT-family-N-acetyltransferase
MTTSEFLTAADVELMQDLAQRITATHPELVNSDASFGELAWNWGRAHAAQGSSWRRRLWFFGGELVAWGWVKLPCGVRLSDGTVANATGAYLAYQVHPDHVELVDEVIDWYDATAAGLERTVLPGDPDRFALERWAAHGYVPDPDGLGDTGSWTQLNQRDLTDVESPKLPGGYRFRTADEAGGEAAVRAHLNAWGPRAYTVEAYRDLRETTGYRGDLHVLVEAPDGEMAASTIMWLDEANRTVEFEPMGTHPDHRRLGLARALLLHGMLLAREAGAVHATVACLGAPGHPAARELYYGAGFRELCRDVPFIKDASAD
>NC_018524.1|WP_014908898.1|4650855_4652172_+|phytase
MNASVPTTLAALLVATGSFAQPPVPVTASVETPPVYDDEAGGNADADDPAVWIDPDDPERSIVIGTLKKAGLDVYGLDGERIQHIPAPEAPDEEAAPGRFNNVDVLYGFELDGEKTDLAIVSDRGRDRIRAFAIDPEAVAEGRPPLRDVTAPDVQPVFAADEAEVDDQRTSYGLTTYRHDDDAFVVVSQREETRLRLLELKDEDGLVGYETEDTLELPGTFTLPDGTEWTPCADLGERPQVEGMAVDEEEHVLYAGQETVGLWRIELDKDEFADAELIDRVREYGTPWTYDETADEECVLDTENDPGFGGENISADAEGVTLYHAGDGAGYVLVSSQGDDTFAVYERGGDNDYVGSFAIVDGPATDGTQHSDGATVVNVPLGDAFPQGLLVTHDGEETPEEGDRESTNFKLTRWDAVASAFPEPLVIDTESFDPRGVN
>NC_018524.1|WP_014909560.1|4653592_4654399_-|NAD(P)H-dependent-oxidoreductase
MWQTTTKSATVLWVSAHPEPLSLNGNLRRDAIAHLRESGHTVLESDLYAMVWDPVLRSPDGGHSPEETAHTFHVSADTRNAYLADAQPPEVAREQEKIRRADAVVVQFPLWWYGMPAILKGWFDRVFVNGFAFGIDSVSRRRLRFEQGPFVGKRALVVTTLGDRPRSIGPRGKSGELRELLFGLLHGTFAYTGMSVLPPWALPSADRLSDYERARDGLRERLDRLFIDEPIPYRPQFTGDYTEEWELAPHVSPGESGLRVHVDREADT

Crispr_ID: NC_018524_32

• CRISPR_ID: NC_018524_32
• CRISPR_location: 4652533-4653475
• CRISPR_type: Orphan
• Repeat_type: A:N
• Spacer_info: 15 spacers

Consensus repeat of NC_018524_32

Consensus_repeat	Method
GGTCCATCCCCACGTGCGTGGGGCTCAC	PILER-CR
GTGAGCCCCACGCACGTGGGGATGGACCG	CRISPRCasFinder
GTGAGCCCCACGCACGTGGGGATGGACC	CRT

spacers of NC_018524_32

>32.1|4652561|33|NC_018524|PILER-CR,CRT
CTCTGGACGATCGACCAGGTCACCGAGTTCCTG
>32.2|4652622|33|NC_018524|PILER-CR,CRT
GTTCGAGTTCCAGACCAAGGAGCTCATCGCCGC
>32.3|4652683|33|NC_018524|PILER-CR,CRT
GCGCTGGAGGACTGGTGCCGCTACCGCCTAGAC
>32.4|4652744|33|NC_018524|PILER-CR,CRT
GCTCATCGCTGCCATCTTCGGGTCGGTGAGTGG
>32.5|4652805|33|NC_018524|PILER-CR,CRT
TCACGAACTACGCCCACGGAACGATGCAGGACT
>32.6|4652866|32|NC_018524|PILER-CR,CRT
TCCGCGGTAGGTGTTTTCGAACCCGTGGGGGG
>32.7|4652926|33|NC_018524|PILER-CR,CRT
GGAGGAGCCTCGGTTTCGGGCCGGTCAGGCCCT
>32.8|4652987|33|NC_018524|PILER-CR,CRT
GCAGATCATCCACGCCCTGGACGAGGCCCCCTC
>32.9|4653048|33|NC_018524|PILER-CR,CRT
GAACACGAAGAACCCGCCGCTGGTCGTTGACCA
>32.10|4653109|33|NC_018524|PILER-CR,CRT
GGGCTTCCAGCTCTCCCGCGAACAACTCGGTGC
>32.11|4653170|33|NC_018524|PILER-CR,CRT
GTCCAGGCCGCTGGCCGGCCGGTGGCTCTGCCG
>32.12|4653231|33|NC_018524|PILER-CR,CRT
GCCGCTCCGCTGCACGCAGGGTACGGTCCGGCC
>32.13|4653292|33|NC_018524|PILER-CR,CRT
GTTTCGGTGGGTGACGTGCACGGCCTCGACGTT
>32.14|4653353|33|NC_018524|PILER-CR,CRT
GAACGCGGCACGCCGGTACACCAAGGCTCGCGC
>32.15|4652562|32|NC_018524|CRISPRCasFinder
TCTGGACGATCGACCAGGTCACCGAGTTCCTG
>32.16|4652623|32|NC_018524|CRISPRCasFinder
TTCGAGTTCCAGACCAAGGAGCTCATCGCCGC
>32.17|4652684|32|NC_018524|CRISPRCasFinder
CGCTGGAGGACTGGTGCCGCTACCGCCTAGAC
>32.18|4652745|32|NC_018524|CRISPRCasFinder
CTCATCGCTGCCATCTTCGGGTCGGTGAGTGG
>32.19|4652806|32|NC_018524|CRISPRCasFinder
CACGAACTACGCCCACGGAACGATGCAGGACT
>32.20|4652867|31|NC_018524|CRISPRCasFinder
CCGCGGTAGGTGTTTTCGAACCCGTGGGGGG
>32.21|4652927|32|NC_018524|CRISPRCasFinder
GAGGAGCCTCGGTTTCGGGCCGGTCAGGCCCT
>32.22|4652988|32|NC_018524|CRISPRCasFinder
CAGATCATCCACGCCCTGGACGAGGCCCCCTC
>32.23|4653049|32|NC_018524|CRISPRCasFinder
AACACGAAGAACCCGCCGCTGGTCGTTGACCA
>32.24|4653110|32|NC_018524|CRISPRCasFinder
GGCTTCCAGCTCTCCCGCGAACAACTCGGTGC
>32.25|4653171|32|NC_018524|CRISPRCasFinder
TCCAGGCCGCTGGCCGGCCGGTGGCTCTGCCG
>32.26|4653232|32|NC_018524|CRISPRCasFinder
CCGCTCCGCTGCACGCAGGGTACGGTCCGGCC
>32.27|4653293|32|NC_018524|CRISPRCasFinder
TTTCGGTGGGTGACGTGCACGGCCTCGACGTT
>32.28|4653354|32|NC_018524|CRISPRCasFinder
AACGCGGCACGCCGGTACACCAAGGCTCGCGC
>32.29|4653415|32|NC_018524|CRISPRCasFinder
CGGCGGTACCAGAGGCCCGTGAATTCGGCGGC
>32.30|4653414|33|NC_018524|CRT
GCGGCGGTACCAGAGGCCCGTGAATTCGGCGGC

CRISPR arrays and Neighbor proteins around NC_018524_32

CRISPR arrays

The CRISPR arrays of NC_018524_32

>merge|NC_018524|32|4652533-4653475|PILER-CR,CRISPRCasFinder,CRT
GTGAGCCCCACGCACGTGGGGATGGACCCTCTGGACGATCGACCAGGTCACCGAGTTCCTGGTGAGCCCCACGCACGTGGGGATGGACCGTTCGAGTTCCAGACCAAGGAGCTCATCGCCGCGTGAGCCCCACGCACGTGGGGATGGACCGCGCTGGAGGACTGGTGCCGCTACCGCCTAGACGTGAGCCCCACGCACGTGGGGATGGACCGCTCATCGCTGCCATCTTCGGGTCGGTGAGTGGGTGAGCCCCACGCACGTGGGGATGGACCTCACGAACTACGCCCACGGAACGATGCAGGACTGTGAGCCCCACGCACGTGGGGATGGACCTCCGCGGTAGGTGTTTTCGAACCCGTGGGGGGGTGAGCCCCACGCACGTGGGGATGGACCGGAGGAGCCTCGGTTTCGGGCCGGTCAGGCCCTGTGAGCCCCACGCACGTGGGGATGGACCGCAGATCATCCACGCCCTGGACGAGGCCCCCTCGTGAGCCCCACGCACGTGGGGATGGACCGAACACGAAGAACCCGCCGCTGGTCGTTGACCAGTGAGCCCCACGCACGTGGGGATGGACCGGGCTTCCAGCTCTCCCGCGAACAACTCGGTGCGTGAGCCCCACGCACGTGGGGATGGACCGTCCAGGCCGCTGGCCGGCCGGTGGCTCTGCCGGTGAACCCCACGCACGTGGGGATGGACCGCCGCTCCGCTGCACGCAGGGTACGGTCCGGCCGTGAGCCCCACACACGTGGGGATGGACCGTTTCGGTGGGTGACGTGCACGGCCTCGACGTTGTGAGCCCCACACACGTGGGGATGGACCGAACGCGGCACGCCGGTACACCAAGGCTCGCGCGTGAGCCCCACGTACGTGGGGATGGACCGCGGCGGTACCAGAGGCCCGTGAATTCGGCGGCGTGAGCCCCACGTATGTGGGGATGGGGCG

>NC_018524|32|19|4652533-4653413|PILER-CR
GTGAGCCCCACGCACGTGGGGATGGACC	CTCTGGACGATCGACCAGGTCACCGAGTTCCTG
GTGAGCCCCACGCACGTGGGGATGGACC	GTTCGAGTTCCAGACCAAGGAGCTCATCGCCGC
GTGAGCCCCACGCACGTGGGGATGGACC	GCGCTGGAGGACTGGTGCCGCTACCGCCTAGAC
GTGAGCCCCACGCACGTGGGGATGGACC	GCTCATCGCTGCCATCTTCGGGTCGGTGAGTGG
GTGAGCCCCACGCACGTGGGGATGGACC	TCACGAACTACGCCCACGGAACGATGCAGGACT
GTGAGCCCCACGCACGTGGGGATGGACC	TCCGCGGTAGGTGTTTTCGAACCCGTGGGGGG
GTGAGCCCCACGCACGTGGGGATGGACC	GGAGGAGCCTCGGTTTCGGGCCGGTCAGGCCCT
GTGAGCCCCACGCACGTGGGGATGGACC	GCAGATCATCCACGCCCTGGACGAGGCCCCCTC
GTGAGCCCCACGCACGTGGGGATGGACC	GAACACGAAGAACCCGCCGCTGGTCGTTGACCA
GTGAGCCCCACGCACGTGGGGATGGACC	GGGCTTCCAGCTCTCCCGCGAACAACTCGGTGC
GTGAGCCCCACGCACGTGGGGATGGACC	GTCCAGGCCGCTGGCCGGCCGGTGGCTCTGCCG
GTGAACCCCACGCACGTGGGGATGGACC	GCCGCTCCGCTGCACGCAGGGTACGGTCCGGCC
GTGAGCCCCACACACGTGGGGATGGACC	GTTTCGGTGGGTGACGTGCACGGCCTCGACGTT
GTGAGCCCCACACACGTGGGGATGGACC	GAACGCGGCACGCCGGTACACCAAGGCTCGCGC
GTGAGCCCCACGTACGTGGGGATGGACC

>NC_018524|32|31|4652533-4653475|CRISPRCasFinder
GTGAGCCCCACGCACGTGGGGATGGACCC	TCTGGACGATCGACCAGGTCACCGAGTTCCTG
GTGAGCCCCACGCACGTGGGGATGGACCG	TTCGAGTTCCAGACCAAGGAGCTCATCGCCGC
GTGAGCCCCACGCACGTGGGGATGGACCG	CGCTGGAGGACTGGTGCCGCTACCGCCTAGAC
GTGAGCCCCACGCACGTGGGGATGGACCG	CTCATCGCTGCCATCTTCGGGTCGGTGAGTGG
GTGAGCCCCACGCACGTGGGGATGGACCT	CACGAACTACGCCCACGGAACGATGCAGGACT
GTGAGCCCCACGCACGTGGGGATGGACCT	CCGCGGTAGGTGTTTTCGAACCCGTGGGGGG
GTGAGCCCCACGCACGTGGGGATGGACCG	GAGGAGCCTCGGTTTCGGGCCGGTCAGGCCCT
GTGAGCCCCACGCACGTGGGGATGGACCG	CAGATCATCCACGCCCTGGACGAGGCCCCCTC
GTGAGCCCCACGCACGTGGGGATGGACCG	AACACGAAGAACCCGCCGCTGGTCGTTGACCA
GTGAGCCCCACGCACGTGGGGATGGACCG	GGCTTCCAGCTCTCCCGCGAACAACTCGGTGC
GTGAGCCCCACGCACGTGGGGATGGACCG	TCCAGGCCGCTGGCCGGCCGGTGGCTCTGCCG
GTGAACCCCACGCACGTGGGGATGGACCG	CCGCTCCGCTGCACGCAGGGTACGGTCCGGCC
GTGAGCCCCACACACGTGGGGATGGACCG	TTTCGGTGGGTGACGTGCACGGCCTCGACGTT
GTGAGCCCCACACACGTGGGGATGGACCG	AACGCGGCACGCCGGTACACCAAGGCTCGCGC
GTGAGCCCCACGTACGTGGGGATGGACCG	CGGCGGTACCAGAGGCCCGTGAATTCGGCGGC
GTGAGCCCCACGTATGTGGGGATGGGGCG

>NC_018524|32|20|4652533-4653474|CRT
GTGAGCCCCACGCACGTGGGGATGGACC	CTCTGGACGATCGACCAGGTCACCGAGTTCCTG
GTGAGCCCCACGCACGTGGGGATGGACC	GTTCGAGTTCCAGACCAAGGAGCTCATCGCCGC
GTGAGCCCCACGCACGTGGGGATGGACC	GCGCTGGAGGACTGGTGCCGCTACCGCCTAGAC
GTGAGCCCCACGCACGTGGGGATGGACC	GCTCATCGCTGCCATCTTCGGGTCGGTGAGTGG
GTGAGCCCCACGCACGTGGGGATGGACC	TCACGAACTACGCCCACGGAACGATGCAGGACT
GTGAGCCCCACGCACGTGGGGATGGACC	TCCGCGGTAGGTGTTTTCGAACCCGTGGGGGG
GTGAGCCCCACGCACGTGGGGATGGACC	GGAGGAGCCTCGGTTTCGGGCCGGTCAGGCCCT
GTGAGCCCCACGCACGTGGGGATGGACC	GCAGATCATCCACGCCCTGGACGAGGCCCCCTC
GTGAGCCCCACGCACGTGGGGATGGACC	GAACACGAAGAACCCGCCGCTGGTCGTTGACCA
GTGAGCCCCACGCACGTGGGGATGGACC	GGGCTTCCAGCTCTCCCGCGAACAACTCGGTGC
GTGAGCCCCACGCACGTGGGGATGGACC	GTCCAGGCCGCTGGCCGGCCGGTGGCTCTGCCG
GTGAACCCCACGCACGTGGGGATGGACC	GCCGCTCCGCTGCACGCAGGGTACGGTCCGGCC
GTGAGCCCCACACACGTGGGGATGGACC	GTTTCGGTGGGTGACGTGCACGGCCTCGACGTT
GTGAGCCCCACACACGTGGGGATGGACC	GAACGCGGCACGCCGGTACACCAAGGCTCGCGC
GTGAGCCCCACGTACGTGGGGATGGACC	GCGGCGGTACCAGAGGCCCGTGAATTCGGCGGC
GTGAGCCCCACGTATGTGGGGATGGGGC

Neighbor Proteins Overview

Protein	Signature genes	Signature genes Name	Protein_function
NC_018524.1|WP_014910303.1|4656785_4657574_-|sulfite-exporter-TauE/SafE-family-protein	unknown	unknown	gnl|CDD|376667
NC_018524.1|WP_148281714.1|4661005_4662076_+|GNAT-family-N-acetyltransferase	unknown	unknown	gnl|CDD|377026
NC_018524.1|WP_014912813.1|4655734_4656697_-|aminoglycoside-phosphotransferase-family-protein	unknown	unknown	gnl|CDD|270703
NC_018524.1|WP_014908235.1|4660447_4660948_-|MarR-family-transcriptional-regulator	unknown	unknown	gnl|CDD|224759
NC_018524.1|WP_014908749.1|4658223_4659033_-|ABC-transporter-permease	unknown	unknown	gnl|CDD|366444
NC_018524.1|WP_014912241.1|4659070_4660006_-|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl|CDD|224054
NC_018524.1|WP_014910610.1|4646456_4647221_+|malonate-transporter-subunit-MadM	unknown	unknown	gnl|CDD|129890
NC_018524.1|WP_014908829.1|4642247_4642925_-|GntR-family-transcriptional-regulator	unknown	unknown	gnl|CDD|224715
NC_018524.1|WP_014909560.1|4653592_4654399_-|NAD(P)H-dependent-oxidoreductase	unknown	unknown	gnl|CDD|376808
NC_018524.1|WP_014908898.1|4650855_4652172_+|phytase	unknown	unknown	gnl|CDD|226698
NC_018524.1|WP_014909688.1|4643044_4644397_+|malonyl-CoA-decarboxylase-family-protein	unknown	unknown	gnl|CDD|368376
NC_018524.1|WP_014908498.1|4657678_4658227_-|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl|CDD|224228
NC_018524.1|WP_014908697.1|4640767_4641661_+|MBL-fold-metallo-hydrolase	unknown	unknown	gnl|CDD|293835
NC_018524.1|WP_026125019.1|4654465_4654801_+|winged-helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl|CDD|224647
NC_018524.1|WP_014912726.1|4646056_4646455_+|malonate-transporter-subunit-MadL	unknown	unknown	gnl|CDD|367674
NC_018524.1|WP_041561968.1|4655392_4655668_+|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_081536579.1|4647624_4648038_+|spore-associated-protein-A	unknown	unknown	unknown
NC_018524.1|WP_014910850.1|4649613_4650567_+|GNAT-family-N-acetyltransferase	unknown	unknown	gnl|CDD|366181
NC_018524.1|WP_041561967.1|4648390_4649356_+|phosphotransferase	unknown	unknown	gnl|CDD|270690
NC_018524.1|WP_041561966.1|4644438_4645959_+|AMP-binding-protein	unknown	unknown	gnl|CDD|181011

rpsblast for functional proteins

Protein	Function_ID	Function_description	E-value
NC_018524.1|WP_014910303.1|4656785_4657574_-|sulfite-exporter-TauE/SafE-family-protein	gnl|CDD|376667	pfam01925, TauE, Sulfite exporter TauE/SafE. This is a family of integral membrane proteins where the alignment appears to contain two duplicated modules of three transmembrane helices. The proteins are involved in the transport of anions across the cytoplasmic membrane during taurine metabolism as an exporter of sulfoacetate. This family used to be known as DUF81.	7.13912e-13
NC_018524.1|WP_148281714.1|4661005_4662076_+|GNAT-family-N-acetyltransferase	gnl|CDD|377026	pfam03358, FMN_red, NADPH-dependent FMN reductase.	1.44622e-29
NC_018524.1|WP_014912813.1|4655734_4656697_-|aminoglycoside-phosphotransferase-family-protein	gnl|CDD|270703	cd05154, ACAD10_11_N-like, N-terminal domain of Acyl-CoA dehydrogenase (ACAD) 10 and 11, and similar proteins. This subfamily is composed of the N-terminal domains of vertebrate ACAD10 and ACAD11, and similar uncharacterized bacterial and eukaryotic proteins. ACADs are a family of flavoproteins that are involved in the beta-oxidation of fatty acyl-CoA derivatives. ACAD deficiency can cause metabolic disorders including muscle fatigue, hypoglycemia, and hepatic lipidosis. There are at least 11 distinct ACADs, some of which show distinct substrate specificities to either straight-chain or branched-chain fatty acids. ACAD10 is widely expressed in human tissues and highly expressed in liver, kidney, pancreas, and spleen. ACAD10 and ACAD11 are both significantly expressed in human brain tissues. They contain a long N-terminal domain with similarity to phosphotransferases with a Protein Kinase fold, which is absent in other ACADs. They may exhibit multiple functions in acyl-CoA oxidation pathways. ACAD11 utilizes substrates with carbon chain lengths of 20 to 26, with optimal activity towards C22CoA. ACAD10 may be associated with an increased risk in type II diabetes. The ACAD10/11-like subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K).	2.36721e-08
NC_018524.1|WP_014908235.1|4660447_4660948_-|MarR-family-transcriptional-regulator	gnl|CDD|224759	COG1846, MarR, Transcriptional regulators [Transcription].	9.82177e-14
NC_018524.1|WP_014912241.1|4659070_4660006_-|ABC-transporter-ATP-binding-protein	gnl|CDD|224054	COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms].	7.6073e-80
NC_018524.1|WP_014910610.1|4646456_4647221_+|malonate-transporter-subunit-MadM	gnl|CDD|129890	TIGR00808, malonate_transporter, malonate transporter, MadM subunit. The MSS family includes the monobasic malonate:Na+ symporter of Malonomonas rubra. It consists of two integral membrane proteins, MadL and MadM.The transporter is believed to catalyze the electroneutral reversible uptake of H+-malonate with one Na+, and both subunits have been shown to be essential for activity. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids].	1.12926e-96
NC_018524.1|WP_014908829.1|4642247_4642925_-|GntR-family-transcriptional-regulator	gnl|CDD|224715	COG1802, GntR, Transcriptional regulators [Transcription].	7.32022e-41
NC_018524.1|WP_014909560.1|4653592_4654399_-|NAD(P)H-dependent-oxidoreductase	gnl|CDD|376808	pfam02525, Flavodoxin_2, Flavodoxin-like fold. This family consists of a domain with a flavodoxin-like fold. The family includes bacterial and eukaryotic NAD(P)H dehydrogenase (quinone) EC:1.6.99.2. These enzymes catalyze the NAD(P)H-dependent two-electron reductions of quinones and protect cells against damage by free radicals and reactive oxygen species. This enzyme uses a FAD co-factor. The equation for this reaction is:- NAD(P)H + acceptor <=> NAD(P)(+) + reduced acceptor. This enzyme is also involved in the bioactivation of prodrugs used in chemotherapy. The family also includes acyl carrier protein phosphodiesterase EC:3.1.4.14. This enzyme converts holo-ACP to apo-ACP by hydrolytic cleavage of the phosphopantetheine residue from ACP. This family is related to pfam03358 and pfam00258.	7.9304e-48
NC_018524.1|WP_014908898.1|4650855_4652172_+|phytase	gnl|CDD|226698	COG4247, Phy, 3-phytase (myo-inositol-hexaphosphate 3-phosphohydrolase) [Lipid metabolism].	1.8029e-71
NC_018524.1|WP_014909688.1|4643044_4644397_+|malonyl-CoA-decarboxylase-family-protein	gnl|CDD|368376	pfam05292, MCD, Malonyl-CoA decarboxylase C-terminal domain. This family consists of several eukaryotic malonyl-CoA decarboxylase (MLYCD) proteins. Malonyl-CoA, in addition to being an intermediate in the de novo synthesis of fatty acids, is an inhibitor of carnitine palmitoyltransferase I, the enzyme that regulates the transfer of long-chain fatty acyl-CoA into mitochondria, where they are oxidized. After exercise, malonyl-CoA decarboxylase participates with acetyl-CoA carboxylase in regulating the concentration of malonyl-CoA in liver and adipose tissue, as well as in muscle. Malonyl-CoA decarboxylase is regulated by AMP-activated protein kinase (AMPK).	6.42138e-97
NC_018524.1|WP_014908498.1|4657678_4658227_-|TetR/AcrR-family-transcriptional-regulator	gnl|CDD|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	1.74584e-11
NC_018524.1|WP_014908697.1|4640767_4641661_+|MBL-fold-metallo-hydrolase	gnl|CDD|293835	cd16277, metallo-hydrolase-like_MBL-fold, uncharacterized subgroup of the MBL-fold_metallo-hydrolase superfamily; MBL-fold metallo hydrolase domain. Members of the MBL-fold metallohydrolase superfamily are mainly hydrolytic enzymes which carry out a variety of biological functions. The class B metal beta-lactamases (MBLs) for which this fold was named perform only a small fraction of the activities included in this superfamily.Activities carried out by superfamily members include class B beta-lactamases, hydroxyacylglutathione hydrolases, AHL (acyl homoserine lactone) lactonases, persulfide dioxygenases, flavodiiron proteins, cleavage and polyadenylation specificity factors such as the Int9 and Int11 subunits of Integrator, Sdsa1-like and AtsA-like arylsulfatases, 5'-exonucleases human SNM1A and yeast Pso2p, ribonuclease J and ribonuclease Z, cyclic nucleotide phosphodiesterases, insecticide hydrolases, and proteins required for natural transformation competence. Classical members of the superfamily are di-, or less commonly mono-, zinc-ion-dependent hydrolases, however the diversity of biological roles is reflected in variations in the active site metallo-chemistry.	8.91932e-101
NC_018524.1|WP_026125019.1|4654465_4654801_+|winged-helix-turn-helix-transcriptional-regulator	gnl|CDD|224647	COG1733, COG1733, Predicted transcriptional regulators [Transcription].	6.97367e-38
NC_018524.1|WP_014912726.1|4646056_4646455_+|malonate-transporter-subunit-MadL	gnl|CDD|367674	pfam03817, MadL, Malonate transporter MadL subunit.	6.23245e-53
NC_018524.1|WP_014908749.1|4658223_4659033_-|ABC-transporter-permease	gnl|CDD|366444	pfam01061, ABC2_membrane, ABC-2 type transporter.	1.4351e-08
NC_018524.1|WP_014910850.1|4649613_4650567_+|GNAT-family-N-acetyltransferase	gnl|CDD|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	6.27546e-06
NC_018524.1|WP_041561967.1|4648390_4649356_+|phosphotransferase	gnl|CDD|270690	cd05120, APH_ChoK_like, Aminoglycoside 3'-phosphotransferase and Choline Kinase family. This family is composed of APH, ChoK, ethanolamine kinase (ETNK), macrolide 2'-phosphotransferase (MPH2'), an unusual homoserine kinase, and uncharacterized proteins with similarity to the N-terminal domain of acyl-CoA dehydrogenase 10 (ACAD10). The members of this family catalyze the transfer of the gamma-phosphoryl group from ATP (or CTP) to small molecule substrates such as aminoglycosides, macrolides, choline, ethanolamine, and homoserine. Phosphorylation of the antibiotics, aminoglycosides and macrolides, leads to their inactivation and to bacterial antibiotic resistance. Phosphorylation of choline, ethanolamine, and homoserine serves as precursors to the synthesis of important biological compounds, such as the major phospholipids, phosphatidylcholine and phosphatidylethanolamine and the amino acids, threonine, methionine, and isoleucine. The APH/ChoK family is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K).	9.56822e-05
NC_018524.1|WP_041561966.1|4644438_4645959_+|AMP-binding-protein	gnl|CDD|181011	PRK07514, PRK07514, malonyl-CoA synthase; Validated.	0

Protein sequences

>NC_018524.1|WP_014908898.1|4650855_4652172_+|phytase
MNASVPTTLAALLVATGSFAQPPVPVTASVETPPVYDDEAGGNADADDPAVWIDPDDPERSIVIGTLKKAGLDVYGLDGERIQHIPAPEAPDEEAAPGRFNNVDVLYGFELDGEKTDLAIVSDRGRDRIRAFAIDPEAVAEGRPPLRDVTAPDVQPVFAADEAEVDDQRTSYGLTTYRHDDDAFVVVSQREETRLRLLELKDEDGLVGYETEDTLELPGTFTLPDGTEWTPCADLGERPQVEGMAVDEEEHVLYAGQETVGLWRIELDKDEFADAELIDRVREYGTPWTYDETADEECVLDTENDPGFGGENISADAEGVTLYHAGDGAGYVLVSSQGDDTFAVYERGGDNDYVGSFAIVDGPATDGTQHSDGATVVNVPLGDAFPQGLLVTHDGEETPEEGDRESTNFKLTRWDAVASAFPEPLVIDTESFDPRGVN
>NC_018524.1|WP_014910850.1|4649613_4650567_+|GNAT-family-N-acetyltransferase
MTTSEFLTAADVELMQDLAQRITATHPELVNSDASFGELAWNWGRAHAAQGSSWRRRLWFFGGELVAWGWVKLPCGVRLSDGTVANATGAYLAYQVHPDHVELVDEVIDWYDATAAGLERTVLPGDPDRFALERWAAHGYVPDPDGLGDTGSWTQLNQRDLTDVESPKLPGGYRFRTADEAGGEAAVRAHLNAWGPRAYTVEAYRDLRETTGYRGDLHVLVEAPDGEMAASTIMWLDEANRTVEFEPMGTHPDHRRLGLARALLLHGMLLAREAGAVHATVACLGAPGHPAARELYYGAGFRELCRDVPFIKDASAD
>NC_018524.1|WP_041561967.1|4648390_4649356_+|phosphotransferase
MMPEPGATSHPLDRHRDPSDAAFVRGLAAEVAARYGGELTRMRRANGYSNATWVGDGIAVRIAHTPVGMVREAALVRALPREVAHPEILGEGVAEGHGWIVTAEVHGENLYEAWPTLTPVEQRQAIQQLWARAQIVHDASPSLKTHVAAHGGFVPSTLGDAAASAGRAGAALGLSDTRQSRLHEIIEGYFRAASLVEQVVDHGDLALMNALWDGEVVALLDFEFAVLGPVEIDLCRLVYEACVSVEGEYVDSEAGAAALEIAAHHMDPIHGRALIRGAAVLDQLRDLDIWLTQGGGEDWNPGRLLTDLIDDEGGYLAPLLG
>NC_018524.1|WP_081536579.1|4647624_4648038_+|spore-associated-protein-A
MRAARKSLTAAVVVALLSAIAVGLSPSAASAAPYNGACGTGYNVLDSRDIIGATVYVTYNPSNGYNCAATIRDSSGAAINMGAAIKRSSASTWVVDDGSYTTYAGPVYVHAPGQCIDWAGYYGPTSNEVRVFNDFCN
>NC_018524.1|WP_014910610.1|4646456_4647221_+|malonate-transporter-subunit-MadM
MDRIIGVFESNDLLVAFVVVGGLMVVSGWLSKKLTRGWLHGSAIAIILGLALAYWGGWVTGGEHGLADIAVFSGLGLMGGAMLRDFAIVSTAYGVDLREIKRAGLVGVLSLVLGVLVSFAVGAAIAAAFGYTDAASMATIGAGAATYIVGPVTGTAVGASSEVIALSVAAGLVKSVVVMVGTPLIAPLIGLNNPKSAMVYGGLMGTTSGVAGGLAATDKRLVPYGAMTATFYTGVGCLLGPSLLYVVLRFLVGG
>NC_018524.1|WP_014912726.1|4646056_4646455_+|malonate-transporter-subunit-MadL
MVLYGVAALAVCLLSGALVGELLGAAVGVDANVGGVGFAMIMLVVVSDRLRRNGKLPEATEQGVLFWSAMYIPVVIAMASTQNVVKAIAGGPMAITAGLAALAVGAALVPVLSRIGEPAEPLPPLVEEERGA
>NC_018524.1|WP_041561966.1|4644438_4645959_+|AMP-binding-protein
MAPFTAIHRSFAEQARRRPDRTLFELPGGGNITYGQTEETVRRIAARLLADGVTPGDRVAMQVEKSPEAVALYLATLRVGGVFLPLNTAYTDAEMTYFLGDAQPRVLVCSPDRRAEHTGREAEGLVVETLGTSGDGTLLEGDGHHDGDHDASAEDPAAILYTSGTTGRSKGAVLTHGNLASNCEALLQAWRYTSEDRLIHALPIFHVHGLFVAVNMTLAAGASMHYLSGFDTDAVIDLLPRATVLMGVPTFYTRLLRSDRLTSESCASMRLFVSGSAPLLASDAEAFQARTGHAILERYGMTETGMNTTNPYEGPRKPGTVGRPLPGVEVRVADRETGGKLSDGEVGIVEVRGPNVFSGYWRMPEKTAAEFREDGFFITGDLGRVDEDGHLCIVGRDKDLVISGGYNVYPKEVEELLDAHPGVLESAVIGVPHPDLGEAVAAVVVPRPGRELQAEELLESISGDLARFKRPRAVRVVEALPRNVMGKVQKAELRERYTDLFTGADA
>NC_018524.1|WP_014909688.1|4643044_4644397_+|malonyl-CoA-decarboxylase-family-protein
MRPDGARETGPVRPAKEGHDGGPQTADTSGPSALDRLLTDCEILMGDVGEASVRAVAARALAAYDELDDPGRTAFFTHVIKDHGVDPDRVRAAFHRWDEAGNSGSGGEEELVELFDAVEPARQRLLRRMNHASDATLALVGMRADLRRLMRRHPELRPLDHDLHHLLASWFNRGFLRLAEVTPDSPRRLHDHLLRYERVHPMADRDALRRRLEPADRRIYAFFHPATGDVPLIFVEVALVRGTPGDITPLLEPGPALDPREADTAALYSINNALDGLTGISFGDLLIKQVIEQVRDRLPHLEHFVTLSPIPGFRRWLDERAESEADLRELVRDLDAADGPADLDPADTARIRPRLLPVLARYIAAEKRDDGRPLDPVARFHLGNGAAAWRLDWPANPSERAWRQSYGAMVNYRYEPDKLERRHEDFVRRRTVALDGPLREALPDAPDSDT
>NC_018524.1|WP_014908829.1|4642247_4642925_-|GntR-family-transcriptional-regulator
MARVPESQRVRDALENAVVEGRYRPGERLDPARLELEFGCSRTPIREALQALERSGLVQIRSKQGTYVTELGVSELAERFEVMAELEGMAARLCARRIERESIERLEDTLRACERYATAGDADGYYYANADFHGVVSEACGNEYLRQQAHALKRALQPYRRLQLRVPDRMRRSLAEHRAIADAIVGGDAEAAENAARDHVLVQVKEFSQLVRTWRHLTDSARDAG
>NC_018524.1|WP_014908697.1|4640767_4641661_+|MBL-fold-metallo-hydrolase
MRTPSTTPSWSVGDVIVHRVDEVPLPPAAGPWLLPDATPDLVLGQDWLRPHFADHDGVLHIDSHSFAFVVDGSRVLVDTGIGNGKQRANPAWHDLRTDYLERLTEAGFPPETIDLVILTHLHADHVGWNTRQVDGAWVPTFPNARYLTSRTEREFWAGQDMDEARRQMFRDSVIPIEEAGLLDLVDVPAGGARISPGLRLIPTPGHTPGHVAVELAVQGETALITGDCVHHPIQLAHPGIGACVDIDPRRSEATRRALLASLAATDTLLLGTHFAPPTVGRVVTDGDAYRLLPVSAD
>NC_018524.1|WP_014909560.1|4653592_4654399_-|NAD(P)H-dependent-oxidoreductase
MWQTTTKSATVLWVSAHPEPLSLNGNLRRDAIAHLRESGHTVLESDLYAMVWDPVLRSPDGGHSPEETAHTFHVSADTRNAYLADAQPPEVAREQEKIRRADAVVVQFPLWWYGMPAILKGWFDRVFVNGFAFGIDSVSRRRLRFEQGPFVGKRALVVTTLGDRPRSIGPRGKSGELRELLFGLLHGTFAYTGMSVLPPWALPSADRLSDYERARDGLRERLDRLFIDEPIPYRPQFTGDYTEEWELAPHVSPGESGLRVHVDREADT
>NC_018524.1|WP_026125019.1|4654465_4654801_+|winged-helix-turn-helix-transcriptional-regulator
MRLPVERAMEVCPVEVAVSVLGGTWKLTLVKHLLAGTRRFNELGRLVPLANTKTLTRQLRELEEDGIVRRTSYPEVPPRVEYSLTESGRSLEPIVKAMDSWGAEFAERYKG
>NC_018524.1|WP_041561968.1|4655392_4655668_+|hypothetical-protein
MAKKIATLLAVCFLSMGLTATPASASEHSLETEAMDTGRCMLYLENLGRYVIGTKVRQACRLSATNPGQCVSSLQAIGVQRAHARRACGLL
>NC_018524.1|WP_014912813.1|4655734_4656697_-|aminoglycoside-phosphotransferase-family-protein
MNDDPPRRSREALNRLVAAAGLPSVTSVRPINGDGDGLDNHLVKAELTDGRAVVLRRSRVESASPESRIGFLRSNGVTTPELYAADHEGTSLWEFVPGRTLAEAVETGTVTGTVWRRTGEALAEVHGVVFPAPLQGPIEVDSLTLRPVDPVEELCASLHESAVWVEREHPHLLEALRRVEGFVVEHAAEIRAERPTVTHGDINLLNIVVTDDEAVRLIDWDFPTVRYPLAEIAAFDEHAYLHGLEGLPHAFFEGYGRAVPEDLLLAYRVVGCLGWLSSDDWREWDETPDLPGPARTRLRAWHERLLAWADRLPDLVKALG
>NC_018524.1|WP_014910303.1|4656785_4657574_-|sulfite-exporter-TauE/SafE-family-protein
MDLLLAVLAGFTVAAVTTPVGISGAVLLLPVQLSALGMHGPAVSATNLLYNVVATPLGLRRLVRSARGHGTEMAVAVVAAVPCSIVGAAVRVTWLSDPDLFRALLAVLMFGMGLRLLIVRSRKRPEPAPNAPARGRGVLALAAGGAALFGAAVGIGGGSLLAPLLVGVGGWLTSRAAVVALSTTLTTSVVGLTAYAVFDLVGFGAAPATPDWGVGLALGVGGMAGSLVGIGLSRRLGEQPLRFLLGGLILLTGVSYLVGLVR
>NC_018524.1|WP_014908498.1|4657678_4658227_-|TetR/AcrR-family-transcriptional-regulator
MSTDTDTRAQIMDAFGEQFSATGYPGISLLGVARTVGIRKPSIYHHFPGGKEDLYTAVAIRFIETTHERITEALAEGETFEDRLKALVRVSVEHTGATVSFEQRVYDALDLVSDETRERVSGLYVGQVLDPVVTLFTEAVEDGHVEGDPHFLTNAFLHLARGASLENAGATVDLFLNGARAR
>NC_018524.1|WP_014908749.1|4658223_4659033_-|ABC-transporter-permease
MTLTADPLPTIRAVRRGDAFSVTAAATRRSLRAVFRSPALLISPLAQSLFFLLVYSGQLSNVGSAYLGDQTFIAFLLPLILLTGVATGAGAAGTLVLADITSGYLDRLRMAHGTVTPFLTGTVIAVLAAVAVQALFTTGGAMLVGYRPADWGATLGMVAIMLVLGVAVALFSVALAIRTGSSSSTGLVTLTFFGLSFFTGVFAPVEELSGWMRAIATVNPLTSIIDTARQVESGGDLTSGPLAAALLITLIVAGFISCVLALAHARRNR
>NC_018524.1|WP_014912241.1|4659070_4660006_-|ABC-transporter-ATP-binding-protein
MPEHTSVSVTDLRKSYGKRTVLDGLSLQVRRGSRTVVLGPNGAGKSTLLEIVSTLRAPTSGTVVVEGHDVVTHTREARRLIGLVPQANALDPLATPREVLGFQGTVLGLGARTTRRRSHELLELFGLGEHRDTRVSKLSGGTRRKVDLAVALVDSPSLVVLDEPTTGLDPLARMDLWRELERLTSEGEVGTLLVSTQDLHEAEVLASDIVVLREGTVVAHDTPDALKNLVGERTLTLTLDSPETTDGLVETGRAGFRTEPEHPTTVRLALPRDPAVLRAALDDIGAVAASVEGMRLADPSLDDVFAALAAG
>NC_018524.1|WP_014908235.1|4660447_4660948_-|MarR-family-transcriptional-regulator
MSTKPPGSATPWLDEHEERAWRAFRRMMIAVRTATVRDLAETSLSEPDYEVLSTLVERPEVTSTLHEQATKMGWSRSRLSRHAGRMETRGLIRRAPDPADGRGCLLILTELGKDTLRSATPVHLESVRRHFADPLDADDLTDLIRIGDKIMSAGRPPENGADSAQG
>NC_018524.1|WP_148281714.1|4661005_4662076_+|GNAT-family-N-acetyltransferase
MVLTCSTRPGSLGPAIADWFTVTVSPLAARLGVELRSLSLAELALPFLDEEEHPSSGIYRRPHTKRWSELVDAVDGFIVVTPEYNYGMPAPLKNALDYLGREWAWKPMGFISYGNTSAGTRSVQHTKEVATTLRLVPLGATVALRLQDAIVGGRVRRSPRHDAAAEGVLREAVRVSRALRPLREALREGSVEGPVPGSHTRVMTPDDAGEVTVLQRCCWVDEAVDNDSLALAPLRESVDEVACWLDRWTTTGLWRGGRLIAMVRVRREGRIGRIGRLAVVPDMRGAGIGRWLLRRAEGDLGAGCDRIELSTGAGSARNIGLYRSEGFVIDAEEDEVVHLGKALPGDLPTTPALGVG

Crispr_ID: NC_018524_33

• CRISPR_ID: NC_018524_33
• CRISPR_location: 5092697-5092783
• CRISPR_type: Orphan
• Repeat_type: A:N
• Spacer_info: 1 spacers

Consensus repeat of NC_018524_33

Consensus_repeat	Method
GGTCCATCCCCGCGTGCGCGGGGCTC	CRISPRCasFinder

spacers of NC_018524_33

>33.1|5092723|35|NC_018524|CRISPRCasFinder
AAGACGAAGTCGTGCGAATCGGAGACCTGTGCGAC

CRISPR arrays and Neighbor proteins around NC_018524_33

CRISPR arrays

The CRISPR arrays of NC_018524_33

>merge|NC_018524|33|5092697-5092783|CRISPRCasFinder
GGTCCATCCCCGCGTGCGCGGGGCTCAAGACGAAGTCGTGCGAATCGGAGACCTGTGCGACGGTCCATCCCCGCGTGTGCGGGGCTC

>NC_018524|33|32|5092697-5092783|CRISPRCasFinder
GGTCCATCCCCGCGTGCGCGGGGCTC	AAGACGAAGTCGTGCGAATCGGAGACCTGTGCGAC
GGTCCATCCCCGCGTGTGCGGGGCTC

Neighbor Proteins Overview

Protein	Signature genes	Signature genes Name	Protein_function
NC_018524.1|WP_014911973.1|5095867_5096323_+|YdcF-family-protein	unknown	unknown	gnl|CDD|99750
NC_018524.1|WP_148281716.1|5091438_5092257_-|follicular-epithelium-yolk-protein-subunit	unknown	unknown	gnl|CDD|380805
NC_018524.1|WP_051018335.1|5087395_5088631_+|MFS-transporter	unknown	unknown	gnl|CDD|341031
NC_018524.1|WP_014913325.1|5083516_5084074_-|dihydrofolate-reductase-family-protein	unknown	unknown	gnl|CDD|223340
NC_018524.1|WP_014911792.1|5090912_5091305_+|VOC-family-protein	unknown	unknown	gnl|CDD|380093
NC_018524.1|WP_014908929.1|5098255_5098822_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014912288.1|5093096_5093855_-|TetR/AcrR-family-transcriptional-regulator-C-terminal-domain-containing-protein	unknown	unknown	gnl|CDD|367243
NC_018524.1|WP_014912310.1|5086618_5087341_-|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl|CDD|225117
NC_018524.1|WP_014910282.1|5089510_5090785_+|glutaminase-A	unknown	unknown	gnl|CDD|377427
NC_018524.1|WP_014911697.1|5099973_5100237_+|winged-helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl|CDD|153418
NC_018524.1|WP_014908210.1|5096344_5097142_-|tyrosine-protein-phosphatase	unknown	unknown	gnl|CDD|379135
NC_018524.1|WP_051018333.1|5086073_5086565_+|GNAT-family-N-acetyltransferase	unknown	unknown	gnl|CDD|224584
NC_018524.1|WP_041562012.1|5084325_5084820_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014910851.1|5088760_5089348_+|maleylpyruvate-isomerase-N-terminal-domain-containing-protein	unknown	unknown	gnl|CDD|371689
NC_018524.1|WP_014912579.1|5101240_5101780_+|polysaccharide-deacetylase-family-protein	unknown	unknown	gnl|CDD|213022
NC_018524.1|WP_051018337.1|5100830_5101271_+|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014909803.1|5097660_5098044_+|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014912499.1|5094902_5095619_+|VOC-family-protein	unknown	unknown	gnl|CDD|380093
NC_018524.1|WP_014913510.1|5084841_5085897_-|OmpA-family-protein	unknown	unknown	gnl|CDD|143586
NC_018524.1|WP_014912042.1|5093922_5094780_+|NAD(P)H-binding-protein	unknown	unknown	gnl|CDD|187578

rpsblast for functional proteins

Protein	Function_ID	Function_description	E-value
NC_018524.1|WP_014911973.1|5095867_5096323_+|YdcF-family-protein	gnl|CDD|99750	cd06259, YdcF-like, YdcF-like. YdcF-like is a large family of mainly bacterial proteins, with a few members found in fungi, plants, and archaea. Escherichia coli YdcF has been shown to bind S-adenosyl-L-methionine (AdoMet), but a biochemical function has not been idenitified. The family also includes Escherichia coli sanA and Salmonella typhimurium sfiX, which are involved in vancomycin resistance; sfiX may also be involved in murein synthesis.	1.62079e-12
NC_018524.1|WP_148281716.1|5091438_5092257_-|follicular-epithelium-yolk-protein-subunit	gnl|CDD|380805	cd20235, PFM_spherulin-2a-like, pore-forming module of Physarum polycephalum spherulin-2a, Plodia interpunctella follicular epithelium yolk protein subunit YP4, and similar aerolysin-type beta-barrel pore-forming proteins. Spherulin 2a is a coat glycoprotein produced during encystment from the slime mold, Physarum polycephalum. YP4, is one of two subunits of the follicular epithelium yolk protein from Plodia interpunctella and other pyralid moths; it is produced in the follicle cells during vitellogenesis, and after secretion it is taken up into the oocyte and stored in the yolk spheres for utilization during embryogenesis. Members of this group belong to the aerolysin family of beta-pore-forming proteins (beta-PFPs). PFPs are generally secreted as water-soluble monomers, which upon binding to target lipid membranes, oligomerize and form transmembrane pores harmful to cells. Beta-PFPs form pores by transmembrane beta-barrels. Aerolysin-type beta-PFPs are believed to use an amphipathic beta-hairpin to form the beta-barrel, are found in all kingdoms of life and many are bacterial toxins. In addition to having a role in microbial infection, they have potential as biotechnological sensors and delivery systems. They share a similar monomeric architecture, with a variable membrane-binding domain and a structurally conserved pore-forming region. A significant portion of the monomeric subunit structure is re-organized to form the pore. Oligomers formed by members of the aerolysin family include: hepta- (aerolysin), octa- (Dln1), and nonameric oligomers (lysenin and monalysin).	4.68683e-70
NC_018524.1|WP_051018335.1|5087395_5088631_+|MFS-transporter	gnl|CDD|341031	cd17478, MFS_FsR, Fosmidomycin resistance protein of the Major Facilitator Superfamily of transporters. Fosmidomycin resistance protein (FsR) confers resistance against fosmidomycin. It shows sequence similarity with the bacterial drug-export proteins that mediate resistance to tetracycline and chloramphenicol. This FsR family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.15634e-76
NC_018524.1|WP_014913325.1|5083516_5084074_-|dihydrofolate-reductase-family-protein	gnl|CDD|223340	COG0262, FolA, Dihydrofolate reductase [Coenzyme metabolism].	3.39243e-12
NC_018524.1|WP_014911792.1|5090912_5091305_+|VOC-family-protein	gnl|CDD|380093	pfam18029, Glyoxalase_6, Glyoxalase-like domain. This entry comprises a diverse set of domains related to the Glyoxalase domain. The exact specificity of these proteins is uncertain.	6.98993e-29
NC_018524.1|WP_014912288.1|5093096_5093855_-|TetR/AcrR-family-transcriptional-regulator-C-terminal-domain-containing-protein	gnl|CDD|367243	pfam02909, TetR_C, Tetracyclin repressor, C-terminal all-alpha domain.	1.11513e-13
NC_018524.1|WP_014912310.1|5086618_5087341_-|helix-turn-helix-transcriptional-regulator	gnl|CDD|225117	COG2207, AraC, AraC-type DNA-binding domain-containing proteins [Transcription].	3.97652e-21
NC_018524.1|WP_014910282.1|5089510_5090785_+|glutaminase-A	gnl|CDD|377427	pfam04960, Glutaminase, Glutaminase. This family of enzymes deaminates glutamine to glutamate EC:3.5.1.2.	2.56996e-157
NC_018524.1|WP_014911697.1|5099973_5100237_+|winged-helix-turn-helix-transcriptional-regulator	gnl|CDD|153418	cd07377, WHTH_GntR, Winged helix-turn-helix (WHTH) DNA-binding domain of the GntR family of transcriptional regulators. This CD represents the winged HTH DNA-binding domain of the GntR (named after the gluconate operon repressor in Bacillus subtilis) family of bacterial transcriptional regulators and their putative homologs found in eukaryota and archaea. The GntR family has over 6000 members distributed among almost all bacterial species, which is comprised of FadR, HutC, MocR, YtrA, AraR, PlmA, and other subfamilies for the regulation of the most varied biological process. The monomeric proteins of the GntR family are characterized by two function domains: a small highly conserved winged helix-turn-helix prokaryotic DNA binding domain in the N-terminus, and a very diverse regulatory ligand-binding domain in the C-terminus for effector-binding/oligomerization, which provides the basis for the subfamily classifications. Binding of the effector to GntR-like transcriptional regulators is presumed to result in a conformational change that regulates the DNA-binding affinity of the repressor. The GntR-like proteins bind as dimers, where each monomer recognizes a half-site of 2-fold symmetric DNA sequences.	7.70432e-17
NC_018524.1|WP_014908210.1|5096344_5097142_-|tyrosine-protein-phosphatase	gnl|CDD|379135	pfam13350, Y_phosphatase3, Tyrosine phosphatase family. This family is closely related to the pfam00102 and pfam00782 families.	3.06067e-45
NC_018524.1|WP_051018333.1|5086073_5086565_+|GNAT-family-N-acetyltransferase	gnl|CDD|224584	COG1670, RimL, Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis].	2.04107e-15
NC_018524.1|WP_014910851.1|5088760_5089348_+|maleylpyruvate-isomerase-N-terminal-domain-containing-protein	gnl|CDD|371689	pfam11716, MDMPI_N, Mycothiol maleylpyruvate isomerase N-terminal domain.	3.00733e-07
NC_018524.1|WP_014912579.1|5101240_5101780_+|polysaccharide-deacetylase-family-protein	gnl|CDD|213022	cd10917, CE4_NodB_like_6s_7s, Catalytic NodB homology domain of rhizobial NodB-like proteins. This family belongs to the large and functionally diverse carbohydrate esterase 4 (CE4) superfamily, whose members show strong sequence similarity with some variability due to their distinct carbohydrate substrates. It includes many rhizobial NodB chitooligosaccharide N-deacetylase (EC 3.5.1.-)-like proteins, mainly from bacteria and eukaryotes, such as chitin deacetylases (EC 3.5.1.41), bacterial peptidoglycan N-acetylglucosamine deacetylases (EC 3.5.1.-), and acetylxylan esterases (EC 3.1.1.72), which catalyze the N- or O-deacetylation of substrates such as acetylated chitin, peptidoglycan, and acetylated xylan. All members of this family contain a catalytic NodB homology domain with the same overall topology and a deformed (beta/alpha)8 barrel fold with 6- or 7 strands. Their catalytic activity is dependent on the presence of a divalent cation, preferably cobalt or zinc, and they employ a conserved His-His-Asp zinc-binding triad closely associated with the conserved catalytic base (aspartic acid) and acid (histidine) to carry out acid/base catalysis. Several family members show diversity both in metal ion specificities and in the residues that coordinate the metal.	5.92941e-62
NC_018524.1|WP_014912499.1|5094902_5095619_+|VOC-family-protein	gnl|CDD|380093	pfam18029, Glyoxalase_6, Glyoxalase-like domain. This entry comprises a diverse set of domains related to the Glyoxalase domain. The exact specificity of these proteins is uncertain.	1.86144e-15
NC_018524.1|WP_014913510.1|5084841_5085897_-|OmpA-family-protein	gnl|CDD|143586	cd07185, OmpA_C-like, Peptidoglycan binding domains similar to the C-terminal domain of outer-membrane protein OmpA. OmpA-like domains (named after the C-terminal domain of Escherichia coli OmpA protein) have been shown to non-covalently associate with peptidoglycan, a network of glycan chains composed of disaccharides, which are crosslinked via short peptide bridges. Well-studied members of this family include the Escherichia coli outer membrane protein OmpA, the Escherichia coli lipoprotein PAL, Neisseria meningitdis RmpM, which interact with the outer membrane, as well as the Escherichia coli motor protein MotB, and the Vibrio flagellar motor proteins PomB and MotY, which interact with the inner membrane.	5.82403e-29
NC_018524.1|WP_014912042.1|5093922_5094780_+|NAD(P)H-binding-protein	gnl|CDD|187578	cd05269, TMR_SDR_a, triphenylmethane reductase (TMR)-like proteins, NMRa-like, atypical (a) SDRs. TMR is an atypical NADP-binding protein of the SDR family. It lacks the active site residues of the SDRs but has a glycine rich NAD(P)-binding motif that matches the extended SDRs. Proteins in this subgroup however, are more similar in length to the classical SDRs. TMR was identified as a reducer of triphenylmethane dyes, important environmental pollutants. This subgroup also includes Escherichia coli NADPH-dependent quinine oxidoreductase (QOR2), which catalyzes two-electron reduction of quinone; but is unlikely to play a major role in protecting against quinone cytotoxicity. Atypical SDRs are distinct from classical SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	1.95894e-45

Protein sequences

>NC_018524.1|WP_148281716.1|5091438_5092257_-|follicular-epithelium-yolk-protein-subunit
MKSPTPWGDLYKSYGWREVHTYTTPSQAYVTGIQSEPVIVATKTLTNNSSVPAEFDAGISEQVTNTVSNTWSSTHSIEVSQEFNYEVKFLGSGGGGTTSFSYTHQWGQEKREEKSTTVGTTSGVKVTLNPGQSVVAKLVATRGVLNYRIVYKATLNGGTAYNYNPTHEGHHFWWSPINNIMNSGNLSTERSFTEDLQVGYYSDSKVELTDPKTGRLLGVLPAHAKYSTPLDMRDLKWADPKAPSEETNGNASEEDENSSEGESSQEEHHEEQ
>NC_018524.1|WP_014911792.1|5090912_5091305_+|VOC-family-protein
MAAKFTELAIDCADPQGLARFWCAVLDYEVQSEEEGGDVVSIGSPEVPEGRERPGPVPPVLTFARVPEGKMVKNRLHVDVNPTDRDQEAEVRRLLDLGARRADVGQGEVSWVTLTDPEGNEFCVLATRRP
>NC_018524.1|WP_014910282.1|5089510_5090785_+|glutaminase-A
MRSPILDYLDAIIAQTAHVDSGARADYIPELASADPGRVAVAICTVNGTVYASGDADDLFSIQSMSKPFAYALAIEDRGIDDILDRVGVEPSGEAFNELSLDPETGRPRNPMINAGAIAVHALVDDREAPAVDRLLGLFSDLTQRPVEVDEGLAASELATGDRNLGLAYLLHASGRLARDPAASVEGYVRQCSASVTVRDLALMAATLANGGVQPNTGKQLFSRRTTRHLLSVMASCGMYDAAGDWLTSVGIPAKSGVAGGIIGVLPGQVGVAVFSPRLDQHGNSARGVVMMEKLSEDLGLHLMEPGRPSRSSLRETRKEVVEGEPTTIYVLQGDMVLSSIEALVHELVENPPATDVVVFDMSRVDEVLPVARRTAAETATKMIDGGYRIIVVDPEETVPAFHDSRGRSVERWTSERLELALRS
>NC_018524.1|WP_014910851.1|5088760_5089348_+|maleylpyruvate-isomerase-N-terminal-domain-containing-protein
MDLFAYSWAALRAAVADLPDEDFARPSGCTGWLVRDLVFHLVIDAQDVLITLVTPTEAPPTRDAATYWDVSASPPAGDGPFDALTVRLAAAYEEPRLLRYHLDEVLTVRDYLDAYVLEWTLHHLDLIAHLPDVPGPPPESSTYARRLLERIAGAPFPGSLTDEAALRVGTGRRAPTEAESSVLDTMATRLPLVLS
>NC_018524.1|WP_051018335.1|5087395_5088631_+|MFS-transporter
MNTLEGMLSSVSRSARGGARLLAYSHATVDFYQGAVAALVPFLVLERGYDYAAAAGVVLAGSLSSSIVQPLFGVLGDRWTMRWLIPVAIVLSGAGIAAISVSESVWVTALLAGLSGVGVAAYHPAGANRSRRISGDDHVVMSWFSLGGTIGFAVAPLFVAATVGVWGLEATPLLLVPALTGLAAVALIGPVTGSAERTGKASRAGHAGRDDWGSFSMMTVAIVCRSVVFVGLGSFLVLFVHAHAGLGETAAATSLFVFYLGGAFGTAVGGHLARRWARVTILRWSYALAVPVLAGLLFVPGPAVFVFIALTSLVLYVPFSLHVTLGQDYLPRRMGTANGVTLGLAVSAGGLASPAIGALADEVGLQGALLPLLVLPALACLVLARVREPVSAAVAAEAKSSSPTDRPSPAP
>NC_018524.1|WP_014912310.1|5086618_5087341_-|helix-turn-helix-transcriptional-regulator
MPIAPTETRRLTSGEDVDAHRHDDHQLIYSSSGVLEVMVESGTWFTPSNRAVWVPGGTEHRWRVHGATRVHLVGVPARRKRPWGHEPAPVLVDPLFRELLIACSETGPAVSPEQRRMLAVLIDRIRPAPEPATMVPVLRDARLREVQAVLESDMTASPTLGELGRRIGVGERTLSRLFHDTVGMGFTVWRTQLRLHRAGLLLAQGRTVTQAAAACGFSSPSAFIVAFQAAFGRTPGSLYR
>NC_018524.1|WP_051018333.1|5086073_5086565_+|GNAT-family-N-acetyltransferase
MSVAAGRLPRMSDQVRLREVEPADLEVFFAYEHDEEAMRRSRFPPRDREAFMEHWRTRVLGDPDSFVRSVTVDGELAGNLVSWSIEGRRFLGYWLGRLYWGRGVGGRALALFLEQERTRPLRADPFVENTASVRLLEGHGFRREGTVRYGEDEHLMLVLDEGC
>NC_018524.1|WP_014913510.1|5084841_5085897_-|OmpA-family-protein
MDMEHTPALPTSPRARLRAAASAGALLLLLTGCGLIGNTPEEEADDTGDGGDTANSTEGAAAQEAVELPVGSTTTSTAWGPDLEVEIQALERVGSDALRLTVGVGNHTTDDIRHFKNLRDNDLGGYDLSGLTLLDVTTDRQYLPLTVGGDCVCEEFPDRRIRAGVVESTTVLFPAPPEGVETMAVLTPITAPFHGVPLTDADEEIPDPGADAPVILDLTHPTDTVVADYQRHETDGEVTYELAADVLFETDSAELGDAAAQSLERVAAEIDISSADRVSIDGHTDDTGDDSVNVPLSRERAEAVETALNDLVDRSGVTYDVDGHGSADPVTDNDTDEGRAQNRRVTVTFAK
>NC_018524.1|WP_041562012.1|5084325_5084820_-|hypothetical-protein
MKRAAALLTLTTTALLATGTAAPADTLDHVGTATGVDERTAGLVLEVNEISRDSSGAYATLLWSVRNEGTERITINPKDTSLDFDRQSFAGVTLRDEESRTRFHPAMNSESACLCTRDTVGTIDTRLDPGATLTYWSLYSVPADLETVTVEVPDFGDVTDVPLT
>NC_018524.1|WP_014913325.1|5083516_5084074_-|dihydrofolate-reductase-family-protein
MSRVIYSVASSLDGYINDPQGDFSWAVPDEEVIAALTEDAARASTFLYGRRMYETMAVWETDPATADQSPESANWARMWKAADKIVFSRTLPKVWTERTRLERELTIEAIERAISEASGDLTIEGPTLAGEALRLGRVDVVEVLVCPAIVGAGTPIFPEGLRLDLSLDRARRFDNGMMQVTYDVR
>NC_018524.1|WP_014912288.1|5093096_5093855_-|TetR/AcrR-family-transcriptional-regulator-C-terminal-domain-containing-protein
MMDRSGRGDPRETLNLLWRTPRTRSGRGRPPKVSFDKIIVAAMALADRDGLDAMTMDRIADSLDVGTMTLYTHVPGKAELTDLMVDHAWRELDLAPEGPWRERIERYARQNVALHERHPWLRQVSTARPPLGPGLFARNDFLLSALFETGLTAAEISAASDSIITFVDGASVTLAEHSHAERISGQSDEDWWDDRRVFWENIFDPARYPAIERTWNDGGFDRSPAEAAAKAFDFGLRSLLDGIEAMARRRSG
>NC_018524.1|WP_014912042.1|5093922_5094780_+|NAD(P)H-binding-protein
MRVLVTGATGNVGRRVTAGLVEAGVSVRALTRNPARAELPGAEIVRGDLTEPEAVPLDGVDRMFLFPEPSTAKDLVERAVRAGVRRIVVLSSGAVTGGFDTTFHPPVEQAAEHSGVEWTHIRPGEFAANKLALWGPSIRAERVVRDPNPDGGWYPVHEWDVADAALAVLLEDGHHGKAYDVNGPELISLRDQVGAIADALGEEIRFEEVTPAEAREIYRRLGGFAAEAADFLLRFTDYDGNAADPADAADFDPGSLGPLPTVSSVTGAEPRTFAQWARDRVEDFR
>NC_018524.1|WP_014912499.1|5094902_5095619_+|VOC-family-protein
MLLDSITLQADDPSFLARFWSKALEVPVVSDGPAGFLLLTSGVPLRFLPTPVSPTPRPEAAITRLHFDLNGGGDHRAWARSLCEMGASPRDVGQGDVVWEVLADVEGHLFCVMPGDRYEETGPGLGSLPVDSARPRVDRDFWARVTGWIPVEASTPELRPPQGPGIRLAFCDELAPKPVDEPNVMGLALQLDEGERESDALDLLVDLGARRVETEAEGPWHLLTDPSGNEFRLAKSLR
>NC_018524.1|WP_014911973.1|5095867_5096323_+|YdcF-family-protein
MLGFRNRSVKANYLNRYRVRAGLRSQDPAAKRSVLVLCGGTVAGDVSEAEVMARYARYQLGYTGPIRLDRKSTSTWENIENVIPLVEDMDTLKIVSNSLHAEKGRAYLWRQRPDIAVRLVRAEEHRFGELALLKPVLAVIGLNRLGRLRRG
>NC_018524.1|WP_014908210.1|5096344_5097142_-|tyrosine-protein-phosphatase
MSENRQITWDGFFNTRDLGGLPTRHGGTTRHGAFIRAADLRFVTVEGWRSAYEAGVRTIVDLRNPDEIRPSQDEGLTRQGGSAVFPASADQAPLPPGMNRLEIPLDHVEDVEFWKDINGRGLNGSPLYFRPFLDHKAERCAAVITALARSEPGGVLFHCGAGRDRTGLIGLLLLALAEVEPDAIADDYEISTEALKPLFAAMGKEDQGPLIASHLADRGLTLCDSVLTVLEDLDAETLLLEAGVTEGDLARVRARLLDRSDRSER
>NC_018524.1|WP_014909803.1|5097660_5098044_+|hypothetical-protein
MREHDWYYDNDEEAPLDADLDDPNSEAATHWIAVERVYRLDWRRFTPESWETLRRIYQALPGHLPSSADSARWFSLDEERELYLWASVEPPGLQVEGVLTLAMWHDWDSRFRREVIGHDLPRAPLLS
>NC_018524.1|WP_014908929.1|5098255_5098822_-|hypothetical-protein
MANEIKYGDLIHLQNGYNDWAGGYLDTNGHRPAPAKYGVSTADTPTRGPGTGTWEVLSAEGKTDGTTVISGDVVYLRNLYQDDGGYLDTNGHASDDQKRSGGRYDVSTSPGKDRGEGTGRWRIFAQTSSPTDQAVRLGDVLLLWNLYSSGSFLETNSTAGPGLYDVCTNAYFNRAEDVTLWKALTAEA
>NC_018524.1|WP_014911697.1|5099973_5100237_+|winged-helix-turn-helix-transcriptional-regulator
MDQPLGPDADIIHDAPEPPYRQLAQILIARIKRGDWAPDRPMSSETQLVQEYELARSTVRRTIALLVEDEWAYVVPRRGTYVKKRDS
>NC_018524.1|WP_051018337.1|5100830_5101271_+|hypothetical-protein
MVDFLHGNGSRVIIDDTNGLLYDRLTEAGLTVYRADHRAPSELPLLGSASAETLARTTLRDRPPLSRSATGSGTHSGRDEELAGGYETAMAAVADQPAPGRFFAHGPRDEKKVALTFDDGPFLRTPTGSWTYSSTMRCLRPFSAWV
>NC_018524.1|WP_014912579.1|5101240_5101780_+|polysaccharide-deacetylase-family-protein
MPATFFCVGLNSAAHPELLGRIQERGHAFGNHTWSHPYLPDLSEAQILEQLRRTGEAISTFTGGAPTLFRPPYGALPPGPYDWLTTMEATTVLWDVDPKDWSRPGAEVIARSVLDQVRPGSIVLMHDGGGDRSQTVDALPTIIETLLARGYRMVRADHLLERPVSEQAEARGTSPSTPD

Crispr_ID: NC_018524_35

• CRISPR_ID: NC_018524_35
• CRISPR_location: 5118263-5118719
• CRISPR_type: Orphan
• Repeat_type: A:N
• Spacer_info: 7 spacers

Consensus repeat of NC_018524_35

Consensus_repeat	Method
GGGGCCATCCCCGCGTGCGCGGGGAGCAG	PILER-CR
GGGGTCATCCCCGCGTGCGCGGGGAGCAG	CRISPRCasFinder
GGGGCCATCCCCGCGTGCGCGGGGAGCAG	CRT

spacers of NC_018524_35

>35.1|5118292|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT
AGAGCCCCGCCGAGGAATCGGTTCTTCGTGAA
>35.2|5118353|33|NC_018524|PILER-CR,CRISPRCasFinder,CRT
ACCCCCTGGCAGGCCCTGGGGCTGCTCCCGATG
>35.3|5118415|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT
TCCCAGGCGTGTCCGTGCTTGGTGTCCCGGTG
>35.4|5118476|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT
GCCCCCAGAAGGGGTTGTTATCACCTCGTGAT
>35.5|5118537|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT
ACCCAGAGCACGAGCTTGCCGGGGTGGTCCTC
>35.6|5118598|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT
CCGCCAAGCTCTACGCGCATCTGCCCGGAGGG
>35.7|5118659|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT
GGTGACGGTCTCGCGGATGACCTCCCGCACGG

CRISPR arrays and Neighbor proteins around NC_018524_35

CRISPR arrays

The CRISPR arrays of NC_018524_35

>merge|NC_018524|35|5118263-5118719|PILER-CR,CRISPRCasFinder,CRT
GGGGCCATCCCCGCGTGCGCGGGGAGCAGAGAGCCCCGCCGAGGAATCGGTTCTTCGTGAAGGGGCCATCCCCGCGTGCGCGGGGAGCAGACCCCCTGGCAGGCCCTGGGGCTGCTCCCGATGGGGGCCATCCCCGCGTGCGCGGGGAGCAGTCCCAGGCGTGTCCGTGCTTGGTGTCCCGGTGGGGGCCATCCCCGCGTGCGCGGGGAGCAGGCCCCCAGAAGGGGTTGTTATCACCTCGTGATGGGGCCATCCCCGCGTGCGCGGGGAGCAGACCCAGAGCACGAGCTTGCCGGGGTGGTCCTCGGGGCCATCCCCGCGTGCGCGGGGAGCAGCCGCCAAGCTCTACGCGCATCTGCCCGGAGGGGGGGCCATCCCCGCGTGCGCGGGGAGCAGGGTGACGGTCTCGCGGATGACCTCCCGCACGGGGGGCCATCCCCGCGTGCGCGGGGAGCAG

>NC_018524|35|21|5118263-5118719|PILER-CR
GGGGCCATCCCCGCGTGCGCGGGGAGCAG	AGAGCCCCGCCGAGGAATCGGTTCTTCGTGAA
GGGGCCATCCCCGCGTGCGCGGGGAGCAG	ACCCCCTGGCAGGCCCTGGGGCTGCTCCCGATG
GGGGCCATCCCCGCGTGCGCGGGGAGCAG	TCCCAGGCGTGTCCGTGCTTGGTGTCCCGGTG
GGGGCCATCCCCGCGTGCGCGGGGAGCAG	GCCCCCAGAAGGGGTTGTTATCACCTCGTGAT
GGGGCCATCCCCGCGTGCGCGGGGAGCAG	ACCCAGAGCACGAGCTTGCCGGGGTGGTCCTC
GGGGCCATCCCCGCGTGCGCGGGGAGCAG	CCGCCAAGCTCTACGCGCATCTGCCCGGAGGG
GGGGCCATCCCCGCGTGCGCGGGGAGCAG	GGTGACGGTCTCGCGGATGACCTCCCGCACGG
GGGGCCATCCCCGCGTGCGCGGGGAGCAG

>NC_018524|35|34|5118263-5118719|CRISPRCasFinder
GGGGCCATCCCCGCGTGCGCGGGGAGCAG	AGAGCCCCGCCGAGGAATCGGTTCTTCGTGAA
GGGGCCATCCCCGCGTGCGCGGGGAGCAG	ACCCCCTGGCAGGCCCTGGGGCTGCTCCCGATG
GGGGCCATCCCCGCGTGCGCGGGGAGCAG	TCCCAGGCGTGTCCGTGCTTGGTGTCCCGGTG
GGGGCCATCCCCGCGTGCGCGGGGAGCAG	GCCCCCAGAAGGGGTTGTTATCACCTCGTGAT
GGGGCCATCCCCGCGTGCGCGGGGAGCAG	ACCCAGAGCACGAGCTTGCCGGGGTGGTCCTC
GGGGCCATCCCCGCGTGCGCGGGGAGCAG	CCGCCAAGCTCTACGCGCATCTGCCCGGAGGG
GGGGCCATCCCCGCGTGCGCGGGGAGCAG	GGTGACGGTCTCGCGGATGACCTCCCGCACGG
GGGGCCATCCCCGCGTGCGCGGGGAGCAG

>NC_018524|35|22|5118263-5118719|CRT
GGGGCCATCCCCGCGTGCGCGGGGAGCAG	AGAGCCCCGCCGAGGAATCGGTTCTTCGTGAA
GGGGCCATCCCCGCGTGCGCGGGGAGCAG	ACCCCCTGGCAGGCCCTGGGGCTGCTCCCGATG
GGGGCCATCCCCGCGTGCGCGGGGAGCAG	TCCCAGGCGTGTCCGTGCTTGGTGTCCCGGTG
GGGGCCATCCCCGCGTGCGCGGGGAGCAG	GCCCCCAGAAGGGGTTGTTATCACCTCGTGAT
GGGGCCATCCCCGCGTGCGCGGGGAGCAG	ACCCAGAGCACGAGCTTGCCGGGGTGGTCCTC
GGGGCCATCCCCGCGTGCGCGGGGAGCAG	CCGCCAAGCTCTACGCGCATCTGCCCGGAGGG
GGGGCCATCCCCGCGTGCGCGGGGAGCAG	GGTGACGGTCTCGCGGATGACCTCCCGCACGG
GGGGCCATCCCCGCGTGCGCGGGGAGCAG

Neighbor Proteins Overview

Protein	Signature genes	Signature genes Name	Protein_function
NC_018524.1|WP_041562280.1|5112379_5113084_-|GntR-family-transcriptional-regulator	unknown	unknown	gnl|CDD|224715
NC_018524.1|WP_014908555.1|5113199_5114366_+|mandelate-racemase	unknown	unknown	gnl|CDD|239442
NC_018524.1|WP_014910365.1|5123635_5124343_-|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl|CDD|213222
NC_018524.1|WP_014911400.1|5124339_5125470_-|ABC-transporter-permease	unknown	unknown	gnl|CDD|223650
NC_018524.1|WP_014912688.1|5109876_5110899_+|zinc-dependent-alcohol-dehydrogenase-family-protein	unknown	unknown	gnl|CDD|176247
NC_018524.1|WP_014911565.1|5108851_5109748_-|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl|CDD|375319
NC_018524.1|WP_041562014.1|5103878_5104187_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_051018394.1|5126091_5126901_+|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014910881.1|5120002_5120926_+|APH(6)-I-family-aminoglycoside-O-phosphotransferase	unknown	unknown	gnl|CDD|309685
NC_018524.1|WP_014911998.1|5117360_5118251_+|MerR-family-transcriptional-regulator	unknown	unknown	gnl|CDD|133378
NC_018524.1|WP_187294498.1|5123024_5123639_-|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl|CDD|366102
NC_018524.1|WP_014908981.1|5129187_5129850_-|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl|CDD|224228
NC_018524.1|WP_014908524.1|5106122_5106857_-|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl|CDD|379312
NC_018524.1|WP_014908795.1|5127612_5128191_+|hypothetical-protein	unknown	unknown	gnl|CDD|376764
NC_018524.1|WP_014908837.1|5119140_5119743_+|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014912282.1|5126971_5127616_+|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014910079.1|5107152_5108130_-|aldo/keto-reductase	unknown	unknown	gnl|CDD|381313
NC_018524.1|WP_014908747.1|5114644_5116339_+|SLC13/DASS-family-transporter	unknown	unknown	gnl|CDD|238535
NC_018524.1|WP_014912684.1|5121037_5121454_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_041562015.1|5104281_5105763_-|MFS-transporter	unknown	unknown	gnl|CDD|129794

rpsblast for functional proteins

Protein	Function_ID	Function_description	E-value
NC_018524.1|WP_041562280.1|5112379_5113084_-|GntR-family-transcriptional-regulator	gnl|CDD|224715	COG1802, GntR, Transcriptional regulators [Transcription].	6.59191e-47
NC_018524.1|WP_014910881.1|5120002_5120926_+|APH(6)-I-family-aminoglycoside-O-phosphotransferase	gnl|CDD|309685	pfam04655, APH_6_hur, Aminoglycoside/hydroxyurea antibiotic resistance kinase. The aminoglycoside phosphotransferases achieve inactivation of their antibiotic substrates by phosphorylation utilising ATP. Likewise hydroxyurea is inactivated by phosphorylation of the hydroxy group in the hydroxylamine moiety.	4.67521e-77
NC_018524.1|WP_014910365.1|5123635_5124343_-|ABC-transporter-ATP-binding-protein	gnl|CDD|213222	cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein. This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of lipoproteins from the cytoplasmic membrane (LolCDE). They are clustered together phylogenetically. MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all. An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport. The LolCDE complex catalyzes the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane.	7.37583e-86
NC_018524.1|WP_014911400.1|5124339_5125470_-|ABC-transporter-permease	gnl|CDD|223650	COG0577, SalY, ABC-type antimicrobial peptide transport system, permease component [Defense mechanisms].	3.64963e-11
NC_018524.1|WP_014912688.1|5109876_5110899_+|zinc-dependent-alcohol-dehydrogenase-family-protein	gnl|CDD|176247	cd08287, FDH_like_ADH3, formaldehyde dehydrogenase (FDH)-like. This group contains proteins identified as alcohol dehydrogenases and glutathione-dependant formaldehyde dehydrogenases (FDH) of the zinc-dependent/medium chain alcohol dehydrogenase family. The MDR family uses NAD(H) as a cofactor in the interconversion of alcohols and aldehydes, or ketones. FDH converts formaldehyde and NAD to formate and NADH. The initial step in this process the spontaneous formation of a S-(hydroxymethyl)glutathione adduct from formaldehyde and glutathione, followed by FDH-mediated oxidation (and detoxification) of the adduct to S-formylglutathione. The medium chain alcohol dehydrogenase family (MDR) has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit.	0
NC_018524.1|WP_014908747.1|5114644_5116339_+|SLC13/DASS-family-transporter	gnl|CDD|238535	cd01115, SLC13_permease, Permease SLC13 (solute carrier 13). The sodium/dicarboxylate cotransporter NaDC-1 has been shown to translocate Krebs cycle intermediates such as succinate, citrate, and alpha-ketoglutarate across plasma membranes rabbit, human, and rat kidney. It is related to renal and intestinal Na+/sulfate cotransporters and a few putative bacterial permeases. The SLC13-type proteins belong to the ArsB/NhaD superfamily of permeases that translocate sodium and various anions across biological membranes in all three kingdoms of life. A typical ArsB/NhaD permease is composed of 8-13 transmembrane helices.	6.40425e-79
NC_018524.1|WP_187294498.1|5123024_5123639_-|TetR/AcrR-family-transcriptional-regulator	gnl|CDD|366102	pfam00440, TetR_N, Bacterial regulatory proteins, tetR family.	3.20394e-09
NC_018524.1|WP_014908555.1|5113199_5114366_+|mandelate-racemase	gnl|CDD|239442	cd03326, MR_like_1, Mandelate racemase (MR)-like subfamily of the enolase superfamily, subgroup 1. Enzymes of this subgroup share three conserved carboxylate ligands for the essential divalent metal ion (usually Mg2+), two aspartates and a glutamate, and conserved catalytic residues, a Lys-X-Lys motif and a conserved histidine-aspartate dyad. This subgroup's function is unknown.	0
NC_018524.1|WP_014911998.1|5117360_5118251_+|MerR-family-transcriptional-regulator	gnl|CDD|133378	cd00592, HTH_MerR-like, Helix-Turn-Helix DNA binding domain of MerR-like transcription regulators. Helix-turn-helix (HTH) MerR-like transcription regulator, N-terminal domain. The MerR family transcription regulators have been shown to mediate responses to stress including exposure to heavy metals, drugs, or oxygen radicals in eubacterial and some archaeal species. They regulate transcription of multidrug/metal ion transporter genes and oxidative stress regulons by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.	2.54103e-23
NC_018524.1|WP_014908981.1|5129187_5129850_-|TetR/AcrR-family-transcriptional-regulator	gnl|CDD|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	1.86949e-05
NC_018524.1|WP_014908524.1|5106122_5106857_-|class-I-SAM-dependent-methyltransferase	gnl|CDD|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	1.24857e-16
NC_018524.1|WP_014908795.1|5127612_5128191_+|hypothetical-protein	gnl|CDD|376764	pfam02322, Cyt_bd_oxida_II, Cytochrome bd terminal oxidase subunit II. This family consists of cytochrome bd type terminal oxidases that catalyze quinol-dependent, Na+-independent oxygen uptake. Members of this family are integral membrane proteins and contain a protohaem IX centre B558. One member of the family, Klebsiella pneumoniae CydB, is implicated in having an important role in micro-aerobic nitrogen fixation in the enteric bacterium Klebsiella pneumoniae. The family forms an integral functional unit with subunit I, family Bac_Ubq_Cox, pfam01654.	0.00460681
NC_018524.1|WP_014910079.1|5107152_5108130_-|aldo/keto-reductase	gnl|CDD|381313	cd19087, AKR_AKR12A1_B1_C1, AKR12A, AKR12B, AKR12C families of aldo-keto reductase (AKR). Streptomyces fradiae TylCII, Saccharopolyspora erythraea EryBII, and Streptomyces avermitilis aveBVIII are founding members of aldo-keto reductase family 12 member A1 (AKR12A1), B1 (AKR12B1), and C1(AKR12C1), respectively. TylCII acts as a NDP-hexose 2,3-enoyl reductase. EryBII is a mycarose/desosamine reductase involved in L-mycarose and D-desosamine production. aveBVIII functions as a dTDP-4-keto-6-deoxy-L-hexose-2,3-reductase.	1.46467e-153
NC_018524.1|WP_014911565.1|5108851_5109748_-|helix-turn-helix-domain-containing-protein	gnl|CDD|375319	pfam17765, MLTR_LBD, MmyB-like transcription regulator ligand binding domain. This domain is found in a family of actinobacterial transcription factors. The structure shows it has a PAS domain like fold and it is bound to Myristic acid.	1.00744e-58
NC_018524.1|WP_041562015.1|5104281_5105763_-|MFS-transporter	gnl|CDD|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	4.47699e-57

Protein sequences

>NC_018524.1|WP_014911998.1|5117360_5118251_+|MerR-family-transcriptional-regulator
MHSSFKPPHQVKIGDAAAFAGTTPRAIRHYHEIGLLPEPERGGDDRRRYGHEDMIRLLWIRKMADAGIALDDIRDAFTTGTDSEDGIAGTLERLEETLAEQEAELRRQRTAVRRMRTEGSRMGLLSDFVTDRLKNLPEGSLRQADLDTLLVTERIFGPLGAAVQATRFIALATHPALREDSDRIDDAEEALDDSVPVDDPRVAQLAVERHIFESALQAVIEESGLDEDDDALFDAWDALHPEPTDNDEADISSGRRETGSMSAFEAIGKMPYDTSPAQWRCMDLAIELSAQDSPSS
>NC_018524.1|WP_014908747.1|5114644_5116339_+|SLC13/DASS-family-transporter
MATSYPYTLWESLWASHREIKRLLMFAKREEPTQREPVASGGGSAAHEGPEATGPATEPGDPGPGSGPGPGPGYTPARVTGLVLGPLLFVVTLLFFEPEGLSPEGLAVLATTLWVATWWITEAIPIPVTSLLPIVLLPLTGALDGDAVVSAYGNDIIFLFLGGFTLAIAMEKWNLHQRIALSIVSAIGTSPRRIILGFMVATGFLSMWVSNTAATMMMIPVGLAVVYQAARSLRGGEFADDLPKFEKSIIFGIGYAATIGGLGTLIGTPPLAILSATVGELFDESISFGGWMLFGVPIAAILMASAWLYLTGVKFKVRFKQLPGGREIIRKERKALGGMSAEEKIVLAVFLGTAFMWVTRSFLWEGLLPGISDGLIAIVATVVLFTLPTRSAREKRILQWEDSKKIPWGILLLFGGGLAIAAGFVDTGLSEWIGEQLRVLDGVNIILTIIFATALVLFLTEITSNAATATMILPVIAALAFSLNIHPYALMVPCAMAANCAFMLPVGTPPNAIMFGTGRVTIMEMVRTGFWLNLFALALIVVGTLFLLPLLWGIDLMTIPAGFQ
>NC_018524.1|WP_014908555.1|5113199_5114366_+|mandelate-racemase
MRIVSAHAGTIPISSSMRNAYIDFSKMDCTILALVSDVVVDGRPLVGYGFSSNGRYNATAILNERMLPRLLDAAAEDLLDQEGELSPAKAWDVMMSNEKPGGHGERSVAVGVVDMALHDLAAKAAGVPLYRWLSDHYGDGAPDEDVFVYAAGGYYAPGKTLGDLQDEMRGFLDAGYEVVKMKIGGADLAEDLGRIEAVIDVLDGDGSRLMVDVNGKFDLRTALEYGRALDRYGLFWYEEVGDPLDYALNATLSENYRNPIATGENLFSLQDARNLIRYGGMRPDRDFLQVDPALSYGLTEYRRILDMLALHGWSSRRCIPHGGHQFSLHIAAALKLGGNESYPGEFQPTGGFTDDAVITRGRVAPGDLPGIGLEGKAEFYKILRDLHD
>NC_018524.1|WP_041562280.1|5112379_5113084_-|GntR-family-transcriptional-regulator
MSSANVFSSKGGLAYTELRRRITSGELAPGSRLSQYELAEEMGMSITPLREAVRRLASEDWVMMETHRDVRVAPMSASEARELLEARFSLEPSATELAALRRTEREIATMREAADALLPVTRTWGEEAIVAHRAFHRAIYTASHNNVMIRLLDDLWDKTDRYRRIGLELPAGAEPRTIDQNQHHEILELVVSGDGAAAAALVRSHILNSLGAAVTNALEGREDVAYHPFFGYSV
>NC_018524.1|WP_014912688.1|5109876_5110899_+|zinc-dependent-alcohol-dehydrogenase-family-protein
MRAVVMHAPGDVRVEDVEEPEITEPTDAVIRVTASCVCGSDLWPYRGIEEVNGPTRMGHEYIGVVERVGSEVRDVEVGDFVVGSFVASDNTCEICEAGYQSRCVHQVMMGGIGTQAEYARIPLADGTLVKVPGEPTEKQARGLLAASDVLGTGWFAAVAAEAGPGKTVTVVGDGAVGLLGILAAKRLGAERIIAMSRHADRQALARRFGATDIVEERGEAGVAKVKELTGGYGAHSTIEAVGTQESMTQAIHSTRPGGHVGYVGVAHGVELDGMDLFFATVNLLGGPAPVRRFLPELVDLIMTDQIDPGMVFDLTLPLEEAAEGYRAMDERRATKVLLTL
>NC_018524.1|WP_014911565.1|5108851_5109748_-|helix-turn-helix-domain-containing-protein
MDNRAEVREFLTTRRARVTPEQAGLPAGTNRRVEGLRRSEVATLAGVSVEYYTRLERGRISGASPEVLASLAKALRLDDAERAHLFDLAHAASPVARPRRRRNPKSWTPHPSLQWTLDAITAGPAFVRNGRMDILAANTLARAFYKDTFDTPGRSPNIARFTFLDERALEFYPDWEMFAEVTVAILRTEAGRDPHNKELHDLIGELSTRSDEFRRLWGAHNVRHHGTGFKTFHHPVVGEMTLAYEGLEMEAEPGLTITIYTAEPGSPSAERMSLLASWAAGEYGETAASSQGREESRR
>NC_018524.1|WP_014910079.1|5107152_5108130_-|aldo/keto-reductase
MDYAHLGRSGLLVSKVGLGCMNFGDATGEQEAFTVMDRAVELGVNFFDTADVYGGPQRPDMEKGFGTSEEIIGRWLKKSGRRDDIVLATKAYQPMGLGPNDRRLSAYHLKRACEASLRRLQTDHIDLYQMHHVDRATPFEEIWQAMEQLIAEGKITYVGSSNFAGWDVATAQLKAEARHLLGLVSEQSLYNLTNRAIEQELIPALKHFGVGLIPWSPLAMGMLAGKREGEKTVRRAALGERFTAFADRLNAYEALCSELGHTPAEVAQAWLLHRPIVSTLIAGSRTVGQLEAAVEALNVRLDADALDELDRIWPGPGEAPQSYAW
>NC_018524.1|WP_014908524.1|5106122_5106857_-|class-I-SAM-dependent-methyltransferase
MYSDTEAAALYDILNPWGPSDDFYLSHVMASPSVLDVGCGTGMLLRRARESGHTGRLCGVDPDHASLERARTRDDVTWVEGRAEDMEWEGEFALTVMASNAFQVFVTDDQLRSALAAIRRALVPGGKFVFGTRNPLVRAWEGWTPENATDVIDHRGRALRVSHRVESVNGDVVTLTETTATREGETLRVDRGGLRFLDAEGIDGFLHEAGLEVEVRYGDWSRASFTATSDDIVTVARVRPVTVV
>NC_018524.1|WP_041562015.1|5104281_5105763_-|MFS-transporter
MASSRPASEPRESGDTPDQASSNSSDKVALSAKIALAVVLVAELMNVLDHSIVLNAIPTLQRSLGAEPAHVQWFTAGYGLAVALGLITSGRLGDIYGRRRFFLIGATVFTLASLLCGIAISPEQLVLFRVLQGTGAAIMLPQVLATIHVTFEGEHRSRAFGLYGAILSLGSALGPVLGGVLVQADLLGLGWRPIFLINLPVGLAVIVLGRRFITESIAERAERFDVAGMLLSALAVLLLVLPLTEGPVYDWPAWAFAMLVGAVLVLGVFIAQQRRRQHDSPLVVLSIFRGRAFPGGLCAQLLFGLLSGMFFITWTLYLQRGLDMSPIEAAMAFVLITLGEMAGVAVAVRTAGRFARRLPQAGALLGLGTVVAYALLIGTRQEDLTLWEMAVPVLLFGVAAGMIAGPLADLSLSKIPEENSGSASGLFSTSIHLGMALGTALTALVFFSVTGGSFDGSANREAFIGVLWWVAGAFALIWGLLFFLPSCAKAEAD
>NC_018524.1|WP_041562014.1|5103878_5104187_-|hypothetical-protein
MPSHLSHGASGAIRRFAGWVARGSVGHPMLEGIDYWEELRESPSQMETCFAVFVNVLELDERGEPINEKHAEHRAAVWLYRYCTGRLPPGEPDIEPWECQLY
>NC_018524.1|WP_014908837.1|5119140_5119743_+|hypothetical-protein
MSSSLSPYVVDLDVLHSGIGSKDDKLRRMIGGRFKKHLDFDDQQFDSLIEEGAPNIRDAIRTVIEGGPFNDQHGTMYAYAYKWMCEFHGRFQVNGDFCPMKYDWLEMVDEGLEQLGVTAVDVSSFSHGSVPSPIPSPVDLVPGYGEWSFEQCREALEQWEAATDEAKSAIDSEVLHAIETCMGWCRNATALERGVAAFFF
>NC_018524.1|WP_014910881.1|5120002_5120926_+|APH(6)-I-family-aminoglycoside-O-phosphotransferase
MSSPQGIEVPDALVASYTRNGGEEERAWIARLPALVAELLDRWKLERDGGIRSGEASLVVPVRRTDGTRAALKLQMPREETTAALIGLRAWNGDGIVRLLDHDPESSAMLLERLDGSRTLASVEDDDVAMTTLAGLMARLHSVPAPEGLRGLGDLARDMLASVPDALAALPNPEDRRRLHGWASAVTELVGEPGDRMLHWDLHYDNVLAAEREPWLVIDPEPLIGDPGFDLWPALDTGWERIHSTGNAPRVVRRRFDLLTEALGLDRRRAAGWTLARLLQNTLWDIEDGRTDIDPSQTIVAEALPRH
>NC_018524.1|WP_014912684.1|5121037_5121454_-|hypothetical-protein
MFDLIIRVTGVAVGLGAVLLAHRNQRAETELTARARSGELNRSQAGEALLGSLYRSRIIGLLLTTAIAGLLAAVLIRAAVTGEWGAMTMYYLVLLGLLLAWTGIGHARTATRITQAKAEVSALTRAAERRRMPPDPPG
>NC_018524.1|WP_187294498.1|5123024_5123639_-|TetR/AcrR-family-transcriptional-regulator
MSMEGLLPRITAATLADHQANQRRAVLDAAREILAEVGGDALSLSRVAARVGLARSSLYQYFDSRQGLLDALVEDLFPRWSRMVTGEMNKEESPALRVLAYANANLRLVADGEHVVAGALAAASPGAEFAERSRVMHEQLAAPLTEALEALGVPDPQATAELVNAVVHKASRMIETGTAEAEASARVEEILRPFLLEQENRSSS
>NC_018524.1|WP_014910365.1|5123635_5124343_-|ABC-transporter-ATP-binding-protein
MTITAASNAESTDENTEGLLLEGVTLRLGDGDATVTALDDVSISVRPGELVAVVGPSGAGKSSLLAVAGALTVPDSGVVRAGGRDITGLSRRARARFRRDHIGFVFQSGNLLGALTATDQLRMMTHLGRGGRRHDPQRLLEEVGMADKADRRPHQLSGGERQRVGIARALMGEPTVLLVDEPTAALDRARSHEIVRLLARETRRSDVATMMVTHDHDVLEYCDRTVQMTDGRLSE
>NC_018524.1|WP_014911400.1|5124339_5125470_-|ABC-transporter-permease
MFLAVRELWFARSRFGLMGGVVALIAVLMVLLSGLSSGLVEDGVSGLQRLPVHGLAFDEETEVGSAFSRSRVNEEQLQEWRGRPGVEEAAFFGNLLVNARSDKDVPIDLALFGVEEDSFLAPETAEGEGLGRRDGLVVSQSAIEDGVAIGDVLTVDRLGTELEIVGALEDKHTYGHVDVAYLPLETWQEIYAGVTPEQEADPVVYTEATAVALRAEPDARIDHSTGDDEAGTMSLPLEETFAASPGYSAETSTLNLIKAFLYAISALVVGAFFTVWTIQRKHELAVLRAMGASTGYLVRDGLGQALVILAVFCGIGLGVGVGAGSLITGSGVPFLLEGTSVALAVVLLIVLGLLGAMAAIVRVSSIDPLAALGGQR
>NC_018524.1|WP_051018394.1|5126091_5126901_+|hypothetical-protein
MWEHTTTAGSPGLTRPTDVPRPESVDEVSIWAGSEDLRRTVLVHAPVFWVLLPIIAIMFLLHQTITDPTGTGWNITINGEYHDSWPAWVPWLAWIGVGAWLLIAIGVLLLRLIVLRDLGAENERIFEHGVAHSIHRACVDYDDGEASWATYIALDHRLDDRRTARIHAAFEQWLRLSGAPPSASKPISSMTLFGAQAQGGYFFLHLPVSQAAGATTEHEWMLITEPEDGSDEVVVTPVPVRKRLRRIRKRLRRKAARRTSSSSRSSPVR
>NC_018524.1|WP_014912282.1|5126971_5127616_+|hypothetical-protein
MTEKDREESLIERAAEKLLVGTGPKAPFLIRHDRAIPVIVFGACGAFAVLVMISIIQGWAQVLMWIVIGIGIVSVLLTIPGFVGMYRATRGPLPALDRTPRTARVTLNAEDADGGQTILVEYRDEEGKGHDAQLADLIHESWEDRFAPGTRWQVYTFRSPELADSVVFLTEAHDEVWRDGWKLDGVRIGGEGGPLKPGPGSSFLREDSKWRFES
>NC_018524.1|WP_014908795.1|5127612_5128191_+|hypothetical-protein
MNRETEKWTRLARTPKTRDRIRRWVRRERIATGVMIASLIAVCAWPVAAVAHLVWTLVRGEDQPYAPWGWTFLGLLVFVALAALVGGAVRSKREEAVYAGGRVTLGRVVEVITHPSDVHGDTTYSLMVSAESPGSVTMRREIRMEHEWRAPEKWEGGTVRFRHNTLDPDELQDVLFIEFLDQTVQRREEGRP
>NC_018524.1|WP_014908981.1|5129187_5129850_-|TetR/AcrR-family-transcriptional-regulator
MPATPETAPNRTTRRKARTRAALVRAAQGFIAEGRPHAPILEITQAADVGMGSFYNHFESREELMRVASEKAFEAHGRLLDELTLGIDDPAEVFAQNFRLTGRIHRREPELSRVLLDYGLQLIDIEIGLAPRALRAIKAGADAGRFTVADPELSLTIVAGATLVLGNLLHEHPERDDAEATDQVAEDLLRMLGMAPEEARELAHRPLPELTTVAWQEADL

Crispr_ID: NC_018524_34

• CRISPR_ID: NC_018524_34
• CRISPR_location: 5116445-5117146
• CRISPR_type: Orphan
• Repeat_type: A:N
• Spacer_info: 11 spacers

Consensus repeat of NC_018524_34

Consensus_repeat	Method
GGGGTCATCCCCGCGTGCGCGGGGAGCAG	CRISPRCasFinder
GGGGTCATCCCCGCGTGCGCGGGGAGCAG	CRT
GGGGTCATCCCCGCGTGCGCGGGGAGCAG	PILER-CR

spacers of NC_018524_34

>34.1|5116474|32|NC_018524|CRISPRCasFinder,CRT
AACCGGGAGGCGGTCAGATCGATGTAGGCCTC
>34.2|5116535|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR
ACGATCGACACCCGTACCGGCTGGCTGCTGAT
>34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR
AACAGGAAGGAGTCCTGATCGACCGACCCCGA
>34.4|5116657|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR
CCGGGCGACGCCGAGGCGGTGTGGAACATCCG
>34.5|5116718|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR
CTTGCCTTCGAGGGCTTCCTCGATCTCCCGGT
>34.6|5116779|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR
GGAGGCGCTGCTGGAGGCCCCGGCAGTCTGGG
>34.7|5116840|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR
AACCGTGGCCAGCGCCAGACGGTACACCCAAA
>34.8|5116901|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR
GAGCTCGTGCAGATAGATAGCCCCGCCGGCCT
>34.9|5116962|33|NC_018524|CRISPRCasFinder,CRT,PILER-CR
CTTCGAGGGCTCGGGGGAAGGGTCCTGGGGCGG
>34.10|5117024|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR
GGTGGCGCAGGCGGCCACTCCGGGCCAGTGGC
>34.11|5117085|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR
TTTTTCGCCGGCTTGATCTCATCCTCGAAGTA

CRISPR arrays and Neighbor proteins around NC_018524_34

CRISPR arrays

The CRISPR arrays of NC_018524_34

>merge|NC_018524|34|5116445-5117146|CRISPRCasFinder,CRT,PILER-CR
GGGCCCATCCCCGTGCGGGCGGGGAGCAGAACCGGGAGGCGGTCAGATCGATGTAGGCCTCGGGGTCATCCCCGCGTGCGCGGGGAGCAGACGATCGACACCCGTACCGGCTGGCTGCTGATGGGGTCATCCCCGCGTGCGCGGGGAGCAGAACAGGAAGGAGTCCTGATCGACCGACCCCGAGGGGTCATCCCCGCGTGCGCGGGGAGCAGCCGGGCGACGCCGAGGCGGTGTGGAACATCCGGGGGTCATCCCCGCGTGCGCGGGGAGCAGCTTGCCTTCGAGGGCTTCCTCGATCTCCCGGTGGGGTCATCCCCGCGTGCGCGGGGAGCAGGGAGGCGCTGCTGGAGGCCCCGGCAGTCTGGGAGGGTCATCCCCGCGTGCGCGGGGAGCAGAACCGTGGCCAGCGCCAGACGGTACACCCAAAGGGGTCATCCCCGCGTGCGCGGGGAGCAGGAGCTCGTGCAGATAGATAGCCCCGCCGGCCTGGGGTCATCCCCGCGTGCGCGGGGAGCAGCTTCGAGGGCTCGGGGGAAGGGTCCTGGGGCGGGGGGTCATCCCCGCGTGCGCGGGGAGCAGGGTGGCGCAGGCGGCCACTCCGGGCCAGTGGCGGGGTCATCCCCGCGTGCGCGGGGAGCAGTTTTTCGCCGGCTTGATCTCATCCTCGAAGTAGGGGTCATCCCCGCGTGCGCGGGGAGCAGC

>NC_018524|34|33|5116445-5117146|CRISPRCasFinder
GGGCCCATCCCCGTGCGGGCGGGGAGCAG	AACCGGGAGGCGGTCAGATCGATGTAGGCCTC
GGGGTCATCCCCGCGTGCGCGGGGAGCAG	ACGATCGACACCCGTACCGGCTGGCTGCTGAT
GGGGTCATCCCCGCGTGCGCGGGGAGCAG	AACAGGAAGGAGTCCTGATCGACCGACCCCGA
GGGGTCATCCCCGCGTGCGCGGGGAGCAG	CCGGGCGACGCCGAGGCGGTGTGGAACATCCG
GGGGTCATCCCCGCGTGCGCGGGGAGCAG	CTTGCCTTCGAGGGCTTCCTCGATCTCCCGGT
GGGGTCATCCCCGCGTGCGCGGGGAGCAG	GGAGGCGCTGCTGGAGGCCCCGGCAGTCTGGG
AGGGTCATCCCCGCGTGCGCGGGGAGCAG	AACCGTGGCCAGCGCCAGACGGTACACCCAAA
GGGGTCATCCCCGCGTGCGCGGGGAGCAG	GAGCTCGTGCAGATAGATAGCCCCGCCGGCCT
GGGGTCATCCCCGCGTGCGCGGGGAGCAG	CTTCGAGGGCTCGGGGGAAGGGTCCTGGGGCGG
GGGGTCATCCCCGCGTGCGCGGGGAGCAG	GGTGGCGCAGGCGGCCACTCCGGGCCAGTGGC
GGGGTCATCCCCGCGTGCGCGGGGAGCAG	TTTTTCGCCGGCTTGATCTCATCCTCGAAGTA
GGGGTCATCCCCGCGTGCGCGGGGAGCAGC

>NC_018524|34|21|5116445-5117145|CRT
GGGCCCATCCCCGTGCGGGCGGGGAGCAG	AACCGGGAGGCGGTCAGATCGATGTAGGCCTC
GGGGTCATCCCCGCGTGCGCGGGGAGCAG	ACGATCGACACCCGTACCGGCTGGCTGCTGAT
GGGGTCATCCCCGCGTGCGCGGGGAGCAG	AACAGGAAGGAGTCCTGATCGACCGACCCCGA
GGGGTCATCCCCGCGTGCGCGGGGAGCAG	CCGGGCGACGCCGAGGCGGTGTGGAACATCCG
GGGGTCATCCCCGCGTGCGCGGGGAGCAG	CTTGCCTTCGAGGGCTTCCTCGATCTCCCGGT
GGGGTCATCCCCGCGTGCGCGGGGAGCAG	GGAGGCGCTGCTGGAGGCCCCGGCAGTCTGGG
AGGGTCATCCCCGCGTGCGCGGGGAGCAG	AACCGTGGCCAGCGCCAGACGGTACACCCAAA
GGGGTCATCCCCGCGTGCGCGGGGAGCAG	GAGCTCGTGCAGATAGATAGCCCCGCCGGCCT
GGGGTCATCCCCGCGTGCGCGGGGAGCAG	CTTCGAGGGCTCGGGGGAAGGGTCCTGGGGCGG
GGGGTCATCCCCGCGTGCGCGGGGAGCAG	GGTGGCGCAGGCGGCCACTCCGGGCCAGTGGC
GGGGTCATCCCCGCGTGCGCGGGGAGCAG	TTTTTCGCCGGCTTGATCTCATCCTCGAAGTA
GGGGTCATCCCCGCGTGCGCGGGGAGCAG

>NC_018524|34|20|5116506-5117145|PILER-CR
GGGGTCATCCCCGCGTGCGCGGGGAGCAG	ACGATCGACACCCGTACCGGCTGGCTGCTGAT
GGGGTCATCCCCGCGTGCGCGGGGAGCAG	AACAGGAAGGAGTCCTGATCGACCGACCCCGA
GGGGTCATCCCCGCGTGCGCGGGGAGCAG	CCGGGCGACGCCGAGGCGGTGTGGAACATCCG
GGGGTCATCCCCGCGTGCGCGGGGAGCAG	CTTGCCTTCGAGGGCTTCCTCGATCTCCCGGT
GGGGTCATCCCCGCGTGCGCGGGGAGCAG	GGAGGCGCTGCTGGAGGCCCCGGCAGTCTGGG
AGGGTCATCCCCGCGTGCGCGGGGAGCAG	AACCGTGGCCAGCGCCAGACGGTACACCCAAA
GGGGTCATCCCCGCGTGCGCGGGGAGCAG	GAGCTCGTGCAGATAGATAGCCCCGCCGGCCT
GGGGTCATCCCCGCGTGCGCGGGGAGCAG	CTTCGAGGGCTCGGGGGAAGGGTCCTGGGGCGG
GGGGTCATCCCCGCGTGCGCGGGGAGCAG	GGTGGCGCAGGCGGCCACTCCGGGCCAGTGGC
GGGGTCATCCCCGCGTGCGCGGGGAGCAG	TTTTTCGCCGGCTTGATCTCATCCTCGAAGTA
GGGGTCATCCCCGCGTGCGCGGGGAGCAG

Neighbor Proteins Overview

Protein	Signature genes	Signature genes Name	Protein_function
NC_018524.1|WP_041562280.1|5112379_5113084_-|GntR-family-transcriptional-regulator	unknown	unknown	gnl|CDD|224715
NC_018524.1|WP_014908555.1|5113199_5114366_+|mandelate-racemase	unknown	unknown	gnl|CDD|239442
NC_018524.1|WP_014910365.1|5123635_5124343_-|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl|CDD|213222
NC_018524.1|WP_014911400.1|5124339_5125470_-|ABC-transporter-permease	unknown	unknown	gnl|CDD|223650
NC_018524.1|WP_014911565.1|5108851_5109748_-|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl|CDD|375319
NC_018524.1|WP_014912688.1|5109876_5110899_+|zinc-dependent-alcohol-dehydrogenase-family-protein	unknown	unknown	gnl|CDD|176247
NC_018524.1|WP_041562014.1|5103878_5104187_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_051018394.1|5126091_5126901_+|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014910881.1|5120002_5120926_+|APH(6)-I-family-aminoglycoside-O-phosphotransferase	unknown	unknown	gnl|CDD|309685
NC_018524.1|WP_014911998.1|5117360_5118251_+|MerR-family-transcriptional-regulator	unknown	unknown	gnl|CDD|133378
NC_018524.1|WP_014912684.1|5121037_5121454_-|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_187294498.1|5123024_5123639_-|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl|CDD|366102
NC_018524.1|WP_014908524.1|5106122_5106857_-|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl|CDD|379312
NC_018524.1|WP_014908795.1|5127612_5128191_+|hypothetical-protein	unknown	unknown	gnl|CDD|376764
NC_018524.1|WP_014908837.1|5119140_5119743_+|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014912282.1|5126971_5127616_+|hypothetical-protein	unknown	unknown	unknown
NC_018524.1|WP_014910079.1|5107152_5108130_-|aldo/keto-reductase	unknown	unknown	gnl|CDD|381313
NC_018524.1|WP_014908747.1|5114644_5116339_+|SLC13/DASS-family-transporter	unknown	unknown	gnl|CDD|238535
NC_018524.1|WP_081536549.1|5103085_5103853_-|transposase	unknown	unknown	gnl|CDD|372577
NC_018524.1|WP_041562015.1|5104281_5105763_-|MFS-transporter	unknown	unknown	gnl|CDD|129794

rpsblast for functional proteins

Protein	Function_ID	Function_description	E-value
NC_018524.1|WP_041562280.1|5112379_5113084_-|GntR-family-transcriptional-regulator	gnl|CDD|224715	COG1802, GntR, Transcriptional regulators [Transcription].	6.59191e-47
NC_018524.1|WP_014910881.1|5120002_5120926_+|APH(6)-I-family-aminoglycoside-O-phosphotransferase	gnl|CDD|309685	pfam04655, APH_6_hur, Aminoglycoside/hydroxyurea antibiotic resistance kinase. The aminoglycoside phosphotransferases achieve inactivation of their antibiotic substrates by phosphorylation utilising ATP. Likewise hydroxyurea is inactivated by phosphorylation of the hydroxy group in the hydroxylamine moiety.	4.67521e-77
NC_018524.1|WP_014910365.1|5123635_5124343_-|ABC-transporter-ATP-binding-protein	gnl|CDD|213222	cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein. This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of lipoproteins from the cytoplasmic membrane (LolCDE). They are clustered together phylogenetically. MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all. An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport. The LolCDE complex catalyzes the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane.	7.37583e-86
NC_018524.1|WP_014911400.1|5124339_5125470_-|ABC-transporter-permease	gnl|CDD|223650	COG0577, SalY, ABC-type antimicrobial peptide transport system, permease component [Defense mechanisms].	3.64963e-11
NC_018524.1|WP_014911565.1|5108851_5109748_-|helix-turn-helix-domain-containing-protein	gnl|CDD|375319	pfam17765, MLTR_LBD, MmyB-like transcription regulator ligand binding domain. This domain is found in a family of actinobacterial transcription factors. The structure shows it has a PAS domain like fold and it is bound to Myristic acid.	1.00744e-58
NC_018524.1|WP_014912688.1|5109876_5110899_+|zinc-dependent-alcohol-dehydrogenase-family-protein	gnl|CDD|176247	cd08287, FDH_like_ADH3, formaldehyde dehydrogenase (FDH)-like. This group contains proteins identified as alcohol dehydrogenases and glutathione-dependant formaldehyde dehydrogenases (FDH) of the zinc-dependent/medium chain alcohol dehydrogenase family. The MDR family uses NAD(H) as a cofactor in the interconversion of alcohols and aldehydes, or ketones. FDH converts formaldehyde and NAD to formate and NADH. The initial step in this process the spontaneous formation of a S-(hydroxymethyl)glutathione adduct from formaldehyde and glutathione, followed by FDH-mediated oxidation (and detoxification) of the adduct to S-formylglutathione. The medium chain alcohol dehydrogenase family (MDR) has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit.	0
NC_018524.1|WP_014908555.1|5113199_5114366_+|mandelate-racemase	gnl|CDD|239442	cd03326, MR_like_1, Mandelate racemase (MR)-like subfamily of the enolase superfamily, subgroup 1. Enzymes of this subgroup share three conserved carboxylate ligands for the essential divalent metal ion (usually Mg2+), two aspartates and a glutamate, and conserved catalytic residues, a Lys-X-Lys motif and a conserved histidine-aspartate dyad. This subgroup's function is unknown.	0
NC_018524.1|WP_014911998.1|5117360_5118251_+|MerR-family-transcriptional-regulator	gnl|CDD|133378	cd00592, HTH_MerR-like, Helix-Turn-Helix DNA binding domain of MerR-like transcription regulators. Helix-turn-helix (HTH) MerR-like transcription regulator, N-terminal domain. The MerR family transcription regulators have been shown to mediate responses to stress including exposure to heavy metals, drugs, or oxygen radicals in eubacterial and some archaeal species. They regulate transcription of multidrug/metal ion transporter genes and oxidative stress regulons by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.	2.54103e-23
NC_018524.1|WP_187294498.1|5123024_5123639_-|TetR/AcrR-family-transcriptional-regulator	gnl|CDD|366102	pfam00440, TetR_N, Bacterial regulatory proteins, tetR family.	3.20394e-09
NC_018524.1|WP_014908524.1|5106122_5106857_-|class-I-SAM-dependent-methyltransferase	gnl|CDD|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	1.24857e-16
NC_018524.1|WP_014908795.1|5127612_5128191_+|hypothetical-protein	gnl|CDD|376764	pfam02322, Cyt_bd_oxida_II, Cytochrome bd terminal oxidase subunit II. This family consists of cytochrome bd type terminal oxidases that catalyze quinol-dependent, Na+-independent oxygen uptake. Members of this family are integral membrane proteins and contain a protohaem IX centre B558. One member of the family, Klebsiella pneumoniae CydB, is implicated in having an important role in micro-aerobic nitrogen fixation in the enteric bacterium Klebsiella pneumoniae. The family forms an integral functional unit with subunit I, family Bac_Ubq_Cox, pfam01654.	0.00460681
NC_018524.1|WP_014910079.1|5107152_5108130_-|aldo/keto-reductase	gnl|CDD|381313	cd19087, AKR_AKR12A1_B1_C1, AKR12A, AKR12B, AKR12C families of aldo-keto reductase (AKR). Streptomyces fradiae TylCII, Saccharopolyspora erythraea EryBII, and Streptomyces avermitilis aveBVIII are founding members of aldo-keto reductase family 12 member A1 (AKR12A1), B1 (AKR12B1), and C1(AKR12C1), respectively. TylCII acts as a NDP-hexose 2,3-enoyl reductase. EryBII is a mycarose/desosamine reductase involved in L-mycarose and D-desosamine production. aveBVIII functions as a dTDP-4-keto-6-deoxy-L-hexose-2,3-reductase.	1.46467e-153
NC_018524.1|WP_014908747.1|5114644_5116339_+|SLC13/DASS-family-transporter	gnl|CDD|238535	cd01115, SLC13_permease, Permease SLC13 (solute carrier 13). The sodium/dicarboxylate cotransporter NaDC-1 has been shown to translocate Krebs cycle intermediates such as succinate, citrate, and alpha-ketoglutarate across plasma membranes rabbit, human, and rat kidney. It is related to renal and intestinal Na+/sulfate cotransporters and a few putative bacterial permeases. The SLC13-type proteins belong to the ArsB/NhaD superfamily of permeases that translocate sodium and various anions across biological membranes in all three kingdoms of life. A typical ArsB/NhaD permease is composed of 8-13 transmembrane helices.	6.40425e-79
NC_018524.1|WP_081536549.1|5103085_5103853_-|transposase	gnl|CDD|372577	pfam13359, DDE_Tnp_4, DDE superfamily endonuclease. This family of proteins are related to pfam00665 and are probably endonucleases of the DDE superfamily. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	1.06433e-15
NC_018524.1|WP_041562015.1|5104281_5105763_-|MFS-transporter	gnl|CDD|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	4.47699e-57

Protein sequences

>NC_018524.1|WP_014908747.1|5114644_5116339_+|SLC13/DASS-family-transporter
MATSYPYTLWESLWASHREIKRLLMFAKREEPTQREPVASGGGSAAHEGPEATGPATEPGDPGPGSGPGPGPGYTPARVTGLVLGPLLFVVTLLFFEPEGLSPEGLAVLATTLWVATWWITEAIPIPVTSLLPIVLLPLTGALDGDAVVSAYGNDIIFLFLGGFTLAIAMEKWNLHQRIALSIVSAIGTSPRRIILGFMVATGFLSMWVSNTAATMMMIPVGLAVVYQAARSLRGGEFADDLPKFEKSIIFGIGYAATIGGLGTLIGTPPLAILSATVGELFDESISFGGWMLFGVPIAAILMASAWLYLTGVKFKVRFKQLPGGREIIRKERKALGGMSAEEKIVLAVFLGTAFMWVTRSFLWEGLLPGISDGLIAIVATVVLFTLPTRSAREKRILQWEDSKKIPWGILLLFGGGLAIAAGFVDTGLSEWIGEQLRVLDGVNIILTIIFATALVLFLTEITSNAATATMILPVIAALAFSLNIHPYALMVPCAMAANCAFMLPVGTPPNAIMFGTGRVTIMEMVRTGFWLNLFALALIVVGTLFLLPLLWGIDLMTIPAGFQ
>NC_018524.1|WP_014908555.1|5113199_5114366_+|mandelate-racemase
MRIVSAHAGTIPISSSMRNAYIDFSKMDCTILALVSDVVVDGRPLVGYGFSSNGRYNATAILNERMLPRLLDAAAEDLLDQEGELSPAKAWDVMMSNEKPGGHGERSVAVGVVDMALHDLAAKAAGVPLYRWLSDHYGDGAPDEDVFVYAAGGYYAPGKTLGDLQDEMRGFLDAGYEVVKMKIGGADLAEDLGRIEAVIDVLDGDGSRLMVDVNGKFDLRTALEYGRALDRYGLFWYEEVGDPLDYALNATLSENYRNPIATGENLFSLQDARNLIRYGGMRPDRDFLQVDPALSYGLTEYRRILDMLALHGWSSRRCIPHGGHQFSLHIAAALKLGGNESYPGEFQPTGGFTDDAVITRGRVAPGDLPGIGLEGKAEFYKILRDLHD
>NC_018524.1|WP_041562280.1|5112379_5113084_-|GntR-family-transcriptional-regulator
MSSANVFSSKGGLAYTELRRRITSGELAPGSRLSQYELAEEMGMSITPLREAVRRLASEDWVMMETHRDVRVAPMSASEARELLEARFSLEPSATELAALRRTEREIATMREAADALLPVTRTWGEEAIVAHRAFHRAIYTASHNNVMIRLLDDLWDKTDRYRRIGLELPAGAEPRTIDQNQHHEILELVVSGDGAAAAALVRSHILNSLGAAVTNALEGREDVAYHPFFGYSV
>NC_018524.1|WP_014912688.1|5109876_5110899_+|zinc-dependent-alcohol-dehydrogenase-family-protein
MRAVVMHAPGDVRVEDVEEPEITEPTDAVIRVTASCVCGSDLWPYRGIEEVNGPTRMGHEYIGVVERVGSEVRDVEVGDFVVGSFVASDNTCEICEAGYQSRCVHQVMMGGIGTQAEYARIPLADGTLVKVPGEPTEKQARGLLAASDVLGTGWFAAVAAEAGPGKTVTVVGDGAVGLLGILAAKRLGAERIIAMSRHADRQALARRFGATDIVEERGEAGVAKVKELTGGYGAHSTIEAVGTQESMTQAIHSTRPGGHVGYVGVAHGVELDGMDLFFATVNLLGGPAPVRRFLPELVDLIMTDQIDPGMVFDLTLPLEEAAEGYRAMDERRATKVLLTL
>NC_018524.1|WP_014911565.1|5108851_5109748_-|helix-turn-helix-domain-containing-protein
MDNRAEVREFLTTRRARVTPEQAGLPAGTNRRVEGLRRSEVATLAGVSVEYYTRLERGRISGASPEVLASLAKALRLDDAERAHLFDLAHAASPVARPRRRRNPKSWTPHPSLQWTLDAITAGPAFVRNGRMDILAANTLARAFYKDTFDTPGRSPNIARFTFLDERALEFYPDWEMFAEVTVAILRTEAGRDPHNKELHDLIGELSTRSDEFRRLWGAHNVRHHGTGFKTFHHPVVGEMTLAYEGLEMEAEPGLTITIYTAEPGSPSAERMSLLASWAAGEYGETAASSQGREESRR
>NC_018524.1|WP_014910079.1|5107152_5108130_-|aldo/keto-reductase
MDYAHLGRSGLLVSKVGLGCMNFGDATGEQEAFTVMDRAVELGVNFFDTADVYGGPQRPDMEKGFGTSEEIIGRWLKKSGRRDDIVLATKAYQPMGLGPNDRRLSAYHLKRACEASLRRLQTDHIDLYQMHHVDRATPFEEIWQAMEQLIAEGKITYVGSSNFAGWDVATAQLKAEARHLLGLVSEQSLYNLTNRAIEQELIPALKHFGVGLIPWSPLAMGMLAGKREGEKTVRRAALGERFTAFADRLNAYEALCSELGHTPAEVAQAWLLHRPIVSTLIAGSRTVGQLEAAVEALNVRLDADALDELDRIWPGPGEAPQSYAW
>NC_018524.1|WP_014908524.1|5106122_5106857_-|class-I-SAM-dependent-methyltransferase
MYSDTEAAALYDILNPWGPSDDFYLSHVMASPSVLDVGCGTGMLLRRARESGHTGRLCGVDPDHASLERARTRDDVTWVEGRAEDMEWEGEFALTVMASNAFQVFVTDDQLRSALAAIRRALVPGGKFVFGTRNPLVRAWEGWTPENATDVIDHRGRALRVSHRVESVNGDVVTLTETTATREGETLRVDRGGLRFLDAEGIDGFLHEAGLEVEVRYGDWSRASFTATSDDIVTVARVRPVTVV
>NC_018524.1|WP_041562015.1|5104281_5105763_-|MFS-transporter
MASSRPASEPRESGDTPDQASSNSSDKVALSAKIALAVVLVAELMNVLDHSIVLNAIPTLQRSLGAEPAHVQWFTAGYGLAVALGLITSGRLGDIYGRRRFFLIGATVFTLASLLCGIAISPEQLVLFRVLQGTGAAIMLPQVLATIHVTFEGEHRSRAFGLYGAILSLGSALGPVLGGVLVQADLLGLGWRPIFLINLPVGLAVIVLGRRFITESIAERAERFDVAGMLLSALAVLLLVLPLTEGPVYDWPAWAFAMLVGAVLVLGVFIAQQRRRQHDSPLVVLSIFRGRAFPGGLCAQLLFGLLSGMFFITWTLYLQRGLDMSPIEAAMAFVLITLGEMAGVAVAVRTAGRFARRLPQAGALLGLGTVVAYALLIGTRQEDLTLWEMAVPVLLFGVAAGMIAGPLADLSLSKIPEENSGSASGLFSTSIHLGMALGTALTALVFFSVTGGSFDGSANREAFIGVLWWVAGAFALIWGLLFFLPSCAKAEAD
>NC_018524.1|WP_041562014.1|5103878_5104187_-|hypothetical-protein
MPSHLSHGASGAIRRFAGWVARGSVGHPMLEGIDYWEELRESPSQMETCFAVFVNVLELDERGEPINEKHAEHRAAVWLYRYCTGRLPPGEPDIEPWECQLY
>NC_018524.1|WP_081536549.1|5103085_5103853_-|transposase
MAGVSTASEPSWIVPFTGLSPRSFGKPPTVLRRQGADEVRKGRPWSLPLEDWALLVAAYWRTNLTMRQLAPLFGVSKSAADRIIDHLGPMLALQLRKRFARDTVLIVDGTLVPTRDHAIAAQSKNYRYSTNHQVVIDADTRLVVVVGRPLAGNRNDCKAWKESGAKAAVGKTLTIADGGYPGSGLLMPHRRLKGEELPDWKQAQNKSHKQVRARVEHVFARVKTWKILRDCRLKGDGVHHAMLGIARLHNLALAG
>NC_018524.1|WP_014911998.1|5117360_5118251_+|MerR-family-transcriptional-regulator
MHSSFKPPHQVKIGDAAAFAGTTPRAIRHYHEIGLLPEPERGGDDRRRYGHEDMIRLLWIRKMADAGIALDDIRDAFTTGTDSEDGIAGTLERLEETLAEQEAELRRQRTAVRRMRTEGSRMGLLSDFVTDRLKNLPEGSLRQADLDTLLVTERIFGPLGAAVQATRFIALATHPALREDSDRIDDAEEALDDSVPVDDPRVAQLAVERHIFESALQAVIEESGLDEDDDALFDAWDALHPEPTDNDEADISSGRRETGSMSAFEAIGKMPYDTSPAQWRCMDLAIELSAQDSPSS
>NC_018524.1|WP_014908837.1|5119140_5119743_+|hypothetical-protein
MSSSLSPYVVDLDVLHSGIGSKDDKLRRMIGGRFKKHLDFDDQQFDSLIEEGAPNIRDAIRTVIEGGPFNDQHGTMYAYAYKWMCEFHGRFQVNGDFCPMKYDWLEMVDEGLEQLGVTAVDVSSFSHGSVPSPIPSPVDLVPGYGEWSFEQCREALEQWEAATDEAKSAIDSEVLHAIETCMGWCRNATALERGVAAFFF
>NC_018524.1|WP_014910881.1|5120002_5120926_+|APH(6)-I-family-aminoglycoside-O-phosphotransferase
MSSPQGIEVPDALVASYTRNGGEEERAWIARLPALVAELLDRWKLERDGGIRSGEASLVVPVRRTDGTRAALKLQMPREETTAALIGLRAWNGDGIVRLLDHDPESSAMLLERLDGSRTLASVEDDDVAMTTLAGLMARLHSVPAPEGLRGLGDLARDMLASVPDALAALPNPEDRRRLHGWASAVTELVGEPGDRMLHWDLHYDNVLAAEREPWLVIDPEPLIGDPGFDLWPALDTGWERIHSTGNAPRVVRRRFDLLTEALGLDRRRAAGWTLARLLQNTLWDIEDGRTDIDPSQTIVAEALPRH
>NC_018524.1|WP_014912684.1|5121037_5121454_-|hypothetical-protein
MFDLIIRVTGVAVGLGAVLLAHRNQRAETELTARARSGELNRSQAGEALLGSLYRSRIIGLLLTTAIAGLLAAVLIRAAVTGEWGAMTMYYLVLLGLLLAWTGIGHARTATRITQAKAEVSALTRAAERRRMPPDPPG
>NC_018524.1|WP_187294498.1|5123024_5123639_-|TetR/AcrR-family-transcriptional-regulator
MSMEGLLPRITAATLADHQANQRRAVLDAAREILAEVGGDALSLSRVAARVGLARSSLYQYFDSRQGLLDALVEDLFPRWSRMVTGEMNKEESPALRVLAYANANLRLVADGEHVVAGALAAASPGAEFAERSRVMHEQLAAPLTEALEALGVPDPQATAELVNAVVHKASRMIETGTAEAEASARVEEILRPFLLEQENRSSS
>NC_018524.1|WP_014910365.1|5123635_5124343_-|ABC-transporter-ATP-binding-protein
MTITAASNAESTDENTEGLLLEGVTLRLGDGDATVTALDDVSISVRPGELVAVVGPSGAGKSSLLAVAGALTVPDSGVVRAGGRDITGLSRRARARFRRDHIGFVFQSGNLLGALTATDQLRMMTHLGRGGRRHDPQRLLEEVGMADKADRRPHQLSGGERQRVGIARALMGEPTVLLVDEPTAALDRARSHEIVRLLARETRRSDVATMMVTHDHDVLEYCDRTVQMTDGRLSE
>NC_018524.1|WP_014911400.1|5124339_5125470_-|ABC-transporter-permease
MFLAVRELWFARSRFGLMGGVVALIAVLMVLLSGLSSGLVEDGVSGLQRLPVHGLAFDEETEVGSAFSRSRVNEEQLQEWRGRPGVEEAAFFGNLLVNARSDKDVPIDLALFGVEEDSFLAPETAEGEGLGRRDGLVVSQSAIEDGVAIGDVLTVDRLGTELEIVGALEDKHTYGHVDVAYLPLETWQEIYAGVTPEQEADPVVYTEATAVALRAEPDARIDHSTGDDEAGTMSLPLEETFAASPGYSAETSTLNLIKAFLYAISALVVGAFFTVWTIQRKHELAVLRAMGASTGYLVRDGLGQALVILAVFCGIGLGVGVGAGSLITGSGVPFLLEGTSVALAVVLLIVLGLLGAMAAIVRVSSIDPLAALGGQR
>NC_018524.1|WP_051018394.1|5126091_5126901_+|hypothetical-protein
MWEHTTTAGSPGLTRPTDVPRPESVDEVSIWAGSEDLRRTVLVHAPVFWVLLPIIAIMFLLHQTITDPTGTGWNITINGEYHDSWPAWVPWLAWIGVGAWLLIAIGVLLLRLIVLRDLGAENERIFEHGVAHSIHRACVDYDDGEASWATYIALDHRLDDRRTARIHAAFEQWLRLSGAPPSASKPISSMTLFGAQAQGGYFFLHLPVSQAAGATTEHEWMLITEPEDGSDEVVVTPVPVRKRLRRIRKRLRRKAARRTSSSSRSSPVR
>NC_018524.1|WP_014912282.1|5126971_5127616_+|hypothetical-protein
MTEKDREESLIERAAEKLLVGTGPKAPFLIRHDRAIPVIVFGACGAFAVLVMISIIQGWAQVLMWIVIGIGIVSVLLTIPGFVGMYRATRGPLPALDRTPRTARVTLNAEDADGGQTILVEYRDEEGKGHDAQLADLIHESWEDRFAPGTRWQVYTFRSPELADSVVFLTEAHDEVWRDGWKLDGVRIGGEGGPLKPGPGSSFLREDSKWRFES
>NC_018524.1|WP_014908795.1|5127612_5128191_+|hypothetical-protein
MNRETEKWTRLARTPKTRDRIRRWVRRERIATGVMIASLIAVCAWPVAAVAHLVWTLVRGEDQPYAPWGWTFLGLLVFVALAALVGGAVRSKREEAVYAGGRVTLGRVVEVITHPSDVHGDTTYSLMVSAESPGSVTMRREIRMEHEWRAPEKWEGGTVRFRHNTLDPDELQDVLFIEFLDQTVQRREEGRP

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NC_018524_17	17.1|2357515|22|NC_018524|CRISPRCasFinder	2357515-2357536	22	NC_018524.1	1277546-1277567	2	0.909

1. spacer 17.1|2357515|22|NC_018524|CRISPRCasFinder matches to position: 1277546-1277567, mismatch: 2, identity: 0.909

cgggccccctccggcccaggcc	CRISPR spacer
cgagccccctccggccccggcc	Protospacer
**.************** ****

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_018524_18	18.1|2357863|22|NC_018524|CRISPRCasFinder	2357863-2357884	22	NZ_CP013104	Paraburkholderia caribensis strain MWAP64 plasmid 1, complete sequence	1294500-1294521	2	0.909
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	NZ_CP023408	Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence	549069-549093	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MH590593	Mycobacterium phage Rabinovish, complete genome	117601-117625	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	KX781992	Mycobacterium phage Gabriel, complete genome	115630-115654	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MH697579	Mycobacterium phage Cane17, complete genome	120091-120115	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MK112554	Mycobacterium phage TinyTim, complete genome	116084-116108	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MK359314	Mycobacterium phage Ewok, complete genome	117028-117052	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MK359337	Mycobacterium phage Flabslab, complete genome	115073-115097	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MN234193	Mycobacterium phage Kboogie, complete genome	116451-116475	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MK450432	Mycobacterium phage ValleyTerrace, complete genome	115997-116021	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MH051261	Mycobacterium phage Tyke, complete genome	117913-117937	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MH779502	Mycobacterium phage FudgeTart, complete genome	116175-116199	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MK359365	Mycobacterium phage Loanshark, complete genome	116559-116583	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MK359311	Mycobacterium phage SmallFry, complete genome	115801-115825	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MK359364	Mycobacterium phage ChickenPhender, complete genome	115656-115680	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MK359303	Mycobacterium phage Shnickers, complete genome	115707-115731	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MH697586	Mycobacterium phage InigoMontoya, complete genome	116661-116685	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MK112549	Mycobacterium phage Morizzled23, complete genome	115364-115388	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MK112541	Mycobacterium phage Jessibeth14, complete genome	117777-117801	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MK359347	Mycobacterium phage Ading, complete genome	117581-117605	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MK450425	Mycobacterium phage Shelob, complete genome	118609-118633	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	NC_023714	Mycobacterium phage LinStu, complete genome	116736-116760	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MK359358	Mycobacterium phage Essence, complete genome	115892-115916	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	KJ595575	Mycobacterium phage Willis, complete genome	116895-116919	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MG812493	Mycobacterium phage NuevoMundo, complete genome	118987-119011	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MK359339	Mycobacterium phage Naija, complete genome	116700-116724	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MK359333	Mycobacterium phage JustHall, complete genome	115793-115817	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	KT321476	Mycobacterium phage Zeenon, complete genome	117295-117319	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MN428065	Mycobacterium phage Cactojaque, complete genome	115529-115553	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MK359306	Mycobacterium phage Norm, complete genome	117435-117459	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MN735434	Mycobacterium phage Mangeria, complete genome	117790-117814	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	JN699625	Mycobacterium phage Wally, complete genome	115981-116005	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	EU826471	Mycobacterium phage Cali, complete genome	117476-117500	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	KX721255	Mycobacterium phage Yucca, complete genome	117643-117667	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MK359366	Mycobacterium phage Basquiat, complete genome	115509-115533	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MK359346	Mycobacterium phage NoodleTree, complete genome	117433-117457	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	JN699013	Mycobacterium phage Pio, complete genome	119724-119748	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MK359361	Mycobacterium phage Darko, complete genome	116234-116258	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	NC_023725	Mycobacterium phage Nappy, complete genome	118394-118418	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MK359348	Mycobacterium phage Rahel, complete genome	116435-116459	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MH779498	Mycobacterium phage Bread, complete genome	116100-116124	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MK450427	Mycobacterium phage Adlitam, complete genome	116185-116209	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MG812494	Mycobacterium phage Pier, complete genome	118532-118556	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	GQ303262	Mycobacterium phage LRRHood, complete genome	116449-116473	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MT818423	Mycobacterium phage Janiyra, complete genome	116886-116910	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MH316567	Mycobacterium phage ParkTD, complete genome	116997-117021	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	AY129337	Mycobacteriophage Bxz1, complete genome	119069-119093	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MH051260	Mycobacterium phage InterFolia, complete genome	118359-118383	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	KX721256	Mycobacterium phage Erdmann, complete genome	117110-117134	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MK359328	Mycobacterium phage EmmaElysia, complete genome	117442-117466	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	KM881426	Mycobacterium phage ZygoTaiga	117915-117939	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MK359335	Mycobacterium phage Patter, complete genome	116011-116035	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MT889395	Mycobacterium phage Shifa, complete genome	116220-116244	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	EU826467	Mycobacterium phage Rizal, complete genome	114953-114977	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MT723944	Mycobacterium phage ChaylaJr, complete genome	116209-116233	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	KR080196	Mycobacterium phage Momo, complete genome	115997-116021	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MH910040	Mycobacterium phage Sauce, complete genome	115652-115676	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MF919495	Mycobacterium phage Bigswole, complete genome	119460-119484	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MK359318	Mycobacterium phage Specks, complete genome	118110-118134	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	KF024734	Mycobacterium phage Shrimp, complete genome	117764-117788	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MK112548	Mycobacterium phage McWolfish, complete genome	116455-116479	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MK359308	Mycobacterium phage Shaqnato, complete genome	115869-115893	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MK112545	Mycobacterium phage Khaleesi, complete genome	117244-117268	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MH825697	Mycobacterium phage Bangla1971, complete genome	116003-116027	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MK359338	Mycobacterium phage Amataga, complete genome	115997-116021	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MK359350	Mycobacterium phage Nidhogg, complete genome	117526-117550	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MT723945	Mycobacterium phage Quasimodo, complete genome	117326-117350	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MK359342	Mycobacterium phage ShiaLabeouf, complete genome	115643-115667	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MH316561	Mycobacterium phage Derek, complete genome	116563-116587	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MK112533	Mycobacterium phage Bonray, complete genome	118102-118126	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MK450422	Mycobacterium phage RoMag, complete genome	116746-116770	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MK359327	Mycobacterium phage EmToTheThree, complete genome	117151-117175	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MH727543	Mycobacterium phage CharlieB, complete genome	116237-116261	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	JF704116	Mycobacterium phage Drazdys, complete genome	116680-116704	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MK359336	Mycobacterium phage Chargie21, complete genome	115509-115533	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MK359355	Mycobacterium phage Sprinklers, complete genome	116359-116383	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MK112534	Mycobacterium phage Burrough, complete genome	117870-117894	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MF919499	Mycobacterium phage Daffodil, complete genome	117000-117024	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MK359334	Mycobacterium phage Delilah, complete genome	117118-117142	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	NC_023696	Mycobacterium phage Dandelion, complete genome	120633-120657	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MN276192	Mycobacterium phage Trinitium, complete genome	115831-115855	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MK359324	Mycobacterium phage Tortoise16, complete genome	116546-116570	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MH825713	Mycobacterium phage Zalkecks, complete genome	116724-116748	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MK359349	Mycobacterium phage FoxtrotP1, complete genome	117708-117732	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	JF704096	Mycobacterium phage Ghost, complete sequence	115908-115932	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MN062707	Mycobacterium phage Grungle, complete genome	113945-113969	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MK359344	Mycobacterium phage Napoleon13, complete genome	115728-115752	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MH727558	Mycobacterium phage Salacia, complete genome	116838-116862	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MK359363	Mycobacterium phage Fludd, complete genome	116464-116488	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	KX831080	Mycobacterium phage Lukilu, complete genome	117459-117483	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MK359329	Mycobacterium phage Kamryn, complete genome	117423-117447	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	JQ911768	Mycobacterium phage Ava3, complete genome	116431-116455	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	NC_004687	Mycobacterium phage Bxz1, complete genome	119069-119093	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	NC_011270	Mycobacterium phage Spud, complete genome	116071-116095	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MN183280	Mycobacteriophage LolaVinca, complete genome	117789-117813	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MK359345	Mycobacterium phage QBert, complete genome	116056-116080	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	GQ303260	Mycobacterium phage ET08, complete genome	116271-116295	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MH744422	Mycobacterium phage Roots515, complete genome	118254-118278	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MK359321	Mycobacterium phage Phusco, complete genome	115532-115556	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MK359362	Mycobacterium phage Atlantean, complete genome	115997-116021	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	EU826469	Mycobacterium phage ScottMcG, complete genome	115731-115755	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MK310143	Mycobacterium phage Dietrick, complete genome	115239-115263	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MK450429	Mycobacterium phage Bipolarisk, complete genome	116700-116724	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MH051266	Mycobacterium phage MikeLiesIn, complete genome	117882-117906	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	NC_029044	Mycobacterium phage Breeniome, complete genome	115554-115578	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MH669008	Mycobacterium phage Megamind, complete genome	116746-116770	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MK878897	Mycobacterium phage Blackbrain, complete genome	116594-116618	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MK450434	Mycobacterium phage DrPhinkDaddy, complete genome	117778-117802	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MK359359	Mycobacterium phage Colt, complete genome	119322-119346	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MF919527	Mycobacterium phage Phox, complete genome	117655-117679	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MT818416	Mycobacterium phage BackyardAgain, complete genome	114955-114979	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MK359330	Mycobacterium phage Iota, complete genome	116346-116370	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	KT365398	Mycobacterium phage DTDevon, complete genome	118035-118059	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	KX369583	Mycobacterium phage Littleton, complete genome	117234-117258	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MF919494	Mycobacterium phage BeanWater, complete genome	116035-116059	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	NC_028869	Mycobacterium phage HyRo, complete genome	116251-116275	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	KT365400	Mycobacterium phage ErnieJ, complete genome	114931-114955	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	KC691257	Mycobacterium phage Astraea, complete genome	115601-115625	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MG872839	Mycobacterium phage LifeSavor, complete genome	116522-116546	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	KC748968	Mycobacterium phage Gizmo, complete genome	119026-119050	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	KC748970	Mycobacterium phage ArcherS7, complete genome	117039-117063	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MK359353	Mycobacterium phage BadAgartude, complete genome	116099-116123	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MH697590	Mycobacterium phage Phlegm, complete genome	116700-116724	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MK359317	Mycobacterium phage FrayBell, complete genome	116554-116578	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MT553335	Mycobacterium phage Ronan, complete genome	115138-115162	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MN428066	Mycobacterium phage JPickles, complete genome	114646-114670	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MK359305	Mycobacterium phage Teardrop, complete genome	115303-115327	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	DQ398053	Mycobacteriophage Catera, complete genome	115210-115234	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MF919513	Mycobacterium phage Koguma, complete genome	116104-116128	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	JN699626	Mycobacterium phage MoMoMixon, complete genome	116921-116945	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	NC_028986	Mycobacterium phage Alice, complete sequence	116153-116177	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MK450424	Mycobacterium phage Melpomini, complete genome	115531-115555	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	JN204348	Mycobacterium phage Sebata, complete genome	118161-118185	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MN183285	Mycobacterium phage YoungMoneyMata, complete genome	116465-116489	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MK450423	Mycobacterium phage Stubby, complete genome	116111-116135	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MF919493	Mycobacterium phage Audrick, complete genome	115887-115911	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	NC_008207	Mycobacterium phage Catera, complete genome	115210-115234	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	JN624850	Mycobacterium phage Pleione, complete genome	117475-117499	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	KX752698	Mycobacterium phage Tonenili, complete genome	122889-122913	3	0.88
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MK359326	Mycobacterium phage Pivoine, complete genome	116700-116724	3	0.88
NC_018524_19	19.2|4409027|27|NC_018524|CRISPRCasFinder	4409027-4409053	27	NZ_CP007129	Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence	662183-662209	3	0.889
NC_018524_11	11.3|2251146|32|NC_018524|PILER-CR,CRT	2251146-2251177	32	NZ_CP017076	Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence	973892-973923	4	0.875
NC_018524_15	15.7|2270703|32|NC_018524|CRISPRCasFinder	2270703-2270734	32	NC_015383	Burkholderia gladioli BSR3 plasmid bgla_4p, complete sequence	316447-316478	4	0.875
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	NZ_CP023440	Thauera sp. K11 plasmid pTX1, complete sequence	116555-116579	4	0.84
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	NZ_CP023000	Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-B, complete sequence	82585-82609	4	0.84
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	NZ_CP032324	Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence	15835-15859	4	0.84
NC_018524_15	15.13|2271069|25|NC_018524|CRISPRCasFinder	2271069-2271093	25	MT657336	Microbacterium phage ClearAsMud, complete genome	17514-17538	4	0.84
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	NZ_CP023440	Thauera sp. K11 plasmid pTX1, complete sequence	116551-116579	4	0.862
NC_018524_18	18.2|2357908|28|NC_018524|CRISPRCasFinder	2357908-2357935	28	LC473083	Cutibacterium acnes TP-CU389 plasmid pTZC1 DNA, complete sequence	4284-4311	4	0.857
NC_018524_19	19.2|4409027|27|NC_018524|CRISPRCasFinder	4409027-4409053	27	NZ_CP007129	Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence	210071-210097	4	0.852
NC_018524_19	19.2|4409027|27|NC_018524|CRISPRCasFinder	4409027-4409053	27	NZ_CP032322	Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence	1307650-1307676	4	0.852
NC_018524_19	19.2|4409027|27|NC_018524|CRISPRCasFinder	4409027-4409053	27	NZ_CP020399	Burkholderia multivorans strain FDAARGOS_246 plasmid unnamed, complete sequence	296319-296345	4	0.852
NC_018524_19	19.2|4409027|27|NC_018524|CRISPRCasFinder	4409027-4409053	27	NZ_CP007794	Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence	135642-135668	4	0.852
NC_018524_19	19.2|4409027|27|NC_018524|CRISPRCasFinder	4409027-4409053	27	NZ_CP012916	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence	462805-462831	4	0.852
NC_018524_19	19.2|4409027|27|NC_018524|CRISPRCasFinder	4409027-4409053	27	NZ_CP022367	Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence	1086911-1086937	4	0.852
NC_018524_19	19.2|4409027|27|NC_018524|CRISPRCasFinder	4409027-4409053	27	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	570787-570813	4	0.852
NC_018524_19	19.2|4409027|27|NC_018524|CRISPRCasFinder	4409027-4409053	27	NZ_CP032341	Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence	585806-585832	4	0.852
NC_018524_19	19.2|4409027|27|NC_018524|CRISPRCasFinder	4409027-4409053	27	NZ_CP032346	Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence	1399495-1399521	4	0.852
NC_018524_34	34.6|5116779|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116779-5116810	32	NZ_CP026518	Deinococcus sp. NW-56 plasmid unnamed2, complete sequence	56496-56527	4	0.875
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP019313	Tateyamaria omphalii strain DOK1-4 plasmid pDOK1-4-1, complete sequence	44390-44421	5	0.844
NC_018524_2	2.10|313401|30|NC_018524|PILER-CR	313401-313430	30	NZ_CP045548	Streptomyces sp. SYP-A7193 plasmid unnamed1, complete sequence	266706-266735	5	0.833
NC_018524_2	2.10|313401|30|NC_018524|PILER-CR	313401-313430	30	NZ_CP053445	Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eA, complete sequence	71271-71300	5	0.833
NC_018524_2	2.10|313401|30|NC_018524|PILER-CR	313401-313430	30	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	1033028-1033057	5	0.833
NC_018524_2	2.10|313401|30|NC_018524|PILER-CR	313401-313430	30	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	2398666-2398695	5	0.833
NC_018524_4	4.4|321553|32|NC_018524|CRISPRCasFinder,CRT	321553-321584	32	NC_009339	Mycolicibacterium gilvum PYR-GCK plasmid pMFLV01, complete sequence	113449-113480	5	0.844
NC_018524_5	5.1|326532|32|NC_018524|CRISPRCasFinder	326532-326563	32	NZ_KY349138	Mycolicibacterium sp. CBMA 213 plasmid pCBMA213_2, complete sequence	107035-107066	5	0.844
NC_018524_11	11.4|2251207|32|NC_018524|PILER-CR,CRT	2251207-2251238	32	NC_016623	Azospirillum lipoferum 4B plasmid AZO_p3, complete sequence	89015-89046	5	0.844
NC_018524_15	15.3|2270459|32|NC_018524|CRISPRCasFinder	2270459-2270490	32	NZ_CP031953	Phaeobacter inhibens strain 2.10 plasmid unnamed1, complete sequence	146007-146038	5	0.844
NC_018524_15	15.3|2270459|32|NC_018524|CRISPRCasFinder	2270459-2270490	32	NC_018421	Phaeobacter inhibens 2.10 plasmid pPGA2_239, complete sequence	145912-145943	5	0.844
NC_018524_15	15.7|2270703|32|NC_018524|CRISPRCasFinder	2270703-2270734	32	NZ_CP022209	Burkholderia gladioli pv. gladioli strain FDAARGOS_188 plasmid unnamed1, complete sequence	19491-19522	5	0.844
NC_018524_15	15.7|2270703|32|NC_018524|CRISPRCasFinder	2270703-2270734	32	NZ_CP009321	Burkholderia gladioli strain ATCC 10248 plasmid 1, complete sequence	106917-106948	5	0.844
NC_018524_15	15.7|2270703|32|NC_018524|CRISPRCasFinder	2270703-2270734	32	NZ_CP022007	Burkholderia gladioli pv. gladioli strain KACC 11889 plasmid pls1, complete sequence	34294-34325	5	0.844
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	NZ_CP023408	Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence	549069-549097	5	0.828
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	1436253-1436281	5	0.828
NC_018524_18	18.2|2357908|28|NC_018524|CRISPRCasFinder	2357908-2357935	28	NZ_CP045548	Streptomyces sp. SYP-A7193 plasmid unnamed1, complete sequence	158203-158230	5	0.821
NC_018524_18	18.2|2357908|28|NC_018524|CRISPRCasFinder	2357908-2357935	28	NC_023286	Streptomyces sp. F12 plasmid pFRL6, complete sequence	380496-380523	5	0.821
NC_018524_18	18.2|2357908|28|NC_018524|CRISPRCasFinder	2357908-2357935	28	NZ_CP012477	Arthrobacter sp. ERGS1:01 isolate water plasmid unnamed2, complete sequence	192763-192790	5	0.821
NC_018524_19	19.2|4409027|27|NC_018524|CRISPRCasFinder	4409027-4409053	27	KT887559	Pseudomonas phage phi3, complete genome	13333-13359	5	0.815
NC_018524_19	19.2|4409027|27|NC_018524|CRISPRCasFinder	4409027-4409053	27	NZ_AP017656	Sphingobium cloacae strain JCM 10874 plasmid pSCLO_2, complete sequence	111066-111092	5	0.815
NC_018524_19	19.2|4409027|27|NC_018524|CRISPRCasFinder	4409027-4409053	27	NZ_CP007130	Gemmatirosa kalamazoonesis strain KBS708 plasmid 2, complete sequence	543551-543577	5	0.815
NC_018524_19	19.2|4409027|27|NC_018524|CRISPRCasFinder	4409027-4409053	27	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	2547103-2547129	5	0.815
NC_018524_19	19.2|4409027|27|NC_018524|CRISPRCasFinder	4409027-4409053	27	NZ_AP014579	Burkholderia sp. RPE67 plasmid p1, complete sequence	1347805-1347831	5	0.815
NC_018524_19	19.2|4409027|27|NC_018524|CRISPRCasFinder	4409027-4409053	27	NC_016626	Burkholderia sp. YI23 plasmid byi_1p, complete sequence	1200500-1200526	5	0.815
NC_018524_19	19.2|4409027|27|NC_018524|CRISPRCasFinder	4409027-4409053	27	NZ_CP043961	Streptomyces tendae strain 139 plasmid unnamed2, complete sequence	22292-22318	5	0.815
NC_018524_19	19.2|4409027|27|NC_018524|CRISPRCasFinder	4409027-4409053	27	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	1080206-1080232	5	0.815
NC_018524_19	19.2|4409027|27|NC_018524|CRISPRCasFinder	4409027-4409053	27	NC_010514	Methylobacterium radiotolerans JCM 2831 plasmid pMRAD03, complete sequence	2051-2077	5	0.815
NC_018524_19	19.2|4409027|27|NC_018524|CRISPRCasFinder	4409027-4409053	27	NC_008697	Nocardioides sp. JS614 plasmid pNOCA01, complete sequence	24461-24487	5	0.815
NC_018524_26	26.20|4598877|32|NC_018524|CRISPRCasFinder,CRT	4598877-4598908	32	NZ_CP036456	Streptomonospora sp. M2 plasmid phiM2, complete sequence	12569-12600	5	0.844
NC_018524_26	26.20|4598877|32|NC_018524|CRISPRCasFinder,CRT	4598877-4598908	32	NZ_CP042998	Aquisphaera giovannonii strain OJF2 plasmid pOJF2_1, complete sequence	40413-40444	5	0.844
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	NZ_CP030864	Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence	350450-350481	5	0.844
NC_018524_32	32.28|4653354|32|NC_018524|CRISPRCasFinder	4653354-4653385	32	NC_018853	Streptomyce phage TG1, complete genome	20462-20493	5	0.844
NC_018524_32	32.28|4653354|32|NC_018524|CRISPRCasFinder	4653354-4653385	32	JX182372	Streptomyces virus TG1, complete genome	20462-20493	5	0.844
NC_018524_34	34.6|5116779|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116779-5116810	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	3458159-3458190	5	0.844
NC_018524_1	1.7|311992|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311992-312023	32	NZ_CP020900	Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5d, complete sequence	117144-117175	6	0.812
NC_018524_1	1.7|311992|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311992-312023	32	NZ_CP013589	Rhizobium phaseoli strain N161 plasmid pRphaN161d, complete sequence	293499-293530	6	0.812
NC_018524_1	1.7|311992|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311992-312023	32	NZ_CP013562	Rhizobium phaseoli strain N841 plasmid pRphaN841e, complete sequence	336056-336087	6	0.812
NC_018524_1	1.7|311992|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311992-312023	32	NZ_CP013541	Rhizobium phaseoli strain R630 plasmid pRphaR630d, complete sequence	296930-296961	6	0.812
NC_018524_1	1.7|311992|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311992-312023	32	NC_010997	Rhizobium etli CIAT 652 plasmid pC, complete sequence	290231-290262	6	0.812
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	NC_013858	Azospirillum sp. B510 plasmid pAB510d, complete sequence	389350-389381	6	0.812
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	NZ_CP020331	Martelella mediterranea DSM 17316 strain MACL11 plasmid pMM593, complete sequence	302528-302559	6	0.812
NC_018524_2	2.4|313399|32|NC_018524|CRISPRCasFinder	313399-313430	32	NZ_CP045548	Streptomyces sp. SYP-A7193 plasmid unnamed1, complete sequence	266705-266736	6	0.812
NC_018524_2	2.4|313399|32|NC_018524|CRISPRCasFinder	313399-313430	32	NZ_CP012477	Arthrobacter sp. ERGS1:01 isolate water plasmid unnamed2, complete sequence	162649-162680	6	0.812
NC_018524_2	2.8|313399|33|NC_018524|CRT	313399-313431	33	NZ_CP045548	Streptomyces sp. SYP-A7193 plasmid unnamed1, complete sequence	266704-266736	6	0.818
NC_018524_2	2.10|313401|30|NC_018524|PILER-CR	313401-313430	30	NZ_AP012556	Mycobacterium avium subsp. hominissuis TH135 plasmid pMAH135, complete sequence	146342-146371	6	0.8
NC_018524_3	3.2|318578|32|NC_018524|CRISPRCasFinder,CRT	318578-318609	32	NZ_CP045303	Azotobacter salinestris strain KACC 13899 plasmid unnamed1, complete sequence	136227-136258	6	0.812
NC_018524_3	3.2|318578|32|NC_018524|CRISPRCasFinder,CRT	318578-318609	32	NZ_CP010421	Azotobacter chroococcum NCIMB 8003 plasmid pAcX50f, complete sequence	173855-173886	6	0.812
NC_018524_3	3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318761-318792	32	NZ_CP046575	Rhodococcus sp. WAY2 plasmid pRWAY03, complete sequence	57127-57158	6	0.812
NC_018524_3	3.8|318944|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318944-318975	32	NZ_CP013104	Paraburkholderia caribensis strain MWAP64 plasmid 1, complete sequence	222739-222770	6	0.812
NC_018524_3	3.8|318944|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318944-318975	32	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	542837-542868	6	0.812
NC_018524_3	3.12|319187|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	319187-319218	32	NC_019387	Thermus oshimai JL-2 plasmid pTHEOS01, complete sequence	211339-211370	6	0.812
NC_018524_4	4.9|321858|32|NC_018524|CRISPRCasFinder,CRT	321858-321889	32	JF974300	Synechococcus phage S-CBP42, *** SEQUENCING IN PROGRESS ***, 8 unordered pieces	39386-39417	6	0.812
NC_018524_4	4.9|321858|32|NC_018524|CRISPRCasFinder,CRT	321858-321889	32	KC310805	Synechococcus phage S-CBP42, complete genome	664-695	6	0.812
NC_018524_4	4.21|322004|28|NC_018524|PILER-CR	322004-322031	28	NZ_CP030828	Neorhizobium sp. NCHU2750 plasmid pNCHU2750a, complete sequence	27650-27677	6	0.786
NC_018524_5	5.5|326776|32|NC_018524|CRISPRCasFinder	326776-326807	32	NC_012987	Methylorubrum extorquens AM1 plasmid p1METDI, complete sequence	70094-70125	6	0.812
NC_018524_5	5.7|326532|33|NC_018524|CRT	326532-326564	33	NZ_KY349138	Mycolicibacterium sp. CBMA 213 plasmid pCBMA213_2, complete sequence	107034-107066	6	0.818
NC_018524_5	5.11|326776|33|NC_018524|CRT	326776-326808	33	NC_012987	Methylorubrum extorquens AM1 plasmid p1METDI, complete sequence	70093-70125	6	0.818
NC_018524_5	5.16|326777|32|NC_018524|PILER-CR	326777-326808	32	NC_012987	Methylorubrum extorquens AM1 plasmid p1METDI, complete sequence	70094-70125	6	0.812
NC_018524_9	9.8|1460493|32|NC_018524|CRISPRCasFinder,CRT	1460493-1460524	32	NZ_CP007129	Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence	606674-606705	6	0.812
NC_018524_9	9.18|1460494|32|NC_018524|PILER-CR	1460494-1460525	32	NZ_CP007129	Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence	606674-606705	6	0.812
NC_018524_11	11.3|2251146|32|NC_018524|PILER-CR,CRT	2251146-2251177	32	NZ_CP032326	Azospirillum brasilense strain MTCC4035 plasmid p5, complete sequence	217509-217540	6	0.812
NC_018524_11	11.3|2251146|32|NC_018524|PILER-CR,CRT	2251146-2251177	32	NZ_CP007796	Azospirillum brasilense strain Az39 plasmid AbAZ39_p3, complete sequence	349917-349948	6	0.812
NC_018524_11	11.3|2251146|32|NC_018524|PILER-CR,CRT	2251146-2251177	32	NC_010510	Methylobacterium radiotolerans JCM 2831 plasmid pMRAD01, complete sequence	446321-446352	6	0.812
NC_018524_11	11.3|2251146|32|NC_018524|PILER-CR,CRT	2251146-2251177	32	NZ_CP032342	Azospirillum brasilense strain MTCC4038 plasmid p3, complete sequence	451383-451414	6	0.812
NC_018524_11	11.3|2251146|32|NC_018524|PILER-CR,CRT	2251146-2251177	32	NZ_CP033321	Azospirillum brasilense strain Cd plasmid p3, complete sequence	367663-367694	6	0.812
NC_018524_11	11.3|2251146|32|NC_018524|PILER-CR,CRT	2251146-2251177	32	NZ_CP033315	Azospirillum brasilense strain Sp 7 plasmid p3, complete sequence	260994-261025	6	0.812
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP020898	Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRetBra5b, complete sequence	129078-129109	6	0.812
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP020950	Rhizobium sp. CIAT894 plasmid pRheCIAT894c, complete sequence	211870-211901	6	0.812
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP013587	Rhizobium phaseoli strain N161 plasmid pRphaN161b, complete sequence	159652-159683	6	0.812
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP013598	Rhizobium sp. N741 plasmid pRspN741c, complete sequence	197929-197960	6	0.812
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP013544	Rhizobium phaseoli strain R620 plasmid pRphaR620b, complete sequence	129664-129695	6	0.812
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP013502	Rhizobium esperanzae strain N561 plasmid pRspN561b, complete sequence	197851-197882	6	0.812
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP013508	Rhizobium sp. N1341 plasmid pRspN1341c, complete sequence	197929-197960	6	0.812
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP013519	Rhizobium sp. N113 plasmid pRspN113b, complete sequence	197928-197959	6	0.812
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP021125	Rhizobium sp. Kim5 plasmid pRetKim5a, complete sequence	185773-185804	6	0.812
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP013492	Rhizobium sp. N6212 plasmid pRspN6212b, complete sequence	200491-200522	6	0.812
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP013497	Rhizobium sp. N621 plasmid pRspN621b, complete sequence	200491-200522	6	0.812
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP013592	Rhizobium sp. N871 plasmid pRspN871b, complete sequence	197851-197882	6	0.812
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NC_010996	Rhizobium etli CIAT 652 plasmid pB, complete sequence	178853-178884	6	0.812
NC_018524_11	11.8|2251452|32|NC_018524|PILER-CR,CRT	2251452-2251483	32	NZ_CP012940	Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence	902674-902705	6	0.812
NC_018524_11	11.8|2251452|32|NC_018524|PILER-CR,CRT	2251452-2251483	32	NZ_CP012944	Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence	940308-940339	6	0.812
NC_018524_11	11.8|2251452|32|NC_018524|PILER-CR,CRT	2251452-2251483	32	NC_017575	Ralstonia solanacearum Po82 megaplasmid, complete sequence	1406082-1406113	6	0.812
NC_018524_11	11.8|2251452|32|NC_018524|PILER-CR,CRT	2251452-2251483	32	NZ_CP026308	Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence	1406026-1406057	6	0.812
NC_018524_11	11.8|2251452|32|NC_018524|PILER-CR,CRT	2251452-2251483	32	NZ_CP051295	Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence	894014-894045	6	0.812
NC_018524_11	11.18|2251513|32|NC_018524|CRT	2251513-2251544	32	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	991777-991808	6	0.812
NC_018524_11	11.18|2251513|32|NC_018524|CRT	2251513-2251544	32	NZ_CP032054	Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence	593519-593550	6	0.812
NC_018524_11	11.18|2251513|32|NC_018524|CRT	2251513-2251544	32	NZ_CP016560	Streptomyces clavuligerus strain F613-1 plasmid pSCL4, complete sequence	250775-250806	6	0.812
NC_018524_14	14.4|2268443|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	2268443-2268474	32	AP014276	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S41-C62, *** SEQUENCING IN PROGRESS ***	4776-4807	6	0.812
NC_018524_15	15.3|2270459|32|NC_018524|CRISPRCasFinder	2270459-2270490	32	NZ_CP010612	Phaeobacter inhibens strain P92 plasmid pP92_b, complete sequence	135710-135741	6	0.812
NC_018524_15	15.3|2270459|32|NC_018524|CRISPRCasFinder	2270459-2270490	32	NZ_CP010624	Phaeobacter inhibens strain P51 plasmid pP51_a, complete sequence	128481-128512	6	0.812
NC_018524_15	15.3|2270459|32|NC_018524|CRISPRCasFinder	2270459-2270490	32	NZ_CP010669	Phaeobacter inhibens strain P57 plasmid pP57_a, complete sequence	128481-128512	6	0.812
NC_018524_15	15.3|2270459|32|NC_018524|CRISPRCasFinder	2270459-2270490	32	NZ_CP010600	Phaeobacter inhibens strain P83 plasmid pP83_a, complete sequence	136296-136327	6	0.812
NC_018524_15	15.3|2270459|32|NC_018524|CRISPRCasFinder	2270459-2270490	32	NZ_CP010742	Phaeobacter inhibens strain P59 plasmid pP59_a, complete sequence	145865-145896	6	0.812
NC_018524_15	15.3|2270459|32|NC_018524|CRISPRCasFinder	2270459-2270490	32	NZ_CP010726	Phaeobacter inhibens strain P88 plasmid pP88_a, complete sequence	136286-136317	6	0.812
NC_018524_15	15.3|2270459|32|NC_018524|CRISPRCasFinder	2270459-2270490	32	NZ_CP010651	Phaeobacter inhibens strain P54 plasmid pP54_a, complete sequence	151299-151330	6	0.812
NC_018524_15	15.3|2270459|32|NC_018524|CRISPRCasFinder	2270459-2270490	32	NZ_CP010706	Phaeobacter inhibens strain P66 plasmid pP66_a, complete sequence	136296-136327	6	0.812
NC_018524_15	15.3|2270459|32|NC_018524|CRISPRCasFinder	2270459-2270490	32	NZ_CP010697	Phaeobacter inhibens strain P24 plasmid pP24_a, complete sequence	128481-128512	6	0.812
NC_018524_15	15.3|2270459|32|NC_018524|CRISPRCasFinder	2270459-2270490	32	NZ_CP010746	Phaeobacter inhibens strain P48 isolate M21-2.3 plasmid pP48_a, complete sequence	143378-143409	6	0.812
NC_018524_15	15.3|2270459|32|NC_018524|CRISPRCasFinder	2270459-2270490	32	NZ_CP019308	Phaeobacter inhibens strain DOK1-1 plasmid pDOK1-1-1, complete sequence	221199-221230	6	0.812
NC_018524_15	15.3|2270459|32|NC_018524|CRISPRCasFinder	2270459-2270490	32	NZ_CP010736	Phaeobacter inhibens strain P72 plasmid pP72_a, complete sequence	136290-136321	6	0.812
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	NZ_CP023000	Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-B, complete sequence	82581-82609	6	0.793
NC_018524_18	18.2|2357908|28|NC_018524|CRISPRCasFinder	2357908-2357935	28	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	1039573-1039600	6	0.786
NC_018524_18	18.2|2357908|28|NC_018524|CRISPRCasFinder	2357908-2357935	28	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	773556-773583	6	0.786
NC_018524_18	18.2|2357908|28|NC_018524|CRISPRCasFinder	2357908-2357935	28	MH673674	Thermus phage phiMa, complete genome	21433-21460	6	0.786
NC_018524_18	18.2|2357908|28|NC_018524|CRISPRCasFinder	2357908-2357935	28	NZ_CP016083	Streptomyces sp. SAT1 plasmid unnamed3, complete sequence	517397-517424	6	0.786
NC_018524_18	18.2|2357908|28|NC_018524|CRISPRCasFinder	2357908-2357935	28	NC_023285	Streptomyces sp. F8 plasmid pFRL5, complete sequence	215813-215840	6	0.786
NC_018524_18	18.2|2357908|28|NC_018524|CRISPRCasFinder	2357908-2357935	28	NC_023284	Streptomyces sp. F2 plasmid pFRL4, complete sequence	286879-286906	6	0.786
NC_018524_18	18.2|2357908|28|NC_018524|CRISPRCasFinder	2357908-2357935	28	NZ_AP022578	Mycolicibacterium aubagnense strain JCM 15296 plasmid pJCM15296, complete sequence	160143-160170	6	0.786
NC_018524_18	18.2|2357908|28|NC_018524|CRISPRCasFinder	2357908-2357935	28	NZ_CP034351	Streptomyces sp. W1SF4 plasmid p1, complete sequence	217196-217223	6	0.786
NC_018524_19	19.2|4409027|27|NC_018524|CRISPRCasFinder	4409027-4409053	27	NC_011961	Thermomicrobium roseum DSM 5159 plasmid unnamed, complete sequence	705864-705890	6	0.778
NC_018524_19	19.2|4409027|27|NC_018524|CRISPRCasFinder	4409027-4409053	27	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	1653967-1653993	6	0.778
NC_018524_19	19.2|4409027|27|NC_018524|CRISPRCasFinder	4409027-4409053	27	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	4007471-4007497	6	0.778
NC_018524_19	19.2|4409027|27|NC_018524|CRISPRCasFinder	4409027-4409053	27	NC_011366	Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG202, complete sequence	40724-40750	6	0.778
NC_018524_19	19.2|4409027|27|NC_018524|CRISPRCasFinder	4409027-4409053	27	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	159299-159325	6	0.778
NC_018524_19	19.2|4409027|27|NC_018524|CRISPRCasFinder	4409027-4409053	27	NZ_CP035001	Rhizobium acidisoli strain FH23 plasmid pRapFH23c, complete sequence	21471-21497	6	0.778
NC_018524_19	19.2|4409027|27|NC_018524|CRISPRCasFinder	4409027-4409053	27	NZ_MF600313	Mycolicibacterium sp. CBMA 213 plasmid pCBMA213_1, complete sequence	113433-113459	6	0.778
NC_018524_19	19.2|4409027|27|NC_018524|CRISPRCasFinder	4409027-4409053	27	NC_003037	Sinorhizobium meliloti 1021 plasmid pSymA, complete sequence	253828-253854	6	0.778
NC_018524_19	19.2|4409027|27|NC_018524|CRISPRCasFinder	4409027-4409053	27	NZ_CP019585	Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymA, complete sequence	367333-367359	6	0.778
NC_018524_19	19.2|4409027|27|NC_018524|CRISPRCasFinder	4409027-4409053	27	CP006583	Mesorhizobium huakuii 7653R plasmid pMHb, complete sequence	262292-262318	6	0.778
NC_018524_19	19.2|4409027|27|NC_018524|CRISPRCasFinder	4409027-4409053	27	NC_016626	Burkholderia sp. YI23 plasmid byi_1p, complete sequence	1023772-1023798	6	0.778
NC_018524_19	19.2|4409027|27|NC_018524|CRISPRCasFinder	4409027-4409053	27	NC_016626	Burkholderia sp. YI23 plasmid byi_1p, complete sequence	1109315-1109341	6	0.778
NC_018524_19	19.2|4409027|27|NC_018524|CRISPRCasFinder	4409027-4409053	27	NZ_AP022611	Mycolicibacterium madagascariense strain JCM 13574 plasmid pJCM13574	66590-66616	6	0.778
NC_018524_19	19.2|4409027|27|NC_018524|CRISPRCasFinder	4409027-4409053	27	NC_020527	Sinorhizobium meliloti 2011 plasmid pSymA, complete sequence	253493-253519	6	0.778
NC_018524_19	19.2|4409027|27|NC_018524|CRISPRCasFinder	4409027-4409053	27	NZ_CP021798	Sinorhizobium meliloti strain USDA1106 plasmid psymA, complete sequence	470404-470430	6	0.778
NC_018524_19	19.2|4409027|27|NC_018524|CRISPRCasFinder	4409027-4409053	27	NZ_CP016617	Microvirga ossetica strain V5/3m plasmid unnamed1, complete sequence	466086-466112	6	0.778
NC_018524_21	21.7|4582540|33|NC_018524|PILER-CR	4582540-4582572	33	NZ_CP029452	Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence	1225500-1225532	6	0.818
NC_018524_21	21.7|4582540|33|NC_018524|PILER-CR	4582540-4582572	33	NZ_CP023071	Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence	1234980-1235012	6	0.818
NC_018524_21	21.12|4582845|33|NC_018524|PILER-CR	4582845-4582877	33	MT952845	Microbacterium phage GardenState, complete genome	24365-24397	6	0.818
NC_018524_21	21.12|4582845|33|NC_018524|PILER-CR	4582845-4582877	33	MK880124	Microbacterium phage IAmGroot, complete genome	25030-25062	6	0.818
NC_018524_21	21.19|4582480|32|NC_018524|CRISPRCasFinder,CRT	4582480-4582511	32	NZ_LR134465	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 23, complete sequence	281664-281695	6	0.812
NC_018524_21	21.25|4582846|32|NC_018524|CRISPRCasFinder,CRT	4582846-4582877	32	MT952845	Microbacterium phage GardenState, complete genome	24365-24396	6	0.812
NC_018524_21	21.25|4582846|32|NC_018524|CRISPRCasFinder,CRT	4582846-4582877	32	MK880124	Microbacterium phage IAmGroot, complete genome	25030-25061	6	0.812
NC_018524_23	23.9|4592091|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4592091-4592122	32	NZ_CP016463	Bosea sp. RAC05 plasmid pBSY19_1, complete sequence	386208-386239	6	0.812
NC_018524_23	23.9|4592091|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4592091-4592122	32	NZ_CP032341	Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence	565850-565881	6	0.812
NC_018524_23	23.9|4592091|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4592091-4592122	32	NZ_CP012916	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence	482756-482787	6	0.812
NC_018524_26	26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT	4598633-4598664	32	MN310546	Microbacterium phage PhriedRice, complete genome	14463-14494	6	0.812
NC_018524_26	26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT	4598633-4598664	32	MT657337	Microbacterium phage Mazun, complete genome	14393-14424	6	0.812
NC_018524_26	26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT	4598633-4598664	32	MT310890	Microbacterium phage Phedro, complete genome	14484-14515	6	0.812
NC_018524_26	26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT	4598633-4598664	32	MT310889	Microbacterium phage Phractured, complete genome	14484-14515	6	0.812
NC_018524_26	26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT	4598633-4598664	32	MT310891	Microbacterium phage Pharky, complete genome	14484-14515	6	0.812
NC_018524_26	26.21|4598938|32|NC_018524|CRISPRCasFinder,CRT	4598938-4598969	32	CP054927	Streptomyces fulvissimus strain NA06532 plasmid unnamed1, complete sequence	555895-555926	6	0.812
NC_018524_26	26.23|4599060|32|NC_018524|CRISPRCasFinder,CRT	4599060-4599091	32	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	329428-329459	6	0.812
NC_018524_26	26.23|4599060|32|NC_018524|CRISPRCasFinder,CRT	4599060-4599091	32	NZ_CP024895	Amycolatopsis sp. AA4 plasmid unnamed1, complete sequence	103614-103645	6	0.812
NC_018524_26	26.25|4599182|32|NC_018524|CRISPRCasFinder,CRT	4599182-4599213	32	NZ_CP007129	Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence	412952-412983	6	0.812
NC_018524_26	26.25|4599182|32|NC_018524|CRISPRCasFinder,CRT	4599182-4599213	32	NZ_CP012185	Pseudonocardia sp. EC080619-01 plasmid pBCI1-2, complete sequence	208228-208259	6	0.812
NC_018524_26	26.25|4599182|32|NC_018524|CRISPRCasFinder,CRT	4599182-4599213	32	NZ_CP012182	Pseudonocardia sp. EC080610-09 plasmid pBCI2-1, complete sequence	131581-131612	6	0.812
NC_018524_26	26.25|4599182|32|NC_018524|CRISPRCasFinder,CRT	4599182-4599213	32	NZ_CP045855	Agrobacterium sp. MA01 plasmid punnamed1, complete sequence	24793-24824	6	0.812
NC_018524_26	26.25|4599182|32|NC_018524|CRISPRCasFinder,CRT	4599182-4599213	32	NZ_CP012477	Arthrobacter sp. ERGS1:01 isolate water plasmid unnamed2, complete sequence	327262-327293	6	0.812
NC_018524_26	26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT	4599243-4599274	32	NZ_AP014705	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence	91029-91060	6	0.812
NC_018524_26	26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT	4599243-4599274	32	NZ_CP011808	Pandoraea faecigallinarum strain DSM 23572 plasmid pPF72-1, complete sequence	238481-238512	6	0.812
NC_018524_28	28.1|4608658|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4608658-4608689	32	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	1428466-1428497	6	0.812
NC_018524_28	28.1|4608658|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4608658-4608689	32	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	384791-384822	6	0.812
NC_018524_30	30.2|4637791|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637791-4637822	32	NC_011667	Thauera sp. MZ1T plasmid pTha01, complete sequence	36888-36919	6	0.812
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	MH791403	UNVERIFIED: Pseudomonas phage PaTs-2, complete genome	35426-35457	6	0.812
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	MN871478	UNVERIFIED: Pseudomonas phage PaSt-2_45_61k, complete genome	35426-35457	6	0.812
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	MH791406	UNVERIFIED: Pseudomonas phage PaSz-4, complete genome	24969-25000	6	0.812
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	NC_015258	Polymorphum gilvum SL003B-26A1 plasmid pSL003B, complete sequence	18135-18166	6	0.812
NC_018524_32	32.14|4653353|33|NC_018524|PILER-CR,CRT	4653353-4653385	33	NC_018853	Streptomyce phage TG1, complete genome	20461-20493	6	0.818
NC_018524_32	32.14|4653353|33|NC_018524|PILER-CR,CRT	4653353-4653385	33	JX182372	Streptomyces virus TG1, complete genome	20461-20493	6	0.818
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	NZ_CP043499	Rhizobium grahamii strain BG7 plasmid unnamed, complete sequence	1518859-1518890	6	0.812
NC_018524_34	34.5|5116718|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116718-5116749	32	NZ_CP044425	Paracoccus pantotrophus strain DSM 2944 plasmid pPAN2, complete sequence	359336-359367	6	0.812
NC_018524_34	34.6|5116779|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116779-5116810	32	NZ_CP054617	Azospirillum oryzae strain KACC 14407 plasmid unnamed3, complete sequence	711963-711994	6	0.812
NC_018524_34	34.10|5117024|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5117024-5117055	32	KU886222	Erwinia phage vB_EamM_Special G, complete genome	96948-96979	6	0.812
NC_018524_1	1.2|311687|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311687-311718	32	NZ_CP022195	Yangia pacifica strain YSBP01 plasmid unnamed5, complete sequence	95266-95297	7	0.781
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	5801849-5801880	7	0.781
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP044072	Pseudomonas oryzihabitans strain FDAARGOS_657 plasmid unnamed1, complete sequence	57035-57066	7	0.781
NC_018524_1	1.6|311931|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311931-311962	32	NZ_CP023408	Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence	633329-633360	7	0.781
NC_018524_1	1.6|311931|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311931-311962	32	NZ_CP010990	Pseudonocardia sp. EC080625-04 plasmid pFRP1-1, complete sequence	48902-48933	7	0.781
NC_018524_1	1.10|312180|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312180-312211	32	NZ_CP017077	Novosphingobium resinovorum strain SA1 plasmid pSA2, complete sequence	366110-366141	7	0.781
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2032678-2032709	7	0.781
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	NZ_LR134461	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 19, complete sequence	32553-32584	7	0.781
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	NZ_CP007129	Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence	264095-264126	7	0.781
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	1108264-1108295	7	0.781
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	NZ_CP053709	Acetobacteraceae bacterium strain PAMC 26569 plasmid unnamed1, complete sequence	371415-371446	7	0.781
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	NZ_KR997898	Mycobacterium avium subsp. hominissuis strain 88Br plasmid pMA100, complete sequence	14020-14051	7	0.781
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	MH727545	Mycobacterium phage DismalStressor, complete genome	36276-36307	7	0.781
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	NC_026598	Mycobacterium phage Milly, complete genome	36249-36280	7	0.781
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	KX688047	Mycobacterium phage Marcoliusprime, complete genome	36276-36307	7	0.781
NC_018524_2	2.3|313338|32|NC_018524|CRISPRCasFinder	313338-313369	32	NZ_CP020331	Martelella mediterranea DSM 17316 strain MACL11 plasmid pMM593, complete sequence	573837-573868	7	0.781
NC_018524_2	2.4|313399|32|NC_018524|CRISPRCasFinder	313399-313430	32	NC_015727	Cupriavidus necator N-1 plasmid pBB1, complete sequence	1002560-1002591	7	0.781
NC_018524_2	2.4|313399|32|NC_018524|CRISPRCasFinder	313399-313430	32	NZ_CP053445	Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eA, complete sequence	71270-71301	7	0.781
NC_018524_2	2.8|313399|33|NC_018524|CRT	313399-313431	33	NZ_CP009439	Streptomyces glaucescens strain GLA.O plasmid pSglau1, complete sequence	77952-77984	7	0.788
NC_018524_2	2.10|313401|30|NC_018524|PILER-CR	313401-313430	30	NZ_CP016613	Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence	399583-399612	7	0.767
NC_018524_2	2.10|313401|30|NC_018524|PILER-CR	313401-313430	30	NZ_CP022766	Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence	229502-229531	7	0.767
NC_018524_2	2.10|313401|30|NC_018524|PILER-CR	313401-313430	30	NZ_CP009439	Streptomyces glaucescens strain GLA.O plasmid pSglau1, complete sequence	77954-77983	7	0.767
NC_018524_2	2.10|313401|30|NC_018524|PILER-CR	313401-313430	30	NZ_CP016555	Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence	1957338-1957367	7	0.767
NC_018524_2	2.10|313401|30|NC_018524|PILER-CR	313401-313430	30	NZ_CP052069	Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence	230447-230476	7	0.767
NC_018524_2	2.10|313401|30|NC_018524|PILER-CR	313401-313430	30	NZ_CP016905	Ralstonia solanacearum strain KACC 10709 plasmid unnamed1	1219524-1219553	7	0.767
NC_018524_2	2.10|313401|30|NC_018524|PILER-CR	313401-313430	30	NZ_CP022769	Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence	230761-230790	7	0.767
NC_018524_2	2.10|313401|30|NC_018524|PILER-CR	313401-313430	30	NZ_CP015851	Ralstonia solanacearum strain YC40-M plasmid, complete sequence	160495-160524	7	0.767
NC_018524_2	2.10|313401|30|NC_018524|PILER-CR	313401-313430	30	NZ_CP022773	Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence	237796-237825	7	0.767
NC_018524_2	2.10|313401|30|NC_018524|PILER-CR	313401-313430	30	NZ_CP022791	Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence	119279-119308	7	0.767
NC_018524_2	2.10|313401|30|NC_018524|PILER-CR	313401-313430	30	NZ_CP052071	Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence	243570-243599	7	0.767
NC_018524_2	2.10|313401|30|NC_018524|PILER-CR	313401-313430	30	NZ_CP022779	Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence	230778-230807	7	0.767
NC_018524_2	2.10|313401|30|NC_018524|PILER-CR	313401-313430	30	NZ_CP052075	Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence	243570-243599	7	0.767
NC_018524_2	2.10|313401|30|NC_018524|PILER-CR	313401-313430	30	NZ_CP052085	Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence	245182-245211	7	0.767
NC_018524_2	2.10|313401|30|NC_018524|PILER-CR	313401-313430	30	NZ_CP052105	Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence	243570-243599	7	0.767
NC_018524_2	2.10|313401|30|NC_018524|PILER-CR	313401-313430	30	NZ_CP052087	Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence	245182-245211	7	0.767
NC_018524_2	2.10|313401|30|NC_018524|PILER-CR	313401-313430	30	NZ_CP052115	Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence	243570-243599	7	0.767
NC_018524_2	2.10|313401|30|NC_018524|PILER-CR	313401-313430	30	NZ_CP052127	Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence	245182-245211	7	0.767
NC_018524_2	2.10|313401|30|NC_018524|PILER-CR	313401-313430	30	NZ_CP052089	Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence	245182-245211	7	0.767
NC_018524_2	2.10|313401|30|NC_018524|PILER-CR	313401-313430	30	NZ_CP052107	Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence	243570-243599	7	0.767
NC_018524_2	2.10|313401|30|NC_018524|PILER-CR	313401-313430	30	NZ_CP022781	Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence	1867105-1867134	7	0.767
NC_018524_2	2.10|313401|30|NC_018524|PILER-CR	313401-313430	30	NZ_CP052117	Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence	243570-243599	7	0.767
NC_018524_2	2.10|313401|30|NC_018524|PILER-CR	313401-313430	30	NZ_CP022793	Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence	237779-237808	7	0.767
NC_018524_2	2.10|313401|30|NC_018524|PILER-CR	313401-313430	30	NZ_CP022785	Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence	237758-237787	7	0.767
NC_018524_2	2.10|313401|30|NC_018524|PILER-CR	313401-313430	30	NZ_CP022787	Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence	234381-234410	7	0.767
NC_018524_2	2.10|313401|30|NC_018524|PILER-CR	313401-313430	30	NZ_CP022756	Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence	232521-232550	7	0.767
NC_018524_2	2.10|313401|30|NC_018524|PILER-CR	313401-313430	30	NZ_CP052121	Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence	243570-243599	7	0.767
NC_018524_2	2.10|313401|30|NC_018524|PILER-CR	313401-313430	30	NZ_CP052131	Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence	245182-245211	7	0.767
NC_018524_2	2.10|313401|30|NC_018524|PILER-CR	313401-313430	30	NZ_CP052073	Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence	243570-243599	7	0.767
NC_018524_2	2.10|313401|30|NC_018524|PILER-CR	313401-313430	30	NZ_CP052109	Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence	243570-243599	7	0.767
NC_018524_2	2.10|313401|30|NC_018524|PILER-CR	313401-313430	30	NZ_CP052111	Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence	1849207-1849236	7	0.767
NC_018524_2	2.10|313401|30|NC_018524|PILER-CR	313401-313430	30	NZ_CP052103	Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence	243570-243599	7	0.767
NC_018524_2	2.10|313401|30|NC_018524|PILER-CR	313401-313430	30	NZ_CP052119	Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence	243570-243599	7	0.767
NC_018524_2	2.10|313401|30|NC_018524|PILER-CR	313401-313430	30	NZ_CP052113	Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence	1849207-1849236	7	0.767
NC_018524_3	3.1|318517|32|NC_018524|CRISPRCasFinder,CRT	318517-318548	32	NC_008269	Rhodococcus jostii RHA1 plasmid pRHL1, complete sequence	1083494-1083525	7	0.781
NC_018524_3	3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318761-318792	32	NZ_CP039924	Agrobacterium tumefaciens strain CFBP7129 plasmid pAtCFBP7129a, complete sequence	55168-55199	7	0.781
NC_018524_3	3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318761-318792	32	NC_024970	Streptomyces aureofaciens strain CCM3239 plasmid pSA3239, complete sequence	133330-133361	7	0.781
NC_018524_3	3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318761-318792	32	NZ_KJ396772	Streptomyces lavendulae subsp. lavendulae strain CCM3239 plasmid pSA3239, complete sequence	133330-133361	7	0.781
NC_018524_3	3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318761-318792	32	NZ_CP024986	Streptomyces lavendulae subsp. lavendulae strain CCM 3239 plasmid pSA3239, complete sequence	107716-107747	7	0.781
NC_018524_3	3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318761-318792	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	1311095-1311126	7	0.781
NC_018524_3	3.7|318883|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318883-318914	32	NZ_CP015867	Streptomyces parvulus strain 2297 plasmid pSPA1, complete sequence	585705-585736	7	0.781
NC_018524_3	3.8|318944|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318944-318975	32	NZ_CP017076	Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence	429922-429953	7	0.781
NC_018524_3	3.8|318944|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318944-318975	32	NZ_LS999564	Escherichia coli isolate EC-TO143 plasmid 5, complete sequence	17207-17238	7	0.781
NC_018524_3	3.8|318944|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318944-318975	32	NZ_CP028999	Klebsiella pneumoniae strain AR_0079 plasmid unnamed2, complete sequence	44707-44738	7	0.781
NC_018524_3	3.8|318944|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318944-318975	32	NZ_CP009146	Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence	1352280-1352311	7	0.781
NC_018524_3	3.8|318944|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318944-318975	32	NZ_CP027258	Escherichia coli strain EC11 plasmid unnamed3, complete sequence	5192-5223	7	0.781
NC_018524_3	3.8|318944|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318944-318975	32	NZ_CP019200	Salmonella enterica subsp. enterica serovar Muenster str. 0315 plasmid pCFSAN001297_01, complete sequence	14129-14160	7	0.781
NC_018524_3	3.8|318944|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318944-318975	32	NZ_CP048281	Rhizobium leguminosarum bv. viciae 248 plasmid pRle248e, complete sequence	451791-451822	7	0.781
NC_018524_3	3.8|318944|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318944-318975	32	NZ_CP021831	Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence	1597668-1597699	7	0.781
NC_018524_3	3.8|318944|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318944-318975	32	NZ_CP026025	Klebsiella pneumoniae strain 11420 plasmid p11420-KPC, complete sequence	8064-8095	7	0.781
NC_018524_3	3.8|318944|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318944-318975	32	NZ_CP018988	Escherichia coli strain Ecol_AZ146 plasmid pECAZ146_3, complete sequence	17207-17238	7	0.781
NC_018524_3	3.8|318944|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318944-318975	32	NZ_MG557999	Escherichia coli strain Eco-36682cz plasmid pEco-36682cz, complete sequence	69510-69541	7	0.781
NC_018524_3	3.8|318944|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318944-318975	32	NZ_MF497781	Citrobacter freundii strain Cfr-36049cz plasmid pCrf-36049cz, complete sequence	69510-69541	7	0.781
NC_018524_3	3.8|318944|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318944-318975	32	NC_011216	Burkholderia phage KS10, complete genome	21853-21884	7	0.781
NC_018524_3	3.13|319248|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	319248-319279	32	NZ_CP050095	Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b1, complete sequence	180460-180491	7	0.781
NC_018524_3	3.13|319248|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	319248-319279	32	NZ_CP050106	Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b5, complete sequence	278119-278150	7	0.781
NC_018524_3	3.13|319248|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	319248-319279	32	NC_008381	Rhizobium leguminosarum bv. viciae 3841 plasmid pRL10, complete sequence	390988-391019	7	0.781
NC_018524_3	3.13|319248|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	319248-319279	32	NZ_CP018232	Rhizobium leguminosarum strain Vaf-108 plasmid unnamed4, complete sequence	123497-123528	7	0.781
NC_018524_3	3.13|319248|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	319248-319279	32	NZ_CP050111	Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b1, complete sequence	278303-278334	7	0.781
NC_018524_4	4.7|321736|32|NC_018524|CRISPRCasFinder,CRT	321736-321767	32	NZ_CP029830	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed1, complete sequence	555832-555863	7	0.781
NC_018524_4	4.9|321858|32|NC_018524|CRISPRCasFinder,CRT	321858-321889	32	NZ_CP032054	Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence	919586-919617	7	0.781
NC_018524_4	4.9|321858|32|NC_018524|CRISPRCasFinder,CRT	321858-321889	32	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	1317490-1317521	7	0.781
NC_018524_4	4.9|321858|32|NC_018524|CRISPRCasFinder,CRT	321858-321889	32	NZ_CP016560	Streptomyces clavuligerus strain F613-1 plasmid pSCL4, complete sequence	576476-576507	7	0.781
NC_018524_4	4.9|321858|32|NC_018524|CRISPRCasFinder,CRT	321858-321889	32	KF306380	Mycobacterium phage DrDrey, complete genome	17852-17883	7	0.781
NC_018524_5	5.1|326532|32|NC_018524|CRISPRCasFinder	326532-326563	32	NZ_CP029452	Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence	672567-672598	7	0.781
NC_018524_5	5.1|326532|32|NC_018524|CRISPRCasFinder	326532-326563	32	NZ_CP023071	Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence	632931-632962	7	0.781
NC_018524_5	5.1|326532|32|NC_018524|CRISPRCasFinder	326532-326563	32	NZ_CP029232	Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence	1439275-1439306	7	0.781
NC_018524_5	5.2|326593|32|NC_018524|CRISPRCasFinder	326593-326624	32	NC_012849	Ralstonia pickettii 12D plasmid pRp12D02, complete sequence	158233-158264	7	0.781
NC_018524_5	5.5|326776|32|NC_018524|CRISPRCasFinder	326776-326807	32	NC_019848	Sinorhizobium meliloti GR4 plasmid pRmeGR4c, complete sequence	780876-780907	7	0.781
NC_018524_5	5.5|326776|32|NC_018524|CRISPRCasFinder	326776-326807	32	NZ_CP021813	Sinorhizobium meliloti strain M270 plasmid psymA, complete sequence	1071998-1072029	7	0.781
NC_018524_5	5.5|326776|32|NC_018524|CRISPRCasFinder	326776-326807	32	NZ_CP021805	Sinorhizobium meliloti strain T073 plasmid psymA, complete sequence	972536-972567	7	0.781
NC_018524_5	5.5|326776|32|NC_018524|CRISPRCasFinder	326776-326807	32	NZ_CP054625	Cupriavidus gilardii strain FDAARGOS_639 plasmid unnamed1, complete sequence	11788-11819	7	0.781
NC_018524_5	5.6|326837|32|NC_018524|CRISPRCasFinder	326837-326868	32	NZ_LN831789	Streptomyces leeuwenhoekii strain type strain (C34 = DSM 42122 = NRRL B-24963) plasmid pSLE2	54238-54269	7	0.781
NC_018524_5	5.7|326532|33|NC_018524|CRT	326532-326564	33	NZ_CP029232	Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence	1439274-1439306	7	0.788
NC_018524_5	5.7|326532|33|NC_018524|CRT	326532-326564	33	NZ_CP029452	Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence	672567-672599	7	0.788
NC_018524_5	5.7|326532|33|NC_018524|CRT	326532-326564	33	NZ_CP023071	Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence	632931-632963	7	0.788
NC_018524_5	5.9|326654|33|NC_018524|CRT	326654-326686	33	NZ_CP029357	Azospirillum sp. CFH 70021 plasmid unnamed2	69805-69837	7	0.788
NC_018524_5	5.13|326594|32|NC_018524|PILER-CR	326594-326625	32	NC_012849	Ralstonia pickettii 12D plasmid pRp12D02, complete sequence	158233-158264	7	0.781
NC_018524_5	5.16|326777|32|NC_018524|PILER-CR	326777-326808	32	NC_019848	Sinorhizobium meliloti GR4 plasmid pRmeGR4c, complete sequence	780876-780907	7	0.781
NC_018524_5	5.16|326777|32|NC_018524|PILER-CR	326777-326808	32	NZ_CP021813	Sinorhizobium meliloti strain M270 plasmid psymA, complete sequence	1071998-1072029	7	0.781
NC_018524_5	5.16|326777|32|NC_018524|PILER-CR	326777-326808	32	NZ_CP021805	Sinorhizobium meliloti strain T073 plasmid psymA, complete sequence	972536-972567	7	0.781
NC_018524_5	5.16|326777|32|NC_018524|PILER-CR	326777-326808	32	NZ_CP054625	Cupriavidus gilardii strain FDAARGOS_639 plasmid unnamed1, complete sequence	11788-11819	7	0.781
NC_018524_5	5.17|326838|32|NC_018524|PILER-CR	326838-326869	32	NZ_LN831789	Streptomyces leeuwenhoekii strain type strain (C34 = DSM 42122 = NRRL B-24963) plasmid pSLE2	54238-54269	7	0.781
NC_018524_11	11.3|2251146|32|NC_018524|PILER-CR,CRT	2251146-2251177	32	NZ_CP012399	Chelatococcus sp. CO-6 plasmid pCO-6, complete sequence	413245-413276	7	0.781
NC_018524_11	11.3|2251146|32|NC_018524|PILER-CR,CRT	2251146-2251177	32	NZ_CP015090	Pelagibaca abyssi strain JLT2014 plasmid pPABY2, complete sequence	113260-113291	7	0.781
NC_018524_11	11.3|2251146|32|NC_018524|PILER-CR,CRT	2251146-2251177	32	NC_017805	Deinococcus gobiensis I-0 plasmid P1, complete sequence	351246-351277	7	0.781
NC_018524_11	11.3|2251146|32|NC_018524|PILER-CR,CRT	2251146-2251177	32	NZ_CP048419	Sphingomonas insulae strain KCTC 12872 plasmid unnamed1, complete sequence	21370-21401	7	0.781
NC_018524_11	11.3|2251146|32|NC_018524|PILER-CR,CRT	2251146-2251177	32	NZ_CP025584	Paracoccus jeotgali strain CBA4604 plasmid pCBA4604-01, complete sequence	1034-1065	7	0.781
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP016613	Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence	1732228-1732259	7	0.781
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP021449	Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence	1513921-1513952	7	0.781
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	CP023013	Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence	907198-907229	7	0.781
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP049790	Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence	1119229-1119260	7	0.781
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP049794	Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence	1552618-1552649	7	0.781
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP049788	Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence	822462-822493	7	0.781
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP022766	Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence	980468-980499	7	0.781
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP021763	Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence	999260-999291	7	0.781
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP015116	Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence	1174817-1174848	7	0.781
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP016555	Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence	896242-896273	7	0.781
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP049792	Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence	1327779-1327810	7	0.781
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP052069	Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence	898685-898716	7	0.781
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP016915	Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence	1714713-1714744	7	0.781
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP016905	Ralstonia solanacearum strain KACC 10709 plasmid unnamed1	127775-127806	7	0.781
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	1503662-1503693	7	0.781
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP022769	Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence	986301-986332	7	0.781
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP022773	Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence	704263-704294	7	0.781
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP022783	Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence	910800-910831	7	0.781
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP022791	Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence	813998-814029	7	0.781
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP022795	Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence	909405-909436	7	0.781
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP052071	Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence	1259338-1259369	7	0.781
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP022482	Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence	177936-177967	7	0.781
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP009763	Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence	907897-907928	7	0.781
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	CP023015	Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence	1079918-1079949	7	0.781
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP022779	Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence	986290-986321	7	0.781
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP052075	Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence	1259305-1259336	7	0.781
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP052085	Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence	977471-977502	7	0.781
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP052095	Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence	1020415-1020446	7	0.781
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP052105	Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence	1258110-1258141	7	0.781
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP021765	Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence	999306-999337	7	0.781
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP052077	Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence	872914-872945	7	0.781
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP052087	Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence	977471-977502	7	0.781
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP052097	Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence	1020415-1020446	7	0.781
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP052115	Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence	1258147-1258178	7	0.781
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP052127	Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence	977471-977502	7	0.781
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP052079	Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence	872937-872968	7	0.781
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP052089	Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence	977475-977506	7	0.781
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP052093	Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence	1020415-1020446	7	0.781
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP052101	Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence	1020415-1020446	7	0.781
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP052099	Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence	1020415-1020446	7	0.781
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP052107	Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence	1258147-1258178	7	0.781
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP022781	Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence	1054574-1054605	7	0.781
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP052117	Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence	1258136-1258167	7	0.781
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP052125	Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence	872937-872968	7	0.781
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP022793	Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence	912198-912229	7	0.781
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP022785	Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence	892881-892912	7	0.781
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP022787	Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence	940826-940857	7	0.781
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP022756	Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence	986976-987007	7	0.781
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP052129	Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence	1164745-1164776	7	0.781
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP052121	Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence	1258136-1258167	7	0.781
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP052123	Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence	872937-872968	7	0.781
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP052131	Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence	977471-977502	7	0.781
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	CP011998	Ralstonia solanacearum strain YC45 plasmid, complete sequence	1186870-1186901	7	0.781
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP052073	Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence	1259303-1259334	7	0.781
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP052081	Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence	872937-872968	7	0.781
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP052083	Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence	872937-872968	7	0.781
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP052109	Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence	1258147-1258178	7	0.781
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP052091	Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence	1020417-1020448	7	0.781
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP052111	Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence	1079495-1079526	7	0.781
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP052103	Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence	1258158-1258189	7	0.781
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP052119	Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence	1258136-1258167	7	0.781
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP052113	Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence	1079495-1079526	7	0.781
NC_018524_11	11.8|2251452|32|NC_018524|PILER-CR,CRT	2251452-2251483	32	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	1635394-1635425	7	0.781
NC_018524_11	11.16|2251448|36|NC_018524|CRISPRCasFinder	2251448-2251483	36	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	1635394-1635429	7	0.806
NC_018524_11	11.18|2251513|32|NC_018524|CRT	2251513-2251544	32	NZ_CP019459	Streptomyces autolyticus strain CGMCC0516 plasmid unnamed2, complete sequence	4685-4716	7	0.781
NC_018524_11	11.18|2251513|32|NC_018524|CRT	2251513-2251544	32	NZ_CP019459	Streptomyces autolyticus strain CGMCC0516 plasmid unnamed2, complete sequence	20285-20316	7	0.781
NC_018524_11	11.18|2251513|32|NC_018524|CRT	2251513-2251544	32	NZ_CP019459	Streptomyces autolyticus strain CGMCC0516 plasmid unnamed2, complete sequence	35884-35915	7	0.781
NC_018524_11	11.18|2251513|32|NC_018524|CRT	2251513-2251544	32	NZ_CP019461	Streptomyces autolyticus strain CGMCC0516 plasmid unnamed4, complete sequence	12177-12208	7	0.781
NC_018524_11	11.18|2251513|32|NC_018524|CRT	2251513-2251544	32	NZ_CP019462	Streptomyces autolyticus strain CGMCC0516 plasmid unnamed5, complete sequence	12168-12199	7	0.781
NC_018524_11	11.18|2251513|32|NC_018524|CRT	2251513-2251544	32	NZ_CP019463	Streptomyces autolyticus strain CGMCC0516 plasmid unnamed6, complete sequence	11787-11818	7	0.781
NC_018524_11	11.18|2251513|32|NC_018524|CRT	2251513-2251544	32	NZ_CP019464	Streptomyces autolyticus strain CGMCC0516 plasmid unnamed7, complete sequence	14935-14966	7	0.781
NC_018524_11	11.18|2251513|32|NC_018524|CRT	2251513-2251544	32	NC_042088	Gordonia phage Gustav, complete genome	12883-12914	7	0.781
NC_018524_12	12.1|2254172|29|NC_018524|PILER-CR	2254172-2254200	29	MT740733	Ralstonia phage Dimitile, complete genome	15408-15436	7	0.759
NC_018524_12	12.1|2254172|29|NC_018524|PILER-CR	2254172-2254200	29	MT740738	Ralstonia phage Gamede, complete genome	11829-11857	7	0.759
NC_018524_12	12.1|2254172|29|NC_018524|PILER-CR	2254172-2254200	29	MT740736	Ralstonia phage Eline, complete genome	17385-17413	7	0.759
NC_018524_12	12.1|2254172|29|NC_018524|PILER-CR	2254172-2254200	29	MT740730	Ralstonia phage Cimandef, complete genome	29030-29058	7	0.759
NC_018524_12	12.1|2254172|29|NC_018524|PILER-CR	2254172-2254200	29	MT740739	Ralstonia phage Gerry, complete genome	3633-3661	7	0.759
NC_018524_12	12.1|2254172|29|NC_018524|PILER-CR	2254172-2254200	29	MT740742	Ralstonia phage Heva, complete genome	44686-44714	7	0.759
NC_018524_12	12.1|2254172|29|NC_018524|PILER-CR	2254172-2254200	29	MT740727	Ralstonia phage Alix, complete genome	47343-47371	7	0.759
NC_018524_12	12.1|2254172|29|NC_018524|PILER-CR	2254172-2254200	29	MT361768	Ralstonia phage RPZH6, complete genome	6537-6565	7	0.759
NC_018524_12	12.1|2254172|29|NC_018524|PILER-CR	2254172-2254200	29	MT740731	Ralstonia phage Claudette, complete genome	28847-28875	7	0.759
NC_018524_12	12.1|2254172|29|NC_018524|PILER-CR	2254172-2254200	29	MH638294	Ralstonia phage GP4, complete genome	5442-5470	7	0.759
NC_018524_14	14.2|2268321|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	2268321-2268352	32	NZ_CP024582	Roseomonas sp. FDAARGOS_362 plasmid unnamed1, complete sequence	146031-146062	7	0.781
NC_018524_14	14.6|2268565|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	2268565-2268596	32	NZ_CP023549	Rhodobacter sp. CZR27 plasmid unnamed1, complete sequence	116912-116943	7	0.781
NC_018524_15	15.2|2270398|32|NC_018524|CRISPRCasFinder	2270398-2270429	32	NZ_CP026091	Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence	487995-488026	7	0.781
NC_018524_15	15.2|2270398|32|NC_018524|CRISPRCasFinder	2270398-2270429	32	NZ_CP026093	Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence	488011-488042	7	0.781
NC_018524_15	15.2|2270398|32|NC_018524|CRISPRCasFinder	2270398-2270429	32	NZ_CP012940	Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence	1514590-1514621	7	0.781
NC_018524_15	15.2|2270398|32|NC_018524|CRISPRCasFinder	2270398-2270429	32	NZ_CP012944	Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence	1386097-1386128	7	0.781
NC_018524_15	15.2|2270398|32|NC_018524|CRISPRCasFinder	2270398-2270429	32	NC_017575	Ralstonia solanacearum Po82 megaplasmid, complete sequence	487752-487783	7	0.781
NC_018524_15	15.2|2270398|32|NC_018524|CRISPRCasFinder	2270398-2270429	32	NZ_CP026308	Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence	487748-487779	7	0.781
NC_018524_15	15.2|2270398|32|NC_018524|CRISPRCasFinder	2270398-2270429	32	NZ_CP051295	Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence	1499163-1499194	7	0.781
NC_018524_15	15.5|2270581|32|NC_018524|CRISPRCasFinder	2270581-2270612	32	NZ_CP017244	Rhizobium etli 8C-3 plasmid pRsp8C3c, complete sequence	1918909-1918940	7	0.781
NC_018524_15	15.12|2271008|32|NC_018524|CRISPRCasFinder	2271008-2271039	32	NZ_CP018075	Streptomyces venezuelae strain NRRL B-65442 plasmid, complete sequence	41344-41375	7	0.781
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MH590593	Mycobacterium phage Rabinovish, complete genome	117601-117629	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	KX781992	Mycobacterium phage Gabriel, complete genome	115630-115658	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MH697579	Mycobacterium phage Cane17, complete genome	120091-120119	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MK112554	Mycobacterium phage TinyTim, complete genome	116084-116112	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MK359314	Mycobacterium phage Ewok, complete genome	117028-117056	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MK359337	Mycobacterium phage Flabslab, complete genome	115073-115101	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MN234193	Mycobacterium phage Kboogie, complete genome	116451-116479	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MK450432	Mycobacterium phage ValleyTerrace, complete genome	115997-116025	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MH051261	Mycobacterium phage Tyke, complete genome	117913-117941	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MH779502	Mycobacterium phage FudgeTart, complete genome	116175-116203	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MK359365	Mycobacterium phage Loanshark, complete genome	116559-116587	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MK359311	Mycobacterium phage SmallFry, complete genome	115801-115829	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MK359364	Mycobacterium phage ChickenPhender, complete genome	115656-115684	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MK359303	Mycobacterium phage Shnickers, complete genome	115707-115735	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MH697586	Mycobacterium phage InigoMontoya, complete genome	116661-116689	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MK112549	Mycobacterium phage Morizzled23, complete genome	115364-115392	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MK112541	Mycobacterium phage Jessibeth14, complete genome	117777-117805	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MK359347	Mycobacterium phage Ading, complete genome	117581-117609	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MK450425	Mycobacterium phage Shelob, complete genome	118609-118637	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	NC_023714	Mycobacterium phage LinStu, complete genome	116736-116764	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MK359358	Mycobacterium phage Essence, complete genome	115892-115920	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	KJ595575	Mycobacterium phage Willis, complete genome	116895-116923	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MG812493	Mycobacterium phage NuevoMundo, complete genome	118987-119015	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MK359339	Mycobacterium phage Naija, complete genome	116700-116728	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MK359333	Mycobacterium phage JustHall, complete genome	115793-115821	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	KT321476	Mycobacterium phage Zeenon, complete genome	117295-117323	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MN428065	Mycobacterium phage Cactojaque, complete genome	115529-115557	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MK359306	Mycobacterium phage Norm, complete genome	117435-117463	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MN735434	Mycobacterium phage Mangeria, complete genome	117790-117818	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	JN699625	Mycobacterium phage Wally, complete genome	115981-116009	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	EU826471	Mycobacterium phage Cali, complete genome	117476-117504	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	KX721255	Mycobacterium phage Yucca, complete genome	117643-117671	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MK359366	Mycobacterium phage Basquiat, complete genome	115509-115537	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MK359346	Mycobacterium phage NoodleTree, complete genome	117433-117461	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	JN699013	Mycobacterium phage Pio, complete genome	119724-119752	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MK359361	Mycobacterium phage Darko, complete genome	116234-116262	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	NC_023725	Mycobacterium phage Nappy, complete genome	118394-118422	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MK359348	Mycobacterium phage Rahel, complete genome	116435-116463	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MH779498	Mycobacterium phage Bread, complete genome	116100-116128	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MK450427	Mycobacterium phage Adlitam, complete genome	116185-116213	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MG812494	Mycobacterium phage Pier, complete genome	118532-118560	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	GQ303262	Mycobacterium phage LRRHood, complete genome	116449-116477	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MT818423	Mycobacterium phage Janiyra, complete genome	116886-116914	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MH316567	Mycobacterium phage ParkTD, complete genome	116997-117025	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	AY129337	Mycobacteriophage Bxz1, complete genome	119069-119097	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MH051260	Mycobacterium phage InterFolia, complete genome	118359-118387	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	KX721256	Mycobacterium phage Erdmann, complete genome	117110-117138	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MK359328	Mycobacterium phage EmmaElysia, complete genome	117442-117470	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	KM881426	Mycobacterium phage ZygoTaiga	117915-117943	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MK359335	Mycobacterium phage Patter, complete genome	116011-116039	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MT889395	Mycobacterium phage Shifa, complete genome	116220-116248	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	EU826467	Mycobacterium phage Rizal, complete genome	114953-114981	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MT723944	Mycobacterium phage ChaylaJr, complete genome	116209-116237	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	KR080196	Mycobacterium phage Momo, complete genome	115997-116025	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MH910040	Mycobacterium phage Sauce, complete genome	115652-115680	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MF919495	Mycobacterium phage Bigswole, complete genome	119460-119488	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MK359318	Mycobacterium phage Specks, complete genome	118110-118138	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	KF024734	Mycobacterium phage Shrimp, complete genome	117764-117792	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MK112548	Mycobacterium phage McWolfish, complete genome	116455-116483	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MK359308	Mycobacterium phage Shaqnato, complete genome	115869-115897	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MK112545	Mycobacterium phage Khaleesi, complete genome	117244-117272	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MH825697	Mycobacterium phage Bangla1971, complete genome	116003-116031	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MK359338	Mycobacterium phage Amataga, complete genome	115997-116025	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MK359350	Mycobacterium phage Nidhogg, complete genome	117526-117554	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MT723945	Mycobacterium phage Quasimodo, complete genome	117326-117354	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MK359342	Mycobacterium phage ShiaLabeouf, complete genome	115643-115671	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MH316561	Mycobacterium phage Derek, complete genome	116563-116591	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MK112533	Mycobacterium phage Bonray, complete genome	118102-118130	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MK450422	Mycobacterium phage RoMag, complete genome	116746-116774	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MK359327	Mycobacterium phage EmToTheThree, complete genome	117151-117179	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MH727543	Mycobacterium phage CharlieB, complete genome	116237-116265	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	JF704116	Mycobacterium phage Drazdys, complete genome	116680-116708	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MK359336	Mycobacterium phage Chargie21, complete genome	115509-115537	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MK359355	Mycobacterium phage Sprinklers, complete genome	116359-116387	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MK112534	Mycobacterium phage Burrough, complete genome	117870-117898	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MF919499	Mycobacterium phage Daffodil, complete genome	117000-117028	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MK359334	Mycobacterium phage Delilah, complete genome	117118-117146	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	NC_023696	Mycobacterium phage Dandelion, complete genome	120633-120661	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MN276192	Mycobacterium phage Trinitium, complete genome	115831-115859	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MK359324	Mycobacterium phage Tortoise16, complete genome	116546-116574	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MH825713	Mycobacterium phage Zalkecks, complete genome	116724-116752	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MK359349	Mycobacterium phage FoxtrotP1, complete genome	117708-117736	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	JF704096	Mycobacterium phage Ghost, complete sequence	115908-115936	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MN062707	Mycobacterium phage Grungle, complete genome	113945-113973	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MK359344	Mycobacterium phage Napoleon13, complete genome	115728-115756	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MH727558	Mycobacterium phage Salacia, complete genome	116838-116866	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MK359363	Mycobacterium phage Fludd, complete genome	116464-116492	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	KX831080	Mycobacterium phage Lukilu, complete genome	117459-117487	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MK359329	Mycobacterium phage Kamryn, complete genome	117423-117451	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	JQ911768	Mycobacterium phage Ava3, complete genome	116431-116459	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	NC_004687	Mycobacterium phage Bxz1, complete genome	119069-119097	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	NC_011270	Mycobacterium phage Spud, complete genome	116071-116099	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MN183280	Mycobacteriophage LolaVinca, complete genome	117789-117817	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MK359345	Mycobacterium phage QBert, complete genome	116056-116084	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	GQ303260	Mycobacterium phage ET08, complete genome	116271-116299	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MH744422	Mycobacterium phage Roots515, complete genome	118254-118282	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MK359321	Mycobacterium phage Phusco, complete genome	115532-115560	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MK359362	Mycobacterium phage Atlantean, complete genome	115997-116025	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	EU826469	Mycobacterium phage ScottMcG, complete genome	115731-115759	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MK310143	Mycobacterium phage Dietrick, complete genome	115239-115267	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MK450429	Mycobacterium phage Bipolarisk, complete genome	116700-116728	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MH051266	Mycobacterium phage MikeLiesIn, complete genome	117882-117910	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	NC_029044	Mycobacterium phage Breeniome, complete genome	115554-115582	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MH669008	Mycobacterium phage Megamind, complete genome	116746-116774	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MK878897	Mycobacterium phage Blackbrain, complete genome	116594-116622	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MK450434	Mycobacterium phage DrPhinkDaddy, complete genome	117778-117806	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MK359359	Mycobacterium phage Colt, complete genome	119322-119350	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MF919527	Mycobacterium phage Phox, complete genome	117655-117683	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MT818416	Mycobacterium phage BackyardAgain, complete genome	114955-114983	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MK359330	Mycobacterium phage Iota, complete genome	116346-116374	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	KT365398	Mycobacterium phage DTDevon, complete genome	118035-118063	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	KX369583	Mycobacterium phage Littleton, complete genome	117234-117262	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MF919494	Mycobacterium phage BeanWater, complete genome	116035-116063	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	NC_028869	Mycobacterium phage HyRo, complete genome	116251-116279	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	KT365400	Mycobacterium phage ErnieJ, complete genome	114931-114959	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	KC691257	Mycobacterium phage Astraea, complete genome	115601-115629	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MG872839	Mycobacterium phage LifeSavor, complete genome	116522-116550	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	KC748968	Mycobacterium phage Gizmo, complete genome	119026-119054	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	KC748970	Mycobacterium phage ArcherS7, complete genome	117039-117067	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MK359353	Mycobacterium phage BadAgartude, complete genome	116099-116127	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MH697590	Mycobacterium phage Phlegm, complete genome	116700-116728	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MK359317	Mycobacterium phage FrayBell, complete genome	116554-116582	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MT553335	Mycobacterium phage Ronan, complete genome	115138-115166	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MN428066	Mycobacterium phage JPickles, complete genome	114646-114674	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MK359305	Mycobacterium phage Teardrop, complete genome	115303-115331	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	DQ398053	Mycobacteriophage Catera, complete genome	115210-115238	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MF919513	Mycobacterium phage Koguma, complete genome	116104-116132	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	JN699626	Mycobacterium phage MoMoMixon, complete genome	116921-116949	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	NC_028986	Mycobacterium phage Alice, complete sequence	116153-116181	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MK450424	Mycobacterium phage Melpomini, complete genome	115531-115559	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	JN204348	Mycobacterium phage Sebata, complete genome	118161-118189	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MN183285	Mycobacterium phage YoungMoneyMata, complete genome	116465-116493	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MK450423	Mycobacterium phage Stubby, complete genome	116111-116139	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MF919493	Mycobacterium phage Audrick, complete genome	115887-115915	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	NC_008207	Mycobacterium phage Catera, complete genome	115210-115238	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	JN624850	Mycobacterium phage Pleione, complete genome	117475-117503	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	KX752698	Mycobacterium phage Tonenili, complete genome	122889-122917	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MK359326	Mycobacterium phage Pivoine, complete genome	116700-116728	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	NZ_CP032324	Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence	15835-15863	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	1114151-1114179	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	NZ_CP032054	Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence	335946-335974	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	NZ_CP032054	Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence	715881-715909	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	NZ_CP016560	Streptomyces clavuligerus strain F613-1 plasmid pSCL4, complete sequence	373137-373165	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	NZ_CP029452	Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence	1345740-1345768	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	NZ_CP023071	Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence	1322428-1322456	7	0.759
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	NZ_CP023976	Streptomyces alboflavus strain MDJK44 plasmid pMDJK44.1, complete sequence	137821-137849	7	0.759
NC_018524_18	18.2|2357908|28|NC_018524|CRISPRCasFinder	2357908-2357935	28	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	707018-707045	7	0.75
NC_018524_18	18.2|2357908|28|NC_018524|CRISPRCasFinder	2357908-2357935	28	NC_015314	Pseudonocardia dioxanivorans CB1190 plasmid pPSED01, complete sequence	76906-76933	7	0.75
NC_018524_18	18.2|2357908|28|NC_018524|CRISPRCasFinder	2357908-2357935	28	NC_017958	Tistrella mobilis KA081020-065 plasmid pTM3, complete sequence	834674-834701	7	0.75
NC_018524_19	19.5|4409022|32|NC_018524|CRT	4409022-4409053	32	NZ_CP007129	Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence	662178-662209	7	0.781
NC_018524_21	21.12|4582845|33|NC_018524|PILER-CR	4582845-4582877	33	NZ_CP045120	Rubrobacter sp. SCSIO 52909 plasmid unnamed1, complete sequence	28761-28793	7	0.788
NC_018524_21	21.12|4582845|33|NC_018524|PILER-CR	4582845-4582877	33	LN997843	Streptomyces reticuli genome assembly TUE45, plasmid : II	69715-69747	7	0.788
NC_018524_21	21.18|4582419|32|NC_018524|CRISPRCasFinder,CRT	4582419-4582450	32	MN445183	Salmonella phage vB_SalM_SA002, complete genome	270383-270414	7	0.781
NC_018524_21	21.19|4582480|32|NC_018524|CRISPRCasFinder,CRT	4582480-4582511	32	KX066068	Pseudomonas phage VSW-3, complete genome	14013-14044	7	0.781
NC_018524_21	21.20|4582541|32|NC_018524|CRISPRCasFinder,CRT	4582541-4582572	32	NC_012586	Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence	1422782-1422813	7	0.781
NC_018524_21	21.20|4582541|32|NC_018524|CRISPRCasFinder,CRT	4582541-4582572	32	NZ_CP029452	Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence	1225500-1225531	7	0.781
NC_018524_21	21.20|4582541|32|NC_018524|CRISPRCasFinder,CRT	4582541-4582572	32	NZ_CP023071	Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence	1234980-1235011	7	0.781
NC_018524_21	21.20|4582541|32|NC_018524|CRISPRCasFinder,CRT	4582541-4582572	32	NZ_CP029232	Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence	856288-856319	7	0.781
NC_018524_21	21.25|4582846|32|NC_018524|CRISPRCasFinder,CRT	4582846-4582877	32	NZ_CP045120	Rubrobacter sp. SCSIO 52909 plasmid unnamed1, complete sequence	28761-28792	7	0.781
NC_018524_21	21.25|4582846|32|NC_018524|CRISPRCasFinder,CRT	4582846-4582877	32	LN997843	Streptomyces reticuli genome assembly TUE45, plasmid : II	69716-69747	7	0.781
NC_018524_21	21.25|4582846|32|NC_018524|CRISPRCasFinder,CRT	4582846-4582877	32	NZ_CP032685	Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence	497476-497507	7	0.781
NC_018524_21	21.25|4582846|32|NC_018524|CRISPRCasFinder,CRT	4582846-4582877	32	NZ_CP032690	Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence	497484-497515	7	0.781
NC_018524_21	21.25|4582846|32|NC_018524|CRISPRCasFinder,CRT	4582846-4582877	32	NZ_LR134460	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 18, complete sequence	237592-237623	7	0.781
NC_018524_23	23.5|4591847|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4591847-4591878	32	NZ_CP023408	Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence	218712-218743	7	0.781
NC_018524_23	23.8|4592030|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4592030-4592061	32	NC_008384	Rhizobium leguminosarum bv. viciae 3841 plasmid pRL11, complete sequence	33328-33359	7	0.781
NC_018524_23	23.8|4592030|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4592030-4592061	32	NZ_CP018230	Rhizobium leguminosarum strain Vaf-108 plasmid unnamed2, complete sequence	371952-371983	7	0.781
NC_018524_23	23.8|4592030|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4592030-4592061	32	NZ_CP048282	Rhizobium leguminosarum bv. viciae 248 plasmid pRle248d, complete sequence	32667-32698	7	0.781
NC_018524_23	23.8|4592030|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4592030-4592061	32	NZ_CP053208	Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1B, complete sequence	33788-33819	7	0.781
NC_018524_23	23.9|4592091|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4592091-4592122	32	NZ_CP007797	Azospirillum brasilense strain Az39 plasmid AbAZ39_p4, complete sequence	600826-600857	7	0.781
NC_018524_23	23.9|4592091|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4592091-4592122	32	NZ_AP022319	Burkholderia sp. THE68 plasmid BTHE68_p1, complete sequence	821326-821357	7	0.781
NC_018524_23	23.9|4592091|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4592091-4592122	32	NZ_CP032348	Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence	67073-67104	7	0.781
NC_018524_25	25.5|4595383|32|NC_018524|CRISPRCasFinder	4595383-4595414	32	FJ937737	Burkholderia cenocepacia phage BcepIL02, complete genome	33680-33711	7	0.781
NC_018524_25	25.5|4595383|32|NC_018524|CRISPRCasFinder	4595383-4595414	32	NC_012743	Burkholderia phage BcepIL02, complete genome	33680-33711	7	0.781
NC_018524_25	25.7|4595504|32|NC_018524|CRISPRCasFinder	4595504-4595535	32	NZ_CP030127	Indioceanicola profundi strain SCSIO 08040 plasmid unnamed1, complete sequence	1060095-1060126	7	0.781
NC_018524_25	25.8|4595565|32|NC_018524|CRISPRCasFinder	4595565-4595596	32	NC_005009	Pseudomonas putida plasmid pYQ39, complete sequence	1769-1800	7	0.781
NC_018524_25	25.8|4595565|32|NC_018524|CRISPRCasFinder	4595565-4595596	32	NZ_CP028351	Pantoea vagans strain PV989 plasmid pPV989-167, complete sequence	95850-95881	7	0.781
NC_018524_25	25.8|4595565|32|NC_018524|CRISPRCasFinder	4595565-4595596	32	NZ_CP038855	Pantoea vagans strain LMG 24199 plasmid unnamed2, complete sequence	52679-52710	7	0.781
NC_018524_25	25.8|4595565|32|NC_018524|CRISPRCasFinder	4595565-4595596	32	NC_014561	Pantoea vagans C9-1 plasmid pPag1, complete sequence	107317-107348	7	0.781
NC_018524_26	26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT	4598633-4598664	32	NZ_CP030841	Acidisarcina polymorpha strain SBC82 plasmid pACPOL1, complete sequence	45949-45980	7	0.781
NC_018524_26	26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT	4598633-4598664	32	NZ_CP030842	Acidisarcina polymorpha strain SBC82 plasmid pACPOL2, complete sequence	6878-6909	7	0.781
NC_018524_26	26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT	4598633-4598664	32	NZ_CP030843	Acidisarcina polymorpha strain SBC82 plasmid pACPOL4, complete sequence	71003-71034	7	0.781
NC_018524_26	26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT	4598633-4598664	32	MK376962	Gordonia phage NosilaM, complete genome	32895-32926	7	0.781
NC_018524_26	26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT	4598633-4598664	32	NZ_AP021845	Azospira sp. I09 plasmid pAZI09, complete sequence	248405-248436	7	0.781
NC_018524_26	26.18|4598755|32|NC_018524|CRISPRCasFinder,CRT	4598755-4598786	32	MT498057	Microbacterium phage Cicada, complete genome	30581-30612	7	0.781
NC_018524_26	26.18|4598755|32|NC_018524|CRISPRCasFinder,CRT	4598755-4598786	32	MK016497	Microbacterium phage Johann, complete genome	30351-30382	7	0.781
NC_018524_26	26.18|4598755|32|NC_018524|CRISPRCasFinder,CRT	4598755-4598786	32	MN369765	Microbacterium phage Zanella, complete genome	30263-30294	7	0.781
NC_018524_26	26.18|4598755|32|NC_018524|CRISPRCasFinder,CRT	4598755-4598786	32	MK016495	Microbacterium phage Goodman, complete genome	30351-30382	7	0.781
NC_018524_26	26.20|4598877|32|NC_018524|CRISPRCasFinder,CRT	4598877-4598908	32	NC_016585	Azospirillum lipoferum 4B plasmid AZO_p1, complete sequence	684079-684110	7	0.781
NC_018524_26	26.20|4598877|32|NC_018524|CRISPRCasFinder,CRT	4598877-4598908	32	NZ_LR134456	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 14, complete sequence	85106-85137	7	0.781
NC_018524_26	26.20|4598877|32|NC_018524|CRISPRCasFinder,CRT	4598877-4598908	32	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	985599-985630	7	0.781
NC_018524_26	26.20|4598877|32|NC_018524|CRISPRCasFinder,CRT	4598877-4598908	32	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	827526-827557	7	0.781
NC_018524_26	26.20|4598877|32|NC_018524|CRISPRCasFinder,CRT	4598877-4598908	32	NZ_CP030074	Streptomyces sp. ZFG47 plasmid unnamed1, complete sequence	654544-654575	7	0.781
NC_018524_26	26.21|4598938|32|NC_018524|CRISPRCasFinder,CRT	4598938-4598969	32	NZ_CP013381	Burkholderia sp. Bp5365 strain MSMB43 plasmid pMSMB43, complete sequence	277412-277443	7	0.781
NC_018524_26	26.21|4598938|32|NC_018524|CRISPRCasFinder,CRT	4598938-4598969	32	NZ_CP029357	Azospirillum sp. CFH 70021 plasmid unnamed2	469203-469234	7	0.781
NC_018524_26	26.21|4598938|32|NC_018524|CRISPRCasFinder,CRT	4598938-4598969	32	NZ_CP009547	Burkholderia sp. 2002721687 plasmid pBTU, complete sequence	145560-145591	7	0.781
NC_018524_26	26.23|4599060|32|NC_018524|CRISPRCasFinder,CRT	4599060-4599091	32	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	46715-46746	7	0.781
NC_018524_26	26.23|4599060|32|NC_018524|CRISPRCasFinder,CRT	4599060-4599091	32	NC_013855	Azospirillum sp. B510 plasmid pAB510a, complete sequence	1351660-1351691	7	0.781
NC_018524_26	26.23|4599060|32|NC_018524|CRISPRCasFinder,CRT	4599060-4599091	32	NZ_CP054618	Azospirillum oryzae strain KACC 14407 plasmid unnamed4, complete sequence	33522-33553	7	0.781
NC_018524_26	26.23|4599060|32|NC_018524|CRISPRCasFinder,CRT	4599060-4599091	32	NC_009621	Sinorhizobium medicae WSM419 plasmid pSMED02, complete sequence	629919-629950	7	0.781
NC_018524_26	26.23|4599060|32|NC_018524|CRISPRCasFinder,CRT	4599060-4599091	32	NZ_CP016452	Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence	654851-654882	7	0.781
NC_018524_26	26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT	4599243-4599274	32	MG869619	Polaromonas sp. H1N plasmid pH1NP1, complete sequence	8331-8362	7	0.781
NC_018524_26	26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT	4599243-4599274	32	MG869622	Polaromonas sp. H8N plasmid pH8NP2, complete sequence	16710-16741	7	0.781
NC_018524_26	26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT	4599243-4599274	32	NZ_LN868941	Nocardia farcinica strain NCTC11134 plasmid 4, complete sequence	28971-29002	7	0.781
NC_018524_26	26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT	4599243-4599274	32	NZ_CP031419	Nocardia farcinica strain W6977 plasmid unnamed1, complete sequence	67561-67592	7	0.781
NC_018524_26	26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT	4599243-4599274	32	NC_006911	Streptomyces sp. F11 plasmid pFP11, complete sequence	32349-32380	7	0.781
NC_018524_27	27.1|4607990|32|NC_018524|CRISPRCasFinder	4607990-4608021	32	MH513974	Gordonia phage LastResort, complete genome	48279-48310	7	0.781
NC_018524_27	27.1|4607990|32|NC_018524|CRISPRCasFinder	4607990-4608021	32	KX557283	Gordonia phage Remus, complete genome	48600-48631	7	0.781
NC_018524_27	27.1|4607990|32|NC_018524|CRISPRCasFinder	4607990-4608021	32	MT522007	Gordonia phage Epsocamisio, complete genome	48188-48219	7	0.781
NC_018524_27	27.1|4607990|32|NC_018524|CRISPRCasFinder	4607990-4608021	32	KX557280	Gordonia phage JSwag, complete genome	48036-48067	7	0.781
NC_018524_27	27.1|4607990|32|NC_018524|CRISPRCasFinder	4607990-4608021	32	NC_042123	Gordonia phage Waits, complete genome	48231-48262	7	0.781
NC_018524_27	27.1|4607990|32|NC_018524|CRISPRCasFinder	4607990-4608021	32	NC_041886	Gordonia phage Strosahl, complete genome	48600-48631	7	0.781
NC_018524_28	28.1|4608658|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4608658-4608689	32	NZ_CP015739	Shinella sp. HZN7 plasmid pShin-03, complete sequence	22385-22416	7	0.781
NC_018524_28	28.1|4608658|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4608658-4608689	32	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	1428013-1428044	7	0.781
NC_018524_28	28.1|4608658|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4608658-4608689	32	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	385244-385275	7	0.781
NC_018524_28	28.1|4608658|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4608658-4608689	32	NZ_CP013635	Rhizobium sp. N324 plasmid pRspN324e, complete sequence	48208-48239	7	0.781
NC_018524_28	28.1|4608658|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4608658-4608689	32	NC_008308	Sphingomonas sp. KA1 plasmid pCAR3 DNA, complete sequence	145563-145594	7	0.781
NC_018524_28	28.1|4608658|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4608658-4608689	32	NZ_CP054028	Rhizobium sp. JKLM19E plasmid pPR19E01, complete sequence	1349433-1349464	7	0.781
NC_018524_28	28.2|4608719|33|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4608719-4608751	33	NC_016626	Burkholderia sp. YI23 plasmid byi_1p, complete sequence	1378027-1378059	7	0.788
NC_018524_28	28.4|4608842|32|NC_018524|CRISPRCasFinder,CRT	4608842-4608873	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	3775085-3775116	7	0.781
NC_018524_30	30.2|4637791|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637791-4637822	32	NZ_CP025013	Rhizobium leguminosarum strain Norway plasmid pRLN1, complete sequence	565911-565942	7	0.781
NC_018524_30	30.2|4637791|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637791-4637822	32	NZ_LR594691	Variovorax sp. WDL1 plasmid 3	705-736	7	0.781
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	180551-180582	7	0.781
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	1632566-1632597	7	0.781
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	NC_008697	Nocardioides sp. JS614 plasmid pNOCA01, complete sequence	32123-32154	7	0.781
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	NZ_CP007792	Corynebacterium marinum DSM 44953 plasmid pCmarinum1, complete sequence	26770-26801	7	0.781
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	NZ_CP015269	Mycobacterium chimaera strain ZUERICH-2 plasmid unnamed 2, complete sequence	82752-82783	7	0.781
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	CP006583	Mesorhizobium huakuii 7653R plasmid pMHb, complete sequence	21322-21353	7	0.781
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	CP006583	Mesorhizobium huakuii 7653R plasmid pMHb, complete sequence	114525-114556	7	0.781
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	CP006583	Mesorhizobium huakuii 7653R plasmid pMHb, complete sequence	131512-131543	7	0.781
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	CP006583	Mesorhizobium huakuii 7653R plasmid pMHb, complete sequence	163599-163630	7	0.781
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	CP006583	Mesorhizobium huakuii 7653R plasmid pMHb, complete sequence	211164-211195	7	0.781
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	CP006583	Mesorhizobium huakuii 7653R plasmid pMHb, complete sequence	360457-360488	7	0.781
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	CP006583	Mesorhizobium huakuii 7653R plasmid pMHb, complete sequence	376165-376196	7	0.781
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	CP006583	Mesorhizobium huakuii 7653R plasmid pMHb, complete sequence	413548-413579	7	0.781
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	CP006582	Mesorhizobium huakuii 7653R plasmid pMHa, complete sequence	10004-10035	7	0.781
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	CP006582	Mesorhizobium huakuii 7653R plasmid pMHa, complete sequence	114294-114325	7	0.781
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	CP006582	Mesorhizobium huakuii 7653R plasmid pMHa, complete sequence	129380-129411	7	0.781
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	CP006582	Mesorhizobium huakuii 7653R plasmid pMHa, complete sequence	134244-134275	7	0.781
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	CP006582	Mesorhizobium huakuii 7653R plasmid pMHa, complete sequence	139236-139267	7	0.781
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	CP006582	Mesorhizobium huakuii 7653R plasmid pMHa, complete sequence	173514-173545	7	0.781
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	CP006582	Mesorhizobium huakuii 7653R plasmid pMHa, complete sequence	184603-184634	7	0.781
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	CP006582	Mesorhizobium huakuii 7653R plasmid pMHa, complete sequence	219575-219606	7	0.781
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	NZ_CP046454	Corynebacterium sp. 2019 plasmid pCETAM, complete sequence	41557-41588	7	0.781
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	MN871482	UNVERIFIED: Pseudomonas virus PaSz-6, complete genome	37245-37276	7	0.781
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	MN871486	UNVERIFIED: Pseudomonas phage PaSz-9_45_61k, complete genome	20393-20424	7	0.781
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	MN234216	Streptomyces phage Gilgamesh, complete genome	35727-35758	7	0.781
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	MN871463	UNVERIFIED: Pseudomonas phage Pa-L, complete genome	11348-11379	7	0.781
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	MN871456	UNVERIFIED: Pseudomonas phage Pa-C, complete genome	34811-34842	7	0.781
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	JX131330	Pseudomonas phage MP1412, complete genome	17274-17305	7	0.781
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	MN871469	UNVERIFIED: Pseudomonas phage Pa-S, complete genome	35201-35232	7	0.781
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	NC_010116	Pseudomonas phage YuA, complete genome	17336-17367	7	0.781
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	NC_028980	Pseudomonas phage PAE1, complete genome	45910-45941	7	0.781
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	MF490239	Pseudomonas phage vB_PaeS_S218, complete genome	26297-26328	7	0.781
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	DQ163916	Bacteriophage M6, complete genome	47053-47084	7	0.781
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	DI373496	KR 1020130142837-A/10: Bacteriophage of Pseudomonas aeruginosa and uses thereof	611-642	7	0.781
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	KX198613	Pseudomonas phage AN14, complete genome	42750-42781	7	0.781
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	KC758116	Pseudomonas phage LKO4, complete genome	18396-18427	7	0.781
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	NC_007809	Pseudomonas phage M6, complete genome	47053-47084	7	0.781
NC_018524_30	30.5|4637974|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637974-4638005	32	MK494113	Mycobacterium phage Refuge, complete genome	1365-1396	7	0.781
NC_018524_30	30.5|4637974|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637974-4638005	32	NC_048139	Streptomyces phage Hiyaa, complete genome	7282-7313	7	0.781
NC_018524_31	31.5|4642157|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4642157-4642188	32	JN201525	Mycobacterium phage Thibault, complete genome	72542-72573	7	0.781
NC_018524_32	32.11|4653170|33|NC_018524|PILER-CR,CRT	4653170-4653202	33	NZ_CP035420	Leisingera sp. NJS204 plasmid unnamed3, complete sequence	88158-88190	7	0.788
NC_018524_32	32.15|4652562|32|NC_018524|CRISPRCasFinder	4652562-4652593	32	NZ_CP015742	Shinella sp. HZN7 plasmid pShin-06, complete sequence	62903-62934	7	0.781
NC_018524_32	32.15|4652562|32|NC_018524|CRISPRCasFinder	4652562-4652593	32	NZ_CP013381	Burkholderia sp. Bp5365 strain MSMB43 plasmid pMSMB43, complete sequence	75826-75857	7	0.781
NC_018524_32	32.15|4652562|32|NC_018524|CRISPRCasFinder	4652562-4652593	32	NZ_CP009547	Burkholderia sp. 2002721687 plasmid pBTU, complete sequence	42033-42064	7	0.781
NC_018524_32	32.15|4652562|32|NC_018524|CRISPRCasFinder	4652562-4652593	32	EU982300	Pseudomonas phage DVM-2008, genomic sequence	5924-5955	7	0.781
NC_018524_32	32.16|4652623|32|NC_018524|CRISPRCasFinder	4652623-4652654	32	MT114163	Mycobacterium phage Settecandela, complete genome	59567-59598	7	0.781
NC_018524_32	32.16|4652623|32|NC_018524|CRISPRCasFinder	4652623-4652654	32	MK937592	Mycobacterium phage Phrappuccino, complete genome	59567-59598	7	0.781
NC_018524_32	32.19|4652806|32|NC_018524|CRISPRCasFinder	4652806-4652837	32	NZ_CP032520	Cupriavidus oxalaticus strain T2 plasmid unnamed1, complete sequence	265634-265665	7	0.781
NC_018524_32	32.21|4652927|32|NC_018524|CRISPRCasFinder	4652927-4652958	32	NZ_CP025613	Niveispirillum cyanobacteriorum strain TH16 plasmid unnamed1, complete sequence	778200-778231	7	0.781
NC_018524_32	32.21|4652927|32|NC_018524|CRISPRCasFinder	4652927-4652958	32	MN234199	Mycobacterium phage Ekdilam, complete genome	46713-46744	7	0.781
NC_018524_32	32.22|4652988|32|NC_018524|CRISPRCasFinder	4652988-4653019	32	NZ_CP032325	Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence	275270-275301	7	0.781
NC_018524_32	32.22|4652988|32|NC_018524|CRISPRCasFinder	4652988-4653019	32	NZ_CP022369	Azospirillum sp. TSH58 plasmid TSH58_p05, complete sequence	366322-366353	7	0.781
NC_018524_32	32.22|4652988|32|NC_018524|CRISPRCasFinder	4652988-4653019	32	NZ_CP007796	Azospirillum brasilense strain Az39 plasmid AbAZ39_p3, complete sequence	435946-435977	7	0.781
NC_018524_32	32.22|4652988|32|NC_018524|CRISPRCasFinder	4652988-4653019	32	NZ_CP032342	Azospirillum brasilense strain MTCC4038 plasmid p3, complete sequence	322057-322088	7	0.781
NC_018524_32	32.22|4652988|32|NC_018524|CRISPRCasFinder	4652988-4653019	32	NZ_CP033321	Azospirillum brasilense strain Cd plasmid p3, complete sequence	329808-329839	7	0.781
NC_018524_32	32.22|4652988|32|NC_018524|CRISPRCasFinder	4652988-4653019	32	NZ_CP033315	Azospirillum brasilense strain Sp 7 plasmid p3, complete sequence	376116-376147	7	0.781
NC_018524_32	32.25|4653171|32|NC_018524|CRISPRCasFinder	4653171-4653202	32	NZ_CP014126	Pantoea vagans strain FDAARGOS_160 plasmid unnamed1, complete sequence	11398-11429	7	0.781
NC_018524_32	32.25|4653171|32|NC_018524|CRISPRCasFinder	4653171-4653202	32	NC_014304	Erwinia billingiae Eb661 plasmid pEB102, complete sequence	93482-93513	7	0.781
NC_018524_32	32.25|4653171|32|NC_018524|CRISPRCasFinder	4653171-4653202	32	NZ_CP022726	Erwinia persicina strain B64 plasmid pEP1, complete sequence	84790-84821	7	0.781
NC_018524_32	32.25|4653171|32|NC_018524|CRISPRCasFinder	4653171-4653202	32	NZ_CP034473	Pantoea agglomerans strain CFSAN047153 plasmid pCFSAN047153_4, complete sequence	44888-44919	7	0.781
NC_018524_32	32.25|4653171|32|NC_018524|CRISPRCasFinder	4653171-4653202	32	NZ_CP034478	Pantoea agglomerans strain CFSAN047154 plasmid pCFSAN047154_4, complete sequence	6197-6228	7	0.781
NC_018524_32	32.25|4653171|32|NC_018524|CRISPRCasFinder	4653171-4653202	32	NC_019310	Erwinia amylovora plasmid pEM65, complete sequence	59505-59536	7	0.781
NC_018524_32	32.25|4653171|32|NC_018524|CRISPRCasFinder	4653171-4653202	32	NZ_CP035420	Leisingera sp. NJS204 plasmid unnamed3, complete sequence	88158-88189	7	0.781
NC_018524_34	34.4|5116657|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116657-5116688	32	NZ_CP048421	Sphingomonas insulae strain KCTC 12872 plasmid unnamed3, complete sequence	70187-70218	7	0.781
NC_018524_34	34.5|5116718|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116718-5116749	32	NC_009453	Arthrobacter sp. Rue61a plasmid pAL1, complete sequence	435-466	7	0.781
NC_018524_34	34.5|5116718|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116718-5116749	32	NZ_CP042998	Aquisphaera giovannonii strain OJF2 plasmid pOJF2_1, complete sequence	87535-87566	7	0.781
NC_018524_34	34.5|5116718|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116718-5116749	32	NZ_CP017565	Paraburkholderia sprentiae WSM5005 plasmid pl2WSM5005, complete sequence	107973-108004	7	0.781
NC_018524_34	34.6|5116779|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116779-5116810	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2653879-2653910	7	0.781
NC_018524_34	34.6|5116779|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116779-5116810	32	NZ_CP030127	Indioceanicola profundi strain SCSIO 08040 plasmid unnamed1, complete sequence	1098140-1098171	7	0.781
NC_018524_34	34.6|5116779|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116779-5116810	32	NZ_CP029833	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed3, complete sequence	448510-448541	7	0.781
NC_018524_34	34.6|5116779|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116779-5116810	32	NZ_CP034186	Deinococcus sp. S14-83 strain S14-83T plasmid unnamed2, complete sequence	217072-217103	7	0.781
NC_018524_34	34.8|5116901|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116901-5116932	32	NZ_CP006257	Pseudomonas syringae pv. syringae HS191 plasmid unnamed, complete sequence	35786-35817	7	0.781
NC_018524_34	34.10|5117024|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5117024-5117055	32	NC_042098	Erwinia phage vB_EamM_Desertfox, complete genome	96781-96812	7	0.781
NC_018524_34	34.10|5117024|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5117024-5117055	32	MG655267	Erwinia phage vB_EamM_Bosolaphorus, complete genome	96694-96725	7	0.781
NC_018524_34	34.10|5117024|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5117024-5117055	32	MG655269	Erwinia phage vB_EamM_MadMel, complete genome	97004-97035	7	0.781
NC_018524_34	34.10|5117024|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5117024-5117055	32	KF806589	Erwinia phage Ea35-70, complete genome	95896-95927	7	0.781
NC_018524_34	34.10|5117024|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5117024-5117055	32	KU886223	Erwinia phage vB_EamM_Simmy50, complete genome	96198-96229	7	0.781
NC_018524_1	1.2|311687|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311687-311718	32	NZ_AP022602	Mycobacterium gallinarum strain JCM 6399 plasmid pJCM6399	24877-24908	8	0.75
NC_018524_1	1.2|311687|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311687-311718	32	NZ_AP022602	Mycobacterium gallinarum strain JCM 6399 plasmid pJCM6399	210106-210137	8	0.75
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP044976	Hydrogenophaga sp. PBL-H3 substr. PBL-H3(B2) plasmid pPBL-H3_B2-1, complete sequence	136480-136511	8	0.75
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_LR594663	Variovorax sp. RA8 plasmid 2	377314-377345	8	0.75
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP021449	Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence	1213503-1213534	8	0.75
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP049358	Deinococcus wulumuqiensis R12 plasmid unnamed1, complete sequence	248160-248191	8	0.75
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NC_010408	Clavibacter michiganensis subsp. sepedonicus plasmid pCSL1, complete sequence	69425-69456	8	0.75
NC_018524_1	1.4|311809|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311809-311840	32	NZ_AP022849	Bosea sp. ANAM02 plasmid pANAM02, complete sequence	431736-431767	8	0.75
NC_018524_1	1.5|311870|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311870-311901	32	NZ_CP020084	Blastomonas fulva strain T2 plasmid unnamed, complete sequence	112484-112515	8	0.75
NC_018524_1	1.6|311931|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311931-311962	32	CP042595	Streptomyces albogriseolus strain LBX-2 plasmid pSALBX2, complete sequence	135699-135730	8	0.75
NC_018524_1	1.6|311931|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311931-311962	32	NZ_CP025613	Niveispirillum cyanobacteriorum strain TH16 plasmid unnamed1, complete sequence	67177-67208	8	0.75
NC_018524_1	1.7|311992|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311992-312023	32	NZ_CP013526	Rhizobium phaseoli strain R744 plasmid pRphaR744d, complete sequence	290744-290775	8	0.75
NC_018524_1	1.7|311992|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311992-312023	32	NZ_CP013556	Rhizobium phaseoli strain N931 plasmid pRphaN931d, complete sequence	303508-303539	8	0.75
NC_018524_1	1.7|311992|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311992-312023	32	NZ_CP013579	Rhizobium phaseoli strain N671 plasmid pRphaN671e, complete sequence	290685-290716	8	0.75
NC_018524_1	1.7|311992|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311992-312023	32	NZ_CP013531	Rhizobium phaseoli strain R723 plasmid pRphaR723d, complete sequence	310141-310172	8	0.75
NC_018524_1	1.7|311992|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311992-312023	32	NZ_CP013536	Rhizobium phaseoli strain R650 plasmid pRphaR650d, complete sequence	610840-610871	8	0.75
NC_018524_1	1.7|311992|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311992-312023	32	NZ_CP013546	Rhizobium phaseoli strain R620 plasmid pRphaR620d, complete sequence	305105-305136	8	0.75
NC_018524_1	1.7|311992|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311992-312023	32	NZ_CP013567	Rhizobium phaseoli strain N831 plasmid pRphaN831d, complete sequence	303508-303539	8	0.75
NC_018524_1	1.7|311992|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311992-312023	32	NZ_CP013584	Rhizobium phaseoli strain N261 plasmid pRphaN261d, complete sequence	310141-310172	8	0.75
NC_018524_1	1.7|311992|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311992-312023	32	NZ_CP013573	Rhizobium phaseoli strain N771 plasmid pRphaN771e, complete sequence	290685-290716	8	0.75
NC_018524_1	1.8|312053|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312053-312084	32	KC252997	Halovirus PH1, complete genome	21331-21362	8	0.75
NC_018524_1	1.8|312053|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312053-312084	32	NC_020159	Halovirus HSTV-2, complete genome	48714-48745	8	0.75
NC_018524_1	1.9|312114|37|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312114-312150	37	NZ_LR134451	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 9, complete sequence	264871-264907	8	0.784
NC_018524_1	1.10|312180|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312180-312211	32	NZ_CP045223	Achromobacter xylosoxidans strain DN002 plasmid unnamed	83126-83157	8	0.75
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2535528-2535559	8	0.75
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	MN234183	Mycobacterium phage Antsirabe, complete genome	21993-22024	8	0.75
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	1190982-1191013	8	0.75
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	622551-622582	8	0.75
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	NC_025427	Rhizobium phage vB_RleM_PPF1, complete genome	40887-40918	8	0.75
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	NZ_CP016083	Streptomyces sp. SAT1 plasmid unnamed3, complete sequence	520387-520418	8	0.75
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	NZ_CP032322	Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence	1568743-1568774	8	0.75
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	NZ_CP007129	Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence	461685-461716	8	0.75
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	NZ_CP016354	Prauserella marina strain DSM 45268 plasmid pPmarDSM45268, complete sequence	131589-131620	8	0.75
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	NZ_CP033582	Streptomyces sp. ADI95-16 plasmid pADI95-16a, complete sequence	254354-254385	8	0.75
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	NZ_CP017242	Rhizobium etli 8C-3 plasmid pRsp8C3a, complete sequence	229630-229661	8	0.75
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	NC_016586	Azospirillum lipoferum 4B plasmid AZO_p2, complete sequence	372391-372422	8	0.75
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	X80164	Bacteriophage phi-H dcm4, dcm5a and dcm5b genes for cytosine methylase	6685-6716	8	0.75
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	MK002701	Halobacterium phage phiH variant phiH1, complete genome	48629-48660	8	0.75
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	FJ937737	Burkholderia cenocepacia phage BcepIL02, complete genome	32057-32088	8	0.75
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	NC_012743	Burkholderia phage BcepIL02, complete genome	32057-32088	8	0.75
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	NZ_CP044283	Rhodococcus erythropolis strain X5 plasmid pRhX5, complete sequence	174911-174942	8	0.75
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	NZ_CP026974	Achromobacter insolitus strain FDAARGOS_88 plasmid unnamed1, complete sequence	183097-183128	8	0.75
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	NZ_AP022333	Methylosinus sp. C49 isolate Methylosinus sp. C49 plasmid pMSC49a, complete sequence	251059-251090	8	0.75
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	NZ_CP011665	Streptomyces sp. Mg1 plasmid pSMg1-1, complete sequence	228541-228572	8	0.75
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	NZ_CP011665	Streptomyces sp. Mg1 plasmid pSMg1-1, complete sequence	379732-379763	8	0.75
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	NC_017966	Tistrella mobilis KA081020-065 plasmid pTM2, complete sequence	469163-469194	8	0.75
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	NZ_CP024309	Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3b, complete sequence	471380-471411	8	0.75
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	NZ_CP014797	Salipiger profundus strain JLT2016 plasmid pTPRO1, complete sequence	27997-28028	8	0.75
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	MN329675	Microbacterium phage SansAfet, complete genome	39894-39925	8	0.75
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	MN813686	Mycobacterium phage BirdsNest, complete genome	29551-29582	8	0.75
NC_018524_2	2.4|313399|32|NC_018524|CRISPRCasFinder	313399-313430	32	NZ_AP012556	Mycobacterium avium subsp. hominissuis TH135 plasmid pMAH135, complete sequence	146341-146372	8	0.75
NC_018524_2	2.4|313399|32|NC_018524|CRISPRCasFinder	313399-313430	32	NZ_CP041964	Xanthomonas citri pv. glycines strain 1157 plasmid unnamed1	13528-13559	8	0.75
NC_018524_2	2.4|313399|32|NC_018524|CRISPRCasFinder	313399-313430	32	NZ_CP041964	Xanthomonas citri pv. glycines strain 1157 plasmid unnamed1	57440-57471	8	0.75
NC_018524_2	2.4|313399|32|NC_018524|CRISPRCasFinder	313399-313430	32	NZ_CP019227	Xanthomonas oryzae pv. oryzae strain IX-280 plasmid pXOO43, complete sequence	26550-26581	8	0.75
NC_018524_2	2.4|313399|32|NC_018524|CRISPRCasFinder	313399-313430	32	NZ_CP020883	Xanthomonas citri pv. citri strain TX160042 plasmid unnamed1, complete sequence	10969-11000	8	0.75
NC_018524_2	2.4|313399|32|NC_018524|CRISPRCasFinder	313399-313430	32	NZ_CP021007	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6975 plasmid pC, complete sequence	5776-5807	8	0.75
NC_018524_2	2.4|313399|32|NC_018524|CRISPRCasFinder	313399-313430	32	NZ_CP021007	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6975 plasmid pC, complete sequence	44643-44674	8	0.75
NC_018524_2	2.4|313399|32|NC_018524|CRISPRCasFinder	313399-313430	32	NZ_CP021007	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6975 plasmid pC, complete sequence	55638-55669	8	0.75
NC_018524_2	2.4|313399|32|NC_018524|CRISPRCasFinder	313399-313430	32	NZ_CP020994	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP4885 plasmid pC, complete sequence	7318-7349	8	0.75
NC_018524_2	2.4|313399|32|NC_018524|CRISPRCasFinder	313399-313430	32	NZ_CP020994	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP4885 plasmid pC, complete sequence	49354-49385	8	0.75
NC_018524_2	2.4|313399|32|NC_018524|CRISPRCasFinder	313399-313430	32	NC_010509	Methylobacterium radiotolerans JCM 2831 plasmid pMRAD02, complete sequence	16845-16876	8	0.75
NC_018524_2	2.4|313399|32|NC_018524|CRISPRCasFinder	313399-313430	32	NC_010509	Methylobacterium radiotolerans JCM 2831 plasmid pMRAD02, complete sequence	46907-46938	8	0.75
NC_018524_2	2.4|313399|32|NC_018524|CRISPRCasFinder	313399-313430	32	NZ_CP020886	Xanthomonas citri pv. citri strain TX160149 plasmid unnamed1, complete sequence	98199-98230	8	0.75
NC_018524_2	2.4|313399|32|NC_018524|CRISPRCasFinder	313399-313430	32	NZ_CP021020	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6167 plasmid pC, complete sequence	48741-48772	8	0.75
NC_018524_2	2.4|313399|32|NC_018524|CRISPRCasFinder	313399-313430	32	NZ_CP020977	Xanthomonas phaseoli pv. phaseoli strain CFBP6982 plasmid pC	15477-15508	8	0.75
NC_018524_2	2.4|313399|32|NC_018524|CRISPRCasFinder	313399-313430	32	NZ_CP012056	Xanthomonas citri pv. fuscans strain ISO12C3 plasmid pXff45, complete sequence	21274-21305	8	0.75
NC_018524_2	2.4|313399|32|NC_018524|CRISPRCasFinder	313399-313430	32	NZ_CP012054	Xanthomonas citri pv. fuscans strain ISO118C1 plasmid pXff45, complete sequence	21274-21305	8	0.75
NC_018524_2	2.4|313399|32|NC_018524|CRISPRCasFinder	313399-313430	32	NZ_CP013007	Xanthomonas citri pv. malvacearum strain XcmN1003 plasmid pXcmN, complete sequence	9647-9678	8	0.75
NC_018524_2	2.4|313399|32|NC_018524|CRISPRCasFinder	313399-313430	32	NZ_CP021003	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6166 plasmid pC, complete sequence	29585-29616	8	0.75
NC_018524_2	2.4|313399|32|NC_018524|CRISPRCasFinder	313399-313430	32	NZ_CP012052	Xanthomonas citri pv. fuscans strain ISO118C5 plasmid pXff45, complete sequence	21274-21305	8	0.75
NC_018524_2	2.4|313399|32|NC_018524|CRISPRCasFinder	313399-313430	32	NZ_CP020890	Xanthomonas citri pv. citri strain TX160197 plasmid unnamed1, complete sequence	115531-115562	8	0.75
NC_018524_2	2.4|313399|32|NC_018524|CRISPRCasFinder	313399-313430	32	CP021014	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP7767 plasmid pC, complete sequence	17736-17767	8	0.75
NC_018524_2	2.4|313399|32|NC_018524|CRISPRCasFinder	313399-313430	32	NC_022542	Xanthomonas citri pv. fuscans plasmid plc, complete sequence	19808-19839	8	0.75
NC_018524_2	2.10|313401|30|NC_018524|PILER-CR	313401-313430	30	NZ_CP041964	Xanthomonas citri pv. glycines strain 1157 plasmid unnamed1	13529-13558	8	0.733
NC_018524_2	2.10|313401|30|NC_018524|PILER-CR	313401-313430	30	NZ_CP041964	Xanthomonas citri pv. glycines strain 1157 plasmid unnamed1	57441-57470	8	0.733
NC_018524_2	2.10|313401|30|NC_018524|PILER-CR	313401-313430	30	NZ_CP019227	Xanthomonas oryzae pv. oryzae strain IX-280 plasmid pXOO43, complete sequence	26551-26580	8	0.733
NC_018524_2	2.10|313401|30|NC_018524|PILER-CR	313401-313430	30	NZ_CP020883	Xanthomonas citri pv. citri strain TX160042 plasmid unnamed1, complete sequence	10970-10999	8	0.733
NC_018524_2	2.10|313401|30|NC_018524|PILER-CR	313401-313430	30	NZ_CP021007	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6975 plasmid pC, complete sequence	5777-5806	8	0.733
NC_018524_2	2.10|313401|30|NC_018524|PILER-CR	313401-313430	30	NZ_CP021007	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6975 plasmid pC, complete sequence	44644-44673	8	0.733
NC_018524_2	2.10|313401|30|NC_018524|PILER-CR	313401-313430	30	NZ_CP021007	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6975 plasmid pC, complete sequence	55639-55668	8	0.733
NC_018524_2	2.10|313401|30|NC_018524|PILER-CR	313401-313430	30	NZ_CP020994	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP4885 plasmid pC, complete sequence	7319-7348	8	0.733
NC_018524_2	2.10|313401|30|NC_018524|PILER-CR	313401-313430	30	NZ_CP020994	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP4885 plasmid pC, complete sequence	49355-49384	8	0.733
NC_018524_2	2.10|313401|30|NC_018524|PILER-CR	313401-313430	30	NC_010509	Methylobacterium radiotolerans JCM 2831 plasmid pMRAD02, complete sequence	16846-16875	8	0.733
NC_018524_2	2.10|313401|30|NC_018524|PILER-CR	313401-313430	30	NC_010509	Methylobacterium radiotolerans JCM 2831 plasmid pMRAD02, complete sequence	46908-46937	8	0.733
NC_018524_2	2.10|313401|30|NC_018524|PILER-CR	313401-313430	30	NZ_CP020886	Xanthomonas citri pv. citri strain TX160149 plasmid unnamed1, complete sequence	98200-98229	8	0.733
NC_018524_2	2.10|313401|30|NC_018524|PILER-CR	313401-313430	30	NZ_CP040821	Paraoceanicella profunda strain D4M1 plasmid pD4M1C, complete sequence	159708-159737	8	0.733
NC_018524_2	2.10|313401|30|NC_018524|PILER-CR	313401-313430	30	NZ_CP021020	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6167 plasmid pC, complete sequence	48742-48771	8	0.733
NC_018524_2	2.10|313401|30|NC_018524|PILER-CR	313401-313430	30	NZ_CP020977	Xanthomonas phaseoli pv. phaseoli strain CFBP6982 plasmid pC	15478-15507	8	0.733
NC_018524_2	2.10|313401|30|NC_018524|PILER-CR	313401-313430	30	NZ_CP012056	Xanthomonas citri pv. fuscans strain ISO12C3 plasmid pXff45, complete sequence	21275-21304	8	0.733
NC_018524_2	2.10|313401|30|NC_018524|PILER-CR	313401-313430	30	NZ_CP022482	Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence	853367-853396	8	0.733
NC_018524_2	2.10|313401|30|NC_018524|PILER-CR	313401-313430	30	NZ_CP012054	Xanthomonas citri pv. fuscans strain ISO118C1 plasmid pXff45, complete sequence	21275-21304	8	0.733
NC_018524_2	2.10|313401|30|NC_018524|PILER-CR	313401-313430	30	NZ_CP013007	Xanthomonas citri pv. malvacearum strain XcmN1003 plasmid pXcmN, complete sequence	9648-9677	8	0.733
NC_018524_2	2.10|313401|30|NC_018524|PILER-CR	313401-313430	30	NZ_CP021003	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6166 plasmid pC, complete sequence	29586-29615	8	0.733
NC_018524_2	2.10|313401|30|NC_018524|PILER-CR	313401-313430	30	NZ_CP012052	Xanthomonas citri pv. fuscans strain ISO118C5 plasmid pXff45, complete sequence	21275-21304	8	0.733
NC_018524_2	2.10|313401|30|NC_018524|PILER-CR	313401-313430	30	NZ_CP020890	Xanthomonas citri pv. citri strain TX160197 plasmid unnamed1, complete sequence	115532-115561	8	0.733
NC_018524_2	2.10|313401|30|NC_018524|PILER-CR	313401-313430	30	CP021014	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP7767 plasmid pC, complete sequence	17737-17766	8	0.733
NC_018524_2	2.10|313401|30|NC_018524|PILER-CR	313401-313430	30	NC_022542	Xanthomonas citri pv. fuscans plasmid plc, complete sequence	19809-19838	8	0.733
NC_018524_3	3.1|318517|32|NC_018524|CRISPRCasFinder,CRT	318517-318548	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	1239763-1239794	8	0.75
NC_018524_3	3.2|318578|32|NC_018524|CRISPRCasFinder,CRT	318578-318609	32	NZ_CP040096	Pantoea sp. SO10 plasmid unnamed1, complete sequence	530391-530422	8	0.75
NC_018524_3	3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318761-318792	32	NZ_CP040764	Paracoccus sp. 2251 plasmid unnamed3, complete sequence	45011-45042	8	0.75
NC_018524_3	3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318761-318792	32	NZ_CP024310	Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3c, complete sequence	1084035-1084066	8	0.75
NC_018524_3	3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318761-318792	32	NZ_CP013054	Sinorhizobium americanum CCGM7 plasmid C, complete sequence	1406447-1406478	8	0.75
NC_018524_3	3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318761-318792	32	NC_011887	Methylobacterium nodulans ORS 2060 plasmid pMNOD02, complete sequence	48245-48276	8	0.75
NC_018524_3	3.7|318883|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318883-318914	32	NZ_CP020951	Rhizobium sp. CIAT894 plasmid pRheCIAT894d, complete sequence	223036-223067	8	0.75
NC_018524_3	3.7|318883|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318883-318914	32	NZ_CP040765	Paracoccus sp. 2251 plasmid unnamed1, complete sequence	273068-273099	8	0.75
NC_018524_3	3.7|318883|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318883-318914	32	MK967384	Gordonia phage Sidious, complete genome	4322-4353	8	0.75
NC_018524_3	3.8|318944|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318944-318975	32	NC_017958	Tistrella mobilis KA081020-065 plasmid pTM3, complete sequence	476436-476467	8	0.75
NC_018524_3	3.8|318944|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318944-318975	32	NZ_CP025614	Niveispirillum cyanobacteriorum strain TH16 plasmid unnamed2, complete sequence	176057-176088	8	0.75
NC_018524_3	3.8|318944|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318944-318975	32	NZ_CP029357	Azospirillum sp. CFH 70021 plasmid unnamed2	134769-134800	8	0.75
NC_018524_3	3.8|318944|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318944-318975	32	NZ_CP011772	Croceicoccus naphthovorans strain PQ-2 plasmid p2, complete sequence	71220-71251	8	0.75
NC_018524_3	3.9|319005|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	319005-319036	32	NZ_CP049244	Rhizobium pseudoryzae strain DSM 19479 plasmid unnamed3, complete sequence	578150-578181	8	0.75
NC_018524_3	3.12|319187|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	319187-319218	32	NZ_CP021083	Deinococcus ficus strain CC-FR2-10 plasmid pDFI2, complete sequence	340295-340326	8	0.75
NC_018524_3	3.13|319248|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	319248-319279	32	NZ_CP014276	Martelella sp. AD-3 plasmid unnamed1, complete sequence	228683-228714	8	0.75
NC_018524_3	3.13|319248|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	319248-319279	32	NZ_CP016291	Rhizobium leguminosarum strain Vaf10 plasmid unnamed6, complete sequence	218545-218576	8	0.75
NC_018524_4	4.6|321675|32|NC_018524|CRISPRCasFinder,CRT	321675-321706	32	NC_023316	Streptomyces sp. 14R-10 plasmid pZL1, complete sequence	172-203	8	0.75
NC_018524_4	4.6|321675|32|NC_018524|CRISPRCasFinder,CRT	321675-321706	32	NC_023316	Streptomyces sp. 14R-10 plasmid pZL1, complete sequence	127107-127138	8	0.75
NC_018524_4	4.7|321736|32|NC_018524|CRISPRCasFinder,CRT	321736-321767	32	NZ_CP019603	Croceicoccus marinus strain E4A9 plasmid pCME4A9I, complete sequence	744995-745026	8	0.75
NC_018524_4	4.7|321736|32|NC_018524|CRISPRCasFinder,CRT	321736-321767	32	NZ_CP019604	Croceicoccus marinus strain E4A9 plasmid pCME4A9II, complete sequence	260025-260056	8	0.75
NC_018524_4	4.9|321858|32|NC_018524|CRISPRCasFinder,CRT	321858-321889	32	NZ_CP032325	Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence	411324-411355	8	0.75
NC_018524_4	4.9|321858|32|NC_018524|CRISPRCasFinder,CRT	321858-321889	32	NZ_CP027239	Dietzia sp. oral taxon 368 strain W5195 plasmid unnamed1, complete sequence	78148-78179	8	0.75
NC_018524_4	4.9|321858|32|NC_018524|CRISPRCasFinder,CRT	321858-321889	32	NZ_CP041156	Leisingera aquaemixtae strain R2C4 plasmid unnamed1, complete sequence	70484-70515	8	0.75
NC_018524_4	4.9|321858|32|NC_018524|CRISPRCasFinder,CRT	321858-321889	32	NZ_CP007796	Azospirillum brasilense strain Az39 plasmid AbAZ39_p3, complete sequence	265885-265916	8	0.75
NC_018524_4	4.9|321858|32|NC_018524|CRISPRCasFinder,CRT	321858-321889	32	NZ_CP018865	Arthrobacter crystallopoietes strain DSM 20117 plasmid pLDW-10, complete sequence	13452-13483	8	0.75
NC_018524_4	4.9|321858|32|NC_018524|CRISPRCasFinder,CRT	321858-321889	32	NZ_CP018865	Arthrobacter crystallopoietes strain DSM 20117 plasmid pLDW-10, complete sequence	240282-240313	8	0.75
NC_018524_4	4.9|321858|32|NC_018524|CRISPRCasFinder,CRT	321858-321889	32	NZ_CP032349	Azospirillum brasilense strain MTCC4039 plasmid p3, complete sequence	612687-612718	8	0.75
NC_018524_4	4.9|321858|32|NC_018524|CRISPRCasFinder,CRT	321858-321889	32	MN234234	Arthrobacter phage Lymara, complete genome	26998-27029	8	0.75
NC_018524_4	4.9|321858|32|NC_018524|CRISPRCasFinder,CRT	321858-321889	32	NZ_CP032342	Azospirillum brasilense strain MTCC4038 plasmid p3, complete sequence	524523-524554	8	0.75
NC_018524_4	4.9|321858|32|NC_018524|CRISPRCasFinder,CRT	321858-321889	32	NZ_CP046573	Rhodococcus sp. WAY2 plasmid pRWAY01, complete sequence	866280-866311	8	0.75
NC_018524_4	4.9|321858|32|NC_018524|CRISPRCasFinder,CRT	321858-321889	32	NZ_CP033321	Azospirillum brasilense strain Cd plasmid p3, complete sequence	240328-240359	8	0.75
NC_018524_4	4.9|321858|32|NC_018524|CRISPRCasFinder,CRT	321858-321889	32	NZ_CP033323	Azospirillum brasilense strain Cd plasmid p5, complete sequence	112313-112344	8	0.75
NC_018524_4	4.9|321858|32|NC_018524|CRISPRCasFinder,CRT	321858-321889	32	NZ_CP033315	Azospirillum brasilense strain Sp 7 plasmid p3, complete sequence	209907-209938	8	0.75
NC_018524_4	4.9|321858|32|NC_018524|CRISPRCasFinder,CRT	321858-321889	32	NZ_CP026517	Deinococcus sp. NW-56 plasmid unnamed1, complete sequence	321560-321591	8	0.75
NC_018524_4	4.9|321858|32|NC_018524|CRISPRCasFinder,CRT	321858-321889	32	NC_003903	Streptomyces coelicolor A3(2) plasmid SCP1, complete sequence	137661-137692	8	0.75
NC_018524_4	4.11|322003|32|NC_018524|CRISPRCasFinder,CRT	322003-322034	32	NZ_CP030828	Neorhizobium sp. NCHU2750 plasmid pNCHU2750a, complete sequence	27649-27680	8	0.75
NC_018524_4	4.22|322065|28|NC_018524|PILER-CR	322065-322092	28	MT713136	Aeromonas phage AP1, complete genome	248721-248748	8	0.714
NC_018524_5	5.1|326532|32|NC_018524|CRISPRCasFinder	326532-326563	32	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	1128876-1128907	8	0.75
NC_018524_5	5.5|326776|32|NC_018524|CRISPRCasFinder	326776-326807	32	CP054934	Nocardiopsis flavescens strain NA01583 plasmid unnamed1, complete sequence	58144-58175	8	0.75
NC_018524_5	5.6|326837|32|NC_018524|CRISPRCasFinder	326837-326868	32	NZ_CP038636	Cupriavidus oxalaticus strain X32 plasmid unnamed1, complete sequence	56111-56142	8	0.75
NC_018524_5	5.6|326837|32|NC_018524|CRISPRCasFinder	326837-326868	32	CP000663	Rhodobacter sphaeroides ATCC 17025 plasmid pRSPA02, complete sequence	266762-266793	8	0.75
NC_018524_5	5.6|326837|32|NC_018524|CRISPRCasFinder	326837-326868	32	NZ_CP031752	Rhodobacter sphaeroides strain EBL0706 plasmid p.A, complete sequence	264864-264895	8	0.75
NC_018524_5	5.8|326593|33|NC_018524|CRT	326593-326625	33	NC_012849	Ralstonia pickettii 12D plasmid pRp12D02, complete sequence	158233-158265	8	0.758
NC_018524_5	5.11|326776|33|NC_018524|CRT	326776-326808	33	NC_019848	Sinorhizobium meliloti GR4 plasmid pRmeGR4c, complete sequence	780875-780907	8	0.758
NC_018524_5	5.11|326776|33|NC_018524|CRT	326776-326808	33	NZ_CP021813	Sinorhizobium meliloti strain M270 plasmid psymA, complete sequence	1071998-1072030	8	0.758
NC_018524_5	5.11|326776|33|NC_018524|CRT	326776-326808	33	NZ_CP021805	Sinorhizobium meliloti strain T073 plasmid psymA, complete sequence	972536-972568	8	0.758
NC_018524_5	5.11|326776|33|NC_018524|CRT	326776-326808	33	NZ_CP054625	Cupriavidus gilardii strain FDAARGOS_639 plasmid unnamed1, complete sequence	11788-11820	8	0.758
NC_018524_5	5.12|326837|33|NC_018524|CRT	326837-326869	33	NZ_CP038636	Cupriavidus oxalaticus strain X32 plasmid unnamed1, complete sequence	56110-56142	8	0.758
NC_018524_5	5.16|326777|32|NC_018524|PILER-CR	326777-326808	32	CP054934	Nocardiopsis flavescens strain NA01583 plasmid unnamed1, complete sequence	58144-58175	8	0.75
NC_018524_5	5.17|326838|32|NC_018524|PILER-CR	326838-326869	32	NZ_CP038636	Cupriavidus oxalaticus strain X32 plasmid unnamed1, complete sequence	56111-56142	8	0.75
NC_018524_5	5.17|326838|32|NC_018524|PILER-CR	326838-326869	32	CP000663	Rhodobacter sphaeroides ATCC 17025 plasmid pRSPA02, complete sequence	266762-266793	8	0.75
NC_018524_5	5.17|326838|32|NC_018524|PILER-CR	326838-326869	32	NZ_CP031752	Rhodobacter sphaeroides strain EBL0706 plasmid p.A, complete sequence	264864-264895	8	0.75
NC_018524_9	9.8|1460493|32|NC_018524|CRISPRCasFinder,CRT	1460493-1460524	32	NZ_CP017077	Novosphingobium resinovorum strain SA1 plasmid pSA2, complete sequence	295709-295740	8	0.75
NC_018524_9	9.8|1460493|32|NC_018524|CRISPRCasFinder,CRT	1460493-1460524	32	NZ_CP054613	Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence	1571412-1571443	8	0.75
NC_018524_9	9.18|1460494|32|NC_018524|PILER-CR	1460494-1460525	32	NZ_CP017077	Novosphingobium resinovorum strain SA1 plasmid pSA2, complete sequence	295709-295740	8	0.75
NC_018524_9	9.18|1460494|32|NC_018524|PILER-CR	1460494-1460525	32	NZ_CP054613	Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence	1571412-1571443	8	0.75
NC_018524_11	11.3|2251146|32|NC_018524|PILER-CR,CRT	2251146-2251177	32	NZ_CP007130	Gemmatirosa kalamazoonesis strain KBS708 plasmid 2, complete sequence	436029-436060	8	0.75
NC_018524_11	11.3|2251146|32|NC_018524|PILER-CR,CRT	2251146-2251177	32	NC_016624	Azospirillum lipoferum 4B plasmid AZO_p5, complete sequence	441174-441205	8	0.75
NC_018524_11	11.3|2251146|32|NC_018524|PILER-CR,CRT	2251146-2251177	32	NZ_CP040821	Paraoceanicella profunda strain D4M1 plasmid pD4M1C, complete sequence	58603-58634	8	0.75
NC_018524_11	11.3|2251146|32|NC_018524|PILER-CR,CRT	2251146-2251177	32	MH271308	Microbacterium phage Percival, complete genome	6644-6675	8	0.75
NC_018524_11	11.3|2251146|32|NC_018524|PILER-CR,CRT	2251146-2251177	32	MH553517	Serratia phage Scapp, complete genome	16396-16427	8	0.75
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	990435-990466	8	0.75
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	MT522004	Mycobacterium phage Gail, complete genome	7119-7150	8	0.75
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NC_028849	Mycobacterium phage Luchador, complete genome	8117-8148	8	0.75
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP013578	Rhizobium phaseoli strain N671 plasmid pRphaN671d, complete sequence	216061-216092	8	0.75
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP013550	Rhizobium phaseoli strain R611 plasmid pRetR611c, complete sequence	181042-181073	8	0.75
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP013530	Rhizobium phaseoli strain R723 plasmid pRphaR723c, complete sequence	181042-181073	8	0.75
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP013535	Rhizobium phaseoli strain R650 plasmid pRphaR650c, complete sequence	181042-181073	8	0.75
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP013540	Rhizobium phaseoli strain R630 plasmid pRphaR630c, complete sequence	200572-200603	8	0.75
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP013583	Rhizobium phaseoli strain N261 plasmid pRphaN261c, complete sequence	181042-181073	8	0.75
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP013572	Rhizobium phaseoli strain N771 plasmid pRphaN671d, complete sequence	216061-216092	8	0.75
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP012399	Chelatococcus sp. CO-6 plasmid pCO-6, complete sequence	355136-355167	8	0.75
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NC_016626	Burkholderia sp. YI23 plasmid byi_1p, complete sequence	477693-477724	8	0.75
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP046475	Janibacter melonis strain M714 plasmid unnamed, complete sequence	24065-24096	8	0.75
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP017243	Rhizobium etli 8C-3 plasmid pRsp8C3b, complete sequence	176495-176526	8	0.75
NC_018524_11	11.7|2251390|33|NC_018524|PILER-CR,CRT	2251390-2251422	33	KT287080	Enterobacter phage phiEap-2, complete genome	9458-9490	8	0.758
NC_018524_11	11.18|2251513|32|NC_018524|CRT	2251513-2251544	32	MH271305	Gordonia phage Morrissey, complete genome	13614-13645	8	0.75
NC_018524_12	12.1|2254172|29|NC_018524|PILER-CR	2254172-2254200	29	MN856119	Siphoviridae sp. isolate 149, complete genome	225-253	8	0.724
NC_018524_12	12.1|2254172|29|NC_018524|PILER-CR	2254172-2254200	29	MT006236	Bifidobacterium phage BitterVaud1, complete genome	4628-4656	8	0.724
NC_018524_12	12.5|2254293|32|NC_018524|CRISPRCasFinder,CRT	2254293-2254324	32	NZ_CP021083	Deinococcus ficus strain CC-FR2-10 plasmid pDFI2, complete sequence	379167-379198	8	0.75
NC_018524_13	13.1|2254469|32|NC_018524|CRISPRCasFinder	2254469-2254500	32	MT711888	Pseudomonas phage Dolphis, complete genome	80809-80840	8	0.75
NC_018524_14	14.2|2268321|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	2268321-2268352	32	LN997843	Streptomyces reticuli genome assembly TUE45, plasmid : II	410276-410307	8	0.75
NC_018524_14	14.2|2268321|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	2268321-2268352	32	NZ_CP034329	Tabrizicola piscis strain K13M18 plasmid unnamed1, complete sequence	27921-27952	8	0.75
NC_018524_14	14.2|2268321|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	2268321-2268352	32	NZ_CP034329	Tabrizicola piscis strain K13M18 plasmid unnamed1, complete sequence	122027-122058	8	0.75
NC_018524_14	14.2|2268321|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	2268321-2268352	32	NZ_CP034351	Streptomyces sp. W1SF4 plasmid p1, complete sequence	140793-140824	8	0.75
NC_018524_14	14.2|2268321|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	2268321-2268352	32	NZ_CP045548	Streptomyces sp. SYP-A7193 plasmid unnamed1, complete sequence	402030-402061	8	0.75
NC_018524_14	14.3|2268382|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	2268382-2268413	32	MH669006	Streptomyces phage LibertyBell, complete genome	37075-37106	8	0.75
NC_018524_14	14.7|2268626|32|NC_018524|CRISPRCasFinder,CRT	2268626-2268657	32	NZ_CP020883	Xanthomonas citri pv. citri strain TX160042 plasmid unnamed1, complete sequence	103890-103921	8	0.75
NC_018524_14	14.7|2268626|32|NC_018524|CRISPRCasFinder,CRT	2268626-2268657	32	NZ_CP020886	Xanthomonas citri pv. citri strain TX160149 plasmid unnamed1, complete sequence	67563-67594	8	0.75
NC_018524_14	14.7|2268626|32|NC_018524|CRISPRCasFinder,CRT	2268626-2268657	32	NZ_CP020890	Xanthomonas citri pv. citri strain TX160197 plasmid unnamed1, complete sequence	22610-22641	8	0.75
NC_018524_14	14.7|2268626|32|NC_018524|CRISPRCasFinder,CRT	2268626-2268657	32	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	475143-475174	8	0.75
NC_018524_14	14.7|2268626|32|NC_018524|CRISPRCasFinder,CRT	2268626-2268657	32	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	1337926-1337957	8	0.75
NC_018524_14	14.7|2268626|32|NC_018524|CRISPRCasFinder,CRT	2268626-2268657	32	NZ_CP032676	Rhodococcus rhodochrous strain ATCC BAA870 plasmid pNit, complete sequence	9985-10016	8	0.75
NC_018524_14	14.7|2268626|32|NC_018524|CRISPRCasFinder,CRT	2268626-2268657	32	NZ_AP022320	Burkholderia sp. THE68 plasmid BTHE68_p2, complete sequence	174828-174859	8	0.75
NC_018524_15	15.1|2270337|32|NC_018524|CRISPRCasFinder	2270337-2270368	32	LN997843	Streptomyces reticuli genome assembly TUE45, plasmid : II	269385-269416	8	0.75
NC_018524_15	15.1|2270337|32|NC_018524|CRISPRCasFinder	2270337-2270368	32	NZ_LR134456	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 14, complete sequence	50308-50339	8	0.75
NC_018524_15	15.3|2270459|32|NC_018524|CRISPRCasFinder	2270459-2270490	32	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	651970-652001	8	0.75
NC_018524_15	15.3|2270459|32|NC_018524|CRISPRCasFinder	2270459-2270490	32	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	1161101-1161132	8	0.75
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MT657336	Microbacterium phage ClearAsMud, complete genome	17514-17542	8	0.724
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	KJ538722	Mycobacterium phage HH92, complete genome	41153-41181	8	0.724
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	KT222940	Mycobacterium phage Kinbote, complete genome	41153-41181	8	0.724
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MH727549	Mycobacterium phage Gancho, complete genome	40864-40892	8	0.724
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MK919482	Mycobacterium phage DeepSoil15, complete genome	41153-41181	8	0.724
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MT657330	Mycobacterium phage Webster2, complete genome	41153-41181	8	0.724
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MF919517	Mycobacterium phage LilHazelnut, complete genome	41153-41181	8	0.724
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	EU203571	Mycobacterium phage Giles, complete genome	41153-41181	8	0.724
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MK494095	Mycobacterium phage Daegal, complete genome	41737-41765	8	0.724
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MT818421	Mycobacterium phage Luke, complete genome	41108-41136	8	0.724
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MH697577	Mycobacterium phage Amochick, complete genome	41183-41211	8	0.724
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MT684594	Mycobacterium phage Hadrien, complete genome	41153-41181	8	0.724
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	MT114159	Mycobacterium phage Ein37, complete genome	41153-41181	8	0.724
NC_018524_15	15.26|2271065|29|NC_018524|CRT	2271065-2271093	29	KT454972	Mycobacterium phage Evanesce, complete genome	41153-41181	8	0.724
NC_018524_18	18.2|2357908|28|NC_018524|CRISPRCasFinder	2357908-2357935	28	NZ_CP007794	Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence	91468-91495	8	0.714
NC_018524_19	19.5|4409022|32|NC_018524|CRT	4409022-4409053	32	NZ_CP021083	Deinococcus ficus strain CC-FR2-10 plasmid pDFI2, complete sequence	137284-137315	8	0.75
NC_018524_19	19.5|4409022|32|NC_018524|CRT	4409022-4409053	32	NZ_CP007129	Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence	210071-210102	8	0.75
NC_018524_19	19.5|4409022|32|NC_018524|CRT	4409022-4409053	32	NZ_CP020399	Burkholderia multivorans strain FDAARGOS_246 plasmid unnamed, complete sequence	296319-296350	8	0.75
NC_018524_19	19.5|4409022|32|NC_018524|CRT	4409022-4409053	32	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	2547098-2547129	8	0.75
NC_018524_19	19.5|4409022|32|NC_018524|CRT	4409022-4409053	32	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	1080206-1080237	8	0.75
NC_018524_19	19.5|4409022|32|NC_018524|CRT	4409022-4409053	32	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	570787-570818	8	0.75
NC_018524_19	19.5|4409022|32|NC_018524|CRT	4409022-4409053	32	NZ_AP017656	Sphingobium cloacae strain JCM 10874 plasmid pSCLO_2, complete sequence	111061-111092	8	0.75
NC_018524_19	19.5|4409022|32|NC_018524|CRT	4409022-4409053	32	NZ_CP043961	Streptomyces tendae strain 139 plasmid unnamed2, complete sequence	22287-22318	8	0.75
NC_018524_21	21.6|4582479|33|NC_018524|PILER-CR	4582479-4582511	33	KX066068	Pseudomonas phage VSW-3, complete genome	14013-14045	8	0.758
NC_018524_21	21.17|4582358|32|NC_018524|CRISPRCasFinder,CRT	4582358-4582389	32	NZ_CP037897	Thermaerobacter sp. FW80 plasmid unnamed2, complete sequence	2638-2669	8	0.75
NC_018524_21	21.17|4582358|32|NC_018524|CRISPRCasFinder,CRT	4582358-4582389	32	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	405908-405939	8	0.75
NC_018524_21	21.18|4582419|32|NC_018524|CRISPRCasFinder,CRT	4582419-4582450	32	NZ_CP032326	Azospirillum brasilense strain MTCC4035 plasmid p5, complete sequence	249636-249667	8	0.75
NC_018524_21	21.18|4582419|32|NC_018524|CRISPRCasFinder,CRT	4582419-4582450	32	NZ_CP021468	Komagataeibacter europaeus strain SRCM101446 plasmid pKE1446-1	25636-25667	8	0.75
NC_018524_21	21.18|4582419|32|NC_018524|CRISPRCasFinder,CRT	4582419-4582450	32	NZ_CP015171	Acetobacter ascendens strain LMG 1591 plasmid unnamed3, complete sequence	22210-22241	8	0.75
NC_018524_21	21.18|4582419|32|NC_018524|CRISPRCasFinder,CRT	4582419-4582450	32	NC_016029	Komagataeibacter medellinensis NBRC 3288 plasmid pGXY050, complete sequence	4136-4167	8	0.75
NC_018524_21	21.18|4582419|32|NC_018524|CRISPRCasFinder,CRT	4582419-4582450	32	NZ_CP021513	Acetobacter pasteurianus subsp. pasteurianus strain SRCM101342 plasmid pAP1342-4, complete sequence	17337-17368	8	0.75
NC_018524_21	21.20|4582541|32|NC_018524|CRISPRCasFinder,CRT	4582541-4582572	32	NZ_CP009145	Sinorhizobium meliloti strain RMO17 plasmid pSymA, complete sequence	45107-45138	8	0.75
NC_018524_21	21.20|4582541|32|NC_018524|CRISPRCasFinder,CRT	4582541-4582572	32	NZ_CP021827	Sinorhizobium meliloti strain KH35c plasmid psymA, complete sequence	243958-243989	8	0.75
NC_018524_21	21.20|4582541|32|NC_018524|CRISPRCasFinder,CRT	4582541-4582572	32	NZ_CP019483	Sinorhizobium meliloti strain B401 plasmid pSymA, complete sequence	1089184-1089215	8	0.75
NC_018524_21	21.20|4582541|32|NC_018524|CRISPRCasFinder,CRT	4582541-4582572	32	NZ_CP019486	Sinorhizobium meliloti strain B399 plasmid pSymA, complete sequence	1071366-1071397	8	0.75
NC_018524_21	21.25|4582846|32|NC_018524|CRISPRCasFinder,CRT	4582846-4582877	32	NC_019959	Mycobacterium sp. JS623 plasmid pMYCSM03, complete sequence	67010-67041	8	0.75
NC_018524_21	21.25|4582846|32|NC_018524|CRISPRCasFinder,CRT	4582846-4582877	32	NC_008382	Rhizobium leguminosarum bv. viciae 3841 plasmid pRL7, complete sequence	137062-137093	8	0.75
NC_018524_21	21.25|4582846|32|NC_018524|CRISPRCasFinder,CRT	4582846-4582877	32	NZ_CP015867	Streptomyces parvulus strain 2297 plasmid pSPA1, complete sequence	22453-22484	8	0.75
NC_018524_21	21.25|4582846|32|NC_018524|CRISPRCasFinder,CRT	4582846-4582877	32	NZ_CP049735	Rhizobium leguminosarum strain A1 plasmid unnamed2, complete sequence	108580-108611	8	0.75
NC_018524_21	21.25|4582846|32|NC_018524|CRISPRCasFinder,CRT	4582846-4582877	32	NZ_CP027299	Streptomyces sp. SGAir0924 plasmid unnamed_5	88107-88138	8	0.75
NC_018524_21	21.25|4582846|32|NC_018524|CRISPRCasFinder,CRT	4582846-4582877	32	CP049735	Rhizobium leguminosarum strain A1 plasmid pRLa12, complete sequence	79007-79038	8	0.75
NC_018524_21	21.25|4582846|32|NC_018524|CRISPRCasFinder,CRT	4582846-4582877	32	MT889365	Microbacterium phage Quenya, complete genome	16121-16152	8	0.75
NC_018524_21	21.27|4582968|32|NC_018524|CRISPRCasFinder,CRT	4582968-4582999	32	NC_019849	Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence	662760-662791	8	0.75
NC_018524_21	21.27|4582968|32|NC_018524|CRISPRCasFinder,CRT	4582968-4582999	32	NC_003078	Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence	1073997-1074028	8	0.75
NC_018524_21	21.27|4582968|32|NC_018524|CRISPRCasFinder,CRT	4582968-4582999	32	NZ_CP019586	Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence	1042822-1042853	8	0.75
NC_018524_21	21.27|4582968|32|NC_018524|CRISPRCasFinder,CRT	4582968-4582999	32	NC_017326	Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence	647754-647785	8	0.75
NC_018524_21	21.27|4582968|32|NC_018524|CRISPRCasFinder,CRT	4582968-4582999	32	NZ_CP021799	Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence	1140218-1140249	8	0.75
NC_018524_21	21.27|4582968|32|NC_018524|CRISPRCasFinder,CRT	4582968-4582999	32	NC_017323	Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence	244798-244829	8	0.75
NC_018524_21	21.27|4582968|32|NC_018524|CRISPRCasFinder,CRT	4582968-4582999	32	NZ_CP009146	Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence	655819-655850	8	0.75
NC_018524_21	21.27|4582968|32|NC_018524|CRISPRCasFinder,CRT	4582968-4582999	32	NC_018701	Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence	645627-645658	8	0.75
NC_018524_21	21.27|4582968|32|NC_018524|CRISPRCasFinder,CRT	4582968-4582999	32	NZ_CP021828	Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence	644735-644766	8	0.75
NC_018524_21	21.27|4582968|32|NC_018524|CRISPRCasFinder,CRT	4582968-4582999	32	NZ_CP021820	Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence	999348-999379	8	0.75
NC_018524_21	21.27|4582968|32|NC_018524|CRISPRCasFinder,CRT	4582968-4582999	32	NZ_CP021831	Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence	907052-907083	8	0.75
NC_018524_21	21.27|4582968|32|NC_018524|CRISPRCasFinder,CRT	4582968-4582999	32	NZ_CP021823	Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence	761616-761647	8	0.75
NC_018524_21	21.27|4582968|32|NC_018524|CRISPRCasFinder,CRT	4582968-4582999	32	NZ_CP021814	Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence	569806-569837	8	0.75
NC_018524_21	21.27|4582968|32|NC_018524|CRISPRCasFinder,CRT	4582968-4582999	32	NZ_CP021795	Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence	281073-281104	8	0.75
NC_018524_21	21.27|4582968|32|NC_018524|CRISPRCasFinder,CRT	4582968-4582999	32	NZ_CP021810	Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence	1434418-1434449	8	0.75
NC_018524_21	21.27|4582968|32|NC_018524|CRISPRCasFinder,CRT	4582968-4582999	32	NZ_CP021806	Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence	361985-362016	8	0.75
NC_018524_21	21.27|4582968|32|NC_018524|CRISPRCasFinder,CRT	4582968-4582999	32	NZ_CP021218	Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence	806360-806391	8	0.75
NC_018524_21	21.27|4582968|32|NC_018524|CRISPRCasFinder,CRT	4582968-4582999	32	NZ_CP026527	Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence	669433-669464	8	0.75
NC_018524_21	21.27|4582968|32|NC_018524|CRISPRCasFinder,CRT	4582968-4582999	32	NZ_CP019484	Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence	1214575-1214606	8	0.75
NC_018524_21	21.27|4582968|32|NC_018524|CRISPRCasFinder,CRT	4582968-4582999	32	NZ_CP019487	Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence	987258-987289	8	0.75
NC_018524_21	21.27|4582968|32|NC_018524|CRISPRCasFinder,CRT	4582968-4582999	32	NC_020560	Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence	1074001-1074032	8	0.75
NC_018524_21	21.27|4582968|32|NC_018524|CRISPRCasFinder,CRT	4582968-4582999	32	NC_009508	Sphingomonas wittichii RW1 plasmid pSWIT02, complete sequence	211428-211459	8	0.75
NC_018524_23	23.5|4591847|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4591847-4591878	32	CP054917	Streptomyces sp. NA02950 plasmid unnamed, complete sequence	22690-22721	8	0.75
NC_018524_23	23.6|4591908|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4591908-4591939	32	NZ_CP025617	Micrococcus luteus strain SGAir0127 plasmid pSGAir0127	60648-60679	8	0.75
NC_018524_23	23.6|4591908|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4591908-4591939	32	NC_024972	Micrococcus sp. A1 plasmid pLMA1, complete sequence	36792-36823	8	0.75
NC_018524_23	23.8|4592030|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4592030-4592061	32	NZ_CP049732	Rhizobium leguminosarum strain A1 plasmid pRL11, complete sequence	34703-34734	8	0.75
NC_018524_23	23.8|4592030|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4592030-4592061	32	NZ_CP032695	Rhizobium jaguaris strain CCGE525 plasmid pRCCGE525c, complete sequence	1891358-1891389	8	0.75
NC_018524_23	23.9|4592091|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4592091-4592122	32	NC_015951	Streptomyces violaceusniger Tu 4113 plasmid pSTRVI01, complete sequence	67509-67540	8	0.75
NC_018524_23	23.9|4592091|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4592091-4592122	32	NZ_CP032324	Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence	453932-453963	8	0.75
NC_018524_23	23.9|4592091|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4592091-4592122	32	NZ_CP022366	Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence	314354-314385	8	0.75
NC_018524_23	23.9|4592091|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4592091-4592122	32	NZ_CP008945	Corynebacterium atypicum strain R2070 plasmid phiCATYP2070I, complete sequence	22014-22045	8	0.75
NC_018524_24	24.1|4593189|32|NC_018524|CRISPRCasFinder,CRT	4593189-4593220	32	NC_023285	Streptomyces sp. F8 plasmid pFRL5, complete sequence	348695-348726	8	0.75
NC_018524_25	25.8|4595565|32|NC_018524|CRISPRCasFinder	4595565-4595596	32	NZ_CP032685	Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence	1117142-1117173	8	0.75
NC_018524_25	25.8|4595565|32|NC_018524|CRISPRCasFinder	4595565-4595596	32	NZ_CP032690	Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence	1118141-1118172	8	0.75
NC_018524_26	26.15|4598572|32|NC_018524|CRISPRCasFinder,CRT	4598572-4598603	32	NC_012987	Methylorubrum extorquens AM1 plasmid p1METDI, complete sequence	129597-129628	8	0.75
NC_018524_26	26.15|4598572|32|NC_018524|CRISPRCasFinder,CRT	4598572-4598603	32	NZ_CP017427	Methylobacterium sp. XJLW plasmid unnamed1, complete sequence	87397-87428	8	0.75
NC_018524_26	26.15|4598572|32|NC_018524|CRISPRCasFinder,CRT	4598572-4598603	32	NZ_CP029174	Methylobacterium sp. DM1 plasmid pLVM1, complete sequence	229302-229333	8	0.75
NC_018524_26	26.15|4598572|32|NC_018524|CRISPRCasFinder,CRT	4598572-4598603	32	NC_011758	Methylorubrum extorquens CM4 plasmid pCMU01, complete sequence	218168-218199	8	0.75
NC_018524_26	26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT	4598633-4598664	32	NC_007353	Sphingomonas sp. A1 plasmid pA1 DNA, complete sequence	42169-42200	8	0.75
NC_018524_26	26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT	4598633-4598664	32	NC_009427	Novosphingobium aromaticivorans DSM 12444 plasmid pNL2, complete sequence	100492-100523	8	0.75
NC_018524_26	26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT	4598633-4598664	32	NZ_CP013109	Sinorhizobium americanum strain CFNEI 73 plasmid B, complete sequence	325256-325287	8	0.75
NC_018524_26	26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT	4598633-4598664	32	NZ_CP017759	Cupriavidus necator strain NH9 plasmid pENH92, complete sequence	382425-382456	8	0.75
NC_018524_26	26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT	4598633-4598664	32	NZ_AP022338	Mameliella alba strain KU6B plasmid pKUB257, complete sequence	41180-41211	8	0.75
NC_018524_26	26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT	4598633-4598664	32	MT952845	Microbacterium phage GardenState, complete genome	606-637	8	0.75
NC_018524_26	26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT	4598633-4598664	32	MK880124	Microbacterium phage IAmGroot, complete genome	606-637	8	0.75
NC_018524_26	26.18|4598755|32|NC_018524|CRISPRCasFinder,CRT	4598755-4598786	32	NZ_CP038636	Cupriavidus oxalaticus strain X32 plasmid unnamed1, complete sequence	59516-59547	8	0.75
NC_018524_26	26.20|4598877|32|NC_018524|CRISPRCasFinder,CRT	4598877-4598908	32	NZ_CP006991	Rhizobium sp. IE4771 plasmid pRetIE4771e, complete sequence	454014-454045	8	0.75
NC_018524_26	26.20|4598877|32|NC_018524|CRISPRCasFinder,CRT	4598877-4598908	32	NC_007763	Rhizobium etli CFN 42 plasmid p42b, complete sequence	81873-81904	8	0.75
NC_018524_26	26.20|4598877|32|NC_018524|CRISPRCasFinder,CRT	4598877-4598908	32	NZ_CP020907	Rhizobium etli strain NXC12 plasmid pRetNXC12a, complete sequence	80996-81027	8	0.75
NC_018524_26	26.20|4598877|32|NC_018524|CRISPRCasFinder,CRT	4598877-4598908	32	NZ_CP013531	Rhizobium phaseoli strain R723 plasmid pRphaR723d, complete sequence	267791-267822	8	0.75
NC_018524_26	26.20|4598877|32|NC_018524|CRISPRCasFinder,CRT	4598877-4598908	32	NC_021906	Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1a, complete sequence	79906-79937	8	0.75
NC_018524_26	26.20|4598877|32|NC_018524|CRISPRCasFinder,CRT	4598877-4598908	32	NZ_CP013584	Rhizobium phaseoli strain N261 plasmid pRphaN261d, complete sequence	267791-267822	8	0.75
NC_018524_26	26.20|4598877|32|NC_018524|CRISPRCasFinder,CRT	4598877-4598908	32	NC_016585	Azospirillum lipoferum 4B plasmid AZO_p1, complete sequence	811933-811964	8	0.75
NC_018524_26	26.20|4598877|32|NC_018524|CRISPRCasFinder,CRT	4598877-4598908	32	NZ_CP039697	Novosphingobium sp. ABRDHK2 plasmid pABRDHK22, complete sequence	457318-457349	8	0.75
NC_018524_26	26.20|4598877|32|NC_018524|CRISPRCasFinder,CRT	4598877-4598908	32	NZ_LR134459	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 17, complete sequence	15862-15893	8	0.75
NC_018524_26	26.20|4598877|32|NC_018524|CRISPRCasFinder,CRT	4598877-4598908	32	MH229865	Streptomyces phage LazerLemon, complete genome	28044-28075	8	0.75
NC_018524_26	26.21|4598938|32|NC_018524|CRISPRCasFinder,CRT	4598938-4598969	32	NZ_LT904879	Salmonella enterica subsp. enterica serovar Typhi strain ty3-193 genome assembly, plasmid: 2	193887-193918	8	0.75
NC_018524_26	26.21|4598938|32|NC_018524|CRISPRCasFinder,CRT	4598938-4598969	32	NZ_CP029645	Salmonella enterica subsp. enterica serovar Typhi strain 311189_217186 plasmid pHCM1, complete sequence	141486-141517	8	0.75
NC_018524_26	26.21|4598938|32|NC_018524|CRISPRCasFinder,CRT	4598938-4598969	32	NZ_CP029895	Salmonella enterica subsp. enterica serovar Typhi strain 311189_252186 plasmid pHCM1, complete sequence	141807-141838	8	0.75
NC_018524_26	26.21|4598938|32|NC_018524|CRISPRCasFinder,CRT	4598938-4598969	32	NZ_CP029877	Salmonella enterica subsp. enterica serovar Typhi strain 311189_224186 plasmid pHCM1, complete sequence	141605-141636	8	0.75
NC_018524_26	26.21|4598938|32|NC_018524|CRISPRCasFinder,CRT	4598938-4598969	32	LT905061	Salmonella enterica subsp. enterica serovar Typhi isolate ISP_03_07467_SGB110-sc-1979083 genome assembly, plasmid: 2	77584-77615	8	0.75
NC_018524_26	26.21|4598938|32|NC_018524|CRISPRCasFinder,CRT	4598938-4598969	32	NZ_CP029926	Salmonella enterica subsp. enterica serovar Typhi strain 311189_218186 plasmid pHCM1, complete sequence	83734-83765	8	0.75
NC_018524_26	26.21|4598938|32|NC_018524|CRISPRCasFinder,CRT	4598938-4598969	32	NZ_CP029947	Salmonella enterica subsp. enterica serovar Typhi strain 311189_210186 plasmid pHCM1, complete sequence	143150-143181	8	0.75
NC_018524_26	26.21|4598938|32|NC_018524|CRISPRCasFinder,CRT	4598938-4598969	32	NZ_CP017759	Cupriavidus necator strain NH9 plasmid pENH92, complete sequence	338642-338673	8	0.75
NC_018524_26	26.21|4598938|32|NC_018524|CRISPRCasFinder,CRT	4598938-4598969	32	NZ_CP029943	Salmonella enterica subsp. enterica serovar Typhi strain 311189_212186 plasmid pHCM1, complete sequence	141594-141625	8	0.75
NC_018524_26	26.21|4598938|32|NC_018524|CRISPRCasFinder,CRT	4598938-4598969	32	NZ_CP029953	Salmonella enterica subsp. enterica serovar Typhi strain 311189_204186 plasmid pHCM1, complete sequence	141917-141948	8	0.75
NC_018524_26	26.21|4598938|32|NC_018524|CRISPRCasFinder,CRT	4598938-4598969	32	NZ_CP029955	Salmonella enterica subsp. enterica serovar Typhi strain 311189_202186 plasmid pHCM1, complete sequence	141862-141893	8	0.75
NC_018524_26	26.21|4598938|32|NC_018524|CRISPRCasFinder,CRT	4598938-4598969	32	NZ_CP029924	Salmonella enterica subsp. enterica serovar Typhi strain 311189_221186 plasmid pHCM1, complete sequence	8469-8500	8	0.75
NC_018524_26	26.21|4598938|32|NC_018524|CRISPRCasFinder,CRT	4598938-4598969	32	NZ_CP029934	Salmonella enterica subsp. enterica serovar Typhi strain 311189_214186 plasmid pHCM1, complete sequence	141605-141636	8	0.75
NC_018524_26	26.21|4598938|32|NC_018524|CRISPRCasFinder,CRT	4598938-4598969	32	NZ_CP029939	Salmonella enterica subsp. enterica serovar Typhi strain 311189_206186 plasmid pHCM1, complete sequence	140315-140346	8	0.75
NC_018524_26	26.21|4598938|32|NC_018524|CRISPRCasFinder,CRT	4598938-4598969	32	NZ_CP029957	Salmonella enterica subsp. enterica serovar Typhi strain 311189_201186 plasmid pHCM1, complete sequence	141370-141401	8	0.75
NC_018524_26	26.21|4598938|32|NC_018524|CRISPRCasFinder,CRT	4598938-4598969	32	NZ_CP029941	Salmonella enterica subsp. enterica serovar Typhi strain 311189_203186 plasmid pHCM1, complete sequence	141697-141728	8	0.75
NC_018524_26	26.21|4598938|32|NC_018524|CRISPRCasFinder,CRT	4598938-4598969	32	NZ_CP029910	Salmonella enterica subsp. enterica serovar Typhi strain 311189_219186 plasmid pHCM1, complete sequence	141605-141636	8	0.75
NC_018524_26	26.21|4598938|32|NC_018524|CRISPRCasFinder,CRT	4598938-4598969	32	NZ_CP029887	Salmonella enterica subsp. enterica serovar Typhi strain 311189_220186 plasmid pHCM1, complete sequence	141431-141462	8	0.75
NC_018524_26	26.21|4598938|32|NC_018524|CRISPRCasFinder,CRT	4598938-4598969	32	NZ_CP029948	Salmonella enterica subsp. enterica serovar Typhi strain 311189_208186 plasmid pHCM1, complete sequence	141807-141838	8	0.75
NC_018524_26	26.21|4598938|32|NC_018524|CRISPRCasFinder,CRT	4598938-4598969	32	NZ_CP029937	Salmonella enterica subsp. enterica serovar Typhi strain 311189_207186 plasmid pHCM1, complete sequence	141333-141364	8	0.75
NC_018524_26	26.21|4598938|32|NC_018524|CRISPRCasFinder,CRT	4598938-4598969	32	NZ_CP029879	Salmonella enterica subsp. enterica serovar Typhi strain 311189_223186 plasmid pHCM1, complete sequence	139119-139150	8	0.75
NC_018524_26	26.21|4598938|32|NC_018524|CRISPRCasFinder,CRT	4598938-4598969	32	NC_016825	Salmonella enterica subsp. enterica serovar Typhi str. P-stx-12 plasmid unnamed, complete sequence	171291-171322	8	0.75
NC_018524_26	26.21|4598938|32|NC_018524|CRISPRCasFinder,CRT	4598938-4598969	32	NZ_CP029931	Salmonella enterica subsp. enterica serovar Typhi strain 311189_215186 plasmid pHCM1, complete sequence	141438-141469	8	0.75
NC_018524_26	26.21|4598938|32|NC_018524|CRISPRCasFinder,CRT	4598938-4598969	32	NZ_CP029935	Salmonella enterica subsp. enterica serovar Typhi strain 311189_213186 plasmid pHCM1, complete sequence	141222-141253	8	0.75
NC_018524_26	26.22|4598999|32|NC_018524|CRISPRCasFinder,CRT	4598999-4599030	32	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	2666554-2666585	8	0.75
NC_018524_26	26.23|4599060|32|NC_018524|CRISPRCasFinder,CRT	4599060-4599091	32	NZ_CP032323	Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence	706423-706454	8	0.75
NC_018524_26	26.23|4599060|32|NC_018524|CRISPRCasFinder,CRT	4599060-4599091	32	NZ_CP007795	Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence	399728-399759	8	0.75
NC_018524_26	26.23|4599060|32|NC_018524|CRISPRCasFinder,CRT	4599060-4599091	32	NZ_CP022363	Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence	65505-65536	8	0.75
NC_018524_26	26.23|4599060|32|NC_018524|CRISPRCasFinder,CRT	4599060-4599091	32	NZ_CP032341	Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence	702860-702891	8	0.75
NC_018524_26	26.23|4599060|32|NC_018524|CRISPRCasFinder,CRT	4599060-4599091	32	NZ_CP033321	Azospirillum brasilense strain Cd plasmid p3, complete sequence	700374-700405	8	0.75
NC_018524_26	26.23|4599060|32|NC_018524|CRISPRCasFinder,CRT	4599060-4599091	32	NZ_CP033315	Azospirillum brasilense strain Sp 7 plasmid p3, complete sequence	698535-698566	8	0.75
NC_018524_26	26.23|4599060|32|NC_018524|CRISPRCasFinder,CRT	4599060-4599091	32	NZ_CP032347	Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence	353120-353151	8	0.75
NC_018524_26	26.23|4599060|32|NC_018524|CRISPRCasFinder,CRT	4599060-4599091	32	NZ_CP012916	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence	345744-345775	8	0.75
NC_018524_26	26.24|4599121|32|NC_018524|CRISPRCasFinder,CRT	4599121-4599152	32	NC_014663	Acinetobacter phage Acj9, complete genome	62501-62532	8	0.75
NC_018524_26	26.25|4599182|32|NC_018524|CRISPRCasFinder,CRT	4599182-4599213	32	NZ_CP017300	Rhodococcus sp. YL-1 plasmid pYLC1, complete sequence	43262-43293	8	0.75
NC_018524_26	26.25|4599182|32|NC_018524|CRISPRCasFinder,CRT	4599182-4599213	32	NZ_CP034154	Rhodococcus sp. NJ-530 plasmid unnamed2, complete sequence	208773-208804	8	0.75
NC_018524_26	26.25|4599182|32|NC_018524|CRISPRCasFinder,CRT	4599182-4599213	32	NZ_LR134452	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 10, complete sequence	297592-297623	8	0.75
NC_018524_26	26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT	4599243-4599274	32	NZ_CP050953	Rhodococcus sp. DMU1 plasmid unnamed	315880-315911	8	0.75
NC_018524_26	26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT	4599243-4599274	32	NZ_CP024310	Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3c, complete sequence	983593-983624	8	0.75
NC_018524_26	26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT	4599243-4599274	32	NZ_CP013054	Sinorhizobium americanum CCGM7 plasmid C, complete sequence	1304772-1304803	8	0.75
NC_018524_26	26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT	4599243-4599274	32	NZ_CP023064	Sinorhizobium sp. CCBAU 05631 plasmid pSS05631b, complete sequence	802051-802082	8	0.75
NC_018524_26	26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT	4599243-4599274	32	NZ_CP040764	Paracoccus sp. 2251 plasmid unnamed3, complete sequence	20578-20609	8	0.75
NC_018524_26	26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT	4599243-4599274	32	NZ_HG813238	Erwinia amylovora strain 692 plasmid pEA68, complete sequence	49248-49279	8	0.75
NC_018524_26	26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT	4599243-4599274	32	NZ_CP026745	Nocardia cyriacigeorgica strain MDA3349 isolate MDA3349 ancestor plasmid p_unnamed, complete sequence	42964-42995	8	0.75
NC_018524_26	26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT	4599243-4599274	32	NZ_CP050138	Sphingomonas sp. CL5.1 plasmid pTSSC1, complete sequence	31464-31495	8	0.75
NC_018524_26	26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT	4599243-4599274	32	NZ_CP030074	Streptomyces sp. ZFG47 plasmid unnamed1, complete sequence	626305-626336	8	0.75
NC_018524_28	28.1|4608658|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4608658-4608689	32	LN997843	Streptomyces reticuli genome assembly TUE45, plasmid : II	661964-661995	8	0.75
NC_018524_28	28.1|4608658|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4608658-4608689	32	NZ_CP054841	Acidovorax sp. 16-35-5 plasmid unnamed1, complete sequence	130974-131005	8	0.75
NC_018524_28	28.1|4608658|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4608658-4608689	32	NZ_CP013069	Pannonibacter phragmitetus strain 31801 plasmid p.p-1, complete sequence	62196-62227	8	0.75
NC_018524_28	28.1|4608658|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4608658-4608689	32	NZ_CP032313	Pannonibacter phragmitetus BB plasmid p.BB_1, complete sequence	258172-258203	8	0.75
NC_018524_28	28.1|4608658|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4608658-4608689	32	NZ_CP012698	Microbacterium sp. No. 7 plasmid A, complete sequence	14617-14648	8	0.75
NC_018524_28	28.1|4608658|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4608658-4608689	32	NZ_CP020568	Kitasatospora aureofaciens strain DM-1 plasmid unnamed1, complete sequence	197592-197623	8	0.75
NC_018524_28	28.1|4608658|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4608658-4608689	32	NC_019846	Sinorhizobium meliloti GR4 plasmid pRmeGR4a, complete sequence	22370-22401	8	0.75
NC_018524_30	30.2|4637791|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637791-4637822	32	NZ_CP028348	Novosphingobium sp. THN1 plasmid pTHN, complete sequence	927240-927271	8	0.75
NC_018524_30	30.2|4637791|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637791-4637822	32	NZ_CP042825	Rhizobium sp. WL3 plasmid unnamed2, complete sequence	261403-261434	8	0.75
NC_018524_30	30.2|4637791|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637791-4637822	32	NZ_CP042825	Rhizobium sp. WL3 plasmid unnamed2, complete sequence	270396-270427	8	0.75
NC_018524_30	30.2|4637791|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637791-4637822	32	NZ_CP029830	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed1, complete sequence	343011-343042	8	0.75
NC_018524_30	30.2|4637791|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637791-4637822	32	NZ_CP054622	Azospirillum oryzae strain KACC 14407 plasmid unnamed7, complete sequence	65133-65164	8	0.75
NC_018524_30	30.2|4637791|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637791-4637822	32	NZ_CP039651	Azospirillum sp. TSA2s plasmid p1	44210-44241	8	0.75
NC_018524_30	30.2|4637791|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637791-4637822	32	NC_019307	Streptomyces sp. W75 plasmid pCQ4, complete sequence	77093-77124	8	0.75
NC_018524_30	30.2|4637791|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637791-4637822	32	KF024734	Mycobacterium phage Shrimp, complete genome	103191-103222	8	0.75
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	635872-635903	8	0.75
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	NC_023283	Streptomyces sp. FR1 plasmid pFRL3, complete sequence	175033-175064	8	0.75
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	NC_023284	Streptomyces sp. F2 plasmid pFRL4, complete sequence	211661-211692	8	0.75
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	1177199-1177230	8	0.75
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	NZ_CP005086	Sphingobium sp. TKS plasmid pTK2, complete sequence	54588-54619	8	0.75
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	730061-730092	8	0.75
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	NZ_CP005087	Sphingobium sp. TKS plasmid pTK3, complete sequence	66771-66802	8	0.75
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	NC_009475	Bradyrhizobium sp. BTAi1 plasmid pBBta01, complete sequence	200824-200855	8	0.75
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	NC_004320	Corynebacterium efficiens YS-314 plasmid pCE3, complete sequence	31182-31213	8	0.75
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	NZ_CP025114	Bradyrhizobium sp. SK17 strain CBNU plasmid unnamed, complete sequence	41728-41759	8	0.75
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	NC_013531	Xylanimonas cellulosilytica DSM 15894 plasmid pXCEL01, complete sequence	15417-15448	8	0.75
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	NZ_CP044544	Bradyrhizobium betae strain PL7HG1 plasmid pBbPL7HG1, complete sequence	92369-92400	8	0.75
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	NC_001387	Streptomyces lividans plasmid pIJ101, complete sequence	965-996	8	0.75
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	NC_001425	Streptomyces flavovirens plasmid pSN22 DNA, complete sequence	8186-8217	8	0.75
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	MT118302	Pseudomonas phage Epa38, complete genome	9416-9447	8	0.75
NC_018524_30	30.5|4637974|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637974-4638005	32	CP021131	Meiothermus taiwanensis strain WR-220 plasmid pMtWR-220, complete sequence	260310-260341	8	0.75
NC_018524_32	32.1|4652561|33|NC_018524|PILER-CR,CRT	4652561-4652593	33	NZ_CP015742	Shinella sp. HZN7 plasmid pShin-06, complete sequence	62903-62935	8	0.758
NC_018524_32	32.2|4652622|33|NC_018524|PILER-CR,CRT	4652622-4652654	33	MT114163	Mycobacterium phage Settecandela, complete genome	59566-59598	8	0.758
NC_018524_32	32.2|4652622|33|NC_018524|PILER-CR,CRT	4652622-4652654	33	MK937592	Mycobacterium phage Phrappuccino, complete genome	59566-59598	8	0.758
NC_018524_32	32.7|4652926|33|NC_018524|PILER-CR,CRT	4652926-4652958	33	NZ_CP025613	Niveispirillum cyanobacteriorum strain TH16 plasmid unnamed1, complete sequence	778200-778232	8	0.758
NC_018524_32	32.7|4652926|33|NC_018524|PILER-CR,CRT	4652926-4652958	33	MN234199	Mycobacterium phage Ekdilam, complete genome	46713-46745	8	0.758
NC_018524_32	32.9|4653048|33|NC_018524|PILER-CR,CRT	4653048-4653080	33	NZ_CP045421	Maribius sp. THAF1 plasmid pTHAF1_a, complete sequence	15412-15444	8	0.758
NC_018524_32	32.15|4652562|32|NC_018524|CRISPRCasFinder	4652562-4652593	32	NZ_CP015882	Ensifer adhaerens strain Casida A plasmid pCasidaAB, complete sequence	1062603-1062634	8	0.75
NC_018524_32	32.16|4652623|32|NC_018524|CRISPRCasFinder	4652623-4652654	32	NZ_CP031163	Deinococcus wulumuqiensis strain NEB 479 plasmid pDrdI, complete sequence	384361-384392	8	0.75
NC_018524_32	32.16|4652623|32|NC_018524|CRISPRCasFinder	4652623-4652654	32	NZ_CP017105	Rhizobium gallicum strain IE4872 plasmid pRgalIE4872d, complete sequence	343283-343314	8	0.75
NC_018524_32	32.22|4652988|32|NC_018524|CRISPRCasFinder	4652988-4653019	32	NZ_AP018520	Sphingobium sp. YG1 plasmid pYGP1, complete sequence	66998-67029	8	0.75
NC_018524_32	32.22|4652988|32|NC_018524|CRISPRCasFinder	4652988-4653019	32	NZ_CP032342	Azospirillum brasilense strain MTCC4038 plasmid p3, complete sequence	707802-707833	8	0.75
NC_018524_32	32.23|4653049|32|NC_018524|CRISPRCasFinder	4653049-4653080	32	NZ_CP045421	Maribius sp. THAF1 plasmid pTHAF1_a, complete sequence	15412-15443	8	0.75
NC_018524_32	32.24|4653110|32|NC_018524|CRISPRCasFinder	4653110-4653141	32	CP021188	Sphingomonas wittichii DC-6 plasmid pDC07, complete sequence	5774-5805	8	0.75
NC_018524_32	32.24|4653110|32|NC_018524|CRISPRCasFinder	4653110-4653141	32	NZ_CP010990	Pseudonocardia sp. EC080625-04 plasmid pFRP1-1, complete sequence	181613-181644	8	0.75
NC_018524_32	32.24|4653110|32|NC_018524|CRISPRCasFinder	4653110-4653141	32	NZ_CP012186	Pseudonocardia sp. EC080619-01 plasmid pBCI1-1, complete sequence	2679-2710	8	0.75
NC_018524_32	32.24|4653110|32|NC_018524|CRISPRCasFinder	4653110-4653141	32	NZ_CP012186	Pseudonocardia sp. EC080619-01 plasmid pBCI1-1, complete sequence	61951-61982	8	0.75
NC_018524_32	32.24|4653110|32|NC_018524|CRISPRCasFinder	4653110-4653141	32	NZ_CP012186	Pseudonocardia sp. EC080619-01 plasmid pBCI1-1, complete sequence	78522-78553	8	0.75
NC_018524_32	32.24|4653110|32|NC_018524|CRISPRCasFinder	4653110-4653141	32	NZ_CP012186	Pseudonocardia sp. EC080619-01 plasmid pBCI1-1, complete sequence	118294-118325	8	0.75
NC_018524_32	32.25|4653171|32|NC_018524|CRISPRCasFinder	4653171-4653202	32	NZ_CP022775	Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence	473438-473469	8	0.75
NC_018524_32	32.25|4653171|32|NC_018524|CRISPRCasFinder	4653171-4653202	32	NZ_CP022762	Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence	440018-440049	8	0.75
NC_018524_32	32.25|4653171|32|NC_018524|CRISPRCasFinder	4653171-4653202	32	NZ_CP023017	Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence	428336-428367	8	0.75
NC_018524_32	32.25|4653171|32|NC_018524|CRISPRCasFinder	4653171-4653202	32	NZ_CP014703	Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence	440018-440049	8	0.75
NC_018524_32	32.25|4653171|32|NC_018524|CRISPRCasFinder	4653171-4653202	32	NZ_CP022771	Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence	440030-440061	8	0.75
NC_018524_32	32.25|4653171|32|NC_018524|CRISPRCasFinder	4653171-4653202	32	NZ_CP022777	Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence	440051-440082	8	0.75
NC_018524_32	32.25|4653171|32|NC_018524|CRISPRCasFinder	4653171-4653202	32	NZ_CP022799	Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence	440017-440048	8	0.75
NC_018524_32	32.25|4653171|32|NC_018524|CRISPRCasFinder	4653171-4653202	32	NZ_CP022764	Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence	473472-473503	8	0.75
NC_018524_32	32.25|4653171|32|NC_018524|CRISPRCasFinder	4653171-4653202	32	NZ_CP022797	Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence	473471-473502	8	0.75
NC_018524_32	32.25|4653171|32|NC_018524|CRISPRCasFinder	4653171-4653202	32	NZ_CP022758	Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence	473463-473494	8	0.75
NC_018524_32	32.27|4653293|32|NC_018524|CRISPRCasFinder	4653293-4653324	32	NC_008242	Chelativorans sp. BNC1 plasmid 1, complete sequence	110713-110744	8	0.75
NC_018524_32	32.27|4653293|32|NC_018524|CRISPRCasFinder	4653293-4653324	32	NC_008270	Rhodococcus jostii RHA1 plasmid pRHL2, complete sequence	228743-228774	8	0.75
NC_018524_34	34.1|5116474|32|NC_018524|CRISPRCasFinder,CRT	5116474-5116505	32	NZ_KY494864	Pseudomonas aeruginosa strain FFUP_PS_37 plasmid pJB37, complete sequence	423844-423875	8	0.75
NC_018524_34	34.1|5116474|32|NC_018524|CRISPRCasFinder,CRT	5116474-5116505	32	NZ_KT935446	Klebsiella pneumoniae strain Kp2964 plasmid 2964TF, complete sequence	58067-58098	8	0.75
NC_018524_34	34.1|5116474|32|NC_018524|CRISPRCasFinder,CRT	5116474-5116505	32	NZ_CP010380	Enterobacter hormaechei subsp. hormaechei strain 34983 plasmid p34983-328.905kb, complete sequence	302787-302818	8	0.75
NC_018524_34	34.1|5116474|32|NC_018524|CRISPRCasFinder,CRT	5116474-5116505	32	NZ_CP042479	Citrobacter freundii strain C50 plasmid pC50_001, complete sequence	95532-95563	8	0.75
NC_018524_34	34.1|5116474|32|NC_018524|CRISPRCasFinder,CRT	5116474-5116505	32	CP049311	Salmonella enterica subsp. enterica serovar Heidelberg strain CVM N53023 plasmid pN53023, complete sequence	88042-88073	8	0.75
NC_018524_34	34.1|5116474|32|NC_018524|CRISPRCasFinder,CRT	5116474-5116505	32	NZ_CP026208	Escherichia coli strain ECONIH5 plasmid pECO-109b, complete sequence	179487-179518	8	0.75
NC_018524_34	34.1|5116474|32|NC_018524|CRISPRCasFinder,CRT	5116474-5116505	32	NZ_CP010360	Enterobacter roggenkampii strain 35734 plasmid p35734-141.404kb, complete sequence	46147-46178	8	0.75
NC_018524_34	34.1|5116474|32|NC_018524|CRISPRCasFinder,CRT	5116474-5116505	32	CP049307	Salmonella enterica subsp. enterica serovar Heidelberg strain CVM N58631 plasmid p58631, complete sequence	277072-277103	8	0.75
NC_018524_34	34.1|5116474|32|NC_018524|CRISPRCasFinder,CRT	5116474-5116505	32	NZ_CP012168	Enterobacter hormaechei subsp. steigerwaltii strain 34998 plasmid p34998-239.973kb, complete sequence	55694-55725	8	0.75
NC_018524_34	34.1|5116474|32|NC_018524|CRISPRCasFinder,CRT	5116474-5116505	32	NZ_CP032179	Citrobacter freundii strain AR_0116 plasmid unnamed1, complete sequence	196411-196442	8	0.75
NC_018524_34	34.1|5116474|32|NC_018524|CRISPRCasFinder,CRT	5116474-5116505	32	NZ_CP017294	Pseudomonas aeruginosa strain PA83 plasmid unnamed1, complete sequence	204510-204541	8	0.75
NC_018524_34	34.1|5116474|32|NC_018524|CRISPRCasFinder,CRT	5116474-5116505	32	NZ_CP031135	Escherichia coli strain CFSAN064035 plasmid pGMI17-003_1, complete sequence	229826-229857	8	0.75
NC_018524_34	34.2|5116535|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116535-5116566	32	NC_048021	Gordonia phage Daredevil, complete genome	87916-87947	8	0.75
NC_018524_34	34.4|5116657|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116657-5116688	32	NZ_CP049734	Rhizobium leguminosarum strain A1 plasmid unnamed1, complete sequence	108618-108649	8	0.75
NC_018524_34	34.4|5116657|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116657-5116688	32	CP049734	Rhizobium leguminosarum strain A1 plasmid pRLa11, complete sequence	225857-225888	8	0.75
NC_018524_34	34.4|5116657|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116657-5116688	32	NZ_CP054024	Rhizobium sp. JKLM12A2 plasmid pPR12A203, complete sequence	100383-100414	8	0.75
NC_018524_34	34.4|5116657|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116657-5116688	32	NZ_CP054035	Rhizobium sp. JKLM13E plasmid pPR13E04, complete sequence	76636-76667	8	0.75
NC_018524_34	34.5|5116718|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116718-5116749	32	NZ_CP050098	Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b4, complete sequence	232239-232270	8	0.75
NC_018524_34	34.5|5116718|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116718-5116749	32	NZ_CP025013	Rhizobium leguminosarum strain Norway plasmid pRLN1, complete sequence	274412-274443	8	0.75
NC_018524_34	34.5|5116718|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116718-5116749	32	NZ_CP053440	Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eF, complete sequence	237828-237859	8	0.75
NC_018524_34	34.5|5116718|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116718-5116749	32	NZ_CP035092	Paracoccus denitrificans strain ATCC 19367 plasmid unnamed1, complete sequence	217126-217157	8	0.75
NC_018524_34	34.5|5116718|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116718-5116749	32	NC_008688	Paracoccus denitrificans PD1222 plasmid 1, complete sequence	464474-464505	8	0.75
NC_018524_34	34.6|5116779|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116779-5116810	32	NZ_AP014863	Pseudomonas furukawaii strain KF707 plasmid pKF707, complete sequence	26473-26504	8	0.75
NC_018524_34	34.6|5116779|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116779-5116810	32	NZ_AP014863	Pseudomonas furukawaii strain KF707 plasmid pKF707, complete sequence	45594-45625	8	0.75
NC_018524_34	34.6|5116779|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116779-5116810	32	AP021850	Deinococcus grandis ATCC 43672 plasmid: pDEGR-1 DNA, complete genome	33471-33502	8	0.75
NC_018524_34	34.6|5116779|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116779-5116810	32	NZ_CP015446	Streptomyces sp. S8 plasmid unnamed, complete sequence	30747-30778	8	0.75
NC_018524_34	34.7|5116840|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116840-5116871	32	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	464053-464084	8	0.75
NC_018524_34	34.10|5117024|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5117024-5117055	32	NZ_CP032703	Pantoea dispersa strain DSM 32899 plasmid unnamed1, complete sequence	314051-314082	8	0.75
NC_018524_34	34.10|5117024|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5117024-5117055	32	MT310869	Microbacterium phage Truong, complete genome	48847-48878	8	0.75
NC_018524_34	34.10|5117024|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5117024-5117055	32	MT310875	Microbacterium phage Ashton, complete genome	49057-49088	8	0.75
NC_018524_34	34.10|5117024|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5117024-5117055	32	MN310546	Microbacterium phage PhriedRice, complete genome	48832-48863	8	0.75
NC_018524_34	34.10|5117024|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5117024-5117055	32	MT657337	Microbacterium phage Mazun, complete genome	49128-49159	8	0.75
NC_018524_34	34.10|5117024|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5117024-5117055	32	MT310890	Microbacterium phage Phedro, complete genome	48728-48759	8	0.75
NC_018524_34	34.10|5117024|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5117024-5117055	32	MT310889	Microbacterium phage Phractured, complete genome	48728-48759	8	0.75
NC_018524_34	34.10|5117024|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5117024-5117055	32	NC_048761	Microbacterium phage Akoni, complete genome	48845-48876	8	0.75
NC_018524_34	34.10|5117024|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5117024-5117055	32	MT310891	Microbacterium phage Pharky, complete genome	48728-48759	8	0.75
NC_018524_35	35.2|5118353|33|NC_018524|PILER-CR,CRISPRCasFinder,CRT	5118353-5118385	33	NC_014213	Meiothermus silvanus DSM 9946 plasmid pMESIL01, complete sequence	222466-222498	8	0.758
NC_018524_35	35.3|5118415|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	5118415-5118446	32	NZ_CP015204	Rhodococcus sp. 008 plasmid pR8C1, complete sequence	46096-46127	8	0.75
NC_018524_35	35.3|5118415|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	5118415-5118446	32	NC_007486	Rhodococcus erythropolis PR4 plasmid pREC1, complete sequence	82811-82842	8	0.75
NC_018524_35	35.3|5118415|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	5118415-5118446	32	NZ_CP042916	Rhodococcus qingshengii strain RL1 plasmid unnamed1, complete sequence	46192-46223	8	0.75
NC_018524_35	35.3|5118415|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	5118415-5118446	32	NZ_CP042916	Rhodococcus qingshengii strain RL1 plasmid unnamed1, complete sequence	131206-131237	8	0.75
NC_018524_35	35.5|5118537|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	5118537-5118568	32	NZ_CP023976	Streptomyces alboflavus strain MDJK44 plasmid pMDJK44.1, complete sequence	29043-29074	8	0.75
NC_018524_35	35.5|5118537|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	5118537-5118568	32	MT740733	Ralstonia phage Dimitile, complete genome	53877-53908	8	0.75
NC_018524_35	35.5|5118537|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	5118537-5118568	32	MT740738	Ralstonia phage Gamede, complete genome	50809-50840	8	0.75
NC_018524_35	35.5|5118537|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	5118537-5118568	32	MT740736	Ralstonia phage Eline, complete genome	53290-53321	8	0.75
NC_018524_35	35.5|5118537|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	5118537-5118568	32	MT740730	Ralstonia phage Cimandef, complete genome	10734-10765	8	0.75
NC_018524_35	35.5|5118537|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	5118537-5118568	32	MT740739	Ralstonia phage Gerry, complete genome	43321-43352	8	0.75
NC_018524_35	35.5|5118537|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	5118537-5118568	32	MT740742	Ralstonia phage Heva, complete genome	23266-23297	8	0.75
NC_018524_35	35.7|5118659|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	5118659-5118690	32	NC_008270	Rhodococcus jostii RHA1 plasmid pRHL2, complete sequence	267982-268013	8	0.75
NC_018524_35	35.7|5118659|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	5118659-5118690	32	NZ_CP033582	Streptomyces sp. ADI95-16 plasmid pADI95-16a, complete sequence	316921-316952	8	0.75
NC_018524_35	35.7|5118659|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	5118659-5118690	32	NZ_CP033582	Streptomyces sp. ADI95-16 plasmid pADI95-16a, complete sequence	599622-599653	8	0.75
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP017076	Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence	1245634-1245665	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP016613	Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence	1184679-1184710	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP022775	Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence	1449927-1449958	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	CP023013	Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence	1448782-1448813	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NC_014310	Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence	1505272-1505303	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP022762	Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence	1372373-1372404	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP049790	Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence	620959-620990	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP049790	Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence	1026761-1026792	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP049794	Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence	30689-30720	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP049794	Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence	1645086-1645117	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP049788	Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence	370363-370394	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP049788	Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence	914869-914900	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP022363	Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence	576759-576790	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP022766	Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence	1522746-1522777	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP022766	Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence	1073934-1073965	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP039340	Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence	1381524-1381555	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP039340	Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence	125123-125154	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP021763	Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence	1526622-1526653	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP021763	Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence	1091880-1091911	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP015116	Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence	1700745-1700776	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP015116	Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence	1267086-1267117	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP016555	Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence	1268095-1268126	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP049792	Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence	1826049-1826080	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP049792	Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence	1420247-1420278	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP052069	Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence	1446234-1446265	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP016915	Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence	1215857-1215888	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP016915	Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence	1622248-1622279	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP016905	Ralstonia solanacearum strain KACC 10709 plasmid unnamed1	525209-525240	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	1967601-1967632	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	1336039-1336070	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP022769	Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence	1530196-1530227	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP022769	Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence	1081685-1081716	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP023017	Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence	1434593-1434624	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP015851	Ralstonia solanacearum strain YC40-M plasmid, complete sequence	942445-942476	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP022773	Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence	1239853-1239884	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP022773	Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence	796539-796570	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP022783	Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence	1455047-1455078	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP022783	Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence	1005303-1005334	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP022791	Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence	1486973-1487004	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP014703	Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence	1371395-1371426	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP022760	Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence	1415954-1415985	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP022789	Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence	1415945-1415976	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP022795	Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence	1451776-1451807	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP052071	Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence	1631204-1631235	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP052071	Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence	1167082-1167113	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP022771	Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence	1372365-1372396	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP022777	Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence	1371718-1371749	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP022799	Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence	1372356-1372387	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP022482	Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence	1586867-1586898	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP009763	Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence	1415760-1415791	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP009763	Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence	1000166-1000197	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	CP023015	Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence	537847-537878	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	CP023015	Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence	987362-987393	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP022779	Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence	1541676-1541707	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP022779	Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence	1081674-1081705	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP052075	Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence	1631171-1631202	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP052075	Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence	1167049-1167080	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP052085	Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence	1505408-1505439	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP052095	Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence	1540380-1540411	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP052105	Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence	1629965-1629996	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP052077	Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence	1440513-1440544	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP052087	Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence	1505720-1505751	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP052097	Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence	1540380-1540411	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP052115	Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence	1630001-1630032	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP052127	Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence	1505408-1505439	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP022764	Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence	1450075-1450106	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP052079	Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence	1441159-1441190	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP052089	Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence	1504611-1504642	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP052093	Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence	1540380-1540411	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP052101	Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence	1540380-1540411	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP052099	Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence	1540380-1540411	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP052107	Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence	1630001-1630032	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP032347	Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence	41994-42025	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP022781	Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence	511078-511109	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP022781	Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence	962303-962334	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP052117	Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence	1629990-1630021	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP052125	Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence	1440535-1440566	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP022793	Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence	1447795-1447826	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP022793	Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence	1004476-1004507	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP022797	Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence	1450056-1450087	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP022785	Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence	1428447-1428478	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP022785	Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence	985151-985182	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP022787	Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence	1481392-1481423	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP022787	Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence	1033097-1033128	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP022756	Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence	1520582-1520613	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP022756	Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence	1079253-1079284	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP052129	Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence	1537695-1537726	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP052121	Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence	1629990-1630021	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP052123	Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence	1440535-1440566	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP052131	Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence	1505719-1505750	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	CP011998	Ralstonia solanacearum strain YC45 plasmid, complete sequence	1454956-1454987	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	CP011998	Ralstonia solanacearum strain YC45 plasmid, complete sequence	1094220-1094251	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP052073	Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence	1630991-1631022	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP052073	Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence	1167047-1167078	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP052081	Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence	1440535-1440566	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP052083	Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence	1440535-1440566	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP052109	Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence	1630001-1630032	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP052091	Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence	1540383-1540414	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP052111	Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence	505720-505751	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP052103	Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence	1630012-1630043	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP052119	Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence	1629813-1629844	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP052113	Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence	505720-505751	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP022758	Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence	1450042-1450073	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP021449	Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence	1421129-1421160	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP016593	Ketogulonicigenium vulgare strain SKV plasmid pKvSKV1, complete sequence	50058-50089	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NC_017386	Ketogulonicigenium vulgare WSH-001 plasmid 1, complete sequence	253240-253271	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NC_014621	Ketogulonicigenium vulgare Y25 plasmid pYP1, complete sequence	220343-220374	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP012909	Ketogulonicigenium vulgare strain Hbe602 plasmid 1, complete sequence	50061-50092	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP021029	Rhizobium sp. TAL182 plasmid pRetTAL182e, complete sequence	123192-123223	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP013600	Rhizobium sp. N741 plasmid pRspN741e, complete sequence	273315-273346	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP013504	Rhizobium esperanzae strain N561 plasmid pRspN561d, complete sequence	273315-273346	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP013510	Rhizobium sp. N1341 plasmid pRspN1341e, complete sequence	271756-271787	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP013521	Rhizobium sp. N113 plasmid pRspN113d, complete sequence	276003-276034	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP013494	Rhizobium sp. N6212 plasmid pRspN6212d, complete sequence	270121-270152	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP013594	Rhizobium sp. N871 plasmid pRspN871d, complete sequence	273315-273346	9	0.719
NC_018524_1	1.6|311931|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311931-311962	32	NZ_LR134465	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 23, complete sequence	400872-400903	9	0.719
NC_018524_1	1.8|312053|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312053-312084	32	KR560069	Stenotrophomonas phage IME-SM1, complete genome	19870-19901	9	0.719
NC_018524_1	1.8|312053|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312053-312084	32	MK580972	Stenotrophomonas phage YB07, complete genome	107980-108011	9	0.719
NC_018524_1	1.10|312180|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312180-312211	32	NZ_CP028919	Gemmobacter sp. HYN0069 plasmid unnamed1, complete sequence	142282-142313	9	0.719
NC_018524_1	1.10|312180|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312180-312211	32	NZ_CP054029	Rhizobium sp. JKLM19E plasmid pPR19E02, complete sequence	338433-338464	9	0.719
NC_018524_1	1.10|312180|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312180-312211	32	AP018487	Mycobacterium phage HC DNA, complete genome	22315-22346	9	0.719
NC_018524_1	1.10|312180|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312180-312211	32	MT024866	Mycobacterium phage Willsammy, complete genome	22514-22545	9	0.719
NC_018524_1	1.10|312180|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312180-312211	32	MN892486	Mycobacterium phage KilKor, complete genome	22510-22541	9	0.719
NC_018524_1	1.10|312180|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312180-312211	32	MN908683	Mycobacterium phage StressBall, complete genome	22510-22541	9	0.719
NC_018524_1	1.10|312180|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312180-312211	32	MT498042	Mycobacterium phage Rebel, complete genome	20814-20845	9	0.719
NC_018524_1	1.10|312180|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312180-312211	32	MK820639	Mycobacterium phage Phineas, complete genome	22616-22647	9	0.719
NC_018524_1	1.10|312180|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312180-312211	32	MN892484	Mycobacterium phage CactusJack, complete genome	22510-22541	9	0.719
NC_018524_1	1.10|312180|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312180-312211	32	MN807249	Mycobacterium phage Megiddo, complete genome	22510-22541	9	0.719
NC_018524_1	1.10|312180|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312180-312211	32	MN807250	Mycobacterium phage Glaske, complete genome	22510-22541	9	0.719
NC_018524_1	1.10|312180|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312180-312211	32	MG099936	Mycobacterium phage Andies, complete genome	21137-21168	9	0.719
NC_018524_1	1.10|312180|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312180-312211	32	KX621007	Mycobacterium phage Taquito, complete genome	25585-25616	9	0.719
NC_018524_1	1.10|312180|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312180-312211	32	MN807248	Mycobacterium phage Phalm, complete genome	22510-22541	9	0.719
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	MN234183	Mycobacterium phage Antsirabe, complete genome	25325-25356	9	0.719
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	1418069-1418100	9	0.719
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	NZ_CP050953	Rhodococcus sp. DMU1 plasmid unnamed	321300-321331	9	0.719
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	NC_010510	Methylobacterium radiotolerans JCM 2831 plasmid pMRAD01, complete sequence	109170-109201	9	0.719
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	395188-395219	9	0.719
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	NZ_LR134460	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 18, complete sequence	165149-165180	9	0.719
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	NZ_CP047174	Rathayibacter sp. VKM Ac-2760 plasmid unnamed1, complete sequence	33246-33277	9	0.719
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	NZ_CP007129	Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence	544657-544688	9	0.719
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	NZ_AP014705	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence	399320-399351	9	0.719
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	NC_047973	Microbacterium phage Hyperion, complete genome	60372-60403	9	0.719
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	KY945355	Mycobacterium phage Shandong1, complete genome	52011-52042	9	0.719
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	NC_047975	Microbacterium phage Squash, complete genome	60908-60939	9	0.719
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	NZ_CP046906	Streptomyces sp. QHH-9511 plasmid unnamed, complete sequence	61412-61443	9	0.719
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	NZ_CP029835	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed5, complete sequence	183020-183051	9	0.719
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	NC_019959	Mycobacterium sp. JS623 plasmid pMYCSM03, complete sequence	14721-14752	9	0.719
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	NZ_CP004394	Celeribacter indicus strain P73 plasmid pP73A, complete sequence	48650-48681	9	0.719
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	NC_003904	Streptomyces coelicolor A3(2) plasmid SCP2, complete sequence	20019-20050	9	0.719
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	MK937594	Gordonia phage Galadriel, complete genome	25384-25415	9	0.719
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	MT723934	Gordonia phage Love, complete genome	25894-25925	9	0.719
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	MK977702	Gordonia terrae phage McKinley, complete genome	25926-25957	9	0.719
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	MH976514	Gordonia phage Nordenberg, complete genome	24096-24127	9	0.719
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	MH976508	Gordonia phage Bibwit, complete genome	24623-24654	9	0.719
NC_018524_2	2.4|313399|32|NC_018524|CRISPRCasFinder	313399-313430	32	NZ_CP016613	Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence	399582-399613	9	0.719
NC_018524_2	2.4|313399|32|NC_018524|CRISPRCasFinder	313399-313430	32	NZ_CP022766	Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence	229501-229532	9	0.719
NC_018524_2	2.4|313399|32|NC_018524|CRISPRCasFinder	313399-313430	32	NZ_CP016555	Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence	1957337-1957368	9	0.719
NC_018524_2	2.4|313399|32|NC_018524|CRISPRCasFinder	313399-313430	32	NZ_CP052069	Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence	230446-230477	9	0.719
NC_018524_2	2.4|313399|32|NC_018524|CRISPRCasFinder	313399-313430	32	NZ_CP016905	Ralstonia solanacearum strain KACC 10709 plasmid unnamed1	1219523-1219554	9	0.719
NC_018524_2	2.4|313399|32|NC_018524|CRISPRCasFinder	313399-313430	32	NZ_CP022769	Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence	230760-230791	9	0.719
NC_018524_2	2.4|313399|32|NC_018524|CRISPRCasFinder	313399-313430	32	NZ_CP015851	Ralstonia solanacearum strain YC40-M plasmid, complete sequence	160494-160525	9	0.719
NC_018524_2	2.4|313399|32|NC_018524|CRISPRCasFinder	313399-313430	32	NZ_CP022773	Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence	237795-237826	9	0.719
NC_018524_2	2.4|313399|32|NC_018524|CRISPRCasFinder	313399-313430	32	NZ_CP022791	Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence	119278-119309	9	0.719
NC_018524_2	2.4|313399|32|NC_018524|CRISPRCasFinder	313399-313430	32	NZ_CP052071	Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence	243569-243600	9	0.719
NC_018524_2	2.4|313399|32|NC_018524|CRISPRCasFinder	313399-313430	32	NZ_CP022779	Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence	230777-230808	9	0.719
NC_018524_2	2.4|313399|32|NC_018524|CRISPRCasFinder	313399-313430	32	NZ_CP052075	Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence	243569-243600	9	0.719
NC_018524_2	2.4|313399|32|NC_018524|CRISPRCasFinder	313399-313430	32	NZ_CP052085	Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence	245181-245212	9	0.719
NC_018524_2	2.4|313399|32|NC_018524|CRISPRCasFinder	313399-313430	32	NZ_CP052105	Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence	243569-243600	9	0.719
NC_018524_2	2.4|313399|32|NC_018524|CRISPRCasFinder	313399-313430	32	NZ_CP052087	Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence	245181-245212	9	0.719
NC_018524_2	2.4|313399|32|NC_018524|CRISPRCasFinder	313399-313430	32	NZ_CP052115	Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence	243569-243600	9	0.719
NC_018524_2	2.4|313399|32|NC_018524|CRISPRCasFinder	313399-313430	32	NZ_CP052127	Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence	245181-245212	9	0.719
NC_018524_2	2.4|313399|32|NC_018524|CRISPRCasFinder	313399-313430	32	NZ_CP052089	Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence	245181-245212	9	0.719
NC_018524_2	2.4|313399|32|NC_018524|CRISPRCasFinder	313399-313430	32	NZ_CP052107	Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence	243569-243600	9	0.719
NC_018524_2	2.4|313399|32|NC_018524|CRISPRCasFinder	313399-313430	32	NZ_CP031163	Deinococcus wulumuqiensis strain NEB 479 plasmid pDrdI, complete sequence	399836-399867	9	0.719
NC_018524_2	2.4|313399|32|NC_018524|CRISPRCasFinder	313399-313430	32	NZ_CP022781	Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence	1867104-1867135	9	0.719
NC_018524_2	2.4|313399|32|NC_018524|CRISPRCasFinder	313399-313430	32	NZ_CP052117	Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence	243569-243600	9	0.719
NC_018524_2	2.4|313399|32|NC_018524|CRISPRCasFinder	313399-313430	32	NZ_CP022793	Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence	237778-237809	9	0.719
NC_018524_2	2.4|313399|32|NC_018524|CRISPRCasFinder	313399-313430	32	NZ_CP022785	Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence	237757-237788	9	0.719
NC_018524_2	2.4|313399|32|NC_018524|CRISPRCasFinder	313399-313430	32	NZ_CP022787	Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence	234380-234411	9	0.719
NC_018524_2	2.4|313399|32|NC_018524|CRISPRCasFinder	313399-313430	32	NZ_CP022756	Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence	232520-232551	9	0.719
NC_018524_2	2.4|313399|32|NC_018524|CRISPRCasFinder	313399-313430	32	NZ_CP052121	Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence	243569-243600	9	0.719
NC_018524_2	2.4|313399|32|NC_018524|CRISPRCasFinder	313399-313430	32	NZ_CP052131	Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence	245181-245212	9	0.719
NC_018524_2	2.4|313399|32|NC_018524|CRISPRCasFinder	313399-313430	32	NZ_CP052073	Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence	243569-243600	9	0.719
NC_018524_2	2.4|313399|32|NC_018524|CRISPRCasFinder	313399-313430	32	NZ_CP052109	Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence	243569-243600	9	0.719
NC_018524_2	2.4|313399|32|NC_018524|CRISPRCasFinder	313399-313430	32	NZ_CP052111	Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence	1849206-1849237	9	0.719
NC_018524_2	2.4|313399|32|NC_018524|CRISPRCasFinder	313399-313430	32	NZ_CP052103	Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence	243569-243600	9	0.719
NC_018524_2	2.4|313399|32|NC_018524|CRISPRCasFinder	313399-313430	32	NZ_CP052119	Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence	243569-243600	9	0.719
NC_018524_2	2.4|313399|32|NC_018524|CRISPRCasFinder	313399-313430	32	NZ_CP052113	Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence	1849206-1849237	9	0.719
NC_018524_2	2.4|313399|32|NC_018524|CRISPRCasFinder	313399-313430	32	MG593802	Streptomyces phage Omar, complete genome	12467-12498	9	0.719
NC_018524_2	2.8|313399|33|NC_018524|CRT	313399-313431	33	NZ_AP012556	Mycobacterium avium subsp. hominissuis TH135 plasmid pMAH135, complete sequence	146341-146373	9	0.727
NC_018524_2	2.8|313399|33|NC_018524|CRT	313399-313431	33	MG593802	Streptomyces phage Omar, complete genome	12467-12499	9	0.727
NC_018524_2	2.10|313401|30|NC_018524|PILER-CR	313401-313430	30	NZ_CP031163	Deinococcus wulumuqiensis strain NEB 479 plasmid pDrdI, complete sequence	399837-399866	9	0.7
NC_018524_3	3.1|318517|32|NC_018524|CRISPRCasFinder,CRT	318517-318548	32	NZ_CP005190	Sphingobium sp. MI1205 plasmid pMI1, complete sequence	127502-127533	9	0.719
NC_018524_3	3.1|318517|32|NC_018524|CRISPRCasFinder,CRT	318517-318548	32	NZ_HG938354	Neorhizobium galegae bv. orientalis str. HAMBI 540 plasmid pHAMBI540a, complete sequence	135185-135216	9	0.719
NC_018524_3	3.1|318517|32|NC_018524|CRISPRCasFinder,CRT	318517-318548	32	NZ_CP032676	Rhodococcus rhodochrous strain ATCC BAA870 plasmid pNit, complete sequence	55059-55090	9	0.719
NC_018524_3	3.1|318517|32|NC_018524|CRISPRCasFinder,CRT	318517-318548	32	NC_020542	Sphingomonas sp. MM-1 plasmid pISP0, complete sequence	127987-128018	9	0.719
NC_018524_3	3.2|318578|32|NC_018524|CRISPRCasFinder,CRT	318578-318609	32	NZ_CP031227	Pseudomonas amygdali pv. lachrymans str. M301315 plasmid pPla107-1, complete sequence	19356-19387	9	0.719
NC_018524_3	3.2|318578|32|NC_018524|CRISPRCasFinder,CRT	318578-318609	32	NZ_CP011808	Pandoraea faecigallinarum strain DSM 23572 plasmid pPF72-1, complete sequence	165211-165242	9	0.719
NC_018524_3	3.2|318578|32|NC_018524|CRISPRCasFinder,CRT	318578-318609	32	MN908693	Gordonia phage AnClar, complete genome	40806-40837	9	0.719
NC_018524_3	3.2|318578|32|NC_018524|CRISPRCasFinder,CRT	318578-318609	32	MK801725	Gordonia phage Yago84, complete genome	38885-38916	9	0.719
NC_018524_3	3.4|318700|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318700-318731	32	NZ_CP043057	Dolichospermum sp. UHCC 0315A plasmid pUHCC0315a, complete sequence	45371-45402	9	0.719
NC_018524_3	3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318761-318792	32	NC_009621	Sinorhizobium medicae WSM419 plasmid pSMED02, complete sequence	625204-625235	9	0.719
NC_018524_3	3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318761-318792	32	NC_012586	Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence	1290353-1290384	9	0.719
NC_018524_3	3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318761-318792	32	NZ_CP013110	Sinorhizobium americanum strain CFNEI 73 plasmid C, complete sequence	983186-983217	9	0.719
NC_018524_3	3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318761-318792	32	NZ_CP029452	Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence	1102348-1102379	9	0.719
NC_018524_3	3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318761-318792	32	CP000662	Rhodobacter sphaeroides ATCC 17025 plasmid pRSPA01, complete sequence	38307-38338	9	0.719
NC_018524_3	3.7|318883|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318883-318914	32	NC_018022	Mycolicibacterium chubuense NBB4 plasmid pMYCCH.01, complete sequence	194286-194317	9	0.719
NC_018524_3	3.8|318944|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318944-318975	32	NZ_CP029831	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed7, complete sequence	506011-506042	9	0.719
NC_018524_3	3.8|318944|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318944-318975	32	NC_015952	Streptomyces violaceusniger Tu 4113 plasmid pSTRVI02, complete sequence	54771-54802	9	0.719
NC_018524_3	3.8|318944|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318944-318975	32	NC_014309	Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome	63825-63856	9	0.719
NC_018524_3	3.8|318944|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318944-318975	32	NZ_CP028348	Novosphingobium sp. THN1 plasmid pTHN, complete sequence	1073950-1073981	9	0.719
NC_018524_3	3.9|319005|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	319005-319036	32	NZ_CP035092	Paracoccus denitrificans strain ATCC 19367 plasmid unnamed1, complete sequence	276373-276404	9	0.719
NC_018524_3	3.9|319005|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	319005-319036	32	NC_008688	Paracoccus denitrificans PD1222 plasmid 1, complete sequence	523721-523752	9	0.719
NC_018524_3	3.9|319005|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	319005-319036	32	NZ_CP020883	Xanthomonas citri pv. citri strain TX160042 plasmid unnamed1, complete sequence	109633-109664	9	0.719
NC_018524_3	3.9|319005|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	319005-319036	32	NZ_CP020886	Xanthomonas citri pv. citri strain TX160149 plasmid unnamed1, complete sequence	73306-73337	9	0.719
NC_018524_3	3.9|319005|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	319005-319036	32	NZ_CP021016	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6991 plasmid pF, complete sequence	20168-20199	9	0.719
NC_018524_3	3.9|319005|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	319005-319036	32	NZ_CP020890	Xanthomonas citri pv. citri strain TX160197 plasmid unnamed1, complete sequence	16867-16898	9	0.719
NC_018524_4	4.2|321431|32|NC_018524|CRISPRCasFinder,CRT	321431-321462	32	NZ_CP010024	Paraburkholderia fungorum strain ATCC BAA-463 plasmid pBIL, complete sequence	229192-229223	9	0.719
NC_018524_4	4.7|321736|32|NC_018524|CRISPRCasFinder,CRT	321736-321767	32	NZ_CP020041	Streptomyces sp. 3211 isolate 3 plasmid p3211-2, complete sequence	51415-51446	9	0.719
NC_018524_4	4.7|321736|32|NC_018524|CRISPRCasFinder,CRT	321736-321767	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	4488315-4488346	9	0.719
NC_018524_4	4.7|321736|32|NC_018524|CRISPRCasFinder,CRT	321736-321767	32	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	949692-949723	9	0.719
NC_018524_4	4.7|321736|32|NC_018524|CRISPRCasFinder,CRT	321736-321767	32	NZ_CP050083	Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b3, complete sequence	454349-454380	9	0.719
NC_018524_4	4.7|321736|32|NC_018524|CRISPRCasFinder,CRT	321736-321767	32	NZ_CP049733	Rhizobium leguminosarum strain A1 plasmid pRL10, complete sequence	442023-442054	9	0.719
NC_018524_4	4.7|321736|32|NC_018524|CRISPRCasFinder,CRT	321736-321767	32	CP054917	Streptomyces sp. NA02950 plasmid unnamed, complete sequence	38434-38465	9	0.719
NC_018524_4	4.7|321736|32|NC_018524|CRISPRCasFinder,CRT	321736-321767	32	NZ_CP053207	Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1C, complete sequence	471125-471156	9	0.719
NC_018524_4	4.7|321736|32|NC_018524|CRISPRCasFinder,CRT	321736-321767	32	CP006880	Rhizobium gallicum bv. gallicum R602 plasmid pRgalR602c, complete sequence	2402206-2402237	9	0.719
NC_018524_4	4.8|321797|32|NC_018524|CRISPRCasFinder,CRT	321797-321828	32	CP011998	Ralstonia solanacearum strain YC45 plasmid, complete sequence	299791-299822	9	0.719
NC_018524_4	4.9|321858|32|NC_018524|CRISPRCasFinder,CRT	321858-321889	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	147933-147964	9	0.719
NC_018524_4	4.9|321858|32|NC_018524|CRISPRCasFinder,CRT	321858-321889	32	NZ_AP014705	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence	356193-356224	9	0.719
NC_018524_4	4.9|321858|32|NC_018524|CRISPRCasFinder,CRT	321858-321889	32	NZ_LR134445	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 3, complete sequence	51202-51233	9	0.719
NC_018524_4	4.9|321858|32|NC_018524|CRISPRCasFinder,CRT	321858-321889	32	NC_008269	Rhodococcus jostii RHA1 plasmid pRHL1, complete sequence	79951-79982	9	0.719
NC_018524_4	4.9|321858|32|NC_018524|CRISPRCasFinder,CRT	321858-321889	32	NZ_CP012886	Mycobacterium chimaera strain AH16 plasmid unnamed1, complete sequence	132524-132555	9	0.719
NC_018524_4	4.9|321858|32|NC_018524|CRISPRCasFinder,CRT	321858-321889	32	NZ_CP012886	Mycobacterium chimaera strain AH16 plasmid unnamed1, complete sequence	402851-402882	9	0.719
NC_018524_4	4.9|321858|32|NC_018524|CRISPRCasFinder,CRT	321858-321889	32	MK433264	Gordonia phage Tiamoceli, complete genome	4834-4865	9	0.719
NC_018524_4	4.9|321858|32|NC_018524|CRISPRCasFinder,CRT	321858-321889	32	MT952843	Gordonia phage Twonlo, complete genome	3798-3829	9	0.719
NC_018524_4	4.9|321858|32|NC_018524|CRISPRCasFinder,CRT	321858-321889	32	MK977704	Gordonia Terrae phage RoadKill, complete genome	3798-3829	9	0.719
NC_018524_4	4.9|321858|32|NC_018524|CRISPRCasFinder,CRT	321858-321889	32	KR053200	Gordonia phage GTE6, complete genome	4489-4520	9	0.719
NC_018524_4	4.9|321858|32|NC_018524|CRISPRCasFinder,CRT	321858-321889	32	MN813693	Mycobacterium phage Imvubu, complete genome	66815-66846	9	0.719
NC_018524_4	4.9|321858|32|NC_018524|CRISPRCasFinder,CRT	321858-321889	32	MK977705	Gordonia Phage Mollymur, complete genome	39168-39199	9	0.719
NC_018524_4	4.18|321675|33|NC_018524|PILER-CR	321675-321707	33	NC_023316	Streptomyces sp. 14R-10 plasmid pZL1, complete sequence	171-203	9	0.727
NC_018524_4	4.18|321675|33|NC_018524|PILER-CR	321675-321707	33	NC_023316	Streptomyces sp. 14R-10 plasmid pZL1, complete sequence	127107-127139	9	0.727
NC_018524_4	4.19|321736|33|NC_018524|PILER-CR	321736-321768	33	NZ_CP019603	Croceicoccus marinus strain E4A9 plasmid pCME4A9I, complete sequence	744995-745027	9	0.727
NC_018524_4	4.19|321736|33|NC_018524|PILER-CR	321736-321768	33	NZ_CP019604	Croceicoccus marinus strain E4A9 plasmid pCME4A9II, complete sequence	260024-260056	9	0.727
NC_018524_5	5.3|326654|32|NC_018524|CRISPRCasFinder	326654-326685	32	NZ_CP021028	Rhizobium sp. TAL182 plasmid pRetTAL182d, complete sequence	87231-87262	9	0.719
NC_018524_5	5.3|326654|32|NC_018524|CRISPRCasFinder	326654-326685	32	NZ_CP013503	Rhizobium esperanzae strain N561 plasmid pRspN561c, complete sequence	83377-83408	9	0.719
NC_018524_5	5.3|326654|32|NC_018524|CRISPRCasFinder	326654-326685	32	NZ_CP013509	Rhizobium sp. N1341 plasmid pRspN1341d, complete sequence	83377-83408	9	0.719
NC_018524_5	5.3|326654|32|NC_018524|CRISPRCasFinder	326654-326685	32	NZ_CP013520	Rhizobium sp. N113 plasmid pRspN113c, complete sequence	83377-83408	9	0.719
NC_018524_5	5.3|326654|32|NC_018524|CRISPRCasFinder	326654-326685	32	NZ_CP029357	Azospirillum sp. CFH 70021 plasmid unnamed2	69806-69837	9	0.719
NC_018524_5	5.3|326654|32|NC_018524|CRISPRCasFinder	326654-326685	32	NZ_CP013493	Rhizobium sp. N6212 plasmid pRspN6212c, complete sequence	83377-83408	9	0.719
NC_018524_5	5.3|326654|32|NC_018524|CRISPRCasFinder	326654-326685	32	NZ_CP013516	Rhizobium sp. N1314 plasmid pRspN1314e, complete sequence	83763-83794	9	0.719
NC_018524_5	5.3|326654|32|NC_018524|CRISPRCasFinder	326654-326685	32	MN813693	Mycobacterium phage Imvubu, complete genome	64267-64298	9	0.719
NC_018524_5	5.4|326715|32|NC_018524|CRISPRCasFinder	326715-326746	32	CP047389	Agrobacterium sp. CGMCC 11546 plasmid pA	35754-35785	9	0.719
NC_018524_5	5.4|326715|32|NC_018524|CRISPRCasFinder	326715-326746	32	NZ_CP033036	Agrobacterium fabrum strain 12D13 plasmid pAt12D13a, complete sequence	375735-375766	9	0.719
NC_018524_5	5.4|326715|32|NC_018524|CRISPRCasFinder	326715-326746	32	NZ_CP033024	Agrobacterium fabrum strain 1D132 plasmid pAt1D132a, complete sequence	306241-306272	9	0.719
NC_018524_5	5.6|326837|32|NC_018524|CRISPRCasFinder	326837-326868	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2210555-2210586	9	0.719
NC_018524_5	5.6|326837|32|NC_018524|CRISPRCasFinder	326837-326868	32	NZ_CP034351	Streptomyces sp. W1SF4 plasmid p1, complete sequence	216716-216747	9	0.719
NC_018524_5	5.9|326654|33|NC_018524|CRT	326654-326686	33	NZ_CP021028	Rhizobium sp. TAL182 plasmid pRetTAL182d, complete sequence	87231-87263	9	0.727
NC_018524_5	5.9|326654|33|NC_018524|CRT	326654-326686	33	NZ_CP013503	Rhizobium esperanzae strain N561 plasmid pRspN561c, complete sequence	83377-83409	9	0.727
NC_018524_5	5.9|326654|33|NC_018524|CRT	326654-326686	33	NZ_CP013509	Rhizobium sp. N1341 plasmid pRspN1341d, complete sequence	83377-83409	9	0.727
NC_018524_5	5.9|326654|33|NC_018524|CRT	326654-326686	33	NZ_CP013520	Rhizobium sp. N113 plasmid pRspN113c, complete sequence	83377-83409	9	0.727
NC_018524_5	5.9|326654|33|NC_018524|CRT	326654-326686	33	NZ_CP013493	Rhizobium sp. N6212 plasmid pRspN6212c, complete sequence	83377-83409	9	0.727
NC_018524_5	5.9|326654|33|NC_018524|CRT	326654-326686	33	NZ_CP013516	Rhizobium sp. N1314 plasmid pRspN1314e, complete sequence	83763-83795	9	0.727
NC_018524_5	5.12|326837|33|NC_018524|CRT	326837-326869	33	CP000663	Rhodobacter sphaeroides ATCC 17025 plasmid pRSPA02, complete sequence	266762-266794	9	0.727
NC_018524_5	5.12|326837|33|NC_018524|CRT	326837-326869	33	NZ_CP031752	Rhodobacter sphaeroides strain EBL0706 plasmid p.A, complete sequence	264864-264896	9	0.727
NC_018524_5	5.14|326655|32|NC_018524|PILER-CR	326655-326686	32	NZ_CP021028	Rhizobium sp. TAL182 plasmid pRetTAL182d, complete sequence	87231-87262	9	0.719
NC_018524_5	5.14|326655|32|NC_018524|PILER-CR	326655-326686	32	NZ_CP013503	Rhizobium esperanzae strain N561 plasmid pRspN561c, complete sequence	83377-83408	9	0.719
NC_018524_5	5.14|326655|32|NC_018524|PILER-CR	326655-326686	32	NZ_CP013509	Rhizobium sp. N1341 plasmid pRspN1341d, complete sequence	83377-83408	9	0.719
NC_018524_5	5.14|326655|32|NC_018524|PILER-CR	326655-326686	32	NZ_CP013520	Rhizobium sp. N113 plasmid pRspN113c, complete sequence	83377-83408	9	0.719
NC_018524_5	5.14|326655|32|NC_018524|PILER-CR	326655-326686	32	NZ_CP029357	Azospirillum sp. CFH 70021 plasmid unnamed2	69806-69837	9	0.719
NC_018524_5	5.14|326655|32|NC_018524|PILER-CR	326655-326686	32	NZ_CP013493	Rhizobium sp. N6212 plasmid pRspN6212c, complete sequence	83377-83408	9	0.719
NC_018524_5	5.14|326655|32|NC_018524|PILER-CR	326655-326686	32	NZ_CP013516	Rhizobium sp. N1314 plasmid pRspN1314e, complete sequence	83763-83794	9	0.719
NC_018524_5	5.14|326655|32|NC_018524|PILER-CR	326655-326686	32	MN813693	Mycobacterium phage Imvubu, complete genome	64267-64298	9	0.719
NC_018524_5	5.15|326716|32|NC_018524|PILER-CR	326716-326747	32	CP047389	Agrobacterium sp. CGMCC 11546 plasmid pA	35754-35785	9	0.719
NC_018524_5	5.15|326716|32|NC_018524|PILER-CR	326716-326747	32	NZ_CP033036	Agrobacterium fabrum strain 12D13 plasmid pAt12D13a, complete sequence	375735-375766	9	0.719
NC_018524_5	5.15|326716|32|NC_018524|PILER-CR	326716-326747	32	NZ_CP033024	Agrobacterium fabrum strain 1D132 plasmid pAt1D132a, complete sequence	306241-306272	9	0.719
NC_018524_5	5.17|326838|32|NC_018524|PILER-CR	326838-326869	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2210555-2210586	9	0.719
NC_018524_5	5.17|326838|32|NC_018524|PILER-CR	326838-326869	32	NZ_CP034351	Streptomyces sp. W1SF4 plasmid p1, complete sequence	216716-216747	9	0.719
NC_018524_9	9.1|1460065|32|NC_018524|CRISPRCasFinder,CRT	1460065-1460096	32	MN657146	Cryobacterium sp. strain ANT_H28B plasmid pA28BH2, complete sequence	44881-44912	9	0.719
NC_018524_9	9.1|1460065|32|NC_018524|CRISPRCasFinder,CRT	1460065-1460096	32	NZ_CP016283	Cryobacterium arcticum strain PAMC 27867 plasmid pP27867_1, complete sequence	77181-77212	9	0.719
NC_018524_9	9.1|1460065|32|NC_018524|CRISPRCasFinder,CRT	1460065-1460096	32	NZ_CP032625	Gryllotalpicola sp. 2DFW10M-5 plasmid unnamed1, complete sequence	29149-29180	9	0.719
NC_018524_9	9.11|1460066|32|NC_018524|PILER-CR	1460066-1460097	32	MN657146	Cryobacterium sp. strain ANT_H28B plasmid pA28BH2, complete sequence	44881-44912	9	0.719
NC_018524_9	9.11|1460066|32|NC_018524|PILER-CR	1460066-1460097	32	NZ_CP016283	Cryobacterium arcticum strain PAMC 27867 plasmid pP27867_1, complete sequence	77181-77212	9	0.719
NC_018524_9	9.11|1460066|32|NC_018524|PILER-CR	1460066-1460097	32	NZ_CP032625	Gryllotalpicola sp. 2DFW10M-5 plasmid unnamed1, complete sequence	29149-29180	9	0.719
NC_018524_11	11.2|2251085|32|NC_018524|PILER-CR,CRT	2251085-2251116	32	NZ_CP022366	Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence	605619-605650	9	0.719
NC_018524_11	11.3|2251146|32|NC_018524|PILER-CR,CRT	2251146-2251177	32	NZ_CP016082	Streptomyces sp. SAT1 plasmid unnamed2, complete sequence	219169-219200	9	0.719
NC_018524_11	11.3|2251146|32|NC_018524|PILER-CR,CRT	2251146-2251177	32	NZ_CP030772	Streptomyces sp. YIM 121038 plasmid pSSP121038, complete sequence	132361-132392	9	0.719
NC_018524_11	11.3|2251146|32|NC_018524|PILER-CR,CRT	2251146-2251177	32	NZ_CP007129	Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence	741192-741223	9	0.719
NC_018524_11	11.3|2251146|32|NC_018524|PILER-CR,CRT	2251146-2251177	32	NC_012528	Deinococcus deserti VCD115 plasmid 3, complete sequence	316902-316933	9	0.719
NC_018524_11	11.3|2251146|32|NC_018524|PILER-CR,CRT	2251146-2251177	32	NZ_CP029209	Nitratireductor sp. OM-1 plasmid pOM-1, complete sequence	234346-234377	9	0.719
NC_018524_11	11.3|2251146|32|NC_018524|PILER-CR,CRT	2251146-2251177	32	MN304824	Catenulispora phage 69_17, complete genome	37185-37216	9	0.719
NC_018524_11	11.4|2251207|32|NC_018524|PILER-CR,CRT	2251207-2251238	32	NC_011961	Thermomicrobium roseum DSM 5159 plasmid unnamed, complete sequence	887807-887838	9	0.719
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP012886	Mycobacterium chimaera strain AH16 plasmid unnamed1, complete sequence	315645-315676	9	0.719
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP016453	Sphingobium sp. RAC03 plasmid pBSY17_1, complete sequence	644840-644871	9	0.719
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_AP022566	Mycolicibacterium alvei strain JCM 12272 plasmid pJCM12272, complete sequence	304028-304059	9	0.719
NC_018524_11	11.7|2251390|33|NC_018524|PILER-CR,CRT	2251390-2251422	33	MN855815	Bacteriophage sp. isolate 146, partial genome	3316-3348	9	0.727
NC_018524_11	11.7|2251390|33|NC_018524|PILER-CR,CRT	2251390-2251422	33	JX163858	Caulobacter phage phiCbK, complete genome	14889-14921	9	0.727
NC_018524_11	11.7|2251390|33|NC_018524|PILER-CR,CRT	2251390-2251422	33	KY555147	Caulobacter phage Ccr34, complete genome	193379-193411	9	0.727
NC_018524_11	11.7|2251390|33|NC_018524|PILER-CR,CRT	2251390-2251422	33	NC_019410	Caulobacter phage CcrKarma, complete genome	199291-199323	9	0.727
NC_018524_11	11.7|2251390|33|NC_018524|PILER-CR,CRT	2251390-2251422	33	KY555146	Caulobacter phage Ccr32, complete genome	192939-192971	9	0.727
NC_018524_11	11.7|2251390|33|NC_018524|PILER-CR,CRT	2251390-2251422	33	NC_019407	Caulobacter phage CcrMagneto, complete genome	196325-196357	9	0.727
NC_018524_11	11.7|2251390|33|NC_018524|PILER-CR,CRT	2251390-2251422	33	KY555144	Caulobacter phage Ccr5, complete genome	195924-195956	9	0.727
NC_018524_11	11.7|2251390|33|NC_018524|PILER-CR,CRT	2251390-2251422	33	NC_019411	Caulobacter phage CcrSwift, complete genome	196655-196687	9	0.727
NC_018524_11	11.8|2251452|32|NC_018524|PILER-CR,CRT	2251452-2251483	32	NZ_CP023068	Ensifer sojae CCBAU 05684 plasmid pSJ05684b, complete sequence	1935542-1935573	9	0.719
NC_018524_12	12.4|2254232|32|NC_018524|CRISPRCasFinder,CRT	2254232-2254263	32	NZ_CP044979	Bacillus thuringiensis strain BT62 plasmid pBT62A, complete sequence	218587-218618	9	0.719
NC_018524_14	14.2|2268321|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	2268321-2268352	32	NZ_CP040723	Rhodococcus pyridinivorans strain YF3 plasmid unnamed4, complete sequence	84001-84032	9	0.719
NC_018524_14	14.2|2268321|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	2268321-2268352	32	NZ_CP024936	Paraburkholderia graminis strain PHS1 plasmid pPHS1_P, complete sequence	472915-472946	9	0.719
NC_018524_14	14.2|2268321|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	2268321-2268352	32	NZ_CP016820	Rhodococcus sp. p52 plasmid pDF02, complete sequence	22605-22636	9	0.719
NC_018524_14	14.2|2268321|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	2268321-2268352	32	NZ_CP023713	Rhodococcus ruber strain YC-YT1 plasmid unnamed2, complete sequence	33982-34013	9	0.719
NC_018524_14	14.4|2268443|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	2268443-2268474	32	MN693068	Marine virus AFVG_25M252, complete genome	635-666	9	0.719
NC_018524_14	14.6|2268565|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	2268565-2268596	32	NZ_CP016083	Streptomyces sp. SAT1 plasmid unnamed3, complete sequence	600758-600789	9	0.719
NC_018524_14	14.7|2268626|32|NC_018524|CRISPRCasFinder,CRT	2268626-2268657	32	NZ_CP021016	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6991 plasmid pF, complete sequence	26079-26110	9	0.719
NC_018524_15	15.3|2270459|32|NC_018524|CRISPRCasFinder	2270459-2270490	32	NZ_CP016082	Streptomyces sp. SAT1 plasmid unnamed2, complete sequence	45464-45495	9	0.719
NC_018524_15	15.3|2270459|32|NC_018524|CRISPRCasFinder	2270459-2270490	32	NZ_CP016369	Phaeobacter porticola strain P97 plasmid pP97_e, complete sequence	42065-42096	9	0.719
NC_018524_15	15.3|2270459|32|NC_018524|CRISPRCasFinder	2270459-2270490	32	NC_041926	Escherichia phage vB_EcoM_ECOO78, complete genome	1140-1171	9	0.719
NC_018524_15	15.5|2270581|32|NC_018524|CRISPRCasFinder	2270581-2270612	32	KX752698	Mycobacterium phage Tonenili, complete genome	45818-45849	9	0.719
NC_018524_15	15.10|2270886|32|NC_018524|CRISPRCasFinder	2270886-2270917	32	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	1045537-1045568	9	0.719
NC_018524_15	15.10|2270886|32|NC_018524|CRISPRCasFinder	2270886-2270917	32	NZ_CP029452	Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence	447825-447856	9	0.719
NC_018524_15	15.10|2270886|32|NC_018524|CRISPRCasFinder	2270886-2270917	32	NZ_CP023071	Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence	349412-349443	9	0.719
NC_018524_15	15.10|2270886|32|NC_018524|CRISPRCasFinder	2270886-2270917	32	NZ_CP029232	Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence	1600715-1600746	9	0.719
NC_018524_15	15.10|2270886|32|NC_018524|CRISPRCasFinder	2270886-2270917	32	NC_017969	Escherichia phage bV_EcoS_AKFV33, complete genome	15288-15319	9	0.719
NC_018524_19	19.4|4408960|33|NC_018524|CRT	4408960-4408992	33	NC_006363	Nocardia farcinica IFM 10152 plasmid pNF2, complete sequence	51401-51433	9	0.727
NC_018524_19	19.5|4409022|32|NC_018524|CRT	4409022-4409053	32	NC_007959	Nitrobacter hamburgensis X14 plasmid 1, complete sequence	186071-186102	9	0.719
NC_018524_19	19.5|4409022|32|NC_018524|CRT	4409022-4409053	32	KT887559	Pseudomonas phage phi3, complete genome	13333-13364	9	0.719
NC_018524_19	19.5|4409022|32|NC_018524|CRT	4409022-4409053	32	NZ_CP013855	Pseudonocardia sp. HH130630-07 plasmid pLS2-1, complete sequence	179124-179155	9	0.719
NC_018524_19	19.5|4409022|32|NC_018524|CRT	4409022-4409053	32	NZ_AP014579	Burkholderia sp. RPE67 plasmid p1, complete sequence	1347800-1347831	9	0.719
NC_018524_19	19.5|4409022|32|NC_018524|CRT	4409022-4409053	32	NZ_CP023068	Ensifer sojae CCBAU 05684 plasmid pSJ05684b, complete sequence	1237495-1237526	9	0.719
NC_018524_19	19.5|4409022|32|NC_018524|CRT	4409022-4409053	32	NC_016626	Burkholderia sp. YI23 plasmid byi_1p, complete sequence	1023767-1023798	9	0.719
NC_018524_19	19.5|4409022|32|NC_018524|CRT	4409022-4409053	32	NC_016626	Burkholderia sp. YI23 plasmid byi_1p, complete sequence	1200495-1200526	9	0.719
NC_018524_19	19.5|4409022|32|NC_018524|CRT	4409022-4409053	32	NZ_CP009572	Sphingomonas taxi strain ATCC 55669 plasmid STP1, complete sequence	44168-44199	9	0.719
NC_018524_19	19.5|4409022|32|NC_018524|CRT	4409022-4409053	32	MK416010	Klebsiella phage ST11-OXA245phi3.2, complete genome	48745-48776	9	0.719
NC_018524_19	19.5|4409022|32|NC_018524|CRT	4409022-4409053	32	MK422448	Klebsiella phage ST512-KPC3phi13.3, complete genome	12026-12057	9	0.719
NC_018524_21	21.4|4582357|33|NC_018524|PILER-CR	4582357-4582389	33	NZ_CP037897	Thermaerobacter sp. FW80 plasmid unnamed2, complete sequence	2638-2670	9	0.727
NC_018524_21	21.18|4582419|32|NC_018524|CRISPRCasFinder,CRT	4582419-4582450	32	KU873925	Pseudomonas phage pf16, complete genome	64407-64438	9	0.719
NC_018524_21	21.20|4582541|32|NC_018524|CRISPRCasFinder,CRT	4582541-4582572	32	NZ_CP049319	Caballeronia sp. SBC2 plasmid pSBC2-3, complete sequence	243138-243169	9	0.719
NC_018524_21	21.21|4582602|32|NC_018524|CRISPRCasFinder,CRT	4582602-4582633	32	MK977696	Gordonia phage SCentae, complete genome	64889-64920	9	0.719
NC_018524_21	21.21|4582602|32|NC_018524|CRISPRCasFinder,CRT	4582602-4582633	32	MK977695	Gordonia phage Pupper, complete genome	64740-64771	9	0.719
NC_018524_21	21.22|4582663|32|NC_018524|CRISPRCasFinder,CRT	4582663-4582694	32	NZ_CP039965	Pseudorhodobacter sp. S12M18 plasmid unnamed1, complete sequence	1018011-1018042	9	0.719
NC_018524_21	21.25|4582846|32|NC_018524|CRISPRCasFinder,CRT	4582846-4582877	32	MT723940	Mycobacterium phage Ellie, complete genome	38519-38550	9	0.719
NC_018524_21	21.25|4582846|32|NC_018524|CRISPRCasFinder,CRT	4582846-4582877	32	NZ_CP011869	Pseudonocardia sp. HH130629-09 plasmid pLS1-1, complete sequence	8593-8624	9	0.719
NC_018524_21	21.27|4582968|32|NC_018524|CRISPRCasFinder,CRT	4582968-4582999	32	NC_009620	Sinorhizobium medicae WSM419 plasmid pSMED01, complete sequence	1386587-1386618	9	0.719
NC_018524_21	21.27|4582968|32|NC_018524|CRISPRCasFinder,CRT	4582968-4582999	32	NC_016588	Azospirillum lipoferum 4B plasmid AZO_p6, complete sequence	135530-135561	9	0.719
NC_018524_21	21.27|4582968|32|NC_018524|CRISPRCasFinder,CRT	4582968-4582999	32	NC_014838	Pantoea sp. At-9b plasmid pPAT9B01, complete sequence	507335-507366	9	0.719
NC_018524_21	21.27|4582968|32|NC_018524|CRISPRCasFinder,CRT	4582968-4582999	32	NC_011892	Methylobacterium nodulans ORS 2060 plasmid pMNOD01, complete sequence	207385-207416	9	0.719
NC_018524_21	21.29|4583089|32|NC_018524|CRISPRCasFinder,CRT	4583089-4583120	32	NZ_CP040819	Paraoceanicella profunda strain D4M1 plasmid pD4M1A, complete sequence	371780-371811	9	0.719
NC_018524_21	21.29|4583089|32|NC_018524|CRISPRCasFinder,CRT	4583089-4583120	32	MF476925	Klebsiella phage YMC16/01/N133_KPN_BP, complete genome	29686-29717	9	0.719
NC_018524_23	23.5|4591847|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4591847-4591878	32	NC_014310	Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence	942647-942678	9	0.719
NC_018524_23	23.5|4591847|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4591847-4591878	32	NZ_CP022760	Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence	844399-844430	9	0.719
NC_018524_23	23.5|4591847|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4591847-4591878	32	NZ_CP022789	Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence	844389-844420	9	0.719
NC_018524_23	23.5|4591847|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4591847-4591878	32	NZ_CP025547	Mycobacterium paragordonae strain 49061 plasmid unnamed1, complete sequence	31353-31384	9	0.719
NC_018524_23	23.9|4592091|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4592091-4592122	32	NZ_CP013052	Sinorhizobium americanum CCGM7 plasmid A, complete sequence	320708-320739	9	0.719
NC_018524_23	23.9|4592091|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4592091-4592122	32	NZ_CP021813	Sinorhizobium meliloti strain M270 plasmid psymA, complete sequence	810621-810652	9	0.719
NC_018524_24	24.1|4593189|32|NC_018524|CRISPRCasFinder,CRT	4593189-4593220	32	NZ_CP030828	Neorhizobium sp. NCHU2750 plasmid pNCHU2750a, complete sequence	497078-497109	9	0.719
NC_018524_24	24.2|4593250|32|NC_018524|CRISPRCasFinder,CRT	4593250-4593281	32	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	785669-785700	9	0.719
NC_018524_24	24.2|4593250|32|NC_018524|CRISPRCasFinder,CRT	4593250-4593281	32	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	2151307-2151338	9	0.719
NC_018524_25	25.3|4595499|37|NC_018524|PILER-CR,CRT	4595499-4595535	37	NZ_CP030127	Indioceanicola profundi strain SCSIO 08040 plasmid unnamed1, complete sequence	1060090-1060126	9	0.757
NC_018524_25	25.5|4595383|32|NC_018524|CRISPRCasFinder	4595383-4595414	32	NZ_CP019586	Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence	24608-24639	9	0.719
NC_018524_25	25.5|4595383|32|NC_018524|CRISPRCasFinder	4595383-4595414	32	NC_017326	Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence	34078-34109	9	0.719
NC_018524_25	25.5|4595383|32|NC_018524|CRISPRCasFinder	4595383-4595414	32	NZ_CP009146	Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence	34368-34399	9	0.719
NC_018524_25	25.5|4595383|32|NC_018524|CRISPRCasFinder	4595383-4595414	32	NC_018701	Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence	34388-34419	9	0.719
NC_018524_25	25.5|4595383|32|NC_018524|CRISPRCasFinder	4595383-4595414	32	NZ_CP021828	Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence	1270328-1270359	9	0.719
NC_018524_25	25.5|4595383|32|NC_018524|CRISPRCasFinder	4595383-4595414	32	NZ_CP021802	Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence	300478-300509	9	0.719
NC_018524_25	25.5|4595383|32|NC_018524|CRISPRCasFinder	4595383-4595414	32	NZ_CP021831	Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence	286445-286476	9	0.719
NC_018524_25	25.5|4595383|32|NC_018524|CRISPRCasFinder	4595383-4595414	32	NZ_CP021823	Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence	1391031-1391062	9	0.719
NC_018524_25	25.5|4595383|32|NC_018524|CRISPRCasFinder	4595383-4595414	32	NZ_CP021814	Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence	1598598-1598629	9	0.719
NC_018524_25	25.5|4595383|32|NC_018524|CRISPRCasFinder	4595383-4595414	32	NZ_CP021795	Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence	936395-936426	9	0.719
NC_018524_25	25.5|4595383|32|NC_018524|CRISPRCasFinder	4595383-4595414	32	NZ_CP021810	Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence	823181-823212	9	0.719
NC_018524_25	25.5|4595383|32|NC_018524|CRISPRCasFinder	4595383-4595414	32	NZ_CP021806	Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence	980511-980542	9	0.719
NC_018524_25	25.5|4595383|32|NC_018524|CRISPRCasFinder	4595383-4595414	32	NZ_CP021218	Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence	187561-187592	9	0.719
NC_018524_25	25.5|4595383|32|NC_018524|CRISPRCasFinder	4595383-4595414	32	NZ_CP026527	Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence	37071-37102	9	0.719
NC_018524_25	25.5|4595383|32|NC_018524|CRISPRCasFinder	4595383-4595414	32	NZ_CP019484	Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence	233992-234023	9	0.719
NC_018524_25	25.5|4595383|32|NC_018524|CRISPRCasFinder	4595383-4595414	32	NZ_CP019487	Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence	24656-24687	9	0.719
NC_018524_26	26.6|4598872|37|NC_018524|PILER-CR	4598872-4598908	37	NZ_CP036456	Streptomonospora sp. M2 plasmid phiM2, complete sequence	12569-12605	9	0.757
NC_018524_26	26.11|4599177|37|NC_018524|PILER-CR	4599177-4599213	37	NZ_CP007129	Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence	412947-412983	9	0.757
NC_018524_26	26.11|4599177|37|NC_018524|PILER-CR	4599177-4599213	37	NZ_CP045855	Agrobacterium sp. MA01 plasmid punnamed1, complete sequence	24788-24824	9	0.757
NC_018524_26	26.15|4598572|32|NC_018524|CRISPRCasFinder,CRT	4598572-4598603	32	NZ_CP037736	Citrobacter freundii strain CAV1857 plasmid pCAV1857-105, complete sequence	77801-77832	9	0.719
NC_018524_26	26.15|4598572|32|NC_018524|CRISPRCasFinder,CRT	4598572-4598603	32	NZ_CP017059	Citrobacter freundii strain SL151 plasmid unnamed2, complete sequence	73787-73818	9	0.719
NC_018524_26	26.15|4598572|32|NC_018524|CRISPRCasFinder,CRT	4598572-4598603	32	NZ_CP026241	Citrobacter freundii complex sp. CFNIH9 plasmid pCFR-e790, complete sequence	45222-45253	9	0.719
NC_018524_26	26.15|4598572|32|NC_018524|CRISPRCasFinder,CRT	4598572-4598603	32	NZ_CP029732	Citrobacter sp. CRE-46 strain AR_0157 plasmid unnamed4, complete sequence	19942-19973	9	0.719
NC_018524_26	26.15|4598572|32|NC_018524|CRISPRCasFinder,CRT	4598572-4598603	32	NZ_LS992176	Citrobacter freundii isolate Citrobacter freundii str. E2614 plasmid 2, complete sequence	58591-58622	9	0.719
NC_018524_26	26.15|4598572|32|NC_018524|CRISPRCasFinder,CRT	4598572-4598603	32	CP044029	Klebsiella pneumoniae strain RJY9645 plasmid pY9645-166, complete sequence	39723-39754	9	0.719
NC_018524_26	26.15|4598572|32|NC_018524|CRISPRCasFinder,CRT	4598572-4598603	32	NZ_CP042480	Citrobacter freundii strain C50 plasmid pC50_002, complete sequence	132397-132428	9	0.719
NC_018524_26	26.15|4598572|32|NC_018524|CRISPRCasFinder,CRT	4598572-4598603	32	NZ_CP026551	Citrobacter sp. SL156 plasmid unnamed2	204600-204631	9	0.719
NC_018524_26	26.15|4598572|32|NC_018524|CRISPRCasFinder,CRT	4598572-4598603	32	NZ_CP042483	Klebsiella pneumoniae strain C51 plasmid pC51_002, complete sequence	99786-99817	9	0.719
NC_018524_26	26.15|4598572|32|NC_018524|CRISPRCasFinder,CRT	4598572-4598603	32	NZ_CP022697	Citrobacter farmeri strain AUSMDU00008141 plasmid pAUSMDU8141-2, complete sequence	121849-121880	9	0.719
NC_018524_26	26.15|4598572|32|NC_018524|CRISPRCasFinder,CRT	4598572-4598603	32	NZ_CP035277	Citrobacter freundii strain R17 plasmid pCFR17_1, complete sequence	179388-179419	9	0.719
NC_018524_26	26.15|4598572|32|NC_018524|CRISPRCasFinder,CRT	4598572-4598603	32	NZ_CP042553	Enterobacter hormaechei strain C45 plasmid pC45_002, complete sequence	129755-129786	9	0.719
NC_018524_26	26.15|4598572|32|NC_018524|CRISPRCasFinder,CRT	4598572-4598603	32	NZ_CP042519	Citrobacter freundii strain E33 plasmid pE33_002, complete sequence	132397-132428	9	0.719
NC_018524_26	26.15|4598572|32|NC_018524|CRISPRCasFinder,CRT	4598572-4598603	32	NZ_CP011654	Citrobacter freundii strain CAV1741 plasmid pCAV1741-101, complete sequence	31764-31795	9	0.719
NC_018524_26	26.15|4598572|32|NC_018524|CRISPRCasFinder,CRT	4598572-4598603	32	NZ_CP011610	Citrobacter freundii strain CAV1321 plasmid pCAV1321-135, complete sequence	3157-3188	9	0.719
NC_018524_26	26.15|4598572|32|NC_018524|CRISPRCasFinder,CRT	4598572-4598603	32	NZ_MH909344	Enterobacter cloacae strain 12949 plasmid p12949-FIIY, complete sequence	74739-74770	9	0.719
NC_018524_26	26.15|4598572|32|NC_018524|CRISPRCasFinder,CRT	4598572-4598603	32	NZ_MK124610	Citrobacter werkmanii strain Cb_CB1_SE1_NDM_08_2017 plasmid pCB1_SE1_NDM, complete sequence	73687-73718	9	0.719
NC_018524_26	26.15|4598572|32|NC_018524|CRISPRCasFinder,CRT	4598572-4598603	32	NZ_CP026698	Citrobacter koseri strain AR_0025 plasmid unitig_2_pilon, complete sequence	7617-7648	9	0.719
NC_018524_26	26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT	4598633-4598664	32	NZ_CP010990	Pseudonocardia sp. EC080625-04 plasmid pFRP1-1, complete sequence	222279-222310	9	0.719
NC_018524_26	26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT	4598633-4598664	32	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	1207562-1207593	9	0.719
NC_018524_26	26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT	4598633-4598664	32	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	605971-606002	9	0.719
NC_018524_26	26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT	4598633-4598664	32	NZ_CP011869	Pseudonocardia sp. HH130629-09 plasmid pLS1-1, complete sequence	165276-165307	9	0.719
NC_018524_26	26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT	4598633-4598664	32	NZ_CP027794	Rhodococcus hoagii strain DSSKP-R-001 plasmid plas1, complete sequence	84972-85003	9	0.719
NC_018524_26	26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT	4598633-4598664	32	NZ_CP023440	Thauera sp. K11 plasmid pTX1, complete sequence	13942-13973	9	0.719
NC_018524_26	26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT	4598633-4598664	32	NZ_CP054616	Azospirillum oryzae strain KACC 14407 plasmid unnamed2, complete sequence	47171-47202	9	0.719
NC_018524_26	26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT	4598633-4598664	32	JF412297	EBPR siphovirus 2, partial sequence	15124-15155	9	0.719
NC_018524_26	26.18|4598755|32|NC_018524|CRISPRCasFinder,CRT	4598755-4598786	32	NC_019917	Burkholderia phage BcepMigl, complete genome	33237-33268	9	0.719
NC_018524_26	26.18|4598755|32|NC_018524|CRISPRCasFinder,CRT	4598755-4598786	32	NC_005262	Burkholderia cepacia phage Bcep22, complete genome	34372-34403	9	0.719
NC_018524_26	26.19|4598816|32|NC_018524|CRISPRCasFinder,CRT	4598816-4598847	32	NC_017805	Deinococcus gobiensis I-0 plasmid P1, complete sequence	196717-196748	9	0.719
NC_018524_26	26.20|4598877|32|NC_018524|CRISPRCasFinder,CRT	4598877-4598908	32	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	1707432-1707463	9	0.719
NC_018524_26	26.20|4598877|32|NC_018524|CRISPRCasFinder,CRT	4598877-4598908	32	NZ_CP054841	Acidovorax sp. 16-35-5 plasmid unnamed1, complete sequence	2615-2646	9	0.719
NC_018524_26	26.20|4598877|32|NC_018524|CRISPRCasFinder,CRT	4598877-4598908	32	NZ_CP040821	Paraoceanicella profunda strain D4M1 plasmid pD4M1C, complete sequence	101772-101803	9	0.719
NC_018524_26	26.20|4598877|32|NC_018524|CRISPRCasFinder,CRT	4598877-4598908	32	NZ_CP021128	Rhizobium sp. Kim5 plasmid pRetKim5d, complete sequence	404060-404091	9	0.719
NC_018524_26	26.20|4598877|32|NC_018524|CRISPRCasFinder,CRT	4598877-4598908	32	CP007645	Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803d, complete sequence	462347-462378	9	0.719
NC_018524_26	26.20|4598877|32|NC_018524|CRISPRCasFinder,CRT	4598877-4598908	32	NZ_CP054618	Azospirillum oryzae strain KACC 14407 plasmid unnamed4, complete sequence	149841-149872	9	0.719
NC_018524_26	26.20|4598877|32|NC_018524|CRISPRCasFinder,CRT	4598877-4598908	32	NZ_AP012556	Mycobacterium avium subsp. hominissuis TH135 plasmid pMAH135, complete sequence	164557-164588	9	0.719
NC_018524_26	26.20|4598877|32|NC_018524|CRISPRCasFinder,CRT	4598877-4598908	32	JQ067089	Pseudomonas phage PaMx28, partial genome	20657-20688	9	0.719
NC_018524_26	26.21|4598938|32|NC_018524|CRISPRCasFinder,CRT	4598938-4598969	32	CP054927	Streptomyces fulvissimus strain NA06532 plasmid unnamed1, complete sequence	353054-353085	9	0.719
NC_018524_26	26.23|4599060|32|NC_018524|CRISPRCasFinder,CRT	4599060-4599091	32	NC_018580	Gordonia sp. KTR9 plasmid pGKT2, complete sequence	74541-74572	9	0.719
NC_018524_26	26.23|4599060|32|NC_018524|CRISPRCasFinder,CRT	4599060-4599091	32	NZ_CP039340	Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence	269877-269908	9	0.719
NC_018524_26	26.25|4599182|32|NC_018524|CRISPRCasFinder,CRT	4599182-4599213	32	NZ_CP009292	Novosphingobium pentaromativorans US6-1 plasmid pLA3, complete sequence	669001-669032	9	0.719
NC_018524_26	26.25|4599182|32|NC_018524|CRISPRCasFinder,CRT	4599182-4599213	32	CP003952	Rhodococcus opacus PD630 plasmid 3, complete sequence	80920-80951	9	0.719
NC_018524_26	26.25|4599182|32|NC_018524|CRISPRCasFinder,CRT	4599182-4599213	32	MK310226	Halobacterium virus ChaoS9, complete genome	49178-49209	9	0.719
NC_018524_26	26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT	4599243-4599274	32	NC_014309	Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome	1212682-1212713	9	0.719
NC_018524_26	26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT	4599243-4599274	32	NZ_AP014579	Burkholderia sp. RPE67 plasmid p1, complete sequence	342025-342056	9	0.719
NC_018524_26	26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT	4599243-4599274	32	NZ_CP020331	Martelella mediterranea DSM 17316 strain MACL11 plasmid pMM593, complete sequence	440709-440740	9	0.719
NC_018524_26	26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT	4599243-4599274	32	MK814750	Gordonia phage Ewald, complete genome	2050-2081	9	0.719
NC_018524_26	26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT	4599243-4599274	32	NC_031004	Gordonia phage Nyceirae, complete genome	2176-2207	9	0.719
NC_018524_26	26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT	4599243-4599274	32	NC_010070	Burkholderia multivorans ATCC 17616 plasmid pBMUL01, complete sequence	7689-7720	9	0.719
NC_018524_26	26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT	4599243-4599274	32	NZ_CP046723	Pantoea agglomerans strain ASB05 plasmid pASB05p1, complete sequence	256607-256638	9	0.719
NC_018524_26	26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT	4599243-4599274	32	NZ_CP051471	Rhodobacter sphaeroides strain CH10 plasmid pRspCH10B, complete sequence	80394-80425	9	0.719
NC_018524_26	26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT	4599243-4599274	32	NZ_CP030274	Rhodobacter sphaeroides 2.4.1 plasmid pB, complete sequence	101863-101894	9	0.719
NC_018524_26	26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT	4599243-4599274	32	CP047034	Rhodobacter sphaeroides strain DSM 158 plasmid pB, complete sequence	11323-11354	9	0.719
NC_018524_26	26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT	4599243-4599274	32	NZ_CP015291	Rhodobacter sphaeroides strain MBTLJ-20 plasmid c, complete sequence	25675-25706	9	0.719
NC_018524_26	26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT	4599243-4599274	32	NZ_CP047040	Rhodobacter sphaeroides strain 2.4.1 substr. H2 plasmid pB, complete sequence	11313-11344	9	0.719
NC_018524_26	26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT	4599243-4599274	32	NZ_CP034351	Streptomyces sp. W1SF4 plasmid p1, complete sequence	187359-187390	9	0.719
NC_018524_26	26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT	4599243-4599274	32	NZ_CP028965	Burkholderia sp. IDO3 plasmid p1, complete sequence	189896-189927	9	0.719
NC_018524_26	26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT	4599243-4599274	32	NC_010802	Burkholderia multivorans ATCC 17616 plasmid pTGL1, complete sequence	105766-105797	9	0.719
NC_018524_26	26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT	4599243-4599274	32	NZ_CP031650	Pantoea agglomerans strain TH81 plasmid unnamed1, complete sequence	270007-270038	9	0.719
NC_018524_26	26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT	4599243-4599274	32	LT559120	Nonomuraea sp. ATCC 39727 isolate nono1 genome assembly, plasmid: III	55359-55390	9	0.719
NC_018524_26	26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT	4599243-4599274	32	NZ_CP015215	Rhodobacter sphaeroides strain MBTLJ-13 plasmid d, complete sequence	65676-65707	9	0.719
NC_018524_26	26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT	4599243-4599274	32	MF417942	Uncultured Caudovirales phage clone 7F_6, partial genome	4686-4717	9	0.719
NC_018524_26	26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT	4599243-4599274	32	MF417876	Uncultured Caudovirales phage clone 3F_6, partial genome	48273-48304	9	0.719
NC_018524_26	26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT	4599243-4599274	32	MG707188	Pseudomonas phage TC7, partial genome	27028-27059	9	0.719
NC_018524_26	26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT	4599243-4599274	32	MF417869	Uncultured Caudovirales phage clone 3S_4, partial genome	49746-49777	9	0.719
NC_018524_26	26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT	4599243-4599274	32	MF417877	Uncultured Caudovirales phage clone 9F_7, partial genome	29131-29162	9	0.719
NC_018524_26	26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT	4599243-4599274	32	MF417878	Uncultured Caudovirales phage clone 8S_7, partial genome	47108-47139	9	0.719
NC_018524_27	27.1|4607990|32|NC_018524|CRISPRCasFinder	4607990-4608021	32	NZ_CP024309	Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3b, complete sequence	339828-339859	9	0.719
NC_018524_28	28.1|4608658|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4608658-4608689	32	NZ_CP022193	Yangia pacifica strain YSBP01 plasmid unnamed3, complete sequence	112120-112151	9	0.719
NC_018524_28	28.1|4608658|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4608658-4608689	32	NZ_CP011665	Streptomyces sp. Mg1 plasmid pSMg1-1, complete sequence	482143-482174	9	0.719
NC_018524_28	28.1|4608658|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4608658-4608689	32	NZ_CP013744	Streptomyces sp. CdTB01 plasmid unnamed, complete sequence	104471-104502	9	0.719
NC_018524_30	30.2|4637791|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637791-4637822	32	NZ_LR594663	Variovorax sp. RA8 plasmid 2	236878-236909	9	0.719
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	NZ_CP019237	Rhodoferax koreense strain DCY-110 plasmid unnamed1	6672-6703	9	0.719
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	NZ_CP021405	Celeribacter manganoxidans strain DY25 plasmid pDY25-A, complete sequence	26814-26845	9	0.719
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	NZ_CP025613	Niveispirillum cyanobacteriorum strain TH16 plasmid unnamed1, complete sequence	246790-246821	9	0.719
NC_018524_30	30.6|4638035|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4638035-4638066	32	MG945447	UNVERIFIED: Microviridae sp. isolate 5964-1801, complete genome	5405-5436	9	0.719
NC_018524_31	31.4|4642096|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4642096-4642127	32	JQ680367	Unidentified phage clone 2203_scaffold802 genomic sequence	20290-20321	9	0.719
NC_018524_32	32.2|4652622|33|NC_018524|PILER-CR,CRT	4652622-4652654	33	NZ_CP031163	Deinococcus wulumuqiensis strain NEB 479 plasmid pDrdI, complete sequence	384361-384393	9	0.727
NC_018524_32	32.8|4652987|33|NC_018524|PILER-CR,CRT	4652987-4653019	33	NZ_AP018520	Sphingobium sp. YG1 plasmid pYGP1, complete sequence	66998-67030	9	0.727
NC_018524_32	32.10|4653109|33|NC_018524|PILER-CR,CRT	4653109-4653141	33	CP021188	Sphingomonas wittichii DC-6 plasmid pDC07, complete sequence	5774-5806	9	0.727
NC_018524_32	32.13|4653292|33|NC_018524|PILER-CR,CRT	4653292-4653324	33	NC_008242	Chelativorans sp. BNC1 plasmid 1, complete sequence	110713-110745	9	0.727
NC_018524_32	32.15|4652562|32|NC_018524|CRISPRCasFinder	4652562-4652593	32	NZ_CP021373	Rhizobium sp. ACO-34A plasmid pRACO34Ac, complete sequence	42971-43002	9	0.719
NC_018524_32	32.17|4652684|32|NC_018524|CRISPRCasFinder	4652684-4652715	32	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	56512-56543	9	0.719
NC_018524_32	32.17|4652684|32|NC_018524|CRISPRCasFinder	4652684-4652715	32	NC_017273	Thermus thermophilus SG0.5JP17-16 plasmid pTHTHE1601, complete sequence	323203-323234	9	0.719
NC_018524_32	32.17|4652684|32|NC_018524|CRISPRCasFinder	4652684-4652715	32	NZ_CP014142	Thermus parvatiensis strain RL plasmid pTP143, complete sequence	89627-89658	9	0.719
NC_018524_32	32.17|4652684|32|NC_018524|CRISPRCasFinder	4652684-4652715	32	NC_005838	Thermus thermophilus HB27 plasmid pTT27, complete sequence	18579-18610	9	0.719
NC_018524_32	32.17|4652684|32|NC_018524|CRISPRCasFinder	4652684-4652715	32	NZ_AP019802	Thermus thermophilus strain HC11 plasmid pHC11, complete sequence	180751-180782	9	0.719
NC_018524_32	32.17|4652684|32|NC_018524|CRISPRCasFinder	4652684-4652715	32	NC_017588	Thermus thermophilus JL-18 plasmid pTTJL1801, complete sequence	175771-175802	9	0.719
NC_018524_32	32.17|4652684|32|NC_018524|CRISPRCasFinder	4652684-4652715	32	NZ_AP019795	Thermus thermophilus strain AA2-29 plasmid pAA229, complete sequence	169483-169514	9	0.719
NC_018524_32	32.17|4652684|32|NC_018524|CRISPRCasFinder	4652684-4652715	32	NZ_LR027520	Thermus thermophilus isolate TTHNAR1 plasmid 4, complete sequence	262058-262089	9	0.719
NC_018524_32	32.17|4652684|32|NC_018524|CRISPRCasFinder	4652684-4652715	32	NZ_AP019793	Thermus thermophilus strain AA2-20 plasmid pAA220, complete sequence	198897-198928	9	0.719
NC_018524_32	32.18|4652745|32|NC_018524|CRISPRCasFinder	4652745-4652776	32	NC_012848	Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132501, complete sequence	527737-527768	9	0.719
NC_018524_32	32.21|4652927|32|NC_018524|CRISPRCasFinder	4652927-4652958	32	NZ_CP022991	Paraburkholderia aromaticivorans strain BN5 plasmid pBN1, complete sequence	95934-95965	9	0.719
NC_018524_32	32.21|4652927|32|NC_018524|CRISPRCasFinder	4652927-4652958	32	NZ_CP031116	Rubrobacter indicoceani strain SCSIO 08198 plasmid unnamed1, complete sequence	91317-91348	9	0.719
NC_018524_32	32.22|4652988|32|NC_018524|CRISPRCasFinder	4652988-4653019	32	NZ_CP023549	Rhodobacter sp. CZR27 plasmid unnamed1, complete sequence	690466-690497	9	0.719
NC_018524_32	32.22|4652988|32|NC_018524|CRISPRCasFinder	4652988-4653019	32	NZ_LR134452	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 10, complete sequence	99785-99816	9	0.719
NC_018524_32	32.22|4652988|32|NC_018524|CRISPRCasFinder	4652988-4653019	32	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	1018933-1018964	9	0.719
NC_018524_32	32.22|4652988|32|NC_018524|CRISPRCasFinder	4652988-4653019	32	NZ_CP020372	Candidatus Thiodictyon syntrophicum strain Cad16T plasmid pTs485, complete sequence	401460-401491	9	0.719
NC_018524_32	32.22|4652988|32|NC_018524|CRISPRCasFinder	4652988-4653019	32	KY092484	Streptomyces phage Raleigh, complete genome	1981-2012	9	0.719
NC_018524_32	32.23|4653049|32|NC_018524|CRISPRCasFinder	4653049-4653080	32	MH153808	Gordonia phage Petra, complete genome	37843-37874	9	0.719
NC_018524_32	32.23|4653049|32|NC_018524|CRISPRCasFinder	4653049-4653080	32	NC_031237	Gordonia phage Obliviate, complete genome	37191-37222	9	0.719
NC_018524_32	32.24|4653110|32|NC_018524|CRISPRCasFinder	4653110-4653141	32	NZ_CP030772	Streptomyces sp. YIM 121038 plasmid pSSP121038, complete sequence	336991-337022	9	0.719
NC_018524_32	32.24|4653110|32|NC_018524|CRISPRCasFinder	4653110-4653141	32	NZ_CP030772	Streptomyces sp. YIM 121038 plasmid pSSP121038, complete sequence	909297-909328	9	0.719
NC_018524_32	32.25|4653171|32|NC_018524|CRISPRCasFinder	4653171-4653202	32	CP008701	Klebsiella variicola strain Kp5-1 plasmid pKp5-1, complete sequence	175835-175866	9	0.719
NC_018524_32	32.25|4653171|32|NC_018524|CRISPRCasFinder	4653171-4653202	32	NZ_CP013986	Klebsiella variicola strain LMG 23571 plasmid unnamed, complete sequence	120724-120755	9	0.719
NC_018524_32	32.27|4653293|32|NC_018524|CRISPRCasFinder	4653293-4653324	32	NC_024970	Streptomyces aureofaciens strain CCM3239 plasmid pSA3239, complete sequence	151186-151217	9	0.719
NC_018524_32	32.27|4653293|32|NC_018524|CRISPRCasFinder	4653293-4653324	32	NZ_KJ396772	Streptomyces lavendulae subsp. lavendulae strain CCM3239 plasmid pSA3239, complete sequence	151186-151217	9	0.719
NC_018524_32	32.27|4653293|32|NC_018524|CRISPRCasFinder	4653293-4653324	32	NZ_CP017322	Xanthomonas campestris pv. campestris str. CN18 plasmid unnamed3, complete sequence	9151-9182	9	0.719
NC_018524_32	32.27|4653293|32|NC_018524|CRISPRCasFinder	4653293-4653324	32	NZ_CP017324	Xanthomonas campestris pv. campestris str. CN15 plasmid unnamed2, complete sequence	2807-2838	9	0.719
NC_018524_32	32.27|4653293|32|NC_018524|CRISPRCasFinder	4653293-4653324	32	NZ_CP020887	Xanthomonas citri pv. citri strain TX160149 plasmid unnamed2, complete sequence	959-990	9	0.719
NC_018524_32	32.27|4653293|32|NC_018524|CRISPRCasFinder	4653293-4653324	32	NZ_CP031060	Xanthomonas axonopodis pv. commiphoreae strain LMG26789 plasmid unnamed1, complete sequence	25293-25324	9	0.719
NC_018524_32	32.27|4653293|32|NC_018524|CRISPRCasFinder	4653293-4653324	32	NZ_CP024986	Streptomyces lavendulae subsp. lavendulae strain CCM 3239 plasmid pSA3239, complete sequence	89860-89891	9	0.719
NC_018524_32	32.27|4653293|32|NC_018524|CRISPRCasFinder	4653293-4653324	32	NZ_CP017309	Xanthomonas campestris pv. campestris str. CN03 plasmid unnamed, complete sequence	13051-13082	9	0.719
NC_018524_32	32.27|4653293|32|NC_018524|CRISPRCasFinder	4653293-4653324	32	AP019683	Xanthomonas campestris pv. campestris MAFF106712 pXcc1 plasmid DNA, complete genome	56021-56052	9	0.719
NC_018524_32	32.29|4653415|32|NC_018524|CRISPRCasFinder	4653415-4653446	32	MT723933	Streptomyces phage Keanu, complete genome	1241-1272	9	0.719
NC_018524_34	34.2|5116535|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116535-5116566	32	NZ_CP012383	Streptomyces ambofaciens ATCC 23877 plasmid pSAM1, complete sequence	74655-74686	9	0.719
NC_018524_34	34.2|5116535|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116535-5116566	32	KP792623	Rhodoferax phage P26218, complete genome	11937-11968	9	0.719
NC_018524_34	34.4|5116657|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116657-5116688	32	NZ_CP013381	Burkholderia sp. Bp5365 strain MSMB43 plasmid pMSMB43, complete sequence	302736-302767	9	0.719
NC_018524_34	34.4|5116657|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116657-5116688	32	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	2460278-2460309	9	0.719
NC_018524_34	34.4|5116657|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116657-5116688	32	NZ_CP009547	Burkholderia sp. 2002721687 plasmid pBTU, complete sequence	120236-120267	9	0.719
NC_018524_34	34.5|5116718|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116718-5116749	32	NZ_CP044976	Hydrogenophaga sp. PBL-H3 substr. PBL-H3(B2) plasmid pPBL-H3_B2-1, complete sequence	84422-84453	9	0.719
NC_018524_34	34.6|5116779|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116779-5116810	32	NZ_AP014686	Bradyrhizobium diazoefficiens strain NK6 plasmid pNK6b, complete sequence	19174-19205	9	0.719
NC_018524_34	34.6|5116779|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116779-5116810	32	NZ_CP049701	Bradyrhizobium sp. 1S5 strain 323S2 plasmid pB323S2b, complete sequence	379041-379072	9	0.719
NC_018524_34	34.10|5117024|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5117024-5117055	32	NC_015583	Novosphingobium sp. PP1Y plasmid Mpl, complete sequence	596556-596587	9	0.719
NC_018524_34	34.11|5117085|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5117085-5117116	32	NC_010335	Caulobacter sp. K31 plasmid pCAUL01, complete sequence	14465-14496	9	0.719
NC_018524_35	35.7|5118659|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	5118659-5118690	32	NZ_CP006369	Aureimonas sp. AU20 plasmid pAU20b, complete sequence	634-665	9	0.719
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP026091	Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence	932605-932636	10	0.688
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NC_014309	Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome	1592386-1592417	10	0.688
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP021653	Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence	1530859-1530890	10	0.688
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP026093	Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence	932695-932726	10	0.688
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP021767	Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence	1530833-1530864	10	0.688
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP012940	Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence	1255857-1255888	10	0.688
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP012944	Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence	587055-587086	10	0.688
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP012688	Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence	1530857-1530888	10	0.688
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NC_017575	Ralstonia solanacearum Po82 megaplasmid, complete sequence	932455-932486	10	0.688
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP032341	Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence	397737-397768	10	0.688
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP026308	Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence	932410-932441	10	0.688
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP021765	Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence	1526637-1526668	10	0.688
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	CP047139	Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence	1438298-1438329	10	0.688
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP051295	Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence	1244291-1244322	10	0.688
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP012916	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence	650871-650902	10	0.688
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NC_007766	Rhizobium etli CFN 42 plasmid p42f, complete sequence	173415-173446	10	0.688
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP020911	Rhizobium etli strain NXC12 plasmid pRetNXC12e, complete sequence	320451-320482	10	0.688
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NC_021911	Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1f, complete sequence	805544-805575	10	0.688
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP013515	Rhizobium sp. N1314 plasmid pRspN1314d, complete sequence	119478-119509	10	0.688
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NC_022044	Paracoccus aminophilus JCM 7686 plasmid pAMI6, complete sequence	89331-89362	10	0.688
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NZ_CP013605	Rhizobium sp. N731 plasmid pRspN731d, complete sequence	119472-119503	10	0.688
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	MG812490	Mycobacterium phage Holeinone, complete genome	48460-48491	10	0.688
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	MH051249	Mycobacterium phage Boyle, complete genome	48621-48652	10	0.688
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	MN428049	Mycobacterium phage West99, complete genome	48633-48664	10	0.688
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	MN586045	Mycobacterium phage Brownie5, complete genome	48637-48668	10	0.688
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	MH001452	Mycobacterium phage Kheth, complete genome	48513-48544	10	0.688
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	MH697584	Mycobacterium phage FrenchFry, complete genome	48595-48626	10	0.688
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	MN813678	Mycobacterium phage Lephleur, complete genome	48490-48521	10	0.688
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	MG757162	Mycobacterium phage Opia, complete genome	48493-48524	10	0.688
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	MK814751	Mycobacterium phage Bananafish, complete genome	48488-48519	10	0.688
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	KT365402	Mycobacterium phage Tres, complete genome	48487-48518	10	0.688
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	KM101117	Mycobacterium phage LizLemon, complete genome	48606-48637	10	0.688
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	JN698991	Mycobacterium phage Hedgerow, complete genome	48609-48640	10	0.688
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	NC_043767	Mycobacterium virus TA17a, complete genome	48474-48505	10	0.688
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	MN586046	Mycobacterium phage Tinciduntsolum, complete genome	48636-48667	10	0.688
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	MK620898	Mycobacterium phage Coffee, complete genome	48596-48627	10	0.688
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	JN699004	Mycobacterium phage Ares, complete genome	48554-48585	10	0.688
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	MG812491	Mycobacterium phage ItsyBitsy1, complete genome	48477-48508	10	0.688
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	DQ398048	Mycobacterium phage Qyrzula, complete genome	48610-48641	10	0.688
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	KR997932	Mycobacterium phage Godines, complete genome	48553-48584	10	0.688
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	AY129334	Mycobacterium phage Rosebush, complete genome	48624-48655	10	0.688
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	MH590591	Mycobacterium phage Sabella, complete genome	48475-48506	10	0.688
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	JN618996	Mycobacterium phage Arbiter, complete genome	48585-48616	10	0.688
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	KX443696	Mycobacterium phage Laurie, complete genome	47969-48000	10	0.688
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	MH727546	Mycobacterium phage Eaglehorse, complete genome	48522-48553	10	0.688
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	MK061411	Mycobacterium phage Faze9, complete genome	48616-48647	10	0.688
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	KT880194	Mycobacterium phage Glass, complete genome	48600-48631	10	0.688
NC_018524_1	1.10|312180|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312180-312211	32	NZ_CP009123	Sphingopyxis fribergensis strain Kp5.2 plasmid pSfKp5.2, complete sequence	37781-37812	10	0.688
NC_018524_1	1.10|312180|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312180-312211	32	NC_009620	Sinorhizobium medicae WSM419 plasmid pSMED01, complete sequence	1167046-1167077	10	0.688
NC_018524_1	1.11|312241|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312241-312272	32	NC_021347	Rhodococcus phage E3, complete genome	38040-38071	10	0.688
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	3115754-3115785	10	0.688
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	NZ_LR134465	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 23, complete sequence	176020-176051	10	0.688
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	NZ_CP007129	Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence	130892-130923	10	0.688
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	KJ410133	Mycobacterium phage Jolie2, complete genome	24155-24186	10	0.688
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	NZ_CP012185	Pseudonocardia sp. EC080619-01 plasmid pBCI1-2, complete sequence	123749-123780	10	0.688
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	NZ_CP013531	Rhizobium phaseoli strain R723 plasmid pRphaR723d, complete sequence	452797-452828	10	0.688
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	NZ_CP013541	Rhizobium phaseoli strain R630 plasmid pRphaR630d, complete sequence	439596-439627	10	0.688
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	NZ_CP013584	Rhizobium phaseoli strain N261 plasmid pRphaN261d, complete sequence	452797-452828	10	0.688
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	NC_013860	Azospirillum sp. B510 plasmid pAB510f, complete sequence	155982-156013	10	0.688
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	NZ_CP054028	Rhizobium sp. JKLM19E plasmid pPR19E01, complete sequence	400238-400269	10	0.688
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	NZ_AP014580	Burkholderia sp. RPE67 plasmid p2, complete sequence	156195-156226	10	0.688
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	NZ_CP054615	Azospirillum oryzae strain KACC 14407 plasmid unnamed1, complete sequence	26572-26603	10	0.688
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	NZ_CP012182	Pseudonocardia sp. EC080610-09 plasmid pBCI2-1, complete sequence	47104-47135	10	0.688
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	NZ_CP039644	Azospirillum sp. TSA2s plasmid p2, complete sequence	237578-237609	10	0.688
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	NZ_CP039640	Azospirillum sp. TSH100 plasmid p1, complete sequence	314733-314764	10	0.688
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	NC_016588	Azospirillum lipoferum 4B plasmid AZO_p6, complete sequence	231455-231486	10	0.688
NC_018524_2	2.4|313399|32|NC_018524|CRISPRCasFinder	313399-313430	32	NZ_CP026091	Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence	1825225-1825256	10	0.688
NC_018524_2	2.4|313399|32|NC_018524|CRISPRCasFinder	313399-313430	32	NC_014309	Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome	2052811-2052842	10	0.688
NC_018524_2	2.4|313399|32|NC_018524|CRISPRCasFinder	313399-313430	32	NZ_CP026093	Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence	1825379-1825410	10	0.688
NC_018524_2	2.4|313399|32|NC_018524|CRISPRCasFinder	313399-313430	32	NZ_CP021767	Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence	1769801-1769832	10	0.688
NC_018524_2	2.4|313399|32|NC_018524|CRISPRCasFinder	313399-313430	32	NZ_CP040821	Paraoceanicella profunda strain D4M1 plasmid pD4M1C, complete sequence	159707-159738	10	0.688
NC_018524_2	2.4|313399|32|NC_018524|CRISPRCasFinder	313399-313430	32	NZ_CP022482	Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence	853366-853397	10	0.688
NC_018524_2	2.8|313399|33|NC_018524|CRT	313399-313431	33	NC_014309	Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome	2052810-2052842	10	0.697
NC_018524_2	2.8|313399|33|NC_018524|CRT	313399-313431	33	NZ_CP021767	Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence	1769800-1769832	10	0.697
NC_018524_2	2.8|313399|33|NC_018524|CRT	313399-313431	33	NZ_CP026091	Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence	1825224-1825256	10	0.697
NC_018524_2	2.8|313399|33|NC_018524|CRT	313399-313431	33	NZ_CP026093	Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence	1825378-1825410	10	0.697
NC_018524_3	3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318761-318792	32	NC_013284	Cronobacter turicensis z3032 plasmid pCTU2, complete sequence	19714-19745	10	0.688
NC_018524_3	3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318761-318792	32	NZ_CP019585	Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymA, complete sequence	206420-206451	10	0.688
NC_018524_3	3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318761-318792	32	NC_017327	Sinorhizobium meliloti SM11 plasmid pSmeSM11c, complete sequence	1304574-1304605	10	0.688
NC_018524_3	3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318761-318792	32	NC_017324	Sinorhizobium meliloti BL225C plasmid pSINMEB01, complete sequence	569704-569735	10	0.688
NC_018524_3	3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318761-318792	32	NZ_CP009145	Sinorhizobium meliloti strain RMO17 plasmid pSymA, complete sequence	1279645-1279676	10	0.688
NC_018524_3	3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318761-318792	32	NC_015597	Sinorhizobium meliloti AK83 plasmid pSINME01, complete sequence	188695-188726	10	0.688
NC_018524_3	3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318761-318792	32	NZ_CP026388	Leclercia sp. LSNIH3 plasmid pLEC-2975, complete sequence	27179-27210	10	0.688
NC_018524_3	3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318761-318792	32	NZ_CP021827	Sinorhizobium meliloti strain KH35c plasmid psymA, complete sequence	340274-340305	10	0.688
NC_018524_3	3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318761-318792	32	NZ_CP015881	Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence	333171-333202	10	0.688
NC_018524_3	3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318761-318792	32	NZ_CP015882	Ensifer adhaerens strain Casida A plasmid pCasidaAB, complete sequence	396741-396772	10	0.688
NC_018524_3	3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318761-318792	32	NZ_CP030264	Ensifer adhaerens strain Corn53 plasmid AB, complete sequence	551868-551899	10	0.688
NC_018524_3	3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318761-318792	32	NZ_CP021801	Sinorhizobium meliloti strain USDA1021 plasmid psymA, complete sequence	1186884-1186915	10	0.688
NC_018524_3	3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318761-318792	32	NZ_CP021819	Sinorhizobium meliloti strain M162 plasmid psymA, complete sequence	255436-255467	10	0.688
NC_018524_3	3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318761-318792	32	NZ_CP021830	Sinorhizobium meliloti strain HM006 plasmid psymA, complete sequence	876003-876034	10	0.688
NC_018524_3	3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318761-318792	32	NZ_CP021824	Sinorhizobium meliloti strain KH46 plasmid psymA, complete sequence	1287071-1287102	10	0.688
NC_018524_3	3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318761-318792	32	NZ_CP021813	Sinorhizobium meliloti strain M270 plasmid psymA, complete sequence	127518-127549	10	0.688
NC_018524_3	3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318761-318792	32	NC_018683	Sinorhizobium meliloti Rm41 plasmid pSYMA, complete sequence	306722-306753	10	0.688
NC_018524_3	3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318761-318792	32	NZ_CP021794	Sinorhizobium meliloti strain USDA1157 plasmid psymA, complete sequence	383546-383577	10	0.688
NC_018524_3	3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318761-318792	32	NZ_CP021809	Sinorhizobium meliloti strain Rm41 plasmid psymA, complete sequence	318694-318725	10	0.688
NC_018524_3	3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318761-318792	32	NZ_CP021217	Sinorhizobium meliloti RU11/001 plasmid pSymA, complete sequence	909729-909760	10	0.688
NC_018524_3	3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318761-318792	32	NZ_CP026526	Sinorhizobium meliloti strain AK21 plasmid pSymA, complete sequence	477290-477321	10	0.688
NC_018524_3	3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318761-318792	32	NC_009779	Cronobacter sakazakii ATCC BAA-894 plasmid pESA2, complete sequence	28580-28611	10	0.688
NC_018524_3	3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318761-318792	32	NZ_CP019483	Sinorhizobium meliloti strain B401 plasmid pSymA, complete sequence	1025557-1025588	10	0.688
NC_018524_3	3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318761-318792	32	NZ_CP019486	Sinorhizobium meliloti strain B399 plasmid pSymA, complete sequence	979776-979807	10	0.688
NC_018524_3	3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318761-318792	32	NZ_CP029232	Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence	1005230-1005261	10	0.688
NC_018524_3	3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318761-318792	32	MN823994	Leclercia adecarboxylata strain 150707804 plasmid p707804-2FII, complete sequence	13160-13191	10	0.688
NC_018524_3	3.7|318883|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318883-318914	32	NZ_CP019603	Croceicoccus marinus strain E4A9 plasmid pCME4A9I, complete sequence	210120-210151	10	0.688
NC_018524_3	3.9|319005|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	319005-319036	32	NZ_LR594663	Variovorax sp. RA8 plasmid 2	267858-267889	10	0.688
NC_018524_3	3.12|319187|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	319187-319218	32	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	226603-226634	10	0.688
NC_018524_4	4.7|321736|32|NC_018524|CRISPRCasFinder,CRT	321736-321767	32	NZ_CP034352	Streptomyces sp. W1SF4 plasmid p2, complete sequence	181836-181867	10	0.688
NC_018524_4	4.7|321736|32|NC_018524|CRISPRCasFinder,CRT	321736-321767	32	NZ_CP032343	Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence	474046-474077	10	0.688
NC_018524_4	4.7|321736|32|NC_018524|CRISPRCasFinder,CRT	321736-321767	32	NZ_CP012917	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence	254148-254179	10	0.688
NC_018524_4	4.7|321736|32|NC_018524|CRISPRCasFinder,CRT	321736-321767	32	NZ_CP045548	Streptomyces sp. SYP-A7193 plasmid unnamed1, complete sequence	488735-488766	10	0.688
NC_018524_4	4.9|321858|32|NC_018524|CRISPRCasFinder,CRT	321858-321889	32	NZ_CP030772	Streptomyces sp. YIM 121038 plasmid pSSP121038, complete sequence	288635-288666	10	0.688
NC_018524_4	4.9|321858|32|NC_018524|CRISPRCasFinder,CRT	321858-321889	32	NZ_CP030772	Streptomyces sp. YIM 121038 plasmid pSSP121038, complete sequence	382093-382124	10	0.688
NC_018524_4	4.9|321858|32|NC_018524|CRISPRCasFinder,CRT	321858-321889	32	NZ_CP030772	Streptomyces sp. YIM 121038 plasmid pSSP121038, complete sequence	508024-508055	10	0.688
NC_018524_4	4.9|321858|32|NC_018524|CRISPRCasFinder,CRT	321858-321889	32	NZ_CP030772	Streptomyces sp. YIM 121038 plasmid pSSP121038, complete sequence	669177-669208	10	0.688
NC_018524_4	4.9|321858|32|NC_018524|CRISPRCasFinder,CRT	321858-321889	32	NZ_CP030772	Streptomyces sp. YIM 121038 plasmid pSSP121038, complete sequence	731913-731944	10	0.688
NC_018524_4	4.9|321858|32|NC_018524|CRISPRCasFinder,CRT	321858-321889	32	NZ_CP015090	Pelagibaca abyssi strain JLT2014 plasmid pPABY2, complete sequence	67502-67533	10	0.688
NC_018524_4	4.9|321858|32|NC_018524|CRISPRCasFinder,CRT	321858-321889	32	NZ_CP013739	Streptomyces globisporus C-1027 plasmid SGLP1, complete sequence	124782-124813	10	0.688
NC_018524_4	4.19|321736|33|NC_018524|PILER-CR	321736-321768	33	NZ_CP020041	Streptomyces sp. 3211 isolate 3 plasmid p3211-2, complete sequence	51415-51447	10	0.697
NC_018524_4	4.19|321736|33|NC_018524|PILER-CR	321736-321768	33	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	949691-949723	10	0.697
NC_018524_4	4.19|321736|33|NC_018524|PILER-CR	321736-321768	33	NZ_CP050083	Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b3, complete sequence	454349-454381	10	0.697
NC_018524_4	4.19|321736|33|NC_018524|PILER-CR	321736-321768	33	NZ_CP049733	Rhizobium leguminosarum strain A1 plasmid pRL10, complete sequence	442023-442055	10	0.697
NC_018524_4	4.19|321736|33|NC_018524|PILER-CR	321736-321768	33	CP054917	Streptomyces sp. NA02950 plasmid unnamed, complete sequence	38433-38465	10	0.697
NC_018524_4	4.19|321736|33|NC_018524|PILER-CR	321736-321768	33	NZ_CP053207	Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1C, complete sequence	471125-471157	10	0.697
NC_018524_4	4.20|321797|33|NC_018524|PILER-CR	321797-321829	33	CP011998	Ralstonia solanacearum strain YC45 plasmid, complete sequence	299791-299823	10	0.697
NC_018524_5	5.2|326593|32|NC_018524|CRISPRCasFinder	326593-326624	32	NC_009040	Rhodobacter sphaeroides ATCC 17029 plasmid pRSPH01, complete sequence	25659-25690	10	0.688
NC_018524_5	5.2|326593|32|NC_018524|CRISPRCasFinder	326593-326624	32	NZ_CP034186	Deinococcus sp. S14-83 strain S14-83T plasmid unnamed2, complete sequence	52909-52940	10	0.688
NC_018524_5	5.13|326594|32|NC_018524|PILER-CR	326594-326625	32	NC_009040	Rhodobacter sphaeroides ATCC 17029 plasmid pRSPH01, complete sequence	25659-25690	10	0.688
NC_018524_5	5.13|326594|32|NC_018524|PILER-CR	326594-326625	32	NZ_CP034186	Deinococcus sp. S14-83 strain S14-83T plasmid unnamed2, complete sequence	52909-52940	10	0.688
NC_018524_11	11.2|2251085|32|NC_018524|PILER-CR,CRT	2251085-2251116	32	NZ_CP016452	Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence	1035936-1035967	10	0.688
NC_018524_11	11.3|2251146|32|NC_018524|PILER-CR,CRT	2251146-2251177	32	NC_022995	Burkholderia sp. M701 plasmid pM7012 DNA, complete sequence	467019-467050	10	0.688
NC_018524_11	11.3|2251146|32|NC_018524|PILER-CR,CRT	2251146-2251177	32	MG812496	Gordonia phage SallySpecial, complete genome	11482-11513	10	0.688
NC_018524_11	11.4|2251207|32|NC_018524|PILER-CR,CRT	2251207-2251238	32	NZ_CP046321	Gordonia bronchialis strain FDAARGOS_676 plasmid unnamed1, complete sequence	72266-72297	10	0.688
NC_018524_11	11.4|2251207|32|NC_018524|PILER-CR,CRT	2251207-2251238	32	NC_013442	Gordonia bronchialis DSM 43247 plasmid pGBRO01, complete sequence	68019-68050	10	0.688
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP022775	Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence	420506-420537	10	0.688
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NC_010580	Beijerinckia indica subsp. indica ATCC 9039 plasmid pBIND01, complete sequence	75398-75429	10	0.688
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NC_013858	Azospirillum sp. B510 plasmid pAB510d, complete sequence	260845-260876	10	0.688
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP054621	Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence	318302-318333	10	0.688
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP022764	Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence	420538-420569	10	0.688
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP022797	Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence	420538-420569	10	0.688
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	NZ_CP022758	Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence	420530-420561	10	0.688
NC_018524_11	11.6|2251329|32|NC_018524|PILER-CR,CRT	2251329-2251360	32	AB916497	Ralstonia phage RS138 DNA, complete genome	29984-30015	10	0.688
NC_018524_11	11.8|2251452|32|NC_018524|PILER-CR,CRT	2251452-2251483	32	NZ_CP021915	Sagittula sp. P11 plasmid unnamed2, complete sequence	144234-144265	10	0.688
NC_018524_11	11.8|2251452|32|NC_018524|PILER-CR,CRT	2251452-2251483	32	NZ_CP018081	Sulfitobacter sp. AM1-D1 plasmid unnamed5, complete sequence	119328-119359	10	0.688
NC_018524_15	15.1|2270337|32|NC_018524|CRISPRCasFinder	2270337-2270368	32	MN693668	Marine virus AFVG_250M1112, complete genome	24881-24912	10	0.688
NC_018524_19	19.5|4409022|32|NC_018524|CRT	4409022-4409053	32	NC_016626	Burkholderia sp. YI23 plasmid byi_1p, complete sequence	1109310-1109341	10	0.688
NC_018524_19	19.5|4409022|32|NC_018524|CRT	4409022-4409053	32	NZ_CP023408	Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence	358081-358112	10	0.688
NC_018524_19	19.5|4409022|32|NC_018524|CRT	4409022-4409053	32	NZ_CP016617	Microvirga ossetica strain V5/3m plasmid unnamed1, complete sequence	466086-466117	10	0.688
NC_018524_21	21.5|4582418|33|NC_018524|PILER-CR	4582418-4582450	33	NC_014825	Ruminococcus albus 7 = DSM 20455 plasmid pRUMAL02, complete sequence	236314-236346	10	0.697
NC_018524_21	21.7|4582540|33|NC_018524|PILER-CR	4582540-4582572	33	NZ_CP049319	Caballeronia sp. SBC2 plasmid pSBC2-3, complete sequence	243137-243169	10	0.697
NC_018524_21	21.12|4582845|33|NC_018524|PILER-CR	4582845-4582877	33	MT723940	Mycobacterium phage Ellie, complete genome	38519-38551	10	0.697
NC_018524_21	21.12|4582845|33|NC_018524|PILER-CR	4582845-4582877	33	NC_019959	Mycobacterium sp. JS623 plasmid pMYCSM03, complete sequence	67009-67041	10	0.697
NC_018524_21	21.18|4582419|32|NC_018524|CRISPRCasFinder,CRT	4582419-4582450	32	NC_014825	Ruminococcus albus 7 = DSM 20455 plasmid pRUMAL02, complete sequence	236315-236346	10	0.688
NC_018524_21	21.18|4582419|32|NC_018524|CRISPRCasFinder,CRT	4582419-4582450	32	NZ_CP032928	Agrobacterium tumefaciens strain 1D1460 plasmid pAt1D1460, complete sequence	409964-409995	10	0.688
NC_018524_21	21.19|4582480|32|NC_018524|CRISPRCasFinder,CRT	4582480-4582511	32	MF417883	Uncultured Caudovirales phage clone 7F_11, partial genome	48202-48233	10	0.688
NC_018524_21	21.19|4582480|32|NC_018524|CRISPRCasFinder,CRT	4582480-4582511	32	MF417938	Uncultured Caudovirales phage clone 9AX_4, partial genome	21554-21585	10	0.688
NC_018524_21	21.19|4582480|32|NC_018524|CRISPRCasFinder,CRT	4582480-4582511	32	MF417872	Uncultured phage clone 7AX_2, partial genome	1100-1131	10	0.688
NC_018524_21	21.19|4582480|32|NC_018524|CRISPRCasFinder,CRT	4582480-4582511	32	MF417884	Uncultured Caudovirales phage clone 8AX_2, partial genome	47754-47785	10	0.688
NC_018524_21	21.19|4582480|32|NC_018524|CRISPRCasFinder,CRT	4582480-4582511	32	MF417839	Uncultured Caudovirales phage clone 2AX_2, partial genome	33675-33706	10	0.688
NC_018524_21	21.19|4582480|32|NC_018524|CRISPRCasFinder,CRT	4582480-4582511	32	MF417931	Uncultured Caudovirales phage clone 3S_7, partial genome	33360-33391	10	0.688
NC_018524_21	21.19|4582480|32|NC_018524|CRISPRCasFinder,CRT	4582480-4582511	32	MF417873	Uncultured Caudovirales phage clone 7S_5, partial genome	33165-33196	10	0.688
NC_018524_21	21.19|4582480|32|NC_018524|CRISPRCasFinder,CRT	4582480-4582511	32	MF417882	Uncultured Caudovirales phage clone 10F_10, partial genome	34398-34429	10	0.688
NC_018524_21	21.25|4582846|32|NC_018524|CRISPRCasFinder,CRT	4582846-4582877	32	NZ_CP006373	Aureimonas sp. AU20 plasmid pAU20f, complete sequence	751-782	10	0.688
NC_018524_21	21.27|4582968|32|NC_018524|CRISPRCasFinder,CRT	4582968-4582999	32	NC_009339	Mycolicibacterium gilvum PYR-GCK plasmid pMFLV01, complete sequence	127603-127634	10	0.688
NC_018524_23	23.2|4591661|33|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4591661-4591693	33	NZ_LN832562	Paracoccus aminovorans isolate JCM7685 plasmid IV, complete sequence	401842-401874	10	0.697
NC_018524_23	23.8|4592030|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4592030-4592061	32	NZ_CP041206	Rhizobium sp. NIBRBAC000502774 plasmid pMK-3, complete sequence	452350-452381	10	0.688
NC_018524_24	24.1|4593189|32|NC_018524|CRISPRCasFinder,CRT	4593189-4593220	32	NZ_CP025613	Niveispirillum cyanobacteriorum strain TH16 plasmid unnamed1, complete sequence	510588-510619	10	0.688
NC_018524_24	24.1|4593189|32|NC_018524|CRISPRCasFinder,CRT	4593189-4593220	32	NZ_CP033227	Sphingobium yanoikuyae strain SJTF8 plasmid pF1, complete sequence	25897-25928	10	0.688
NC_018524_26	26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT	4598633-4598664	32	NZ_CP023408	Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence	421129-421160	10	0.688
NC_018524_26	26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT	4598633-4598664	32	MH588544	Caulobacter phage CcrBL10, complete genome	10222-10253	10	0.688
NC_018524_26	26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT	4598633-4598664	32	KY555147	Caulobacter phage Ccr34, complete genome	79727-79758	10	0.688
NC_018524_26	26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT	4598633-4598664	32	KY555145	Caulobacter phage Ccr29, complete genome	83641-83672	10	0.688
NC_018524_26	26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT	4598633-4598664	32	KY555143	Caulobacter phage Ccr2, complete genome	79108-79139	10	0.688
NC_018524_26	26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT	4598633-4598664	32	NC_048812	Gordonia phage Gibbin, complete genome	44009-44040	10	0.688
NC_018524_26	26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT	4598633-4598664	32	MN234162	Gordonia phage GretelLyn, complete genome	44056-44087	10	0.688
NC_018524_26	26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT	4598633-4598664	32	KY555146	Caulobacter phage Ccr32, complete genome	79287-79318	10	0.688
NC_018524_26	26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT	4598633-4598664	32	MN234220	Gordonia phage Lambo, complete genome	43007-43038	10	0.688
NC_018524_26	26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT	4598633-4598664	32	KY555144	Caulobacter phage Ccr5, complete genome	78560-78591	10	0.688
NC_018524_26	26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT	4598633-4598664	32	NC_028865	Tsukamurella phage TIN2, complete genome	56824-56855	10	0.688
NC_018524_26	26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT	4598633-4598664	32	JX163858	Caulobacter phage phiCbK, complete genome	128542-128573	10	0.688
NC_018524_26	26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT	4598633-4598664	32	KY555142	Caulobacter phage Ccr10, complete genome	78633-78664	10	0.688
NC_018524_26	26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT	4598633-4598664	32	MN586003	Gordonia phage Yikes, complete genome	44495-44526	10	0.688
NC_018524_26	26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT	4598633-4598664	32	NC_019411	Caulobacter phage CcrSwift, complete genome	78530-78561	10	0.688
NC_018524_26	26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT	4598633-4598664	32	NC_048815	Gordonia phage Sadboi, complete genome	44057-44088	10	0.688
NC_018524_26	26.20|4598877|32|NC_018524|CRISPRCasFinder,CRT	4598877-4598908	32	NZ_CP022366	Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence	298710-298741	10	0.688
NC_018524_26	26.20|4598877|32|NC_018524|CRISPRCasFinder,CRT	4598877-4598908	32	NZ_CP032348	Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence	52090-52121	10	0.688
NC_018524_26	26.20|4598877|32|NC_018524|CRISPRCasFinder,CRT	4598877-4598908	32	NC_012987	Methylorubrum extorquens AM1 plasmid p1METDI, complete sequence	107062-107093	10	0.688
NC_018524_26	26.20|4598877|32|NC_018524|CRISPRCasFinder,CRT	4598877-4598908	32	NZ_CP043499	Rhizobium grahamii strain BG7 plasmid unnamed, complete sequence	245925-245956	10	0.688
NC_018524_26	26.23|4599060|32|NC_018524|CRISPRCasFinder,CRT	4599060-4599091	32	NZ_CP024424	Paracoccus yeei strain TT13 plasmid pTT13-2, complete sequence	5078-5109	10	0.688
NC_018524_26	26.23|4599060|32|NC_018524|CRISPRCasFinder,CRT	4599060-4599091	32	NZ_CP020440	Paracoccus yeei strain FDAARGOS_252 plasmid unnamed2, complete sequence	116384-116415	10	0.688
NC_018524_26	26.23|4599060|32|NC_018524|CRISPRCasFinder,CRT	4599060-4599091	32	NZ_CP044082	Paracoccus yeei strain FDAARGOS_643 plasmid unnamed4, complete sequence	206290-206321	10	0.688
NC_018524_26	26.23|4599060|32|NC_018524|CRISPRCasFinder,CRT	4599060-4599091	32	NZ_CP031080	Paracoccus yeei strain CCUG 32053 plasmid pYEE2, complete sequence	97923-97954	10	0.688
NC_018524_26	26.25|4599182|32|NC_018524|CRISPRCasFinder,CRT	4599182-4599213	32	NZ_CP022220	Bradyrhizobium guangxiense strain CCBAU 53363 plasmid p53363, complete sequence	976724-976755	10	0.688
NC_018524_26	26.25|4599182|32|NC_018524|CRISPRCasFinder,CRT	4599182-4599213	32	NZ_CP042167	Burkholderia contaminans strain ZCC plasmid unnamed1, complete sequence	101452-101483	10	0.688
NC_018524_26	26.25|4599182|32|NC_018524|CRISPRCasFinder,CRT	4599182-4599213	32	NZ_CP028810	Burkholderia contaminans strain SK875 plasmid p875, complete sequence	100285-100316	10	0.688
NC_018524_26	26.25|4599182|32|NC_018524|CRISPRCasFinder,CRT	4599182-4599213	32	NZ_CP046610	Burkholderia contaminans strain XL73 plasmid unnamed1, complete sequence	18321-18352	10	0.688
NC_018524_26	26.25|4599182|32|NC_018524|CRISPRCasFinder,CRT	4599182-4599213	32	NZ_CP030052	Bradyrhizobium guangdongense strain CCBAU 51649 plasmid unnamed, complete sequence	589564-589595	10	0.688
NC_018524_26	26.25|4599182|32|NC_018524|CRISPRCasFinder,CRT	4599182-4599213	32	NZ_CP030054	Bradyrhizobium guangzhouense strain CCBAU 51670 plasmid unnamed1, complete sequence	769157-769188	10	0.688
NC_018524_26	26.25|4599182|32|NC_018524|CRISPRCasFinder,CRT	4599182-4599213	32	NC_022599	Micrococcus sp. V7 plasmid pLMV7, complete sequence	22136-22167	10	0.688
NC_018524_26	26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT	4599243-4599274	32	NZ_AP014579	Burkholderia sp. RPE67 plasmid p1, complete sequence	759100-759131	10	0.688
NC_018524_26	26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT	4599243-4599274	32	MT522001	Microbacterium phage Karate, complete genome	7699-7730	10	0.688
NC_018524_26	26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT	4599243-4599274	32	NZ_CP049158	Caballeronia sp. SBC1 plasmid pSBC1_2, complete sequence	1566482-1566513	10	0.688
NC_018524_26	26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT	4599243-4599274	32	NZ_CP049318	Caballeronia sp. SBC2 plasmid pSBC2-2, complete sequence	1571150-1571181	10	0.688
NC_018524_26	26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT	4599243-4599274	32	NC_016626	Burkholderia sp. YI23 plasmid byi_1p, complete sequence	135105-135136	10	0.688
NC_018524_26	26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT	4599243-4599274	32	NC_016626	Burkholderia sp. YI23 plasmid byi_1p, complete sequence	618054-618085	10	0.688
NC_018524_26	26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT	4599243-4599274	32	KM389229	UNVERIFIED: Pseudomonas phage F_TK1718sp/PAK clone contig00001 genomic sequence	3779-3810	10	0.688
NC_018524_26	26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT	4599243-4599274	32	NC_031091	Pseudomonas phage MD8, complete genome	39232-39263	10	0.688
NC_018524_30	30.2|4637791|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637791-4637822	32	NC_017771	Deinococcus gobiensis I-0 plasmid P3, complete sequence	50499-50530	10	0.688
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	NZ_KR152226	Micrococcus sp. MG-2010-D12 plasmid pJD12, complete sequence	33924-33955	10	0.688
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	NZ_CP029358	Azospirillum sp. CFH 70021 plasmid unnamed3	115453-115484	10	0.688
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	NZ_CP021373	Rhizobium sp. ACO-34A plasmid pRACO34Ac, complete sequence	361201-361232	10	0.688
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	NC_024972	Micrococcus sp. A1 plasmid pLMA1, complete sequence	46453-46484	10	0.688
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	KY555147	Caulobacter phage Ccr34, complete genome	18456-18487	10	0.688
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	KY555145	Caulobacter phage Ccr29, complete genome	21102-21133	10	0.688
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	KY555143	Caulobacter phage Ccr2, complete genome	18935-18966	10	0.688
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	NC_019410	Caulobacter phage CcrKarma, complete genome	18553-18584	10	0.688
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	KY555146	Caulobacter phage Ccr32, complete genome	18455-18486	10	0.688
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	NC_019407	Caulobacter phage CcrMagneto, complete genome	17299-17330	10	0.688
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	KY555144	Caulobacter phage Ccr5, complete genome	18329-18360	10	0.688
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	JX163858	Caulobacter phage phiCbK, complete genome	189371-189402	10	0.688
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	KY555142	Caulobacter phage Ccr10, complete genome	18460-18491	10	0.688
NC_018524_30	30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637852-4637883	32	NC_019411	Caulobacter phage CcrSwift, complete genome	17662-17693	10	0.688
NC_018524_30	30.5|4637974|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637974-4638005	32	NZ_LN997849	Magnetospirillum sp. XM-1 isolate XM1 plasmid II, complete sequence	80955-80986	10	0.688
NC_018524_30	30.6|4638035|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4638035-4638066	32	NZ_CP015006	Aminobacter aminovorans strain KCTC 2477 plasmid pAA01, complete sequence	520194-520225	10	0.688
NC_018524_31	31.3|4642035|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4642035-4642066	32	NZ_CP019314	Tateyamaria omphalii strain DOK1-4 plasmid pDOK1-4-2, complete sequence	16836-16867	10	0.688
NC_018524_32	32.8|4652987|33|NC_018524|PILER-CR,CRT	4652987-4653019	33	NZ_CP023549	Rhodobacter sp. CZR27 plasmid unnamed1, complete sequence	690465-690497	10	0.697
NC_018524_32	32.9|4653048|33|NC_018524|PILER-CR,CRT	4653048-4653080	33	MH153808	Gordonia phage Petra, complete genome	37842-37874	10	0.697
NC_018524_32	32.9|4653048|33|NC_018524|PILER-CR,CRT	4653048-4653080	33	NC_031237	Gordonia phage Obliviate, complete genome	37190-37222	10	0.697
NC_018524_32	32.15|4652562|32|NC_018524|CRISPRCasFinder	4652562-4652593	32	NZ_CP027023	Streptomyces sp. WAC00288 plasmid p1, complete sequence	64282-64313	10	0.688
NC_018524_32	32.22|4652988|32|NC_018524|CRISPRCasFinder	4652988-4653019	32	NZ_LN832560	Paracoccus aminovorans isolate JCM7685 plasmid II, complete sequence	120119-120150	10	0.688
NC_018524_32	32.22|4652988|32|NC_018524|CRISPRCasFinder	4652988-4653019	32	NC_012811	Methylorubrum extorquens AM1 megaplasmid, complete sequence	104652-104683	10	0.688
NC_018524_32	32.22|4652988|32|NC_018524|CRISPRCasFinder	4652988-4653019	32	NZ_CP034813	Paracoccus sp. Arc7-R13 plasmid unnamed2, complete sequence	173408-173439	10	0.688
NC_018524_32	32.22|4652988|32|NC_018524|CRISPRCasFinder	4652988-4653019	32	NZ_CP032347	Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence	54480-54511	10	0.688
NC_018524_32	32.27|4653293|32|NC_018524|CRISPRCasFinder	4653293-4653324	32	NC_022536	Rhizobium sp. IRBG74 plasmid IRBL74_p, complete sequence	379178-379209	10	0.688
NC_018524_32	32.27|4653293|32|NC_018524|CRISPRCasFinder	4653293-4653324	32	CP022268	Xanthomonas citri pv. vignicola strain CFBP7112 plasmid plA, complete sequence	47372-47403	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MH590593	Mycobacterium phage Rabinovish, complete genome	111008-111039	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	KX781992	Mycobacterium phage Gabriel, complete genome	109037-109068	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MK112554	Mycobacterium phage TinyTim, complete genome	109491-109522	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MK359337	Mycobacterium phage Flabslab, complete genome	108480-108511	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MN234193	Mycobacterium phage Kboogie, complete genome	109858-109889	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MK450432	Mycobacterium phage ValleyTerrace, complete genome	109404-109435	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MH051261	Mycobacterium phage Tyke, complete genome	111320-111351	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MK359311	Mycobacterium phage SmallFry, complete genome	109208-109239	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MK359364	Mycobacterium phage ChickenPhender, complete genome	109063-109094	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MK359303	Mycobacterium phage Shnickers, complete genome	109114-109145	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MH697586	Mycobacterium phage InigoMontoya, complete genome	110068-110099	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MK112549	Mycobacterium phage Morizzled23, complete genome	108771-108802	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MK359347	Mycobacterium phage Ading, complete genome	110988-111019	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	NC_023714	Mycobacterium phage LinStu, complete genome	110143-110174	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MK359358	Mycobacterium phage Essence, complete genome	109299-109330	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MG812493	Mycobacterium phage NuevoMundo, complete genome	112394-112425	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MK359339	Mycobacterium phage Naija, complete genome	110107-110138	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MK359333	Mycobacterium phage JustHall, complete genome	109200-109231	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MN428065	Mycobacterium phage Cactojaque, complete genome	108936-108967	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MK359306	Mycobacterium phage Norm, complete genome	110842-110873	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MN735434	Mycobacterium phage Mangeria, complete genome	111197-111228	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	JN699625	Mycobacterium phage Wally, complete genome	109388-109419	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	EU826471	Mycobacterium phage Cali, complete genome	110883-110914	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MK359366	Mycobacterium phage Basquiat, complete genome	108916-108947	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MK359346	Mycobacterium phage NoodleTree, complete genome	110840-110871	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	JN699013	Mycobacterium phage Pio, complete genome	113131-113162	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MK359361	Mycobacterium phage Darko, complete genome	109641-109672	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	NC_023725	Mycobacterium phage Nappy, complete genome	111801-111832	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MK359348	Mycobacterium phage Rahel, complete genome	109842-109873	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MH779498	Mycobacterium phage Bread, complete genome	109507-109538	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MK450427	Mycobacterium phage Adlitam, complete genome	109592-109623	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MG812494	Mycobacterium phage Pier, complete genome	111936-111967	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	GQ303262	Mycobacterium phage LRRHood, complete genome	109856-109887	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MT818423	Mycobacterium phage Janiyra, complete genome	110293-110324	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	AY129337	Mycobacteriophage Bxz1, complete genome	112476-112507	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MH051260	Mycobacterium phage InterFolia, complete genome	111766-111797	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	KX721256	Mycobacterium phage Erdmann, complete genome	110516-110547	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MK359328	Mycobacterium phage EmmaElysia, complete genome	110577-110608	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MK359335	Mycobacterium phage Patter, complete genome	109418-109449	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MT889395	Mycobacterium phage Shifa, complete genome	109627-109658	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	EU826467	Mycobacterium phage Rizal, complete genome	108360-108391	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MT723944	Mycobacterium phage ChaylaJr, complete genome	109344-109375	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	KR080196	Mycobacterium phage Momo, complete genome	109404-109435	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MH910040	Mycobacterium phage Sauce, complete genome	109059-109090	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MF919495	Mycobacterium phage Bigswole, complete genome	112864-112895	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MK359318	Mycobacterium phage Specks, complete genome	111515-111546	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	KF024734	Mycobacterium phage Shrimp, complete genome	111171-111202	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MK359308	Mycobacterium phage Shaqnato, complete genome	109276-109307	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MH825697	Mycobacterium phage Bangla1971, complete genome	109410-109441	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MK359338	Mycobacterium phage Amataga, complete genome	109404-109435	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MK359350	Mycobacterium phage Nidhogg, complete genome	110933-110964	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MT723945	Mycobacterium phage Quasimodo, complete genome	110733-110764	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MK359342	Mycobacterium phage ShiaLabeouf, complete genome	109050-109081	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MH316561	Mycobacterium phage Derek, complete genome	109970-110001	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MK450422	Mycobacterium phage RoMag, complete genome	110153-110184	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MH727543	Mycobacterium phage CharlieB, complete genome	109644-109675	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	JF704116	Mycobacterium phage Drazdys, complete genome	110087-110118	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MK359336	Mycobacterium phage Chargie21, complete genome	108916-108947	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MK359355	Mycobacterium phage Sprinklers, complete genome	109766-109797	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MK112534	Mycobacterium phage Burrough, complete genome	111277-111308	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	NC_023696	Mycobacterium phage Dandelion, complete genome	114040-114071	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MN276192	Mycobacterium phage Trinitium, complete genome	109238-109269	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MK359324	Mycobacterium phage Tortoise16, complete genome	109953-109984	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MK359349	Mycobacterium phage FoxtrotP1, complete genome	111115-111146	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	JF704096	Mycobacterium phage Ghost, complete sequence	109315-109346	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MN062707	Mycobacterium phage Grungle, complete genome	107352-107383	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MK359344	Mycobacterium phage Napoleon13, complete genome	109135-109166	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MH727558	Mycobacterium phage Salacia, complete genome	110245-110276	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MK359363	Mycobacterium phage Fludd, complete genome	109871-109902	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	KX831080	Mycobacterium phage Lukilu, complete genome	110866-110897	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MK359329	Mycobacterium phage Kamryn, complete genome	110830-110861	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	NC_004687	Mycobacterium phage Bxz1, complete genome	112476-112507	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	NC_011270	Mycobacterium phage Spud, complete genome	109478-109509	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MN183280	Mycobacteriophage LolaVinca, complete genome	111196-111227	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MK359345	Mycobacterium phage QBert, complete genome	109463-109494	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	GQ303260	Mycobacterium phage ET08, complete genome	109678-109709	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MK359321	Mycobacterium phage Phusco, complete genome	108939-108970	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MK359362	Mycobacterium phage Atlantean, complete genome	109404-109435	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	EU826469	Mycobacterium phage ScottMcG, complete genome	108866-108897	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MK310143	Mycobacterium phage Dietrick, complete genome	108646-108677	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	NC_029044	Mycobacterium phage Breeniome, complete genome	108961-108992	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MK878897	Mycobacterium phage Blackbrain, complete genome	110001-110032	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MF919527	Mycobacterium phage Phox, complete genome	111062-111093	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MT818416	Mycobacterium phage BackyardAgain, complete genome	108090-108121	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MK359330	Mycobacterium phage Iota, complete genome	109753-109784	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	KT365398	Mycobacterium phage DTDevon, complete genome	111442-111473	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	KX369583	Mycobacterium phage Littleton, complete genome	110641-110672	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MF919494	Mycobacterium phage BeanWater, complete genome	109442-109473	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	NC_028869	Mycobacterium phage HyRo, complete genome	109658-109689	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	KT365400	Mycobacterium phage ErnieJ, complete genome	108338-108369	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	KC691257	Mycobacterium phage Astraea, complete genome	109008-109039	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MG872839	Mycobacterium phage LifeSavor, complete genome	109929-109960	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	KC748968	Mycobacterium phage Gizmo, complete genome	112433-112464	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	KC748970	Mycobacterium phage ArcherS7, complete genome	110446-110477	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MK359353	Mycobacterium phage BadAgartude, complete genome	109503-109534	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MH697590	Mycobacterium phage Phlegm, complete genome	110107-110138	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MK359317	Mycobacterium phage FrayBell, complete genome	109960-109991	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MT553335	Mycobacterium phage Ronan, complete genome	108545-108576	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MN428066	Mycobacterium phage JPickles, complete genome	108053-108084	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MK359305	Mycobacterium phage Teardrop, complete genome	108710-108741	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	DQ398053	Mycobacteriophage Catera, complete genome	108617-108648	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MF919513	Mycobacterium phage Koguma, complete genome	109511-109542	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	JN699626	Mycobacterium phage MoMoMixon, complete genome	110328-110359	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	NC_028986	Mycobacterium phage Alice, complete sequence	109560-109591	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MK450424	Mycobacterium phage Melpomini, complete genome	108938-108969	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	JN204348	Mycobacterium phage Sebata, complete genome	111568-111599	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MN183285	Mycobacterium phage YoungMoneyMata, complete genome	109600-109631	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MK450423	Mycobacterium phage Stubby, complete genome	109518-109549	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MF919493	Mycobacterium phage Audrick, complete genome	109294-109325	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	NC_008207	Mycobacterium phage Catera, complete genome	108617-108648	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	JN624850	Mycobacterium phage Pleione, complete genome	110882-110913	10	0.688
NC_018524_34	34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116596-5116627	32	MK359326	Mycobacterium phage Pivoine, complete genome	110107-110138	10	0.688
NC_018524_34	34.4|5116657|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116657-5116688	32	NZ_CP022565	Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK01, complete sequence	298042-298073	10	0.688
NC_018524_34	34.6|5116779|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116779-5116810	32	NZ_CP017076	Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence	721586-721617	10	0.688
NC_018524_34	34.6|5116779|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116779-5116810	32	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	500559-500590	10	0.688
NC_018524_34	34.6|5116779|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	5116779-5116810	32	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	1312510-1312541	10	0.688
NC_018524_35	35.2|5118353|33|NC_018524|PILER-CR,CRISPRCasFinder,CRT	5118353-5118385	33	NZ_CP013739	Streptomyces globisporus C-1027 plasmid SGLP1, complete sequence	68460-68492	10	0.697
NC_018524_35	35.2|5118353|33|NC_018524|PILER-CR,CRISPRCasFinder,CRT	5118353-5118385	33	NZ_CP029362	Streptomyces globisporus strain TFH56 plasmid pTFSG1, complete sequence	52615-52647	10	0.697
NC_018524_35	35.7|5118659|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	5118659-5118690	32	KF626665	Phage Sano, complete genome	33349-33380	10	0.688
NC_018524_1	1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	311748-311779	32	CP047137	Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence	1383556-1383587	11	0.656
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	682108-682139	11	0.656
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	NZ_CP013635	Rhizobium sp. N324 plasmid pRspN324e, complete sequence	220091-220122	11	0.656
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	CP007644	Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803c, complete sequence	204538-204569	11	0.656
NC_018524_3	3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318761-318792	32	CP032840	Aeromonas veronii strain FC951 plasmid unnamed	45749-45780	11	0.656
NC_018524_3	3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318761-318792	32	CP032840	Aeromonas veronii strain FC951 plasmid unnamed	159343-159374	11	0.656
NC_018524_3	3.8|318944|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318944-318975	32	NZ_CP032687	Rhizobium sp. CCGE531 plasmid pRCCGE531b, complete sequence	441269-441300	11	0.656
NC_018524_3	3.8|318944|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318944-318975	32	NC_020061	Rhizobium tropici CIAT 899 plasmid pRtrCIAT899b, complete sequence	468874-468905	11	0.656
NC_018524_3	3.8|318944|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	318944-318975	32	NZ_CP034999	Rhizobium acidisoli strain FH23 plasmid pRapFH23a, complete sequence	441225-441256	11	0.656
NC_018524_3	3.12|319187|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR	319187-319218	32	NZ_AP014863	Pseudomonas furukawaii strain KF707 plasmid pKF707, complete sequence	42284-42315	11	0.656
NC_018524_9	9.1|1460065|32|NC_018524|CRISPRCasFinder,CRT	1460065-1460096	32	NZ_CP032322	Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence	957782-957813	11	0.656
NC_018524_9	9.1|1460065|32|NC_018524|CRISPRCasFinder,CRT	1460065-1460096	32	NZ_CP007794	Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence	1774437-1774468	11	0.656
NC_018524_9	9.6|1460370|32|NC_018524|CRISPRCasFinder,CRT	1460370-1460401	32	KU160671	Arthrobacter phage Vulture, complete genome	43311-43336	11	0.656
NC_018524_9	9.6|1460370|32|NC_018524|CRISPRCasFinder,CRT	1460370-1460401	32	KU160648	Arthrobacter phage HunterDalle, complete genome	43311-43336	11	0.656
NC_018524_9	9.6|1460370|32|NC_018524|CRISPRCasFinder,CRT	1460370-1460401	32	MK279874	Arthrobacter phage Riovina, complete genome	43714-43739	11	0.656
NC_018524_9	9.6|1460370|32|NC_018524|CRISPRCasFinder,CRT	1460370-1460401	32	MK279851	Arthrobacter phage Eunoia, complete genome	44391-44416	11	0.656
NC_018524_9	9.6|1460370|32|NC_018524|CRISPRCasFinder,CRT	1460370-1460401	32	MK112526	Arthrobacter phage Aledel, complete genome	43714-43739	11	0.656
NC_018524_9	9.6|1460370|32|NC_018524|CRISPRCasFinder,CRT	1460370-1460401	32	MK279868	Arthrobacter phage OMalley, complete genome	43714-43739	11	0.656
NC_018524_9	9.6|1460370|32|NC_018524|CRISPRCasFinder,CRT	1460370-1460401	32	MK279884	Arthrobacter phage Supakev, complete genome	43739-43764	11	0.656
NC_018524_9	9.9|1460554|32|NC_018524|CRISPRCasFinder,CRT	1460554-1460585	32	MN855603	Bacteriophage sp. isolate 338, complete genome	1482-1513	11	0.656
NC_018524_9	9.11|1460066|32|NC_018524|PILER-CR	1460066-1460097	32	NZ_CP032322	Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence	957782-957813	11	0.656
NC_018524_9	9.11|1460066|32|NC_018524|PILER-CR	1460066-1460097	32	NZ_CP007794	Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence	1774437-1774468	11	0.656
NC_018524_9	9.16|1460371|32|NC_018524|PILER-CR	1460371-1460402	32	KU160671	Arthrobacter phage Vulture, complete genome	43311-43336	11	0.656
NC_018524_9	9.16|1460371|32|NC_018524|PILER-CR	1460371-1460402	32	KU160648	Arthrobacter phage HunterDalle, complete genome	43311-43336	11	0.656
NC_018524_9	9.16|1460371|32|NC_018524|PILER-CR	1460371-1460402	32	MK279874	Arthrobacter phage Riovina, complete genome	43714-43739	11	0.656
NC_018524_9	9.16|1460371|32|NC_018524|PILER-CR	1460371-1460402	32	MK279851	Arthrobacter phage Eunoia, complete genome	44391-44416	11	0.656
NC_018524_9	9.16|1460371|32|NC_018524|PILER-CR	1460371-1460402	32	MK112526	Arthrobacter phage Aledel, complete genome	43714-43739	11	0.656
NC_018524_9	9.16|1460371|32|NC_018524|PILER-CR	1460371-1460402	32	MK279868	Arthrobacter phage OMalley, complete genome	43714-43739	11	0.656
NC_018524_9	9.16|1460371|32|NC_018524|PILER-CR	1460371-1460402	32	MK279884	Arthrobacter phage Supakev, complete genome	43739-43764	11	0.656
NC_018524_9	9.19|1460555|32|NC_018524|PILER-CR	1460555-1460586	32	MN855603	Bacteriophage sp. isolate 338, complete genome	1482-1513	11	0.656
NC_018524_11	11.1|2251024|32|NC_018524|PILER-CR,CRT	2251024-2251055	32	NC_016585	Azospirillum lipoferum 4B plasmid AZO_p1, complete sequence	273276-273307	11	0.656
NC_018524_19	19.5|4409022|32|NC_018524|CRT	4409022-4409053	32	NZ_LR134455	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 13, complete sequence	79970-80001	11	0.656
NC_018524_19	19.5|4409022|32|NC_018524|CRT	4409022-4409053	32	NC_003037	Sinorhizobium meliloti 1021 plasmid pSymA, complete sequence	253823-253854	11	0.656
NC_018524_19	19.5|4409022|32|NC_018524|CRT	4409022-4409053	32	NZ_CP019585	Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymA, complete sequence	367328-367359	11	0.656
NC_018524_19	19.5|4409022|32|NC_018524|CRT	4409022-4409053	32	NZ_CP021798	Sinorhizobium meliloti strain USDA1106 plasmid psymA, complete sequence	470404-470435	11	0.656
NC_018524_19	19.5|4409022|32|NC_018524|CRT	4409022-4409053	32	NC_020527	Sinorhizobium meliloti 2011 plasmid pSymA, complete sequence	253488-253519	11	0.656
NC_018524_21	21.18|4582419|32|NC_018524|CRISPRCasFinder,CRT	4582419-4582450	32	CP047389	Agrobacterium sp. CGMCC 11546 plasmid pA	78852-78883	11	0.656
NC_018524_21	21.18|4582419|32|NC_018524|CRISPRCasFinder,CRT	4582419-4582450	32	NZ_CP033036	Agrobacterium fabrum strain 12D13 plasmid pAt12D13a, complete sequence	332603-332634	11	0.656
NC_018524_21	21.18|4582419|32|NC_018524|CRISPRCasFinder,CRT	4582419-4582450	32	NZ_CP033024	Agrobacterium fabrum strain 1D132 plasmid pAt1D132a, complete sequence	263103-263134	11	0.656
NC_018524_21	21.18|4582419|32|NC_018524|CRISPRCasFinder,CRT	4582419-4582450	32	MF417876	Uncultured Caudovirales phage clone 3F_6, partial genome	38149-38180	11	0.656
NC_018524_21	21.18|4582419|32|NC_018524|CRISPRCasFinder,CRT	4582419-4582450	32	MF417995	Uncultured Caudovirales phage clone 7F_19, partial genome	5781-5812	11	0.656
NC_018524_21	21.18|4582419|32|NC_018524|CRISPRCasFinder,CRT	4582419-4582450	32	MF417869	Uncultured Caudovirales phage clone 3S_4, partial genome	6350-6381	11	0.656
NC_018524_21	21.18|4582419|32|NC_018524|CRISPRCasFinder,CRT	4582419-4582450	32	MF417877	Uncultured Caudovirales phage clone 9F_7, partial genome	19007-19038	11	0.656
NC_018524_21	21.18|4582419|32|NC_018524|CRISPRCasFinder,CRT	4582419-4582450	32	MF417878	Uncultured Caudovirales phage clone 8S_7, partial genome	3712-3743	11	0.656
NC_018524_21	21.22|4582663|32|NC_018524|CRISPRCasFinder,CRT	4582663-4582694	32	NZ_CP010612	Phaeobacter inhibens strain P92 plasmid pP92_b, complete sequence	179962-179993	11	0.656
NC_018524_21	21.22|4582663|32|NC_018524|CRISPRCasFinder,CRT	4582663-4582694	32	NZ_CP010624	Phaeobacter inhibens strain P51 plasmid pP51_a, complete sequence	172733-172764	11	0.656
NC_018524_21	21.22|4582663|32|NC_018524|CRISPRCasFinder,CRT	4582663-4582694	32	NZ_CP010669	Phaeobacter inhibens strain P57 plasmid pP57_a, complete sequence	172733-172764	11	0.656
NC_018524_21	21.22|4582663|32|NC_018524|CRISPRCasFinder,CRT	4582663-4582694	32	NC_018291	Phaeobacter inhibens DSM 17395 plasmid pPGA1_262, complete sequence	168855-168886	11	0.656
NC_018524_21	21.22|4582663|32|NC_018524|CRISPRCasFinder,CRT	4582663-4582694	32	NZ_CP010596	Phaeobacter inhibens strain P10 plasmid pP10_a, complete sequence	170013-170044	11	0.656
NC_018524_21	21.22|4582663|32|NC_018524|CRISPRCasFinder,CRT	4582663-4582694	32	NZ_CP010630	Phaeobacter inhibens strain P78 plasmid pP78_a, complete sequence	78498-78529	11	0.656
NC_018524_21	21.22|4582663|32|NC_018524|CRISPRCasFinder,CRT	4582663-4582694	32	NZ_CP010600	Phaeobacter inhibens strain P83 plasmid pP83_a, complete sequence	180522-180553	11	0.656
NC_018524_21	21.22|4582663|32|NC_018524|CRISPRCasFinder,CRT	4582663-4582694	32	NZ_CP031949	Phaeobacter inhibens strain BS107 plasmid unnamed1, complete sequence	168856-168887	11	0.656
NC_018524_21	21.22|4582663|32|NC_018524|CRISPRCasFinder,CRT	4582663-4582694	32	NZ_CP010742	Phaeobacter inhibens strain P59 plasmid pP59_a, complete sequence	190114-190145	11	0.656
NC_018524_21	21.22|4582663|32|NC_018524|CRISPRCasFinder,CRT	4582663-4582694	32	NZ_CP010618	Phaeobacter inhibens strain P30 isolate M4-3.1A plasmid pP30_a, complete sequence	194216-194247	11	0.656
NC_018524_21	21.22|4582663|32|NC_018524|CRISPRCasFinder,CRT	4582663-4582694	32	NZ_CP010726	Phaeobacter inhibens strain P88 plasmid pP88_a, complete sequence	180517-180548	11	0.656
NC_018524_21	21.22|4582663|32|NC_018524|CRISPRCasFinder,CRT	4582663-4582694	32	NZ_CP010651	Phaeobacter inhibens strain P54 plasmid pP54_a, complete sequence	195564-195595	11	0.656
NC_018524_21	21.22|4582663|32|NC_018524|CRISPRCasFinder,CRT	4582663-4582694	32	NZ_CP010706	Phaeobacter inhibens strain P66 plasmid pP66_a, complete sequence	180522-180553	11	0.656
NC_018524_21	21.22|4582663|32|NC_018524|CRISPRCasFinder,CRT	4582663-4582694	32	NZ_CP010697	Phaeobacter inhibens strain P24 plasmid pP24_a, complete sequence	172733-172764	11	0.656
NC_018524_21	21.22|4582663|32|NC_018524|CRISPRCasFinder,CRT	4582663-4582694	32	NZ_CP010746	Phaeobacter inhibens strain P48 isolate M21-2.3 plasmid pP48_a, complete sequence	187630-187661	11	0.656
NC_018524_24	24.1|4593189|32|NC_018524|CRISPRCasFinder,CRT	4593189-4593220	32	NZ_CP018172	Mesorhizobium oceanicum strain B7 plasmid unnamed1, complete sequence	51462-51493	11	0.656
NC_018524_25	25.7|4595504|32|NC_018524|CRISPRCasFinder	4595504-4595535	32	NC_021918	Cycloclasticus zancles 78-ME plasmid p7ME01, complete sequence	40648-40679	11	0.656
NC_018524_26	26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT	4599243-4599274	32	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	92370-92401	11	0.656
NC_018524_26	26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT	4599243-4599274	32	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	954850-954881	11	0.656
NC_018524_26	26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT	4599243-4599274	32	NC_011962	Rhodobacter sphaeroides KD131 plasmid pRSKD131A, complete sequence	52855-52886	11	0.656
NC_018524_30	30.2|4637791|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637791-4637822	32	AP013510	Uncultured Mediterranean phage uvMED DNA, complete genome, group G20, isolate: uvMED-CGR-C101A-MedDCM-OCT-S30-C6	10432-10463	11	0.656
NC_018524_30	30.2|4637791|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4637791-4637822	32	AP013876	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C101A-MedDCM-OCT-S39-C9, *** SEQUENCING IN PROGRESS ***	19604-19635	11	0.656
NC_018524_30	30.7|4638096|32|NC_018524|CRISPRCasFinder,CRT	4638096-4638127	32	NC_010510	Methylobacterium radiotolerans JCM 2831 plasmid pMRAD01, complete sequence	123052-123083	11	0.656
NC_018524_31	31.1|4641913|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4641913-4641944	32	NC_015184	Agrobacterium sp. H13-3 plasmid pAspH13-3a, complete sequence	197883-197914	11	0.656
NC_018524_32	32.8|4652987|33|NC_018524|PILER-CR,CRT	4652987-4653019	33	NZ_LN832560	Paracoccus aminovorans isolate JCM7685 plasmid II, complete sequence	120118-120150	11	0.667
NC_018524_32	32.15|4652562|32|NC_018524|CRISPRCasFinder	4652562-4652593	32	NZ_CP045074	Paracoccus kondratievae strain BJQ0001 plasmid unnamed1, complete sequence	317404-317435	11	0.656
NC_018524_32	32.22|4652988|32|NC_018524|CRISPRCasFinder	4652988-4653019	32	NZ_CP031166	Euzebya sp. DY32-46 plasmid pEDY32-46I, complete sequence	253325-253356	11	0.656
NC_018524_32	32.22|4652988|32|NC_018524|CRISPRCasFinder	4652988-4653019	32	NC_009959	Dinoroseobacter shibae DFL 12 = DSM 16493 plasmid pDSHI05, complete sequence	32917-32948	11	0.656
NC_018524_11	11.15|2251386|37|NC_018524|CRISPRCasFinder	2251386-2251422	37	KT287080	Enterobacter phage phiEap-2, complete genome	9454-9490	12	0.676
NC_018524_28	28.1|4608658|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	4608658-4608689	32	NZ_AP014705	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence	747703-747734	12	0.625
NC_018524_11	11.15|2251386|37|NC_018524|CRISPRCasFinder	2251386-2251422	37	MN855815	Bacteriophage sp. isolate 146, partial genome	3316-3352	13	0.649
NC_018524_1	1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT	312363-312394	32	NC_013857	Azospirillum sp. B510 plasmid pAB510c, complete sequence	534552-534583	14	0.562

1. spacer 18.1|2357863|22|NC_018524|CRISPRCasFinder matches to NZ_CP013104 (Paraburkholderia caribensis strain MWAP64 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.909

gggccggttccccgcgcagcca	CRISPR spacer
cggccggttccccgcgcagcga	Protospacer
 ******************* *

2. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to NZ_CP023408 (Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggcgagccggcggtaggcggtct	Protospacer
******* ********* ****** 

3. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MH590593 (Mycobacterium phage Rabinovish, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

4. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to KX781992 (Mycobacterium phage Gabriel, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

5. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MH697579 (Mycobacterium phage Cane17, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

6. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MK112554 (Mycobacterium phage TinyTim, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

7. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MK359314 (Mycobacterium phage Ewok, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

8. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MK359337 (Mycobacterium phage Flabslab, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

9. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MN234193 (Mycobacterium phage Kboogie, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

10. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MK450432 (Mycobacterium phage ValleyTerrace, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

11. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MH051261 (Mycobacterium phage Tyke, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

12. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MH779502 (Mycobacterium phage FudgeTart, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

13. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MK359365 (Mycobacterium phage Loanshark, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

14. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MK359311 (Mycobacterium phage SmallFry, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

15. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MK359364 (Mycobacterium phage ChickenPhender, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

16. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MK359303 (Mycobacterium phage Shnickers, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

17. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MH697586 (Mycobacterium phage InigoMontoya, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

18. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MK112549 (Mycobacterium phage Morizzled23, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

19. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MK112541 (Mycobacterium phage Jessibeth14, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

20. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MK359347 (Mycobacterium phage Ading, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

21. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MK450425 (Mycobacterium phage Shelob, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

22. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to NC_023714 (Mycobacterium phage LinStu, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

23. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MK359358 (Mycobacterium phage Essence, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

24. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to KJ595575 (Mycobacterium phage Willis, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

25. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MG812493 (Mycobacterium phage NuevoMundo, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

26. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MK359339 (Mycobacterium phage Naija, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

27. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MK359333 (Mycobacterium phage JustHall, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

28. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to KT321476 (Mycobacterium phage Zeenon, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

29. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MN428065 (Mycobacterium phage Cactojaque, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

30. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MK359306 (Mycobacterium phage Norm, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

31. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MN735434 (Mycobacterium phage Mangeria, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

32. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to JN699625 (Mycobacterium phage Wally, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

33. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to EU826471 (Mycobacterium phage Cali, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

34. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to KX721255 (Mycobacterium phage Yucca, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

35. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MK359366 (Mycobacterium phage Basquiat, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

36. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MK359346 (Mycobacterium phage NoodleTree, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

37. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to JN699013 (Mycobacterium phage Pio, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

38. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MK359361 (Mycobacterium phage Darko, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

39. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to NC_023725 (Mycobacterium phage Nappy, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

40. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MK359348 (Mycobacterium phage Rahel, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

41. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MH779498 (Mycobacterium phage Bread, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

42. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MK450427 (Mycobacterium phage Adlitam, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

43. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MG812494 (Mycobacterium phage Pier, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

44. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to GQ303262 (Mycobacterium phage LRRHood, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

45. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MT818423 (Mycobacterium phage Janiyra, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

46. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MH316567 (Mycobacterium phage ParkTD, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

47. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to AY129337 (Mycobacteriophage Bxz1, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

48. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MH051260 (Mycobacterium phage InterFolia, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

49. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to KX721256 (Mycobacterium phage Erdmann, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

50. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MK359328 (Mycobacterium phage EmmaElysia, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

51. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to KM881426 (Mycobacterium phage ZygoTaiga) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

52. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MK359335 (Mycobacterium phage Patter, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

53. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MT889395 (Mycobacterium phage Shifa, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

54. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to EU826467 (Mycobacterium phage Rizal, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

55. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MT723944 (Mycobacterium phage ChaylaJr, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

56. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to KR080196 (Mycobacterium phage Momo, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

57. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MH910040 (Mycobacterium phage Sauce, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

58. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MF919495 (Mycobacterium phage Bigswole, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

59. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MK359318 (Mycobacterium phage Specks, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

60. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to KF024734 (Mycobacterium phage Shrimp, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

61. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MK112548 (Mycobacterium phage McWolfish, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

62. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MK359308 (Mycobacterium phage Shaqnato, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

63. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MK112545 (Mycobacterium phage Khaleesi, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

64. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MH825697 (Mycobacterium phage Bangla1971, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

65. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MK359338 (Mycobacterium phage Amataga, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

66. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MK359350 (Mycobacterium phage Nidhogg, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

67. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MT723945 (Mycobacterium phage Quasimodo, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

68. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MK359342 (Mycobacterium phage ShiaLabeouf, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

69. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MH316561 (Mycobacterium phage Derek, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

70. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MK112533 (Mycobacterium phage Bonray, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

71. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MK450422 (Mycobacterium phage RoMag, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

72. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MK359327 (Mycobacterium phage EmToTheThree, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

73. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MH727543 (Mycobacterium phage CharlieB, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

74. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to JF704116 (Mycobacterium phage Drazdys, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

75. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MK359336 (Mycobacterium phage Chargie21, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

76. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MK359355 (Mycobacterium phage Sprinklers, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

77. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MK112534 (Mycobacterium phage Burrough, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

78. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MF919499 (Mycobacterium phage Daffodil, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

79. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MK359334 (Mycobacterium phage Delilah, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

80. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to NC_023696 (Mycobacterium phage Dandelion, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

81. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MN276192 (Mycobacterium phage Trinitium, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

82. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MK359324 (Mycobacterium phage Tortoise16, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

83. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MH825713 (Mycobacterium phage Zalkecks, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

84. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MK359349 (Mycobacterium phage FoxtrotP1, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

85. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to JF704096 (Mycobacterium phage Ghost, complete sequence) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

86. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MN062707 (Mycobacterium phage Grungle, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

87. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MK359344 (Mycobacterium phage Napoleon13, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

88. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MH727558 (Mycobacterium phage Salacia, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

89. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MK359363 (Mycobacterium phage Fludd, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

90. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to KX831080 (Mycobacterium phage Lukilu, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

91. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MK359329 (Mycobacterium phage Kamryn, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

92. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to JQ911768 (Mycobacterium phage Ava3, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

93. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to NC_004687 (Mycobacterium phage Bxz1, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

94. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to NC_011270 (Mycobacterium phage Spud, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

95. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MN183280 (Mycobacteriophage LolaVinca, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

96. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MK359345 (Mycobacterium phage QBert, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

97. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to GQ303260 (Mycobacterium phage ET08, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

98. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MH744422 (Mycobacterium phage Roots515, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

99. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MK359321 (Mycobacterium phage Phusco, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

100. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MK359362 (Mycobacterium phage Atlantean, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

101. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to EU826469 (Mycobacterium phage ScottMcG, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

102. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MK310143 (Mycobacterium phage Dietrick, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

103. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MK450429 (Mycobacterium phage Bipolarisk, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

104. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MH051266 (Mycobacterium phage MikeLiesIn, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

105. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to NC_029044 (Mycobacterium phage Breeniome, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

106. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MH669008 (Mycobacterium phage Megamind, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

107. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MK878897 (Mycobacterium phage Blackbrain, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

108. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MK450434 (Mycobacterium phage DrPhinkDaddy, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

109. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MK359359 (Mycobacterium phage Colt, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

110. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MF919527 (Mycobacterium phage Phox, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

111. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MT818416 (Mycobacterium phage BackyardAgain, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

112. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MK359330 (Mycobacterium phage Iota, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

113. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to KT365398 (Mycobacterium phage DTDevon, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

114. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to KX369583 (Mycobacterium phage Littleton, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

115. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MF919494 (Mycobacterium phage BeanWater, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

116. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to NC_028869 (Mycobacterium phage HyRo, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

117. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to KT365400 (Mycobacterium phage ErnieJ, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

118. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to KC691257 (Mycobacterium phage Astraea, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

119. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MG872839 (Mycobacterium phage LifeSavor, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

120. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to KC748968 (Mycobacterium phage Gizmo, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

121. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to KC748970 (Mycobacterium phage ArcherS7, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

122. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MK359353 (Mycobacterium phage BadAgartude, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

123. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MH697590 (Mycobacterium phage Phlegm, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

124. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MK359317 (Mycobacterium phage FrayBell, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

125. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MT553335 (Mycobacterium phage Ronan, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

126. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MN428066 (Mycobacterium phage JPickles, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

127. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MK359305 (Mycobacterium phage Teardrop, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

128. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to DQ398053 (Mycobacteriophage Catera, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

129. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MF919513 (Mycobacterium phage Koguma, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

130. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to JN699626 (Mycobacterium phage MoMoMixon, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

131. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to NC_028986 (Mycobacterium phage Alice, complete sequence) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

132. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MK450424 (Mycobacterium phage Melpomini, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

133. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to JN204348 (Mycobacterium phage Sebata, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

134. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MN183285 (Mycobacterium phage YoungMoneyMata, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

135. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MK450423 (Mycobacterium phage Stubby, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

136. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MF919493 (Mycobacterium phage Audrick, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

137. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to NC_008207 (Mycobacterium phage Catera, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

138. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to JN624850 (Mycobacterium phage Pleione, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

139. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to KX752698 (Mycobacterium phage Tonenili, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

140. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MK359326 (Mycobacterium phage Pivoine, complete genome) position: , mismatch: 3, identity: 0.88

tcggcgatccggcggtacgcggtcg	CRISPR spacer
tcggccatccggcggaacgcggtct	Protospacer
***** ********* ******** 

141. spacer 19.2|4409027|27|NC_018524|CRISPRCasFinder matches to NZ_CP007129 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.889

ccaccgcgccgagcgcgaacgggagcg	CRISPR spacer
ccgccgcgccgagcacgaacgggagca	Protospacer
**.***********.***********.

142. spacer 11.3|2251146|32|NC_018524|PILER-CR,CRT matches to NZ_CP017076 (Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence) position: , mismatch: 4, identity: 0.875

-cgcggcggcgcctgcgcgacctgctcaacgag	CRISPR spacer
tcgaggc-gcgcgtgagcgacctgctcaacgag	Protospacer
 ** *** **** ** *****************

143. spacer 15.7|2270703|32|NC_018524|CRISPRCasFinder matches to NC_015383 (Burkholderia gladioli BSR3 plasmid bgla_4p, complete sequence) position: , mismatch: 4, identity: 0.875

-aaggacgtgcgacgtgcgaagcacgctgttgt	CRISPR spacer
caagcacg-gcgacgtgcgcagcacgctgttgg	Protospacer
 *** *** ********** ************ 

144. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to NZ_CP023440 (Thauera sp. K11 plasmid pTX1, complete sequence) position: , mismatch: 4, identity: 0.84

tcggcgatccggcggtacgcggtcg	CRISPR spacer
caggcgatccggcagtacacggtcg	Protospacer
. ***********.****.******

145. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to NZ_CP023000 (Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-B, complete sequence) position: , mismatch: 4, identity: 0.84

tcggcgatccggcggtacgcggtcg	CRISPR spacer
ggggagatccggcggttcgcggtcg	Protospacer
  ** *********** ********

146. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to NZ_CP032324 (Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence) position: , mismatch: 4, identity: 0.84

tcggcgatccggcggtacgcggtcg	CRISPR spacer
ccggcgatgcggcggtacgtggtca	Protospacer
.******* **********.****.

147. spacer 15.13|2271069|25|NC_018524|CRISPRCasFinder matches to MT657336 (Microbacterium phage ClearAsMud, complete genome) position: , mismatch: 4, identity: 0.84

tcggcgatccggcggtacgcggtcg	CRISPR spacer
gcggcgagcccgcggtacgcggtca	Protospacer
 ****** ** *************.

148. spacer 15.26|2271065|29|NC_018524|CRT matches to NZ_CP023440 (Thauera sp. K11 plasmid pTX1, complete sequence) position: , mismatch: 4, identity: 0.862

accgtc-ggcgatccggcggtacgcggtcg	CRISPR spacer
-ccgccaggcgatccggcagtacacggtcg	Protospacer
 ***.* ***********.****.******

149. spacer 18.2|2357908|28|NC_018524|CRISPRCasFinder matches to LC473083 (Cutibacterium acnes TP-CU389 plasmid pTZC1 DNA, complete sequence) position: , mismatch: 4, identity: 0.857

cgccgggccgcccggggccggctccgcg	CRISPR spacer
ccacgggccggccggggccggccccgcg	Protospacer
*  ******* ***********.*****

150. spacer 19.2|4409027|27|NC_018524|CRISPRCasFinder matches to NZ_CP007129 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

ccaccgcgccgagcgcgaacgggagcg	CRISPR spacer
ccaccgcgccgagcgcgtactggtccg	Protospacer
***************** ** **  **

151. spacer 19.2|4409027|27|NC_018524|CRISPRCasFinder matches to NZ_CP032322 (Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence) position: , mismatch: 4, identity: 0.852

ccaccgcgccgagcgcgaacgggagcg	CRISPR spacer
acgccgcgccgagcgcgagcgcgagcg	Protospacer
 *.***************.** *****

152. spacer 19.2|4409027|27|NC_018524|CRISPRCasFinder matches to NZ_CP020399 (Burkholderia multivorans strain FDAARGOS_246 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.852

ccaccgcgccgagcgcgaacgggagcg	CRISPR spacer
cgagcgcggcgagcgcgaacggcagcg	Protospacer
* * **** ************* ****

153. spacer 19.2|4409027|27|NC_018524|CRISPRCasFinder matches to NZ_CP007794 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence) position: , mismatch: 4, identity: 0.852

ccaccgcgccgagcgcgaacgggagcg	CRISPR spacer
acgccgcgccgagcgcgagcgcgagcg	Protospacer
 *.***************.** *****

154. spacer 19.2|4409027|27|NC_018524|CRISPRCasFinder matches to NZ_CP012916 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence) position: , mismatch: 4, identity: 0.852

ccaccgcgccgagcgcgaacgggagcg	CRISPR spacer
gcgccgcgccgagcgcgagcgcgagcg	Protospacer
 *.***************.** *****

155. spacer 19.2|4409027|27|NC_018524|CRISPRCasFinder matches to NZ_CP022367 (Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence) position: , mismatch: 4, identity: 0.852

ccaccgcgccgagcgcgaacgggagcg	CRISPR spacer
acgccgcgccgagcgcgagcgcgagcg	Protospacer
 *.***************.** *****

156. spacer 19.2|4409027|27|NC_018524|CRISPRCasFinder matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.852

ccaccgcgccgagcgcgaacgggagcg	CRISPR spacer
ccaccgcgccgagcgcgatcgtgatca	Protospacer
****************** ** ** *.

157. spacer 19.2|4409027|27|NC_018524|CRISPRCasFinder matches to NZ_CP032341 (Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence) position: , mismatch: 4, identity: 0.852

ccaccgcgccgagcgcgaacgggagcg	CRISPR spacer
gcgccgcgccgagcgcgagcgcgagcg	Protospacer
 *.***************.** *****

158. spacer 19.2|4409027|27|NC_018524|CRISPRCasFinder matches to NZ_CP032346 (Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence) position: , mismatch: 4, identity: 0.852

ccaccgcgccgagcgcgaacgggagcg	CRISPR spacer
acgccgcgccgagcgcgagcgcgagcg	Protospacer
 *.***************.** *****

159. spacer 34.6|5116779|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP026518 (Deinococcus sp. NW-56 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.875

ggaggcgctgctggaggccccggcagtctggg-	CRISPR spacer
ggaggcgctgctggaggacccggc-ctctgcgc	Protospacer
***************** ******  **** * 

160. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP019313 (Tateyamaria omphalii strain DOK1-4 plasmid pDOK1-4-1, complete sequence) position: , mismatch: 5, identity: 0.844

gtgccgctggccatctccatcgtcggctccta--	CRISPR spacer
gtgccgctggccatcttcctcgtc--ctcctgct	Protospacer
****************.* *****  *****.  

161. spacer 2.10|313401|30|NC_018524|PILER-CR matches to NZ_CP045548 (Streptomyces sp. SYP-A7193 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

acaccaccccggcctggccacggccggcgt-	CRISPR spacer
gcaccaccccggactcgccacggcc-ccgtg	Protospacer
.*********** ** *********  *** 

162. spacer 2.10|313401|30|NC_018524|PILER-CR matches to NZ_CP053445 (Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eA, complete sequence) position: , mismatch: 5, identity: 0.833

acacca-ccccggcctggccacggccggcgt	CRISPR spacer
-cgccagccctggcctggccacggcccgcgg	Protospacer
 *.*** ***.*************** *** 

163. spacer 2.10|313401|30|NC_018524|PILER-CR matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 5, identity: 0.833

acaccacc-ccggcctggccacggccggcgt	CRISPR spacer
-gaccatcatcgggctggccacggccggcgt	Protospacer
  ****.* .*** *****************

164. spacer 2.10|313401|30|NC_018524|PILER-CR matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 5, identity: 0.833

acaccacc-ccggcctggccacggccggcgt	CRISPR spacer
-gaccatcatcgggctggccacggccggcgt	Protospacer
  ****.* .*** *****************

165. spacer 4.4|321553|32|NC_018524|CRISPRCasFinder,CRT matches to NC_009339 (Mycolicibacterium gilvum PYR-GCK plasmid pMFLV01, complete sequence) position: , mismatch: 5, identity: 0.844

tgggcccggtcctgagcgtaggccgctcgggt	CRISPR spacer
tgtgcccgctcctgagcgtaggccgccccgtt	Protospacer
** ***** *****************.* * *

166. spacer 5.1|326532|32|NC_018524|CRISPRCasFinder matches to NZ_KY349138 (Mycolicibacterium sp. CBMA 213 plasmid pCBMA213_2, complete sequence) position: , mismatch: 5, identity: 0.844

ggcgtcctccagcacgttcatgtaggcggcga	CRISPR spacer
gtagtgttccagcacgttcatgtcggcggcga	Protospacer
*  ** .**************** ********

167. spacer 11.4|2251207|32|NC_018524|PILER-CR,CRT matches to NC_016623 (Azospirillum lipoferum 4B plasmid AZO_p3, complete sequence) position: , mismatch: 5, identity: 0.844

gccacga-tcgaccggtgcgcctcggtctctcg	CRISPR spacer
-ccacaacccgaccggtgcgccgctgtctctcg	Protospacer
 ****.* .************* * ********

168. spacer 15.3|2270459|32|NC_018524|CRISPRCasFinder matches to NZ_CP031953 (Phaeobacter inhibens strain 2.10 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.844

gagcacagcgacggcaccgccaacggctggtg-	CRISPR spacer
aacgacaacgacggcaccgccaacggc-ggtga	Protospacer
.*  ***.******************* **** 

169. spacer 15.3|2270459|32|NC_018524|CRISPRCasFinder matches to NC_018421 (Phaeobacter inhibens 2.10 plasmid pPGA2_239, complete sequence) position: , mismatch: 5, identity: 0.844

gagcacagcgacggcaccgccaacggctggtg-	CRISPR spacer
aacgacaacgacggcaccgccaacggc-ggtga	Protospacer
.*  ***.******************* **** 

170. spacer 15.7|2270703|32|NC_018524|CRISPRCasFinder matches to NZ_CP022209 (Burkholderia gladioli pv. gladioli strain FDAARGOS_188 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.844

-aaggacgtgcgacgtgcgaagcacgctgttgt	CRISPR spacer
caagcacg-gcgacgtgcgcagcacgctgctgg	Protospacer
 *** *** ********** *********.** 

171. spacer 15.7|2270703|32|NC_018524|CRISPRCasFinder matches to NZ_CP009321 (Burkholderia gladioli strain ATCC 10248 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.844

-aaggacgtgcgacgtgcgaagcacgctgttgt	CRISPR spacer
caagcacg-gcgacgtgcgcagcacgctgctgg	Protospacer
 *** *** ********** *********.** 

172. spacer 15.7|2270703|32|NC_018524|CRISPRCasFinder matches to NZ_CP022007 (Burkholderia gladioli pv. gladioli strain KACC 11889 plasmid pls1, complete sequence) position: , mismatch: 5, identity: 0.844

-aaggacgtgcgacgtgcgaagcacgctgttgt	CRISPR spacer
caagcacg-gcgacgtgcgcagcacgctgctgg	Protospacer
 *** *** ********** *********.** 

173. spacer 15.26|2271065|29|NC_018524|CRT matches to NZ_CP023408 (Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence) position: , mismatch: 5, identity: 0.828

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
gcggtcggcgagccggcggtaggcggtct	Protospacer
.* ******** ********* ****** 

174. spacer 15.26|2271065|29|NC_018524|CRT matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.828

accgtcggcgatccggcggtacgcggtcg-	CRISPR spacer
gccgtcggcgagccggcggtgcgc-atcgc	Protospacer
.********** ********.*** .*** 

175. spacer 18.2|2357908|28|NC_018524|CRISPRCasFinder matches to NZ_CP045548 (Streptomyces sp. SYP-A7193 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

cgccgggccgcccggggccggctccgcg	CRISPR spacer
ttccgcgccgcccggggccggctcgccg	Protospacer
. *** ******************  **

176. spacer 18.2|2357908|28|NC_018524|CRISPRCasFinder matches to NC_023286 (Streptomyces sp. F12 plasmid pFRL6, complete sequence) position: , mismatch: 5, identity: 0.821

cgccgggccgcccggggccggctccgcg-	CRISPR spacer
ccccgggccgcccggcgccggct-ggtgt	Protospacer
* ************* *******  *.* 

177. spacer 18.2|2357908|28|NC_018524|CRISPRCasFinder matches to NZ_CP012477 (Arthrobacter sp. ERGS1:01 isolate water plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.821

cgccgggccgcccggggccggctccgcg	CRISPR spacer
gggcggcccgcccggggcaggctccgtg	Protospacer
 * *** *********** *******.*

178. spacer 19.2|4409027|27|NC_018524|CRISPRCasFinder matches to KT887559 (Pseudomonas phage phi3, complete genome) position: , mismatch: 5, identity: 0.815

ccaccgcgccgagcgcgaacgggagcg	CRISPR spacer
agcccgcgccgagcgcggccgggagcg	Protospacer
   **************. ********

179. spacer 19.2|4409027|27|NC_018524|CRISPRCasFinder matches to NZ_AP017656 (Sphingobium cloacae strain JCM 10874 plasmid pSCLO_2, complete sequence) position: , mismatch: 5, identity: 0.815

ccaccgcgccgagcgcgaacgggagcg	CRISPR spacer
tcacctcgtcgagcgcgaacgggatca	Protospacer
.**** **.*************** *.

180. spacer 19.2|4409027|27|NC_018524|CRISPRCasFinder matches to NZ_CP007130 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 2, complete sequence) position: , mismatch: 5, identity: 0.815

ccaccgcgccgagcgcgaacgggagcg	CRISPR spacer
ccaccgcgccgagctcgaacgcgctca	Protospacer
************** ****** *  *.

181. spacer 19.2|4409027|27|NC_018524|CRISPRCasFinder matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 5, identity: 0.815

ccaccgcgccgagcgcgaacgggagcg	CRISPR spacer
acgccgcgccgagcgcgaacgtcagca	Protospacer
 *.******************  ***.

182. spacer 19.2|4409027|27|NC_018524|CRISPRCasFinder matches to NZ_AP014579 (Burkholderia sp. RPE67 plasmid p1, complete sequence) position: , mismatch: 5, identity: 0.815

ccaccgcgccgagcgcgaacgggagcg	CRISPR spacer
acgacgcgccgagcgcgaacttgagcg	Protospacer
 *. ****************  *****

183. spacer 19.2|4409027|27|NC_018524|CRISPRCasFinder matches to NC_016626 (Burkholderia sp. YI23 plasmid byi_1p, complete sequence) position: , mismatch: 5, identity: 0.815

ccaccgcgccgagcgcgaacgggagcg	CRISPR spacer
acgacgcgccgagcgcgaacttgagcg	Protospacer
 *. ****************  *****

184. spacer 19.2|4409027|27|NC_018524|CRISPRCasFinder matches to NZ_CP043961 (Streptomyces tendae strain 139 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

ccaccgcgccgagcgcgaacgggagcg	CRISPR spacer
agagcgggccgaccgcgaacgggagcg	Protospacer
  * ** ***** **************

185. spacer 19.2|4409027|27|NC_018524|CRISPRCasFinder matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 5, identity: 0.815

ccaccgcgccgagcgcgaacgggagcg	CRISPR spacer
acgccgcgccgagcgcgaacgtcagca	Protospacer
 *.******************  ***.

186. spacer 19.2|4409027|27|NC_018524|CRISPRCasFinder matches to NC_010514 (Methylobacterium radiotolerans JCM 2831 plasmid pMRAD03, complete sequence) position: , mismatch: 5, identity: 0.815

ccaccg-cgccgagcgcgaacgggagcg	CRISPR spacer
-gatggccgccgagcgcgatcgggagcg	Protospacer
  *. * ************ ********

187. spacer 19.2|4409027|27|NC_018524|CRISPRCasFinder matches to NC_008697 (Nocardioides sp. JS614 plasmid pNOCA01, complete sequence) position: , mismatch: 5, identity: 0.815

ccaccgcgccgagcgcgaacgggagcg	CRISPR spacer
ccaccgcgccgagcgcgagcgagtact	Protospacer
******************.**.* .* 

188. spacer 26.20|4598877|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP036456 (Streptomonospora sp. M2 plasmid phiM2, complete sequence) position: , mismatch: 5, identity: 0.844

caccagacgccgtgctcgtccggctggccgaa	CRISPR spacer
ccgtagacgccgttctcgtcgggctggccgaa	Protospacer
*  .********* ****** ***********

189. spacer 26.20|4598877|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP042998 (Aquisphaera giovannonii strain OJF2 plasmid pOJF2_1, complete sequence) position: , mismatch: 5, identity: 0.844

-caccagacgccgtgctcgtccggctggccgaa	CRISPR spacer
gcacca-tcgccgtgctcggcccgctggccgat	Protospacer
 *****  *********** ** ********* 

190. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP030864 (Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.844

-cctcggggccggcggtgatcgccccggcccgc	CRISPR spacer
gcctcgccg-cggcggtgctcgccacggcccgc	Protospacer
 *****  * ******** ***** ********

191. spacer 32.28|4653354|32|NC_018524|CRISPRCasFinder matches to NC_018853 (Streptomyce phage TG1, complete genome) position: , mismatch: 5, identity: 0.844

aacgcggcacgccggtacaccaaggctcgcgc	CRISPR spacer
ggggcggcacgccggtacacgaaggttcgcgc	Protospacer
.. ***************** ****.******

192. spacer 32.28|4653354|32|NC_018524|CRISPRCasFinder matches to JX182372 (Streptomyces virus TG1, complete genome) position: , mismatch: 5, identity: 0.844

aacgcggcacgccggtacaccaaggctcgcgc	CRISPR spacer
ggggcggcacgccggtacacgaaggttcgcgc	Protospacer
.. ***************** ****.******

193. spacer 34.6|5116779|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 5, identity: 0.844

ggaggcgctgctggaggccccggc-agtctggg	CRISPR spacer
ggaggcgctgctggaggcgcaggcttgtctgc-	Protospacer
****************** * ***  *****  

194. spacer 1.7|311992|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP020900 (Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5d, complete sequence) position: , mismatch: 6, identity: 0.812

ttcttcatccagggggcgcggga-----gacgatctc	CRISPR spacer
ttcttcatccagggggcgcgcgagaatggacg-----	Protospacer
******************** **     ****     

195. spacer 1.7|311992|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013589 (Rhizobium phaseoli strain N161 plasmid pRphaN161d, complete sequence) position: , mismatch: 6, identity: 0.812

ttcttcatccagggggcgcggga-----gacgatctc	CRISPR spacer
ttcttcatccagggggcgcgcgagaatggacg-----	Protospacer
******************** **     ****     

196. spacer 1.7|311992|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013562 (Rhizobium phaseoli strain N841 plasmid pRphaN841e, complete sequence) position: , mismatch: 6, identity: 0.812

ttcttcatccagggggcgcggga-----gacgatctc	CRISPR spacer
ttcttcatccagggggcgcgcgagaatggacg-----	Protospacer
******************** **     ****     

197. spacer 1.7|311992|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013541 (Rhizobium phaseoli strain R630 plasmid pRphaR630d, complete sequence) position: , mismatch: 6, identity: 0.812

ttcttcatccagggggcgcggga-----gacgatctc	CRISPR spacer
ttcttcatccagggggcgcgcgagaatggacg-----	Protospacer
******************** **     ****     

198. spacer 1.7|311992|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_010997 (Rhizobium etli CIAT 652 plasmid pC, complete sequence) position: , mismatch: 6, identity: 0.812

ttcttcatccagggggcgcggga-----gacgatctc	CRISPR spacer
ttcttcatccagggggcgcgcgagaatggacg-----	Protospacer
******************** **     ****     

199. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_013858 (Azospirillum sp. B510 plasmid pAB510d, complete sequence) position: , mismatch: 6, identity: 0.812

tcctccggcgcctcgtcggcgacgtcggcgac	CRISPR spacer
tccgcctgcgcctcgtcggcgacgtcgagcgc	Protospacer
*** ** ********************.  .*

200. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP020331 (Martelella mediterranea DSM 17316 strain MACL11 plasmid pMM593, complete sequence) position: , mismatch: 6, identity: 0.812

tcctccggc--gcctcgtcggcgacgtcggcgac	CRISPR spacer
--atgcggcaagcctcgtcggcgacgccgccgac	Protospacer
   * ****  ***************.** ****

201. spacer 2.4|313399|32|NC_018524|CRISPRCasFinder matches to NZ_CP045548 (Streptomyces sp. SYP-A7193 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.812

cacaccaccccggcctggccacgg-ccggcgtc	CRISPR spacer
cgcaccaccccggactcgccacggccccgtgt-	Protospacer
*.*********** ** ******* ** *.** 

202. spacer 2.4|313399|32|NC_018524|CRISPRCasFinder matches to NZ_CP012477 (Arthrobacter sp. ERGS1:01 isolate water plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.812

cacaccac-cccggcctggccacggccggcgtc	CRISPR spacer
-acacagcgaccgccctggccaaggccggcgtc	Protospacer
 **** .*  *** ******** **********

203. spacer 2.8|313399|33|NC_018524|CRT matches to NZ_CP045548 (Streptomyces sp. SYP-A7193 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.818

cacaccaccccggcctggccacgg-ccggcgtcg	CRISPR spacer
cgcaccaccccggactcgccacggccccgtgtc-	Protospacer
*.*********** ** ******* ** *.*** 

204. spacer 2.10|313401|30|NC_018524|PILER-CR matches to NZ_AP012556 (Mycobacterium avium subsp. hominissuis TH135 plasmid pMAH135, complete sequence) position: , mismatch: 6, identity: 0.8

acaccaccccggcctggccacggccggcgt	CRISPR spacer
ccaccgccccggcctgggcacggccgctgc	Protospacer
 ****.*********** ******** .*.

205. spacer 3.2|318578|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP045303 (Azotobacter salinestris strain KACC 13899 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.812

tcgggcggcggtgagcagat-gcccaaggagtt	CRISPR spacer
ccgggcggcggtgagcagctggccccacgaga-	Protospacer
.***************** * **** * ***  

206. spacer 3.2|318578|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP010421 (Azotobacter chroococcum NCIMB 8003 plasmid pAcX50f, complete sequence) position: , mismatch: 6, identity: 0.812

tcgggcggcggtgagcagat-gcccaaggagtt	CRISPR spacer
ccgggcggcggtgagcagctggccccacgaga-	Protospacer
.***************** * **** * ***  

207. spacer 3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP046575 (Rhodococcus sp. WAY2 plasmid pRWAY03, complete sequence) position: , mismatch: 6, identity: 0.812

atgaccgcccatttcgccgaccggctcgccgc	CRISPR spacer
gtcaccgcccactgcgccgaccggctcgacac	Protospacer
.* ********.* ************** *.*

208. spacer 3.8|318944|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013104 (Paraburkholderia caribensis strain MWAP64 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.812

ggctgtggagcgcgcggcggctgcgcggggtg	CRISPR spacer
ggcgagcgagcgcgcggcggctgcgagggttg	Protospacer
*** .  ****************** *** **

209. spacer 3.8|318944|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

ggctgtggagcgcgcggcggctgcgcggggtg	CRISPR spacer
ggcgagcgagcgcgcggcggctgcgagggttg	Protospacer
*** .  ****************** *** **

210. spacer 3.12|319187|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NC_019387 (Thermus oshimai JL-2 plasmid pTHEOS01, complete sequence) position: , mismatch: 6, identity: 0.812

tggggtgg-ccaccgggaccccctcctggccgt	CRISPR spacer
-gagctggaccaccgggtcccccccctggccgg	Protospacer
 *.* *** ******** *****.******** 

211. spacer 4.9|321858|32|NC_018524|CRISPRCasFinder,CRT matches to JF974300 (Synechococcus phage S-CBP42, *** SEQUENCING IN PROGRESS ***, 8 unordered pieces) position: , mismatch: 6, identity: 0.812

ggggtgcggccgggggtgccggtgtcgggggt	CRISPR spacer
gtgccggtgccgggggtgccggtgccgggggt	Protospacer
* * .*  ****************.*******

212. spacer 4.9|321858|32|NC_018524|CRISPRCasFinder,CRT matches to KC310805 (Synechococcus phage S-CBP42, complete genome) position: , mismatch: 6, identity: 0.812

ggggtgcggccgggggtgccggtgtcgggggt	CRISPR spacer
gtgccggtgccgggggtgccggtgccgggggt	Protospacer
* * .*  ****************.*******

213. spacer 4.21|322004|28|NC_018524|PILER-CR matches to NZ_CP030828 (Neorhizobium sp. NCHU2750 plasmid pNCHU2750a, complete sequence) position: , mismatch: 6, identity: 0.786

tcggcgattttccgtggctggatcaagc	CRISPR spacer
tcggcgatgttccgtggctcgatttatg	Protospacer
******** ********** ***. *  

214. spacer 5.5|326776|32|NC_018524|CRISPRCasFinder matches to NC_012987 (Methylorubrum extorquens AM1 plasmid p1METDI, complete sequence) position: , mismatch: 6, identity: 0.812

gacaagctg-ttcaacgcgcgcgaactcgccgc	CRISPR spacer
-acgatccgcttcgacgcgcgcgacctcgccgc	Protospacer
 **.* *.* ***.********** ********

215. spacer 5.7|326532|33|NC_018524|CRT matches to NZ_KY349138 (Mycolicibacterium sp. CBMA 213 plasmid pCBMA213_2, complete sequence) position: , mismatch: 6, identity: 0.818

ggcgtcctccagcacgttcatgtaggcggcgag	CRISPR spacer
gtagtgttccagcacgttcatgtcggcggcgaa	Protospacer
*  ** .**************** ********.

216. spacer 5.11|326776|33|NC_018524|CRT matches to NC_012987 (Methylorubrum extorquens AM1 plasmid p1METDI, complete sequence) position: , mismatch: 6, identity: 0.818

gacaagctg-ttcaacgcgcgcgaactcgccgcc	CRISPR spacer
-acgatccgcttcgacgcgcgcgacctcgccgcc	Protospacer
 **.* *.* ***.********** *********

217. spacer 5.16|326777|32|NC_018524|PILER-CR matches to NC_012987 (Methylorubrum extorquens AM1 plasmid p1METDI, complete sequence) position: , mismatch: 6, identity: 0.812

gacaagctg-ttcaacgcgcgcgaactcgccgc	CRISPR spacer
-acgatccgcttcgacgcgcgcgacctcgccgc	Protospacer
 **.* *.* ***.********** ********

218. spacer 9.8|1460493|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP007129 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.812

cggtggtagtcgaccacctgcgc-cgtagacgc	CRISPR spacer
cggtggtggtcgacgacctgcgcaccgaggcg-	Protospacer
*******.****** ******** *  **.** 

219. spacer 9.18|1460494|32|NC_018524|PILER-CR matches to NZ_CP007129 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.812

cggtggtagtcgaccacctgcgc-cgtagacgc	CRISPR spacer
cggtggtggtcgacgacctgcgcaccgaggcg-	Protospacer
*******.****** ******** *  **.** 

220. spacer 11.3|2251146|32|NC_018524|PILER-CR,CRT matches to NZ_CP032326 (Azospirillum brasilense strain MTCC4035 plasmid p5, complete sequence) position: , mismatch: 6, identity: 0.812

cgcg-gcggcgcctgcgcgacctgctcaacgag	CRISPR spacer
-gcgagcggagcctgcgcgacctgctcaccacc	Protospacer
 *** **** ****************** *.  

221. spacer 11.3|2251146|32|NC_018524|PILER-CR,CRT matches to NZ_CP007796 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p3, complete sequence) position: , mismatch: 6, identity: 0.812

cgcg-gcggcgcctgcgcgacctgctcaacgag	CRISPR spacer
-gcgagcggagcctgcgcgacctgctcaccacc	Protospacer
 *** **** ****************** *.  

222. spacer 11.3|2251146|32|NC_018524|PILER-CR,CRT matches to NC_010510 (Methylobacterium radiotolerans JCM 2831 plasmid pMRAD01, complete sequence) position: , mismatch: 6, identity: 0.812

cgcggcggcgcctgcgcgacctgctcaacgag	CRISPR spacer
cccgctcgcgccagcgcgacctgctcatcgag	Protospacer
* ** . ***** ************** ****

223. spacer 11.3|2251146|32|NC_018524|PILER-CR,CRT matches to NZ_CP032342 (Azospirillum brasilense strain MTCC4038 plasmid p3, complete sequence) position: , mismatch: 6, identity: 0.812

cgcg-gcggcgcctgcgcgacctgctcaacgag	CRISPR spacer
-gcgagcggagcctgcgcgacctgctcaccacc	Protospacer
 *** **** ****************** *.  

224. spacer 11.3|2251146|32|NC_018524|PILER-CR,CRT matches to NZ_CP033321 (Azospirillum brasilense strain Cd plasmid p3, complete sequence) position: , mismatch: 6, identity: 0.812

cgcg-gcggcgcctgcgcgacctgctcaacgag	CRISPR spacer
-gcgagcggagcctgcgcgacctgctcaccacc	Protospacer
 *** **** ****************** *.  

225. spacer 11.3|2251146|32|NC_018524|PILER-CR,CRT matches to NZ_CP033315 (Azospirillum brasilense strain Sp 7 plasmid p3, complete sequence) position: , mismatch: 6, identity: 0.812

cgcg-gcggcgcctgcgcgacctgctcaacgag	CRISPR spacer
-gcgagcggagcctgcgcgacctgctcaccacc	Protospacer
 *** **** ****************** *.  

226. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP020898 (Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRetBra5b, complete sequence) position: , mismatch: 6, identity: 0.812

acgtggcggatggcgtcgcgggcc-gcaccgag	CRISPR spacer
gcgtggcggatgtcgtcgccggcctgcagcgc-	Protospacer
.*********** ****** **** *** **  

227. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP020950 (Rhizobium sp. CIAT894 plasmid pRheCIAT894c, complete sequence) position: , mismatch: 6, identity: 0.812

acgtggcggatggcgtcgcgggcc-gcaccgag	CRISPR spacer
gcgtggcggatgtcgtcgccggcctgcagcgc-	Protospacer
.*********** ****** **** *** **  

228. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP013587 (Rhizobium phaseoli strain N161 plasmid pRphaN161b, complete sequence) position: , mismatch: 6, identity: 0.812

acgtggcggatggcgtcgcgggcc-gcaccgag	CRISPR spacer
gcgtggcggatgtcgtcgccggcctgcagcgc-	Protospacer
.*********** ****** **** *** **  

229. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP013598 (Rhizobium sp. N741 plasmid pRspN741c, complete sequence) position: , mismatch: 6, identity: 0.812

acgtggcggatggcgtcgcgggcc-gcaccgag	CRISPR spacer
gcgtggcggatgtcgtcgccggcctgcagcgc-	Protospacer
.*********** ****** **** *** **  

230. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP013544 (Rhizobium phaseoli strain R620 plasmid pRphaR620b, complete sequence) position: , mismatch: 6, identity: 0.812

acgtggcggatggcgtcgcgggcc-gcaccgag	CRISPR spacer
gcgtggcggatgtcgtcgccggcctgcagcgc-	Protospacer
.*********** ****** **** *** **  

231. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP013502 (Rhizobium esperanzae strain N561 plasmid pRspN561b, complete sequence) position: , mismatch: 6, identity: 0.812

acgtggcggatggcgtcgcgggcc-gcaccgag	CRISPR spacer
gcgtggcggatgtcgtcgccggcctgcagcgc-	Protospacer
.*********** ****** **** *** **  

232. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP013508 (Rhizobium sp. N1341 plasmid pRspN1341c, complete sequence) position: , mismatch: 6, identity: 0.812

acgtggcggatggcgtcgcgggcc-gcaccgag	CRISPR spacer
gcgtggcggatgtcgtcgccggcctgcagcgc-	Protospacer
.*********** ****** **** *** **  

233. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP013519 (Rhizobium sp. N113 plasmid pRspN113b, complete sequence) position: , mismatch: 6, identity: 0.812

acgtggcggatggcgtcgcgggcc-gcaccgag	CRISPR spacer
gcgtggcggatgtcgtcgccggcctgcagcgc-	Protospacer
.*********** ****** **** *** **  

234. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP021125 (Rhizobium sp. Kim5 plasmid pRetKim5a, complete sequence) position: , mismatch: 6, identity: 0.812

acgtggcggatggcgtcgcgggcc-gcaccgag	CRISPR spacer
gcgtggcggatgtcgtcgccggcctgcagcgc-	Protospacer
.*********** ****** **** *** **  

235. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP013492 (Rhizobium sp. N6212 plasmid pRspN6212b, complete sequence) position: , mismatch: 6, identity: 0.812

acgtggcggatggcgtcgcgggcc-gcaccgag	CRISPR spacer
gcgtggcggatgtcgtcgccggcctgcagcgc-	Protospacer
.*********** ****** **** *** **  

236. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP013497 (Rhizobium sp. N621 plasmid pRspN621b, complete sequence) position: , mismatch: 6, identity: 0.812

acgtggcggatggcgtcgcgggcc-gcaccgag	CRISPR spacer
gcgtggcggatgtcgtcgccggcctgcagcgc-	Protospacer
.*********** ****** **** *** **  

237. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP013592 (Rhizobium sp. N871 plasmid pRspN871b, complete sequence) position: , mismatch: 6, identity: 0.812

acgtggcggatggcgtcgcgggcc-gcaccgag	CRISPR spacer
gcgtggcggatgtcgtcgccggcctgcagcgc-	Protospacer
.*********** ****** **** *** **  

238. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NC_010996 (Rhizobium etli CIAT 652 plasmid pB, complete sequence) position: , mismatch: 6, identity: 0.812

acgtggcggatggcgtcgcgggcc-gcaccgag	CRISPR spacer
gcgtggcggatgtcgtcgccggcctgcagcgc-	Protospacer
.*********** ****** **** *** **  

239. spacer 11.8|2251452|32|NC_018524|PILER-CR,CRT matches to NZ_CP012940 (Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

-cagtgtgggcaggagattaccgagatcggcgt	CRISPR spacer
gtattgt-ggcaggagattaccgggatctgcgc	Protospacer
 .* *** ***************.**** ***.

240. spacer 11.8|2251452|32|NC_018524|PILER-CR,CRT matches to NZ_CP012944 (Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

-cagtgtgggcaggagattaccgagatcggcgt	CRISPR spacer
gtattgt-ggcaggagattaccgggatctgcgc	Protospacer
 .* *** ***************.**** ***.

241. spacer 11.8|2251452|32|NC_018524|PILER-CR,CRT matches to NC_017575 (Ralstonia solanacearum Po82 megaplasmid, complete sequence) position: , mismatch: 6, identity: 0.812

-cagtgtgggcaggagattaccgagatcggcgt	CRISPR spacer
gtattgt-ggcaggagattaccgggatctgcgc	Protospacer
 .* *** ***************.**** ***.

242. spacer 11.8|2251452|32|NC_018524|PILER-CR,CRT matches to NZ_CP026308 (Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

-cagtgtgggcaggagattaccgagatcggcgt	CRISPR spacer
gtattgt-ggcaggagattaccgggatctgcgc	Protospacer
 .* *** ***************.**** ***.

243. spacer 11.8|2251452|32|NC_018524|PILER-CR,CRT matches to NZ_CP051295 (Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence) position: , mismatch: 6, identity: 0.812

-cagtgtgggcaggagattaccgagatcggcgt	CRISPR spacer
gtattgt-ggcaggagattaccgggatctgcgc	Protospacer
 .* *** ***************.**** ***.

244. spacer 11.18|2251513|32|NC_018524|CRT matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 6, identity: 0.812

gcgtac-gcgtccatgtcctccacaccaccgcg	CRISPR spacer
-cgtactacgaccatgtcctcgacaccaccgtc	Protospacer
 ***** .** ********** *********. 

245. spacer 11.18|2251513|32|NC_018524|CRT matches to NZ_CP032054 (Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence) position: , mismatch: 6, identity: 0.812

gcgtac-gcgtccatgtcctccacaccaccgcg	CRISPR spacer
-cgtactacgaccatgtcctcgacaccaccgtc	Protospacer
 ***** .** ********** *********. 

246. spacer 11.18|2251513|32|NC_018524|CRT matches to NZ_CP016560 (Streptomyces clavuligerus strain F613-1 plasmid pSCL4, complete sequence) position: , mismatch: 6, identity: 0.812

gcgtac-gcgtccatgtcctccacaccaccgcg	CRISPR spacer
-cgtactacgaccatgtcctcgacaccaccgtc	Protospacer
 ***** .** ********** *********. 

247. spacer 14.4|2268443|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to AP014276 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S41-C62, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.812

---gactatggtcccattcaggccgctcgggccac	CRISPR spacer
atgggcta---tcccgctcaggccgctcgggccac	Protospacer
   *.***   ****..******************

248. spacer 15.3|2270459|32|NC_018524|CRISPRCasFinder matches to NZ_CP010612 (Phaeobacter inhibens strain P92 plasmid pP92_b, complete sequence) position: , mismatch: 6, identity: 0.812

gagcacagcgacggcaccgccaacggctggtg-	CRISPR spacer
aacgacaacgacggcaccgccaatggc-ggtga	Protospacer
.*  ***.***************.*** **** 

249. spacer 15.3|2270459|32|NC_018524|CRISPRCasFinder matches to NZ_CP010624 (Phaeobacter inhibens strain P51 plasmid pP51_a, complete sequence) position: , mismatch: 6, identity: 0.812

gagcacagcgacggcaccgccaacggctggtg-	CRISPR spacer
aacgacaacgacggcaccgccaatggc-ggtga	Protospacer
.*  ***.***************.*** **** 

250. spacer 15.3|2270459|32|NC_018524|CRISPRCasFinder matches to NZ_CP010669 (Phaeobacter inhibens strain P57 plasmid pP57_a, complete sequence) position: , mismatch: 6, identity: 0.812

gagcacagcgacggcaccgccaacggctggtg-	CRISPR spacer
aacgacaacgacggcaccgccaatggc-ggtga	Protospacer
.*  ***.***************.*** **** 

251. spacer 15.3|2270459|32|NC_018524|CRISPRCasFinder matches to NZ_CP010600 (Phaeobacter inhibens strain P83 plasmid pP83_a, complete sequence) position: , mismatch: 6, identity: 0.812

gagcacagcgacggcaccgccaacggctggtg-	CRISPR spacer
aacgacaacgacggcaccgccaatggc-ggtga	Protospacer
.*  ***.***************.*** **** 

252. spacer 15.3|2270459|32|NC_018524|CRISPRCasFinder matches to NZ_CP010742 (Phaeobacter inhibens strain P59 plasmid pP59_a, complete sequence) position: , mismatch: 6, identity: 0.812

gagcacagcgacggcaccgccaacggctggtg-	CRISPR spacer
aacgacaacgacggcaccgccaatggc-ggtga	Protospacer
.*  ***.***************.*** **** 

253. spacer 15.3|2270459|32|NC_018524|CRISPRCasFinder matches to NZ_CP010726 (Phaeobacter inhibens strain P88 plasmid pP88_a, complete sequence) position: , mismatch: 6, identity: 0.812

gagcacagcgacggcaccgccaacggctggtg-	CRISPR spacer
aacgacaacgacggcaccgccaatggc-ggtga	Protospacer
.*  ***.***************.*** **** 

254. spacer 15.3|2270459|32|NC_018524|CRISPRCasFinder matches to NZ_CP010651 (Phaeobacter inhibens strain P54 plasmid pP54_a, complete sequence) position: , mismatch: 6, identity: 0.812

gagcacagcgacggcaccgccaacggctggtg-	CRISPR spacer
aacgacaacgacggcaccgccaatggc-ggtga	Protospacer
.*  ***.***************.*** **** 

255. spacer 15.3|2270459|32|NC_018524|CRISPRCasFinder matches to NZ_CP010706 (Phaeobacter inhibens strain P66 plasmid pP66_a, complete sequence) position: , mismatch: 6, identity: 0.812

gagcacagcgacggcaccgccaacggctggtg-	CRISPR spacer
aacgacaacgacggcaccgccaatggc-ggtga	Protospacer
.*  ***.***************.*** **** 

256. spacer 15.3|2270459|32|NC_018524|CRISPRCasFinder matches to NZ_CP010697 (Phaeobacter inhibens strain P24 plasmid pP24_a, complete sequence) position: , mismatch: 6, identity: 0.812

gagcacagcgacggcaccgccaacggctggtg-	CRISPR spacer
aacgacaacgacggcaccgccaatggc-ggtga	Protospacer
.*  ***.***************.*** **** 

257. spacer 15.3|2270459|32|NC_018524|CRISPRCasFinder matches to NZ_CP010746 (Phaeobacter inhibens strain P48 isolate M21-2.3 plasmid pP48_a, complete sequence) position: , mismatch: 6, identity: 0.812

gagcacagcgacggcaccgccaacggctggtg-	CRISPR spacer
aacgacaacgacggcaccgccaatggc-ggtga	Protospacer
.*  ***.***************.*** **** 

258. spacer 15.3|2270459|32|NC_018524|CRISPRCasFinder matches to NZ_CP019308 (Phaeobacter inhibens strain DOK1-1 plasmid pDOK1-1-1, complete sequence) position: , mismatch: 6, identity: 0.812

gagcacagcgacggcaccgccaacggctggtg-	CRISPR spacer
aacgacaacgacggcaccgccaatggc-ggtga	Protospacer
.*  ***.***************.*** **** 

259. spacer 15.3|2270459|32|NC_018524|CRISPRCasFinder matches to NZ_CP010736 (Phaeobacter inhibens strain P72 plasmid pP72_a, complete sequence) position: , mismatch: 6, identity: 0.812

gagcacagcgacggcaccgccaacggctggtg-	CRISPR spacer
aacgacaacgacggcaccgccaatggc-ggtga	Protospacer
.*  ***.***************.*** **** 

260. spacer 15.26|2271065|29|NC_018524|CRT matches to NZ_CP023000 (Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-B, complete sequence) position: , mismatch: 6, identity: 0.793

accgtcggc-----gatccggcggtacgcggtcg	CRISPR spacer
-----cggcggggagatccggcggttcgcggtcg	Protospacer
     ****     *********** ********

261. spacer 18.2|2357908|28|NC_018524|CRISPRCasFinder matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 6, identity: 0.786

cgccgggccgcccggggccggc-tccgcg	CRISPR spacer
ggccgggccgcccgggggcggcggtcgt-	Protospacer
 **************** ****  .**. 

262. spacer 18.2|2357908|28|NC_018524|CRISPRCasFinder matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 6, identity: 0.786

cgccgggccgcccggggccggc-tccgcg	CRISPR spacer
ggccgggccgcccgggggcggcggtcgt-	Protospacer
 **************** ****  .**. 

263. spacer 18.2|2357908|28|NC_018524|CRISPRCasFinder matches to MH673674 (Thermus phage phiMa, complete genome) position: , mismatch: 6, identity: 0.786

cgccgggccgcccggggccggctccgcg	CRISPR spacer
agccgggccgccccgggacggctcctgt	Protospacer
 ************ *** *******   

264. spacer 18.2|2357908|28|NC_018524|CRISPRCasFinder matches to NZ_CP016083 (Streptomyces sp. SAT1 plasmid unnamed3, complete sequence) position: , mismatch: 6, identity: 0.786

cgccgggccgcccggggccggctccgcg	CRISPR spacer
gtccgggccgtccggggccggttcccgg	Protospacer
  ********.**********.***  *

265. spacer 18.2|2357908|28|NC_018524|CRISPRCasFinder matches to NC_023285 (Streptomyces sp. F8 plasmid pFRL5, complete sequence) position: , mismatch: 6, identity: 0.786

cgccgggccgcccggggccggctccgcg	CRISPR spacer
caaggggccgcccggcgccgggtccgca	Protospacer
*.  *********** ***** *****.

266. spacer 18.2|2357908|28|NC_018524|CRISPRCasFinder matches to NC_023284 (Streptomyces sp. F2 plasmid pFRL4, complete sequence) position: , mismatch: 6, identity: 0.786

cgccgggccgcccggggccggctccgcg	CRISPR spacer
cagcgggccgcccggagccgggtccgtt	Protospacer
*. ************.***** ****. 

267. spacer 18.2|2357908|28|NC_018524|CRISPRCasFinder matches to NZ_AP022578 (Mycolicibacterium aubagnense strain JCM 15296 plasmid pJCM15296, complete sequence) position: , mismatch: 6, identity: 0.786

cgccgggccgcccggggccggctccgcg	CRISPR spacer
ggccgggccgcccggagccggcgctccc	Protospacer
 **************.****** *. * 

268. spacer 18.2|2357908|28|NC_018524|CRISPRCasFinder matches to NZ_CP034351 (Streptomyces sp. W1SF4 plasmid p1, complete sequence) position: , mismatch: 6, identity: 0.786

cgccgggccgcccggggccggctccgcg	CRISPR spacer
cgccgggccgccgggggccgggaagtcg	Protospacer
************ ********     **

269. spacer 19.2|4409027|27|NC_018524|CRISPRCasFinder matches to NC_011961 (Thermomicrobium roseum DSM 5159 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.778

ccaccgcgccgagcgcgaacgggagcg	CRISPR spacer
gacgcgcgccgagcgcgaacgggaact	Protospacer
    ********************.* 

270. spacer 19.2|4409027|27|NC_018524|CRISPRCasFinder matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 6, identity: 0.778

ccaccgcgccgagcgcgaacgggagcg	CRISPR spacer
gcaccgcgccgagcgccaacgggtcgc	Protospacer
 *************** ******    

271. spacer 19.2|4409027|27|NC_018524|CRISPRCasFinder matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 6, identity: 0.778

ccaccgcgccgagcgcgaacgggagcg	CRISPR spacer
tcatcgcgccgagcgcgaacgggctga	Protospacer
.**.*******************   .

272. spacer 19.2|4409027|27|NC_018524|CRISPRCasFinder matches to NC_011366 (Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG202, complete sequence) position: , mismatch: 6, identity: 0.778

ccaccgcgccgagcgcgaacgggagcg	CRISPR spacer
acgccgcgccgagcgcgaacgggtaaa	Protospacer
 *.******************** . .

273. spacer 19.2|4409027|27|NC_018524|CRISPRCasFinder matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 6, identity: 0.778

ccaccgcgccgagcgcgaacgggagcg	CRISPR spacer
gcaccgcgccgagcgccaacgggtcgc	Protospacer
 *************** ******    

274. spacer 19.2|4409027|27|NC_018524|CRISPRCasFinder matches to NZ_CP035001 (Rhizobium acidisoli strain FH23 plasmid pRapFH23c, complete sequence) position: , mismatch: 6, identity: 0.778

ccaccgcgccgagcgcgaacgggagcg	CRISPR spacer
acgccgcgccgagcgcgaacgggtaaa	Protospacer
 *.******************** . .

275. spacer 19.2|4409027|27|NC_018524|CRISPRCasFinder matches to NZ_MF600313 (Mycolicibacterium sp. CBMA 213 plasmid pCBMA213_1, complete sequence) position: , mismatch: 6, identity: 0.778

ccaccgcgccgagcgcgaacgggagcg	CRISPR spacer
gcaccgcgccgagcgcgaacgccaata	Protospacer
 ********************  *...

276. spacer 19.2|4409027|27|NC_018524|CRISPRCasFinder matches to NC_003037 (Sinorhizobium meliloti 1021 plasmid pSymA, complete sequence) position: , mismatch: 6, identity: 0.778

ccaccgcgccgagcgcgaacgggagcg	CRISPR spacer
tttccgcgccgtacgcgaacgggagca	Protospacer
.. ******** .*************.

277. spacer 19.2|4409027|27|NC_018524|CRISPRCasFinder matches to NZ_CP019585 (Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymA, complete sequence) position: , mismatch: 6, identity: 0.778

ccaccgcgccgagcgcgaacgggagcg	CRISPR spacer
tttccgcgccgtacgcgaacgggagca	Protospacer
.. ******** .*************.

278. spacer 19.2|4409027|27|NC_018524|CRISPRCasFinder matches to CP006583 (Mesorhizobium huakuii 7653R plasmid pMHb, complete sequence) position: , mismatch: 6, identity: 0.778

ccaccgcgccgagcgcgaacgggagcg	CRISPR spacer
cgacggcgccgagcgcgaacgggctga	Protospacer
* ** ******************   .

279. spacer 19.2|4409027|27|NC_018524|CRISPRCasFinder matches to NC_016626 (Burkholderia sp. YI23 plasmid byi_1p, complete sequence) position: , mismatch: 6, identity: 0.778

ccaccgcgccgagcgcgaacgggagcg	CRISPR spacer
gacccgcgccgagcgcgaccggcagcc	Protospacer
   *************** *** *** 

280. spacer 19.2|4409027|27|NC_018524|CRISPRCasFinder matches to NC_016626 (Burkholderia sp. YI23 plasmid byi_1p, complete sequence) position: , mismatch: 6, identity: 0.778

ccaccgcgccgagcgcgaacgggagcg	CRISPR spacer
ggctcgcgccgagcgcgatcgcgagcg	Protospacer
   .************** ** *****

281. spacer 19.2|4409027|27|NC_018524|CRISPRCasFinder matches to NZ_AP022611 (Mycolicibacterium madagascariense strain JCM 13574 plasmid pJCM13574) position: , mismatch: 6, identity: 0.778

ccaccgcgccgagcgcgaacgggagcg	CRISPR spacer
cagccgcgccgagcgggaacgggacac	Protospacer
* .************ ********   

282. spacer 19.2|4409027|27|NC_018524|CRISPRCasFinder matches to NC_020527 (Sinorhizobium meliloti 2011 plasmid pSymA, complete sequence) position: , mismatch: 6, identity: 0.778

ccaccgcgccgagcgcgaacgggagcg	CRISPR spacer
tttccgcgccgtacgcgaacgggagca	Protospacer
.. ******** .*************.

283. spacer 19.2|4409027|27|NC_018524|CRISPRCasFinder matches to NZ_CP021798 (Sinorhizobium meliloti strain USDA1106 plasmid psymA, complete sequence) position: , mismatch: 6, identity: 0.778

ccaccgcgccgagcgcgaacgggagcg	CRISPR spacer
tttccgcgccgtacgcgaacgggagca	Protospacer
.. ******** .*************.

284. spacer 19.2|4409027|27|NC_018524|CRISPRCasFinder matches to NZ_CP016617 (Microvirga ossetica strain V5/3m plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.778

ccaccgcgccgagcgcgaacgggagcg	CRISPR spacer
atgccgcgccgagcgcgagcgcgagct	Protospacer
 ..***************.** **** 

285. spacer 21.7|4582540|33|NC_018524|PILER-CR matches to NZ_CP029452 (Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence) position: , mismatch: 6, identity: 0.818

tgtcgagt-gccgtggcctcacggtcgtcggcga	CRISPR spacer
-gccggatggccgcggcctcacggtcgtgggcga	Protospacer
 *.**..* ****.************** *****

286. spacer 21.7|4582540|33|NC_018524|PILER-CR matches to NZ_CP023071 (Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence) position: , mismatch: 6, identity: 0.818

tgtcgagt-gccgtggcctcacggtcgtcggcga	CRISPR spacer
-gccggatggccgcggcctcacggtcgtgggcga	Protospacer
 *.**..* ****.************** *****

287. spacer 21.12|4582845|33|NC_018524|PILER-CR matches to MT952845 (Microbacterium phage GardenState, complete genome) position: , mismatch: 6, identity: 0.818

ggaacgacggccgggtcgtcgtggtcctggccg	CRISPR spacer
ggggcgggggccgggtcgtcgtcgtccgggccg	Protospacer
**..**. ************** **** *****

288. spacer 21.12|4582845|33|NC_018524|PILER-CR matches to MK880124 (Microbacterium phage IAmGroot, complete genome) position: , mismatch: 6, identity: 0.818

ggaacgacggccgggtcgtcgtggtcctggccg	CRISPR spacer
ggggcgggggccgggtcgtcgtcgtccgggccg	Protospacer
**..**. ************** **** *****

289. spacer 21.19|4582480|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_LR134465 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 23, complete sequence) position: , mismatch: 6, identity: 0.812

aacttctcc---agctccttgtgagcgctctcccg	CRISPR spacer
---ttcaccatgagctccttgtgcgcgatctcccg	Protospacer
   *** **   *********** *** *******

290. spacer 21.25|4582846|32|NC_018524|CRISPRCasFinder,CRT matches to MT952845 (Microbacterium phage GardenState, complete genome) position: , mismatch: 6, identity: 0.812

gaacgacggccgggtcgtcgtggtcctggccg	CRISPR spacer
gggcgggggccgggtcgtcgtcgtccgggccg	Protospacer
*..**. ************** **** *****

291. spacer 21.25|4582846|32|NC_018524|CRISPRCasFinder,CRT matches to MK880124 (Microbacterium phage IAmGroot, complete genome) position: , mismatch: 6, identity: 0.812

gaacgacggccgggtcgtcgtggtcctggccg	CRISPR spacer
gggcgggggccgggtcgtcgtcgtccgggccg	Protospacer
*..**. ************** **** *****

292. spacer 23.9|4592091|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP016463 (Bosea sp. RAC05 plasmid pBSY19_1, complete sequence) position: , mismatch: 6, identity: 0.812

gctcgtcgaaggcggggttcgcgccaacgacc-	CRISPR spacer
gctcgtcgaaggccgggttctcg-cagcgccac	Protospacer
************* ****** ** **.** *  

293. spacer 23.9|4592091|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032341 (Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence) position: , mismatch: 6, identity: 0.812

gctcgtcgaaggcggggttcgcgc-caacgacc	CRISPR spacer
cctcgccgaaggcggggttggcgctccgcgac-	Protospacer
 ****.************* **** * .**** 

294. spacer 23.9|4592091|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP012916 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence) position: , mismatch: 6, identity: 0.812

gctcgtcgaaggcggggttcgcgc-caacgacc	CRISPR spacer
cctcgccgaaggcggggttggcgctccgcgac-	Protospacer
 ****.************* **** * .**** 

295. spacer 26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT matches to MN310546 (Microbacterium phage PhriedRice, complete genome) position: , mismatch: 6, identity: 0.812

ttgttcgc-ctgctcggcggtgagcttcacgac	CRISPR spacer
-cggtcgcgctgctcggcggtgaccttctcgat	Protospacer
 .* **** ************** **** ***.

296. spacer 26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT matches to MT657337 (Microbacterium phage Mazun, complete genome) position: , mismatch: 6, identity: 0.812

ttgttcgc-ctgctcggcggtgagcttcacgac	CRISPR spacer
-cggtcgcgctgctcggcggtgaccttctcgat	Protospacer
 .* **** ************** **** ***.

297. spacer 26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT matches to MT310890 (Microbacterium phage Phedro, complete genome) position: , mismatch: 6, identity: 0.812

ttgttcgc-ctgctcggcggtgagcttcacgac	CRISPR spacer
-cggtcgcgctgctcggcggtgaccttctcgat	Protospacer
 .* **** ************** **** ***.

298. spacer 26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT matches to MT310889 (Microbacterium phage Phractured, complete genome) position: , mismatch: 6, identity: 0.812

ttgttcgc-ctgctcggcggtgagcttcacgac	CRISPR spacer
-cggtcgcgctgctcggcggtgaccttctcgat	Protospacer
 .* **** ************** **** ***.

299. spacer 26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT matches to MT310891 (Microbacterium phage Pharky, complete genome) position: , mismatch: 6, identity: 0.812

ttgttcgc-ctgctcggcggtgagcttcacgac	CRISPR spacer
-cggtcgcgctgctcggcggtgaccttctcgat	Protospacer
 .* **** ************** **** ***.

300. spacer 26.21|4598938|32|NC_018524|CRISPRCasFinder,CRT matches to CP054927 (Streptomyces fulvissimus strain NA06532 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.812

ggcggcaggccggtacggtgccgccatggatc--	CRISPR spacer
cgcggccggccggtacagtgccgcca--gctcga	Protospacer
 ***** *********.*********  * **  

301. spacer 26.23|4599060|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 6, identity: 0.812

caggccct---ggaggacagccggtccgcccgcgc	CRISPR spacer
---gccacgaaggaggacagccggtccgcctgcgc	Protospacer
   *** .   *******************.****

302. spacer 26.23|4599060|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP024895 (Amycolatopsis sp. AA4 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.812

--caggccctggaggacagccggtccgcccgcgc	CRISPR spacer
ggcatggcc--gaggtcggccggtccgcccgcgc	Protospacer
  ** * **  **** *.****************

303. spacer 26.25|4599182|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP007129 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.812

acggagctcgtcgagctcgacatcgcgggctc	CRISPR spacer
tccacgctcgtcgcgctcgagatcgcgggctc	Protospacer
 * . ******** ****** ***********

304. spacer 26.25|4599182|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP012185 (Pseudonocardia sp. EC080619-01 plasmid pBCI1-2, complete sequence) position: , mismatch: 6, identity: 0.812

acggagctcgtcgagctcgacatcgcgggctc	CRISPR spacer
gccgagctcgccgagctcgacatcgcggtcga	Protospacer
.* *******.***************** *  

305. spacer 26.25|4599182|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP012182 (Pseudonocardia sp. EC080610-09 plasmid pBCI2-1, complete sequence) position: , mismatch: 6, identity: 0.812

acggagctcgtcgagctcgacatcgcgggctc	CRISPR spacer
gccgagctcgccgagctcgacatcgcggtcga	Protospacer
.* *******.***************** *  

306. spacer 26.25|4599182|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP045855 (Agrobacterium sp. MA01 plasmid punnamed1, complete sequence) position: , mismatch: 6, identity: 0.812

acggagctcgtcgagctcgacatcgcgggctc	CRISPR spacer
ccggagctcgtcgagctcgtcatggcgcgacc	Protospacer
 ****************** *** *** * .*

307. spacer 26.25|4599182|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP012477 (Arthrobacter sp. ERGS1:01 isolate water plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.812

acggagc----tcgtcgagctcgacatcgcgggctc	CRISPR spacer
----agctccatcgtcgggctcgacatcacgggctc	Protospacer
    ***    ******.**********.*******

308. spacer 26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_AP014705 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence) position: , mismatch: 6, identity: 0.812

-----acctcgaactcgcggcgctcgcggccgtcacg	CRISPR spacer
gcgagacct-----tcgcggcgctcgcgcccgtcacg	Protospacer
     ****     ************** ********

309. spacer 26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP011808 (Pandoraea faecigallinarum strain DSM 23572 plasmid pPF72-1, complete sequence) position: , mismatch: 6, identity: 0.812

acctcgaactcgcggcgctcgcggccgtcacg-	CRISPR spacer
acctcgtactcgcgtcgctcgc-gcagccgcgc	Protospacer
****** ******* ******* ** *.*.** 

310. spacer 28.1|4608658|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 6, identity: 0.812

ccaccgcccgggaggccgcccaccgggccgca--	CRISPR spacer
ccaccgaccaggaggccgcccac--gccctcaac	Protospacer
****** **.*************  * ** **  

311. spacer 28.1|4608658|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 6, identity: 0.812

ccaccgcccgggaggccgcccaccgggccgca--	CRISPR spacer
ccaccgaccaggaggccgcccac--gccctcaac	Protospacer
****** **.*************  * ** **  

312. spacer 30.2|4637791|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_011667 (Thauera sp. MZ1T plasmid pTha01, complete sequence) position: , mismatch: 6, identity: 0.812

-gagggcagtcgatgatgatctcgtcgaactct	CRISPR spacer
cgccggc-gtcgatgatgatgtcgtcgaacttg	Protospacer
 *  *** ************ **********. 

313. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to MH791403 (UNVERIFIED: Pseudomonas phage PaTs-2, complete genome) position: , mismatch: 6, identity: 0.812

cctcggggccggcggtgatcgccccggcccgc	CRISPR spacer
tctggaagccggaggtgatcgccccggccctc	Protospacer
.** *..***** ***************** *

314. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to MN871478 (UNVERIFIED: Pseudomonas phage PaSt-2_45_61k, complete genome) position: , mismatch: 6, identity: 0.812

cctcggggccggcggtgatcgccccggcccgc	CRISPR spacer
tctggaagccggaggtgatcgccccggccctc	Protospacer
.** *..***** ***************** *

315. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to MH791406 (UNVERIFIED: Pseudomonas phage PaSz-4, complete genome) position: , mismatch: 6, identity: 0.812

cctcggggccggcggtgatcgccccggcccgc	CRISPR spacer
tctggaagccggaggtgatcgccccggccctc	Protospacer
.** *..***** ***************** *

316. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_015258 (Polymorphum gilvum SL003B-26A1 plasmid pSL003B, complete sequence) position: , mismatch: 6, identity: 0.812

cctcggggccggcggtgatcgcc--ccggcccgc	CRISPR spacer
cctcgaggccggcggcgatcgcctgccggacg--	Protospacer
*****.*********.*******  **** *   

317. spacer 32.14|4653353|33|NC_018524|PILER-CR,CRT matches to NC_018853 (Streptomyce phage TG1, complete genome) position: , mismatch: 6, identity: 0.818

gaacgcggcacgccggtacaccaaggctcgcgc	CRISPR spacer
cggggcggcacgccggtacacgaaggttcgcgc	Protospacer
 .. ***************** ****.******

318. spacer 32.14|4653353|33|NC_018524|PILER-CR,CRT matches to JX182372 (Streptomyces virus TG1, complete genome) position: , mismatch: 6, identity: 0.818

gaacgcggcacgccggtacaccaaggctcgcgc	CRISPR spacer
cggggcggcacgccggtacacgaaggttcgcgc	Protospacer
 .. ***************** ****.******

319. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP043499 (Rhizobium grahamii strain BG7 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

aacaggaaggagtcctgatcgaccgaccccga-	CRISPR spacer
aacaggaaggagtcctgctgga-caacggcgac	Protospacer
***************** * ** *.**  *** 

320. spacer 34.5|5116718|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP044425 (Paracoccus pantotrophus strain DSM 2944 plasmid pPAN2, complete sequence) position: , mismatch: 6, identity: 0.812

cttgcct-tcgagggcttcctcgatctcccggt	CRISPR spacer
-gtgcatgtcgaaggcttcctcgatctcctggc	Protospacer
  *** * ****.****************.**.

321. spacer 34.6|5116779|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP054617 (Azospirillum oryzae strain KACC 14407 plasmid unnamed3, complete sequence) position: , mismatch: 6, identity: 0.812

ggaggcgctgctggaggccccggcagtctggg	CRISPR spacer
ggaggcgctgctggaggatccggcgttgtcgg	Protospacer
***************** .*****. * * **

322. spacer 34.10|5117024|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to KU886222 (Erwinia phage vB_EamM_Special G, complete genome) position: , mismatch: 6, identity: 0.812

ggtggcgcaggcggccactccgg-gccagtggc	CRISPR spacer
ggtggcgcaggtggctactccggtgatggtgg-	Protospacer
***********.***.******* * ..**** 

323. spacer 1.2|311687|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022195 (Yangia pacifica strain YSBP01 plasmid unnamed5, complete sequence) position: , mismatch: 7, identity: 0.781

-ccggttgatctcgtcgaatacggctgcgaggt	CRISPR spacer
gctgggt-atcgcgtcgaatacgtctgcgagtg	Protospacer
 *.** * *** *********** *******  

324. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 7, identity: 0.781

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
gtgctgctggccatctccttcgtcgtcctatt	Protospacer
****.************* ****** *.. * 

325. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP044072 (Pseudomonas oryzihabitans strain FDAARGOS_657 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

gtgccgctggccatctccatcgtc--ggctccta	CRISPR spacer
ttggcgctggccatcgccatcgtcctggccgc--	Protospacer
 ** *********** ********  ***. *  

326. spacer 1.6|311931|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP023408 (Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.781

accatcatgtcgccgaacgcggagccggccca	CRISPR spacer
gcctcgatgtcgccgaacgcggagccgacctg	Protospacer
.** . *********************.**..

327. spacer 1.6|311931|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP010990 (Pseudonocardia sp. EC080625-04 plasmid pFRP1-1, complete sequence) position: , mismatch: 7, identity: 0.781

accatcatgtcgccgaacgcggagccggccca	CRISPR spacer
cgcatgtcgtcgccgaaaccggagccggccca	Protospacer
  ***  .*********  *************

328. spacer 1.10|312180|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP017077 (Novosphingobium resinovorum strain SA1 plasmid pSA2, complete sequence) position: , mismatch: 7, identity: 0.781

-taggcggcctcggcggtaaaggcgggggcgtc	CRISPR spacer
acaggc-gcgtcggcggcaaaggcgggggctga	Protospacer
 .**** ** *******.************   

329. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 7, identity: 0.781

tcctccggcgcctcgtcggcgacgtcggcgac	CRISPR spacer
ccgtgcagcgcctcggcggcgacgtcggcgtg	Protospacer
.* * *.******** **************  

330. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_LR134461 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 19, complete sequence) position: , mismatch: 7, identity: 0.781

--tcctccggcgcctcgtcggcgacgtcggcgac	CRISPR spacer
gggcgcccg--gcctcgtcggccacttcggcgac	Protospacer
   * .***  *********** ** ********

331. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP007129 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.781

tcctccggcgcctcgtcggcgacgt-cggcgac	CRISPR spacer
ggctccggcgccgcggcggcgacgtgcagcgt-	Protospacer
  ********** ** ********* *.***  

332. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 7, identity: 0.781

tcctccggcgcctcgtcggcgacgtcggcgac	CRISPR spacer
tccggccacgcctcgtagccgacgtcggcgat	Protospacer
***  * .******** * ************.

333. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP053709 (Acetobacteraceae bacterium strain PAMC 26569 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

tcctccggcgcctcgtcggcgacgtcggcgac	CRISPR spacer
tagacaggcgcctcgacggcgacggcggcggc	Protospacer
*   * ********* ******** *****.*

334. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_KR997898 (Mycobacterium avium subsp. hominissuis strain 88Br plasmid pMA100, complete sequence) position: , mismatch: 7, identity: 0.781

---tcctccggcgcctcgtcggcgacgtcggcgac	CRISPR spacer
aggtcgtc---ggcctcgtcggcggcgtcgtcgac	Protospacer
   ** **    ************.***** ****

335. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to MH727545 (Mycobacterium phage DismalStressor, complete genome) position: , mismatch: 7, identity: 0.781

tcctccggc--gcctcgtcggcgacgtcggcgac	CRISPR spacer
--atcaggttggcctcgtcgtcgtcgtcggcgac	Protospacer
   ** **.  ********* ** **********

336. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_026598 (Mycobacterium phage Milly, complete genome) position: , mismatch: 7, identity: 0.781

tcctccggc--gcctcgtcggcgacgtcggcgac	CRISPR spacer
--atcaggttggcctcgtcgtcgtcgtcggcgac	Protospacer
   ** **.  ********* ** **********

337. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to KX688047 (Mycobacterium phage Marcoliusprime, complete genome) position: , mismatch: 7, identity: 0.781

tcctccggc--gcctcgtcggcgacgtcggcgac	CRISPR spacer
--atcaggttggcctcgtcgtcgtcgtcggcgac	Protospacer
   ** **.  ********* ** **********

338. spacer 2.3|313338|32|NC_018524|CRISPRCasFinder matches to NZ_CP020331 (Martelella mediterranea DSM 17316 strain MACL11 plasmid pMM593, complete sequence) position: , mismatch: 7, identity: 0.781

gaggagtactgcccgttcctggt-gagggtgac	CRISPR spacer
gagaagcactgcccgttcctggtcgtcgatca-	Protospacer
***.**.**************** *  *.* * 

339. spacer 2.4|313399|32|NC_018524|CRISPRCasFinder matches to NC_015727 (Cupriavidus necator N-1 plasmid pBB1, complete sequence) position: , mismatch: 7, identity: 0.781

cacaccaccccggcctggccacggccggcgtc	CRISPR spacer
cgctcttcgccggcctggacacgcccggcgtc	Protospacer
*.* *. * ********* **** ********

340. spacer 2.4|313399|32|NC_018524|CRISPRCasFinder matches to NZ_CP053445 (Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eA, complete sequence) position: , mismatch: 7, identity: 0.781

cacacca-ccccggcctggccacggccggcgtc	CRISPR spacer
-tcgccagccctggcctggccacggcccgcggt	Protospacer
  *.*** ***.*************** *** .

341. spacer 2.8|313399|33|NC_018524|CRT matches to NZ_CP009439 (Streptomyces glaucescens strain GLA.O plasmid pSglau1, complete sequence) position: , mismatch: 7, identity: 0.788

cacaccaccccggcctggccacggccggcgtcg	CRISPR spacer
cgctcggcaccggccttgccacggccggcgacg	Protospacer
*.* * .* ******* ************* **

342. spacer 2.10|313401|30|NC_018524|PILER-CR matches to NZ_CP016613 (Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

acaccaccccggcctggccacggccggcgt	CRISPR spacer
gcgcggcccgggcctggcgacggccggcgg	Protospacer
.*.* .*** ******** ********** 

343. spacer 2.10|313401|30|NC_018524|PILER-CR matches to NZ_CP022766 (Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

acaccaccccggcctggccacggccggcgt	CRISPR spacer
gcgcggcccgggcctggcgacggccggcgg	Protospacer
.*.* .*** ******** ********** 

344. spacer 2.10|313401|30|NC_018524|PILER-CR matches to NZ_CP009439 (Streptomyces glaucescens strain GLA.O plasmid pSglau1, complete sequence) position: , mismatch: 7, identity: 0.767

acaccaccccggcctggccacggccggcgt	CRISPR spacer
gctcggcaccggccttgccacggccggcga	Protospacer
.* * .* ******* ************* 

345. spacer 2.10|313401|30|NC_018524|PILER-CR matches to NZ_CP016555 (Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence) position: , mismatch: 7, identity: 0.767

acaccaccccggcctggccacggccggcgt	CRISPR spacer
gcgcggcccgggcctggcgacggccggcgg	Protospacer
.*.* .*** ******** ********** 

346. spacer 2.10|313401|30|NC_018524|PILER-CR matches to NZ_CP052069 (Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

acaccaccccggcctggccacggccggcgt	CRISPR spacer
gcgcggcccgggcctggcgacggccggcgg	Protospacer
.*.* .*** ******** ********** 

347. spacer 2.10|313401|30|NC_018524|PILER-CR matches to NZ_CP016905 (Ralstonia solanacearum strain KACC 10709 plasmid unnamed1) position: , mismatch: 7, identity: 0.767

acaccaccccggcctggccacggccggcgt	CRISPR spacer
gcgcggcccgggcctggcgacggccggcgg	Protospacer
.*.* .*** ******** ********** 

348. spacer 2.10|313401|30|NC_018524|PILER-CR matches to NZ_CP022769 (Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

acaccaccccggcctggccacggccggcgt	CRISPR spacer
gcgcggcccgggcctggcgacggccggcgg	Protospacer
.*.* .*** ******** ********** 

349. spacer 2.10|313401|30|NC_018524|PILER-CR matches to NZ_CP015851 (Ralstonia solanacearum strain YC40-M plasmid, complete sequence) position: , mismatch: 7, identity: 0.767

acaccaccccggcctggccacggccggcgt	CRISPR spacer
gcgcggcccgggcctggcgacggccggcgg	Protospacer
.*.* .*** ******** ********** 

350. spacer 2.10|313401|30|NC_018524|PILER-CR matches to NZ_CP022773 (Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

acaccaccccggcctggccacggccggcgt	CRISPR spacer
gcgcggcccgggcctggcgacggccggcgg	Protospacer
.*.* .*** ******** ********** 

351. spacer 2.10|313401|30|NC_018524|PILER-CR matches to NZ_CP022791 (Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

acaccaccccggcctggccacggccggcgt	CRISPR spacer
gcgcggcccgggcctggcgacggccggcgg	Protospacer
.*.* .*** ******** ********** 

352. spacer 2.10|313401|30|NC_018524|PILER-CR matches to NZ_CP052071 (Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

acaccaccccggcctggccacggccggcgt	CRISPR spacer
gcgcggcccgggcctggcgacggccggcgg	Protospacer
.*.* .*** ******** ********** 

353. spacer 2.10|313401|30|NC_018524|PILER-CR matches to NZ_CP022779 (Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

acaccaccccggcctggccacggccggcgt	CRISPR spacer
gcgcggcccgggcctggcgacggccggcgg	Protospacer
.*.* .*** ******** ********** 

354. spacer 2.10|313401|30|NC_018524|PILER-CR matches to NZ_CP052075 (Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

acaccaccccggcctggccacggccggcgt	CRISPR spacer
gcgcggcccgggcctggcgacggccggcgg	Protospacer
.*.* .*** ******** ********** 

355. spacer 2.10|313401|30|NC_018524|PILER-CR matches to NZ_CP052085 (Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

acaccaccccggcctggccacggccggcgt	CRISPR spacer
gcgcggcccgggcctggcgacggccggcgg	Protospacer
.*.* .*** ******** ********** 

356. spacer 2.10|313401|30|NC_018524|PILER-CR matches to NZ_CP052105 (Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

acaccaccccggcctggccacggccggcgt	CRISPR spacer
gcgcggcccgggcctggcgacggccggcgg	Protospacer
.*.* .*** ******** ********** 

357. spacer 2.10|313401|30|NC_018524|PILER-CR matches to NZ_CP052087 (Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

acaccaccccggcctggccacggccggcgt	CRISPR spacer
gcgcggcccgggcctggcgacggccggcgg	Protospacer
.*.* .*** ******** ********** 

358. spacer 2.10|313401|30|NC_018524|PILER-CR matches to NZ_CP052115 (Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

acaccaccccggcctggccacggccggcgt	CRISPR spacer
gcgcggcccgggcctggcgacggccggcgg	Protospacer
.*.* .*** ******** ********** 

359. spacer 2.10|313401|30|NC_018524|PILER-CR matches to NZ_CP052127 (Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

acaccaccccggcctggccacggccggcgt	CRISPR spacer
gcgcggcccgggcctggcgacggccggcgg	Protospacer
.*.* .*** ******** ********** 

360. spacer 2.10|313401|30|NC_018524|PILER-CR matches to NZ_CP052089 (Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

acaccaccccggcctggccacggccggcgt	CRISPR spacer
gcgcggcccgggcctggcgacggccggcgg	Protospacer
.*.* .*** ******** ********** 

361. spacer 2.10|313401|30|NC_018524|PILER-CR matches to NZ_CP052107 (Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

acaccaccccggcctggccacggccggcgt	CRISPR spacer
gcgcggcccgggcctggcgacggccggcgg	Protospacer
.*.* .*** ******** ********** 

362. spacer 2.10|313401|30|NC_018524|PILER-CR matches to NZ_CP022781 (Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

acaccaccccggcctggccacggccggcgt	CRISPR spacer
gcgcggcccgggcctggcgacggccggcgg	Protospacer
.*.* .*** ******** ********** 

363. spacer 2.10|313401|30|NC_018524|PILER-CR matches to NZ_CP052117 (Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

acaccaccccggcctggccacggccggcgt	CRISPR spacer
gcgcggcccgggcctggcgacggccggcgg	Protospacer
.*.* .*** ******** ********** 

364. spacer 2.10|313401|30|NC_018524|PILER-CR matches to NZ_CP022793 (Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

acaccaccccggcctggccacggccggcgt	CRISPR spacer
gcgcggcccgggcctggcgacggccggcgg	Protospacer
.*.* .*** ******** ********** 

365. spacer 2.10|313401|30|NC_018524|PILER-CR matches to NZ_CP022785 (Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

acaccaccccggcctggccacggccggcgt	CRISPR spacer
gcgcggcccgggcctggcgacggccggcgg	Protospacer
.*.* .*** ******** ********** 

366. spacer 2.10|313401|30|NC_018524|PILER-CR matches to NZ_CP022787 (Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

acaccaccccggcctggccacggccggcgt	CRISPR spacer
gcgcggcccgggcctggcgacggccggcgg	Protospacer
.*.* .*** ******** ********** 

367. spacer 2.10|313401|30|NC_018524|PILER-CR matches to NZ_CP022756 (Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

acaccaccccggcctggccacggccggcgt	CRISPR spacer
gcgcggcccgggcctggcgacggccggcgg	Protospacer
.*.* .*** ******** ********** 

368. spacer 2.10|313401|30|NC_018524|PILER-CR matches to NZ_CP052121 (Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

acaccaccccggcctggccacggccggcgt	CRISPR spacer
gcgcggcccgggcctggcgacggccggcgg	Protospacer
.*.* .*** ******** ********** 

369. spacer 2.10|313401|30|NC_018524|PILER-CR matches to NZ_CP052131 (Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

acaccaccccggcctggccacggccggcgt	CRISPR spacer
gcgcggcccgggcctggcgacggccggcgg	Protospacer
.*.* .*** ******** ********** 

370. spacer 2.10|313401|30|NC_018524|PILER-CR matches to NZ_CP052073 (Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

acaccaccccggcctggccacggccggcgt	CRISPR spacer
gcgcggcccgggcctggcgacggccggcgg	Protospacer
.*.* .*** ******** ********** 

371. spacer 2.10|313401|30|NC_018524|PILER-CR matches to NZ_CP052109 (Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

acaccaccccggcctggccacggccggcgt	CRISPR spacer
gcgcggcccgggcctggcgacggccggcgg	Protospacer
.*.* .*** ******** ********** 

372. spacer 2.10|313401|30|NC_018524|PILER-CR matches to NZ_CP052111 (Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

acaccaccccggcctggccacggccggcgt	CRISPR spacer
gcgcggcccgggcctggcgacggccggcgg	Protospacer
.*.* .*** ******** ********** 

373. spacer 2.10|313401|30|NC_018524|PILER-CR matches to NZ_CP052103 (Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

acaccaccccggcctggccacggccggcgt	CRISPR spacer
gcgcggcccgggcctggcgacggccggcgg	Protospacer
.*.* .*** ******** ********** 

374. spacer 2.10|313401|30|NC_018524|PILER-CR matches to NZ_CP052119 (Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

acaccaccccggcctggccacggccggcgt	CRISPR spacer
gcgcggcccgggcctggcgacggccggcgg	Protospacer
.*.* .*** ******** ********** 

375. spacer 2.10|313401|30|NC_018524|PILER-CR matches to NZ_CP052113 (Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.767

acaccaccccggcctggccacggccggcgt	CRISPR spacer
gcgcggcccgggcctggcgacggccggcgg	Protospacer
.*.* .*** ******** ********** 

376. spacer 3.1|318517|32|NC_018524|CRISPRCasFinder,CRT matches to NC_008269 (Rhodococcus jostii RHA1 plasmid pRHL1, complete sequence) position: , mismatch: 7, identity: 0.781

gcccagggggccggtctggtcgagttctccat---	CRISPR spacer
gcccagggcgccggtctggtcga---cctgatgcg	Protospacer
******** **************   *.. **   

377. spacer 3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP039924 (Agrobacterium tumefaciens strain CFBP7129 plasmid pAtCFBP7129a, complete sequence) position: , mismatch: 7, identity: 0.781

atgaccgcccatttcgccgaccggctcgccgc	CRISPR spacer
atgcccgcccatttcgccgaccggccctatca	Protospacer
*** *********************.*  .  

378. spacer 3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NC_024970 (Streptomyces aureofaciens strain CCM3239 plasmid pSA3239, complete sequence) position: , mismatch: 7, identity: 0.781

atgaccgcccatttcgccgaccggctcgccgc	CRISPR spacer
gtcatgccccgcttcgccgaccggctcgccgc	Protospacer
.* *.  ***..********************

379. spacer 3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_KJ396772 (Streptomyces lavendulae subsp. lavendulae strain CCM3239 plasmid pSA3239, complete sequence) position: , mismatch: 7, identity: 0.781

atgaccgcccatttcgccgaccggctcgccgc	CRISPR spacer
gtcatgccccgcttcgccgaccggctcgccgc	Protospacer
.* *.  ***..********************

380. spacer 3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP024986 (Streptomyces lavendulae subsp. lavendulae strain CCM 3239 plasmid pSA3239, complete sequence) position: , mismatch: 7, identity: 0.781

atgaccgcccatttcgccgaccggctcgccgc	CRISPR spacer
gtcatgccccgcttcgccgaccggctcgccgc	Protospacer
.* *.  ***..********************

381. spacer 3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 7, identity: 0.781

atgaccgcccatttcgccgaccggctcgccgc	CRISPR spacer
atcatcaggcagttcgccgaccggctcgacgc	Protospacer
** *.*.  ** **************** ***

382. spacer 3.7|318883|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP015867 (Streptomyces parvulus strain 2297 plasmid pSPA1, complete sequence) position: , mismatch: 7, identity: 0.781

gaccctgcccctccgcgccgcccttcatcagg-	CRISPR spacer
cgacctgcccctccactccgcccttc-tcatgt	Protospacer
 . ***********.* ********* *** * 

383. spacer 3.8|318944|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP017076 (Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence) position: , mismatch: 7, identity: 0.781

ggctg--tggagcgcgcggcggctgcgcggggtg	CRISPR spacer
--ccgactggagcgcgcggcgccagcgcggggct	Protospacer
  *.*  ************** * ********. 

384. spacer 3.8|318944|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LS999564 (Escherichia coli isolate EC-TO143 plasmid 5, complete sequence) position: , mismatch: 7, identity: 0.781

ggctgtggagcgcgcggcggctgcgcggggtg	CRISPR spacer
tgccgacgaacgcgcggcggctgcgcggcgtt	Protospacer
 **.*  **.****************** ** 

385. spacer 3.8|318944|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP028999 (Klebsiella pneumoniae strain AR_0079 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.781

ggctgtggagcgcgcggcggctgcgcggggtg	CRISPR spacer
tgccgacgaacgcgcggcggctgcgcggcgtt	Protospacer
 **.*  **.****************** ** 

386. spacer 3.8|318944|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP009146 (Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence) position: , mismatch: 7, identity: 0.781

ggctgtggagcgcgcggcggctgcgcggggtg	CRISPR spacer
ggctggggagcgcgccgcggctgcaatggtta	Protospacer
***** ********* ********.  ** *.

387. spacer 3.8|318944|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP027258 (Escherichia coli strain EC11 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.781

ggctgtggagcgcgcggcggctgcgcggggtg	CRISPR spacer
tgccgacgaacgcgcggcggctgcgcggcgtt	Protospacer
 **.*  **.****************** ** 

388. spacer 3.8|318944|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP019200 (Salmonella enterica subsp. enterica serovar Muenster str. 0315 plasmid pCFSAN001297_01, complete sequence) position: , mismatch: 7, identity: 0.781

ggctgtggagcgcgcggcggctgcgcggggtg	CRISPR spacer
tgccgacgaacgcgcggcggctgcgcggcgtt	Protospacer
 **.*  **.****************** ** 

389. spacer 3.8|318944|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP048281 (Rhizobium leguminosarum bv. viciae 248 plasmid pRle248e, complete sequence) position: , mismatch: 7, identity: 0.781

ggctgtggagcgcgcggcggctgcgcggggtg	CRISPR spacer
agcgctggagcgcccgggggctgcgcgggcgg	Protospacer
.**  ******** *** ***********  *

390. spacer 3.8|318944|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP021831 (Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.781

ggctgtggagcgcgcggcggctgcgcggggtg	CRISPR spacer
ggctggggagcgcgccgcggctgcaatggtta	Protospacer
***** ********* ********.  ** *.

391. spacer 3.8|318944|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP026025 (Klebsiella pneumoniae strain 11420 plasmid p11420-KPC, complete sequence) position: , mismatch: 7, identity: 0.781

ggctgtggagcgcgcggcggctgcgcggggtg	CRISPR spacer
tgccgacgaacgcgcggcggctgcgcggcgtt	Protospacer
 **.*  **.****************** ** 

392. spacer 3.8|318944|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP018988 (Escherichia coli strain Ecol_AZ146 plasmid pECAZ146_3, complete sequence) position: , mismatch: 7, identity: 0.781

ggctgtggagcgcgcggcggctgcgcggggtg	CRISPR spacer
tgccgacgaacgcgcggcggctgcgcggcgtt	Protospacer
 **.*  **.****************** ** 

393. spacer 3.8|318944|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_MG557999 (Escherichia coli strain Eco-36682cz plasmid pEco-36682cz, complete sequence) position: , mismatch: 7, identity: 0.781

ggctgtggagcgcgcggcggctgcgcggggtg	CRISPR spacer
tgccgacgaacgcgcggcggctgcgcggcgtt	Protospacer
 **.*  **.****************** ** 

394. spacer 3.8|318944|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_MF497781 (Citrobacter freundii strain Cfr-36049cz plasmid pCrf-36049cz, complete sequence) position: , mismatch: 7, identity: 0.781

ggctgtggagcgcgcggcggctgcgcggggtg	CRISPR spacer
tgccgacgaacgcgcggcggctgcgcggcgtt	Protospacer
 **.*  **.****************** ** 

395. spacer 3.8|318944|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NC_011216 (Burkholderia phage KS10, complete genome) position: , mismatch: 7, identity: 0.781

ggctgtgg-agcgcgcggcggctgcgcggggtg	CRISPR spacer
-gccgcagtcgcgcgcggcgactgcgcgtggtg	Protospacer
 **.*..*  **********.******* ****

396. spacer 3.13|319248|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP050095 (Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b1, complete sequence) position: , mismatch: 7, identity: 0.781

--gctaggcagggagatctcgatgccgctgtcgg	CRISPR spacer
cggccaa--aaggcgatctcgaagccgctgtcgg	Protospacer
  **.*.  *.** ******** ***********

397. spacer 3.13|319248|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP050106 (Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b5, complete sequence) position: , mismatch: 7, identity: 0.781

--gctaggcagggagatctcgatgccgctgtcgg	CRISPR spacer
cggccaa--aaggcgatctcgaagccgctgtcgg	Protospacer
  **.*.  *.** ******** ***********

398. spacer 3.13|319248|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NC_008381 (Rhizobium leguminosarum bv. viciae 3841 plasmid pRL10, complete sequence) position: , mismatch: 7, identity: 0.781

--gctaggcagggagatctcgatgccgctgtcgg	CRISPR spacer
cggccaa--aaggcgatctcgaagccgctgtcgg	Protospacer
  **.*.  *.** ******** ***********

399. spacer 3.13|319248|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP018232 (Rhizobium leguminosarum strain Vaf-108 plasmid unnamed4, complete sequence) position: , mismatch: 7, identity: 0.781

--gctaggcagggagatctcgatgccgctgtcgg	CRISPR spacer
cggccaa--aaggcgatctcgaagccgctgtcgg	Protospacer
  **.*.  *.** ******** ***********

400. spacer 3.13|319248|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP050111 (Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b1, complete sequence) position: , mismatch: 7, identity: 0.781

--gctaggcagggagatctcgatgccgctgtcgg	CRISPR spacer
cggccaa--aaggcgatctcgaagccgctgtcgg	Protospacer
  **.*.  *.** ******** ***********

401. spacer 4.7|321736|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP029830 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

ttgttcgccgccgaggccacggcat-ccgccaa	CRISPR spacer
gcgtccgccgccgaggccagggcatagcgccc-	Protospacer
 .**.************** *****  ****  

402. spacer 4.9|321858|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP032054 (Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence) position: , mismatch: 7, identity: 0.781

ggggtgcggccgggggtgccggtgtcgggggt	CRISPR spacer
gagctgcggcccggggtcccggtgtcggtgaa	Protospacer
*.* ******* ***** ********** *. 

403. spacer 4.9|321858|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 7, identity: 0.781

ggggtgcggccgggggtgccggtgtcgggggt	CRISPR spacer
gagctgcggcccggggtcccggtgtcggtgaa	Protospacer
*.* ******* ***** ********** *. 

404. spacer 4.9|321858|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP016560 (Streptomyces clavuligerus strain F613-1 plasmid pSCL4, complete sequence) position: , mismatch: 7, identity: 0.781

ggggtgcggccgggggtgccggtgtcgggggt	CRISPR spacer
gagctgcggcccggggtcccggtgtcggtgaa	Protospacer
*.* ******* ***** ********** *. 

405. spacer 4.9|321858|32|NC_018524|CRISPRCasFinder,CRT matches to KF306380 (Mycobacterium phage DrDrey, complete genome) position: , mismatch: 7, identity: 0.781

ggggtgcggccgggggtgccggtgtcgggggt	CRISPR spacer
ggtgcctggccgggggtgccgatgccggggat	Protospacer
** *. .**************.**.*****.*

406. spacer 5.1|326532|32|NC_018524|CRISPRCasFinder matches to NZ_CP029452 (Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence) position: , mismatch: 7, identity: 0.781

ggcgtcctccagcacgttcatgtaggcggcga	CRISPR spacer
ggcgtcctccagcacgcgcatgtaaccgagaa	Protospacer
****************. ******. **. .*

407. spacer 5.1|326532|32|NC_018524|CRISPRCasFinder matches to NZ_CP023071 (Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence) position: , mismatch: 7, identity: 0.781

ggcgtcctccagcacgttcatgtaggcggcga	CRISPR spacer
ggcgtcctccagcacgcgcatgtaaccgagaa	Protospacer
****************. ******. **. .*

408. spacer 5.1|326532|32|NC_018524|CRISPRCasFinder matches to NZ_CP029232 (Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence) position: , mismatch: 7, identity: 0.781

ggcgtcctccagcacgttcatgtaggcggcga	CRISPR spacer
ggcgtcctccagcacgcgcatgtaaccgagaa	Protospacer
****************. ******. **. .*

409. spacer 5.2|326593|32|NC_018524|CRISPRCasFinder matches to NC_012849 (Ralstonia pickettii 12D plasmid pRp12D02, complete sequence) position: , mismatch: 7, identity: 0.781

ccacaaggccccgcccccgaaaggggcggggc	CRISPR spacer
cctgtgagccacgcccccgaaaggggcgtggc	Protospacer
**   ..*** ***************** ***

410. spacer 5.5|326776|32|NC_018524|CRISPRCasFinder matches to NC_019848 (Sinorhizobium meliloti GR4 plasmid pRmeGR4c, complete sequence) position: , mismatch: 7, identity: 0.781

gacaagctgttcaacgcgcgcgaactcgccgc	CRISPR spacer
accaagccgttcaacccgcgcgaactcctggc	Protospacer
. *****.******* *********** . **

411. spacer 5.5|326776|32|NC_018524|CRISPRCasFinder matches to NZ_CP021813 (Sinorhizobium meliloti strain M270 plasmid psymA, complete sequence) position: , mismatch: 7, identity: 0.781

gacaagctgttcaacgcgcgcgaactcgccgc	CRISPR spacer
accaagccgttcaacccgcgcgaactcctggc	Protospacer
. *****.******* *********** . **

412. spacer 5.5|326776|32|NC_018524|CRISPRCasFinder matches to NZ_CP021805 (Sinorhizobium meliloti strain T073 plasmid psymA, complete sequence) position: , mismatch: 7, identity: 0.781

gacaagctgttcaacgcgcgcgaactcgccgc	CRISPR spacer
accaagccgttcaacccgcgcgaactcctggc	Protospacer
. *****.******* *********** . **

413. spacer 5.5|326776|32|NC_018524|CRISPRCasFinder matches to NZ_CP054625 (Cupriavidus gilardii strain FDAARGOS_639 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

gacaagctgttcaacgcgcgcgaactcgccgc	CRISPR spacer
cccaagccgttcaacccgcgcgaactgatcgc	Protospacer
  *****.******* ********** ..***

414. spacer 5.6|326837|32|NC_018524|CRISPRCasFinder matches to NZ_LN831789 (Streptomyces leeuwenhoekii strain type strain (C34 = DSM 42122 = NRRL B-24963) plasmid pSLE2) position: , mismatch: 7, identity: 0.781

ccgagggcgacgcaggcacgacg--ccaggtcca	CRISPR spacer
gcgagggcgacggcggcacgacgcaccccgtc--	Protospacer
 ***********  *********  **  ***  

415. spacer 5.7|326532|33|NC_018524|CRT matches to NZ_CP029232 (Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence) position: , mismatch: 7, identity: 0.788

ggcgtcctccagcacgttcatgtaggcggcgag	CRISPR spacer
ggcgtcctccagcacgcgcatgtaaccgagaag	Protospacer
****************. ******. **. .**

416. spacer 5.7|326532|33|NC_018524|CRT matches to NZ_CP029452 (Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence) position: , mismatch: 7, identity: 0.788

ggcgtcctccagcacgttcatgtaggcggcgag	CRISPR spacer
ggcgtcctccagcacgcgcatgtaaccgagaag	Protospacer
****************. ******. **. .**

417. spacer 5.7|326532|33|NC_018524|CRT matches to NZ_CP023071 (Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence) position: , mismatch: 7, identity: 0.788

ggcgtcctccagcacgttcatgtaggcggcgag	CRISPR spacer
ggcgtcctccagcacgcgcatgtaaccgagaag	Protospacer
****************. ******. **. .**

418. spacer 5.9|326654|33|NC_018524|CRT matches to NZ_CP029357 (Azospirillum sp. CFH 70021 plasmid unnamed2) position: , mismatch: 7, identity: 0.788

atgaggacaccgaccgagaggccgtcg-cactgc	CRISPR spacer
accaggacaccgaccacgaggccgtcgaggctg-	Protospacer
*. ************. **********  .*** 

419. spacer 5.13|326594|32|NC_018524|PILER-CR matches to NC_012849 (Ralstonia pickettii 12D plasmid pRp12D02, complete sequence) position: , mismatch: 7, identity: 0.781

ccacaaggccccgcccccgaaaggggcggggc	CRISPR spacer
cctgtgagccacgcccccgaaaggggcgtggc	Protospacer
**   ..*** ***************** ***

420. spacer 5.16|326777|32|NC_018524|PILER-CR matches to NC_019848 (Sinorhizobium meliloti GR4 plasmid pRmeGR4c, complete sequence) position: , mismatch: 7, identity: 0.781

gacaagctgttcaacgcgcgcgaactcgccgc	CRISPR spacer
accaagccgttcaacccgcgcgaactcctggc	Protospacer
. *****.******* *********** . **

421. spacer 5.16|326777|32|NC_018524|PILER-CR matches to NZ_CP021813 (Sinorhizobium meliloti strain M270 plasmid psymA, complete sequence) position: , mismatch: 7, identity: 0.781

gacaagctgttcaacgcgcgcgaactcgccgc	CRISPR spacer
accaagccgttcaacccgcgcgaactcctggc	Protospacer
. *****.******* *********** . **

422. spacer 5.16|326777|32|NC_018524|PILER-CR matches to NZ_CP021805 (Sinorhizobium meliloti strain T073 plasmid psymA, complete sequence) position: , mismatch: 7, identity: 0.781

gacaagctgttcaacgcgcgcgaactcgccgc	CRISPR spacer
accaagccgttcaacccgcgcgaactcctggc	Protospacer
. *****.******* *********** . **

423. spacer 5.16|326777|32|NC_018524|PILER-CR matches to NZ_CP054625 (Cupriavidus gilardii strain FDAARGOS_639 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

gacaagctgttcaacgcgcgcgaactcgccgc	CRISPR spacer
cccaagccgttcaacccgcgcgaactgatcgc	Protospacer
  *****.******* ********** ..***

424. spacer 5.17|326838|32|NC_018524|PILER-CR matches to NZ_LN831789 (Streptomyces leeuwenhoekii strain type strain (C34 = DSM 42122 = NRRL B-24963) plasmid pSLE2) position: , mismatch: 7, identity: 0.781

ccgagggcgacgcaggcacgacg--ccaggtcca	CRISPR spacer
gcgagggcgacggcggcacgacgcaccccgtc--	Protospacer
 ***********  *********  **  ***  

425. spacer 11.3|2251146|32|NC_018524|PILER-CR,CRT matches to NZ_CP012399 (Chelatococcus sp. CO-6 plasmid pCO-6, complete sequence) position: , mismatch: 7, identity: 0.781

cgcggcggcgcctgcgcgacctgctcaacgag	CRISPR spacer
ccggccacggcctgcgcgacctgctcgacgag	Protospacer
*  * *.  *****************.*****

426. spacer 11.3|2251146|32|NC_018524|PILER-CR,CRT matches to NZ_CP015090 (Pelagibaca abyssi strain JLT2014 plasmid pPABY2, complete sequence) position: , mismatch: 7, identity: 0.781

cgcggcggcgcctgcgcgacctgctcaacgag	CRISPR spacer
cgccgcggcacctgcgcgacctgccgcgccag	Protospacer
*** *****.**************.  .* **

427. spacer 11.3|2251146|32|NC_018524|PILER-CR,CRT matches to NC_017805 (Deinococcus gobiensis I-0 plasmid P1, complete sequence) position: , mismatch: 7, identity: 0.781

cgcggcggcgcctgcgcgacctgctcaacgag	CRISPR spacer
cgctgcggcgcctgagcgacctgcgggccggg	Protospacer
*** ********** *********  . **.*

428. spacer 11.3|2251146|32|NC_018524|PILER-CR,CRT matches to NZ_CP048419 (Sphingomonas insulae strain KCTC 12872 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

--cgcggcggcgcctgcgcgacctgctcaacgag	CRISPR spacer
atctcgtc--cgcctgctcgacgtgctcaacgat	Protospacer
  * ** *  ******* **** ********** 

429. spacer 11.3|2251146|32|NC_018524|PILER-CR,CRT matches to NZ_CP025584 (Paracoccus jeotgali strain CBA4604 plasmid pCBA4604-01, complete sequence) position: , mismatch: 7, identity: 0.781

cgcggcggcgcctgcgcgacctgctcaacgag	CRISPR spacer
cgcagcggcgcctgcgcgaactggtggaggtg	Protospacer
***.*************** *** * .* * *

430. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP016613 (Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
aggtcgcggatggcgtcgcgggcggcgaccgg	Protospacer
* ** ****************** **. * .*

431. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP021449 (Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence) position: , mismatch: 7, identity: 0.781

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
aggtcgcggatggcgtcgcgggcggcgaccgg	Protospacer
* ** ****************** **. * .*

432. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to CP023013 (Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
aggtcgcggatggcgtcgcgggcggcgaccgg	Protospacer
* ** ****************** **. * .*

433. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP049790 (Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
aggtcgcggatggcgtcgcgggcggcgaccgg	Protospacer
* ** ****************** **. * .*

434. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP049794 (Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
aggtcgcggatggcgtcgcgggcggcgaccgg	Protospacer
* ** ****************** **. * .*

435. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP049788 (Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
aggtcgcggatggcgtcgcgggcggcgaccgg	Protospacer
* ** ****************** **. * .*

436. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP022766 (Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
aggtcgcggatggcgtcgcgggcggcgaccgg	Protospacer
* ** ****************** **. * .*

437. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP021763 (Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
aggtcgcggatggcgtcgcgggcggcgaccgg	Protospacer
* ** ****************** **. * .*

438. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP015116 (Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
aggtcgcggatggcgtcgcgggcggcgaccgg	Protospacer
* ** ****************** **. * .*

439. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP016555 (Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence) position: , mismatch: 7, identity: 0.781

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
aggtcgcggatggcgtcgcgggcggcgaccgg	Protospacer
* ** ****************** **. * .*

440. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP049792 (Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
aggtcgcggatggcgtcgcgggcggcgaccgg	Protospacer
* ** ****************** **. * .*

441. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP052069 (Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.781

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
aggtcgcggatggcgtcgcgggcggcgaccgg	Protospacer
* ** ****************** **. * .*

442. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP016915 (Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
aggtcgcggatggcgtcgcgggcggcgaccgg	Protospacer
* ** ****************** **. * .*

443. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP016905 (Ralstonia solanacearum strain KACC 10709 plasmid unnamed1) position: , mismatch: 7, identity: 0.781

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
aggtcgcggatggcgtcgcgggcggcgaccgg	Protospacer
* ** ****************** **. * .*

444. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 7, identity: 0.781

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
aggtcgcggatggcgtcgcgggcggcgaccgg	Protospacer
* ** ****************** **. * .*

445. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP022769 (Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
aggtcgcggatggcgtcgcgggcggcgaccgg	Protospacer
* ** ****************** **. * .*

446. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP022773 (Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
aggtcgcggatggcgtcgcgggcggcgaccgg	Protospacer
* ** ****************** **. * .*

447. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP022783 (Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
aggtcgcggatggcgtcgcgggcggcgaccgg	Protospacer
* ** ****************** **. * .*

448. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP022791 (Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
aggtcgcggatggcgtcgcgggcggcgaccgg	Protospacer
* ** ****************** **. * .*

449. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP022795 (Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
aggtcgcggatggcgtcgcgggcggcgaccgg	Protospacer
* ** ****************** **. * .*

450. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP052071 (Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.781

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
aggtcgcggatggcgtcgcgggcggcgaccgg	Protospacer
* ** ****************** **. * .*

451. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP022482 (Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence) position: , mismatch: 7, identity: 0.781

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
aggtcgcggatggcgtcgcgggcggcgaccgg	Protospacer
* ** ****************** **. * .*

452. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP009763 (Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
aggtcgcggatggcgtcgcgggcggcgaccgg	Protospacer
* ** ****************** **. * .*

453. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to CP023015 (Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
aggtcgcggatggcgtcgcgggcggcgaccgg	Protospacer
* ** ****************** **. * .*

454. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP022779 (Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
aggtcgcggatggcgtcgcgggcggcgaccgg	Protospacer
* ** ****************** **. * .*

455. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP052075 (Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.781

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
aggtcgcggatggcgtcgcgggcggcgaccgg	Protospacer
* ** ****************** **. * .*

456. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP052085 (Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.781

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
aggtcgcggatggcgtcgcgggcggcgaccgg	Protospacer
* ** ****************** **. * .*

457. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP052095 (Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.781

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
aggtcgcggatggcgtcgcgggcggcgaccgg	Protospacer
* ** ****************** **. * .*

458. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP052105 (Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.781

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
aggtcgcggatggcgtcgcgggcggcgaccgg	Protospacer
* ** ****************** **. * .*

459. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP021765 (Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
aggtcgcggatggcgtcgcgggcggcgaccgg	Protospacer
* ** ****************** **. * .*

460. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP052077 (Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.781

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
aggtcgcggatggcgtcgcgggcggcgaccgg	Protospacer
* ** ****************** **. * .*

461. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP052087 (Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.781

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
aggtcgcggatggcgtcgcgggcggcgaccgg	Protospacer
* ** ****************** **. * .*

462. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP052097 (Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.781

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
aggtcgcggatggcgtcgcgggcggcgaccgg	Protospacer
* ** ****************** **. * .*

463. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP052115 (Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.781

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
aggtcgcggatggcgtcgcgggcggcgaccgg	Protospacer
* ** ****************** **. * .*

464. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP052127 (Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.781

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
aggtcgcggatggcgtcgcgggcggcgaccgg	Protospacer
* ** ****************** **. * .*

465. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP052079 (Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.781

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
aggtcgcggatggcgtcgcgggcggcgaccgg	Protospacer
* ** ****************** **. * .*

466. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP052089 (Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.781

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
aggtcgcggatggcgtcgcgggcggcgaccgg	Protospacer
* ** ****************** **. * .*

467. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP052093 (Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.781

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
aggtcgcggatggcgtcgcgggcggcgaccgg	Protospacer
* ** ****************** **. * .*

468. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP052101 (Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.781

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
aggtcgcggatggcgtcgcgggcggcgaccgg	Protospacer
* ** ****************** **. * .*

469. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP052099 (Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.781

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
aggtcgcggatggcgtcgcgggcggcgaccgg	Protospacer
* ** ****************** **. * .*

470. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP052107 (Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.781

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
aggtcgcggatggcgtcgcgggcggcgaccgg	Protospacer
* ** ****************** **. * .*

471. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP022781 (Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
aggtcgcggatggcgtcgcgggcggcgaccgg	Protospacer
* ** ****************** **. * .*

472. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP052117 (Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.781

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
aggtcgcggatggcgtcgcgggcggcgaccgg	Protospacer
* ** ****************** **. * .*

473. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP052125 (Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.781

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
aggtcgcggatggcgtcgcgggcggcgaccgg	Protospacer
* ** ****************** **. * .*

474. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP022793 (Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
aggtcgcggatggcgtcgcgggcggcgaccgg	Protospacer
* ** ****************** **. * .*

475. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP022785 (Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
aggtcgcggatggcgtcgcgggcggcgaccgg	Protospacer
* ** ****************** **. * .*

476. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP022787 (Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
aggtcgcggatggcgtcgcgggcggcgaccgg	Protospacer
* ** ****************** **. * .*

477. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP022756 (Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
aggtcgcggatggcgtcgcgggcggcgaccgg	Protospacer
* ** ****************** **. * .*

478. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP052129 (Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.781

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
aggtcgcggatggcgtcgcgggcggcgaccgg	Protospacer
* ** ****************** **. * .*

479. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP052121 (Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.781

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
aggtcgcggatggcgtcgcgggcggcgaccgg	Protospacer
* ** ****************** **. * .*

480. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP052123 (Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.781

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
aggtcgcggatggcgtcgcgggcggcgaccgg	Protospacer
* ** ****************** **. * .*

481. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP052131 (Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.781

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
aggtcgcggatggcgtcgcgggcggcgaccgg	Protospacer
* ** ****************** **. * .*

482. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to CP011998 (Ralstonia solanacearum strain YC45 plasmid, complete sequence) position: , mismatch: 7, identity: 0.781

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
aggtcgcggatggcgtcgcgggcggcgaccgg	Protospacer
* ** ****************** **. * .*

483. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP052073 (Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.781

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
aggtcgcggatggcgtcgcgggcggcgaccgg	Protospacer
* ** ****************** **. * .*

484. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP052081 (Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.781

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
aggtcgcggatggcgtcgcgggcggcgaccgg	Protospacer
* ** ****************** **. * .*

485. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP052083 (Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.781

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
aggtcgcggatggcgtcgcgggcggcgaccgg	Protospacer
* ** ****************** **. * .*

486. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP052109 (Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.781

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
aggtcgcggatggcgtcgcgggcggcgaccgg	Protospacer
* ** ****************** **. * .*

487. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP052091 (Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.781

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
aggtcgcggatggcgtcgcgggcggcgaccgg	Protospacer
* ** ****************** **. * .*

488. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP052111 (Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.781

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
aggtcgcggatggcgtcgcgggcggcgaccgg	Protospacer
* ** ****************** **. * .*

489. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP052103 (Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.781

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
aggtcgcggatggcgtcgcgggcggcgaccgg	Protospacer
* ** ****************** **. * .*

490. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP052119 (Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.781

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
aggtcgcggatggcgtcgcgggcggcgaccgg	Protospacer
* ** ****************** **. * .*

491. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP052113 (Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.781

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
aggtcgcggatggcgtcgcgggcggcgaccgg	Protospacer
* ** ****************** **. * .*

492. spacer 11.8|2251452|32|NC_018524|PILER-CR,CRT matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

cagtgtgggcaggagattaccgagatcggcgt	CRISPR spacer
gatctggggcaggtgatcaccgagatcggcgt	Protospacer
 * .  ******* ***.**************

493. spacer 11.16|2251448|36|NC_018524|CRISPRCasFinder matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.806

accgcagtgt-gggcaggagattaccgagatcggcgt	CRISPR spacer
-gcgcgatctggggcaggtgatcaccgagatcggcgt	Protospacer
  ***..* * ******* ***.**************

494. spacer 11.18|2251513|32|NC_018524|CRT matches to NZ_CP019459 (Streptomyces autolyticus strain CGMCC0516 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.781

gcgtacgcgtccatgtcctccacaccaccgcg	CRISPR spacer
gccgccccggccatgtcctccacaccatcgcc	Protospacer
**   * ** *****************.*** 

495. spacer 11.18|2251513|32|NC_018524|CRT matches to NZ_CP019459 (Streptomyces autolyticus strain CGMCC0516 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.781

gcgtacgcgtccatgtcctccacaccaccgcg	CRISPR spacer
gccgccccggccatgtcctccacaccatcgcc	Protospacer
**   * ** *****************.*** 

496. spacer 11.18|2251513|32|NC_018524|CRT matches to NZ_CP019459 (Streptomyces autolyticus strain CGMCC0516 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.781

gcgtacgcgtccatgtcctccacaccaccgcg	CRISPR spacer
gccgccccggccatgtcctccacaccatcgcc	Protospacer
**   * ** *****************.*** 

497. spacer 11.18|2251513|32|NC_018524|CRT matches to NZ_CP019461 (Streptomyces autolyticus strain CGMCC0516 plasmid unnamed4, complete sequence) position: , mismatch: 7, identity: 0.781

gcgtacgcgtccatgtcctccacaccaccgcg	CRISPR spacer
gccgccccggccatgtcctccacaccatcgcc	Protospacer
**   * ** *****************.*** 

498. spacer 11.18|2251513|32|NC_018524|CRT matches to NZ_CP019462 (Streptomyces autolyticus strain CGMCC0516 plasmid unnamed5, complete sequence) position: , mismatch: 7, identity: 0.781

gcgtacgcgtccatgtcctccacaccaccgcg	CRISPR spacer
gccgccccggccatgtcctccacaccatcgcc	Protospacer
**   * ** *****************.*** 

499. spacer 11.18|2251513|32|NC_018524|CRT matches to NZ_CP019463 (Streptomyces autolyticus strain CGMCC0516 plasmid unnamed6, complete sequence) position: , mismatch: 7, identity: 0.781

gcgtacgcgtccatgtcctccacaccaccgcg	CRISPR spacer
gccgccccggccatgtcctccacaccatcgcc	Protospacer
**   * ** *****************.*** 

500. spacer 11.18|2251513|32|NC_018524|CRT matches to NZ_CP019464 (Streptomyces autolyticus strain CGMCC0516 plasmid unnamed7, complete sequence) position: , mismatch: 7, identity: 0.781

gcgtacgcgtccatgtcctccacaccaccgcg	CRISPR spacer
gccgccccggccatgtcctccacaccatcgcc	Protospacer
**   * ** *****************.*** 

501. spacer 11.18|2251513|32|NC_018524|CRT matches to NC_042088 (Gordonia phage Gustav, complete genome) position: , mismatch: 7, identity: 0.781

gcgtacgcgtccatgtcctccacaccaccgcg	CRISPR spacer
gcgaacgcgtccatggcctccacggggccgct	Protospacer
*** *********** *******.  .**** 

502. spacer 12.1|2254172|29|NC_018524|PILER-CR matches to MT740733 (Ralstonia phage Dimitile, complete genome) position: , mismatch: 7, identity: 0.759

actcccacgtcaacgtcctgccactgtgg	CRISPR spacer
cacgccacgtcaacgtccagccacttcgg	Protospacer
  . ************** ****** .**

503. spacer 12.1|2254172|29|NC_018524|PILER-CR matches to MT740738 (Ralstonia phage Gamede, complete genome) position: , mismatch: 7, identity: 0.759

actcccacgtcaacgtcctgccactgtgg	CRISPR spacer
cacgccacgtcaacgtccagccacttcgg	Protospacer
  . ************** ****** .**

504. spacer 12.1|2254172|29|NC_018524|PILER-CR matches to MT740736 (Ralstonia phage Eline, complete genome) position: , mismatch: 7, identity: 0.759

actcccacgtcaacgtcctgccactgtgg	CRISPR spacer
cacgccacgtcaacgtccagccacttcgg	Protospacer
  . ************** ****** .**

505. spacer 12.1|2254172|29|NC_018524|PILER-CR matches to MT740730 (Ralstonia phage Cimandef, complete genome) position: , mismatch: 7, identity: 0.759

actcccacgtcaacgtcctgccactgtgg	CRISPR spacer
cacgccacgtcaacgtccagccacttcgg	Protospacer
  . ************** ****** .**

506. spacer 12.1|2254172|29|NC_018524|PILER-CR matches to MT740739 (Ralstonia phage Gerry, complete genome) position: , mismatch: 7, identity: 0.759

actcccacgtcaacgtcctgccactgtgg	CRISPR spacer
cacgccacgtcaacgtccagccacttcgg	Protospacer
  . ************** ****** .**

507. spacer 12.1|2254172|29|NC_018524|PILER-CR matches to MT740742 (Ralstonia phage Heva, complete genome) position: , mismatch: 7, identity: 0.759

actcccacgtcaacgtcctgccactgtgg	CRISPR spacer
cacgccacgtcaacgtccagccacttcgg	Protospacer
  . ************** ****** .**

508. spacer 12.1|2254172|29|NC_018524|PILER-CR matches to MT740727 (Ralstonia phage Alix, complete genome) position: , mismatch: 7, identity: 0.759

actcccacgtcaacgtcctgccactgtgg	CRISPR spacer
cacgccacgtcaacgtccagccacttcgg	Protospacer
  . ************** ****** .**

509. spacer 12.1|2254172|29|NC_018524|PILER-CR matches to MT361768 (Ralstonia phage RPZH6, complete genome) position: , mismatch: 7, identity: 0.759

actcccacgtcaacgtcctgccactgtgg	CRISPR spacer
cacgccacgtcaacgtccagccacttcgg	Protospacer
  . ************** ****** .**

510. spacer 12.1|2254172|29|NC_018524|PILER-CR matches to MT740731 (Ralstonia phage Claudette, complete genome) position: , mismatch: 7, identity: 0.759

actcccacgtcaacgtcctgccactgtgg	CRISPR spacer
cacgccacgtcaacgtccagccacttcgg	Protospacer
  . ************** ****** .**

511. spacer 12.1|2254172|29|NC_018524|PILER-CR matches to MH638294 (Ralstonia phage GP4, complete genome) position: , mismatch: 7, identity: 0.759

actcccacgtcaacgtcctgccactgtgg	CRISPR spacer
cacgccacgtcaacgtccagccacttcgg	Protospacer
  . ************** ****** .**

512. spacer 14.2|2268321|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP024582 (Roseomonas sp. FDAARGOS_362 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

ccgattcgccgccgtggccgccacactcaccg	CRISPR spacer
cgtgaccgccgccgtggccgccaccctcatcg	Protospacer
*  . .****************** ****.**

513. spacer 14.6|2268565|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP023549 (Rhodobacter sp. CZR27 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

aacacc-ggtctcgcgaccggagacgaggtcat	CRISPR spacer
-gcgccaggtctcgcgatcggacacgaggtcgg	Protospacer
 .*.** **********.**** ********. 

514. spacer 15.2|2270398|32|NC_018524|CRISPRCasFinder matches to NZ_CP026091 (Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

tccaggaggccgagacagctaccgttccccga	CRISPR spacer
tgcggtcggccgagacagctccggttccccgg	Protospacer
* *.*  ************* * ********.

515. spacer 15.2|2270398|32|NC_018524|CRISPRCasFinder matches to NZ_CP026093 (Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

tccaggaggccgagacagctaccgttccccga	CRISPR spacer
tgcggtcggccgagacagctccggttccccgg	Protospacer
* *.*  ************* * ********.

516. spacer 15.2|2270398|32|NC_018524|CRISPRCasFinder matches to NZ_CP012940 (Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

tccaggaggccgagacagctaccgttccccga	CRISPR spacer
tgcggtcggccgagacagctccggttccccgg	Protospacer
* *.*  ************* * ********.

517. spacer 15.2|2270398|32|NC_018524|CRISPRCasFinder matches to NZ_CP012944 (Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

tccaggaggccgagacagctaccgttccccga	CRISPR spacer
tgcggtcggccgagacagctccggttccccgg	Protospacer
* *.*  ************* * ********.

518. spacer 15.2|2270398|32|NC_018524|CRISPRCasFinder matches to NC_017575 (Ralstonia solanacearum Po82 megaplasmid, complete sequence) position: , mismatch: 7, identity: 0.781

tccaggaggccgagacagctaccgttccccga	CRISPR spacer
tgcggtcggccgagacagctccggttccccgg	Protospacer
* *.*  ************* * ********.

519. spacer 15.2|2270398|32|NC_018524|CRISPRCasFinder matches to NZ_CP026308 (Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

tccaggaggccgagacagctaccgttccccga	CRISPR spacer
tgcggtcggccgagacagctccggttccccgg	Protospacer
* *.*  ************* * ********.

520. spacer 15.2|2270398|32|NC_018524|CRISPRCasFinder matches to NZ_CP051295 (Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence) position: , mismatch: 7, identity: 0.781

tccaggaggccgagacagctaccgttccccga	CRISPR spacer
tgcggtcggccgagacagctccggttccccgg	Protospacer
* *.*  ************* * ********.

521. spacer 15.5|2270581|32|NC_018524|CRISPRCasFinder matches to NZ_CP017244 (Rhizobium etli 8C-3 plasmid pRsp8C3c, complete sequence) position: , mismatch: 7, identity: 0.781

gtctcggcagacggggacagcga-gggctacca	CRISPR spacer
gtctcggcggacggggacggcgatcggccgct-	Protospacer
********.*********.****  ***..*. 

522. spacer 15.12|2271008|32|NC_018524|CRISPRCasFinder matches to NZ_CP018075 (Streptomyces venezuelae strain NRRL B-65442 plasmid, complete sequence) position: , mismatch: 7, identity: 0.781

tcgatcgcgtggaaccccgggacgtccttgat	CRISPR spacer
ccgcgcacgtggaaccgcgggaggtccttgag	Protospacer
.**  *.********* ***** ******** 

523. spacer 15.26|2271065|29|NC_018524|CRT matches to MH590593 (Mycobacterium phage Rabinovish, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

524. spacer 15.26|2271065|29|NC_018524|CRT matches to KX781992 (Mycobacterium phage Gabriel, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

525. spacer 15.26|2271065|29|NC_018524|CRT matches to MH697579 (Mycobacterium phage Cane17, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
cgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

526. spacer 15.26|2271065|29|NC_018524|CRT matches to MK112554 (Mycobacterium phage TinyTim, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

527. spacer 15.26|2271065|29|NC_018524|CRT matches to MK359314 (Mycobacterium phage Ewok, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

528. spacer 15.26|2271065|29|NC_018524|CRT matches to MK359337 (Mycobacterium phage Flabslab, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

529. spacer 15.26|2271065|29|NC_018524|CRT matches to MN234193 (Mycobacterium phage Kboogie, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

530. spacer 15.26|2271065|29|NC_018524|CRT matches to MK450432 (Mycobacterium phage ValleyTerrace, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

531. spacer 15.26|2271065|29|NC_018524|CRT matches to MH051261 (Mycobacterium phage Tyke, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

532. spacer 15.26|2271065|29|NC_018524|CRT matches to MH779502 (Mycobacterium phage FudgeTart, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

533. spacer 15.26|2271065|29|NC_018524|CRT matches to MK359365 (Mycobacterium phage Loanshark, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

534. spacer 15.26|2271065|29|NC_018524|CRT matches to MK359311 (Mycobacterium phage SmallFry, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

535. spacer 15.26|2271065|29|NC_018524|CRT matches to MK359364 (Mycobacterium phage ChickenPhender, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

536. spacer 15.26|2271065|29|NC_018524|CRT matches to MK359303 (Mycobacterium phage Shnickers, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

537. spacer 15.26|2271065|29|NC_018524|CRT matches to MH697586 (Mycobacterium phage InigoMontoya, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

538. spacer 15.26|2271065|29|NC_018524|CRT matches to MK112549 (Mycobacterium phage Morizzled23, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

539. spacer 15.26|2271065|29|NC_018524|CRT matches to MK112541 (Mycobacterium phage Jessibeth14, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

540. spacer 15.26|2271065|29|NC_018524|CRT matches to MK359347 (Mycobacterium phage Ading, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

541. spacer 15.26|2271065|29|NC_018524|CRT matches to MK450425 (Mycobacterium phage Shelob, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

542. spacer 15.26|2271065|29|NC_018524|CRT matches to NC_023714 (Mycobacterium phage LinStu, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

543. spacer 15.26|2271065|29|NC_018524|CRT matches to MK359358 (Mycobacterium phage Essence, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

544. spacer 15.26|2271065|29|NC_018524|CRT matches to KJ595575 (Mycobacterium phage Willis, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

545. spacer 15.26|2271065|29|NC_018524|CRT matches to MG812493 (Mycobacterium phage NuevoMundo, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

546. spacer 15.26|2271065|29|NC_018524|CRT matches to MK359339 (Mycobacterium phage Naija, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

547. spacer 15.26|2271065|29|NC_018524|CRT matches to MK359333 (Mycobacterium phage JustHall, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

548. spacer 15.26|2271065|29|NC_018524|CRT matches to KT321476 (Mycobacterium phage Zeenon, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

549. spacer 15.26|2271065|29|NC_018524|CRT matches to MN428065 (Mycobacterium phage Cactojaque, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

550. spacer 15.26|2271065|29|NC_018524|CRT matches to MK359306 (Mycobacterium phage Norm, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

551. spacer 15.26|2271065|29|NC_018524|CRT matches to MN735434 (Mycobacterium phage Mangeria, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
cgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

552. spacer 15.26|2271065|29|NC_018524|CRT matches to JN699625 (Mycobacterium phage Wally, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

553. spacer 15.26|2271065|29|NC_018524|CRT matches to EU826471 (Mycobacterium phage Cali, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

554. spacer 15.26|2271065|29|NC_018524|CRT matches to KX721255 (Mycobacterium phage Yucca, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

555. spacer 15.26|2271065|29|NC_018524|CRT matches to MK359366 (Mycobacterium phage Basquiat, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

556. spacer 15.26|2271065|29|NC_018524|CRT matches to MK359346 (Mycobacterium phage NoodleTree, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

557. spacer 15.26|2271065|29|NC_018524|CRT matches to JN699013 (Mycobacterium phage Pio, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

558. spacer 15.26|2271065|29|NC_018524|CRT matches to MK359361 (Mycobacterium phage Darko, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

559. spacer 15.26|2271065|29|NC_018524|CRT matches to NC_023725 (Mycobacterium phage Nappy, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

560. spacer 15.26|2271065|29|NC_018524|CRT matches to MK359348 (Mycobacterium phage Rahel, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

561. spacer 15.26|2271065|29|NC_018524|CRT matches to MH779498 (Mycobacterium phage Bread, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

562. spacer 15.26|2271065|29|NC_018524|CRT matches to MK450427 (Mycobacterium phage Adlitam, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

563. spacer 15.26|2271065|29|NC_018524|CRT matches to MG812494 (Mycobacterium phage Pier, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

564. spacer 15.26|2271065|29|NC_018524|CRT matches to GQ303262 (Mycobacterium phage LRRHood, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

565. spacer 15.26|2271065|29|NC_018524|CRT matches to MT818423 (Mycobacterium phage Janiyra, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

566. spacer 15.26|2271065|29|NC_018524|CRT matches to MH316567 (Mycobacterium phage ParkTD, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

567. spacer 15.26|2271065|29|NC_018524|CRT matches to AY129337 (Mycobacteriophage Bxz1, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

568. spacer 15.26|2271065|29|NC_018524|CRT matches to MH051260 (Mycobacterium phage InterFolia, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

569. spacer 15.26|2271065|29|NC_018524|CRT matches to KX721256 (Mycobacterium phage Erdmann, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

570. spacer 15.26|2271065|29|NC_018524|CRT matches to MK359328 (Mycobacterium phage EmmaElysia, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

571. spacer 15.26|2271065|29|NC_018524|CRT matches to KM881426 (Mycobacterium phage ZygoTaiga) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

572. spacer 15.26|2271065|29|NC_018524|CRT matches to MK359335 (Mycobacterium phage Patter, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

573. spacer 15.26|2271065|29|NC_018524|CRT matches to MT889395 (Mycobacterium phage Shifa, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

574. spacer 15.26|2271065|29|NC_018524|CRT matches to EU826467 (Mycobacterium phage Rizal, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

575. spacer 15.26|2271065|29|NC_018524|CRT matches to MT723944 (Mycobacterium phage ChaylaJr, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

576. spacer 15.26|2271065|29|NC_018524|CRT matches to KR080196 (Mycobacterium phage Momo, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

577. spacer 15.26|2271065|29|NC_018524|CRT matches to MH910040 (Mycobacterium phage Sauce, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

578. spacer 15.26|2271065|29|NC_018524|CRT matches to MF919495 (Mycobacterium phage Bigswole, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

579. spacer 15.26|2271065|29|NC_018524|CRT matches to MK359318 (Mycobacterium phage Specks, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

580. spacer 15.26|2271065|29|NC_018524|CRT matches to KF024734 (Mycobacterium phage Shrimp, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

581. spacer 15.26|2271065|29|NC_018524|CRT matches to MK112548 (Mycobacterium phage McWolfish, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

582. spacer 15.26|2271065|29|NC_018524|CRT matches to MK359308 (Mycobacterium phage Shaqnato, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

583. spacer 15.26|2271065|29|NC_018524|CRT matches to MK112545 (Mycobacterium phage Khaleesi, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

584. spacer 15.26|2271065|29|NC_018524|CRT matches to MH825697 (Mycobacterium phage Bangla1971, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

585. spacer 15.26|2271065|29|NC_018524|CRT matches to MK359338 (Mycobacterium phage Amataga, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

586. spacer 15.26|2271065|29|NC_018524|CRT matches to MK359350 (Mycobacterium phage Nidhogg, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

587. spacer 15.26|2271065|29|NC_018524|CRT matches to MT723945 (Mycobacterium phage Quasimodo, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

588. spacer 15.26|2271065|29|NC_018524|CRT matches to MK359342 (Mycobacterium phage ShiaLabeouf, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

589. spacer 15.26|2271065|29|NC_018524|CRT matches to MH316561 (Mycobacterium phage Derek, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

590. spacer 15.26|2271065|29|NC_018524|CRT matches to MK112533 (Mycobacterium phage Bonray, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

591. spacer 15.26|2271065|29|NC_018524|CRT matches to MK450422 (Mycobacterium phage RoMag, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

592. spacer 15.26|2271065|29|NC_018524|CRT matches to MK359327 (Mycobacterium phage EmToTheThree, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

593. spacer 15.26|2271065|29|NC_018524|CRT matches to MH727543 (Mycobacterium phage CharlieB, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

594. spacer 15.26|2271065|29|NC_018524|CRT matches to JF704116 (Mycobacterium phage Drazdys, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

595. spacer 15.26|2271065|29|NC_018524|CRT matches to MK359336 (Mycobacterium phage Chargie21, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

596. spacer 15.26|2271065|29|NC_018524|CRT matches to MK359355 (Mycobacterium phage Sprinklers, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

597. spacer 15.26|2271065|29|NC_018524|CRT matches to MK112534 (Mycobacterium phage Burrough, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

598. spacer 15.26|2271065|29|NC_018524|CRT matches to MF919499 (Mycobacterium phage Daffodil, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

599. spacer 15.26|2271065|29|NC_018524|CRT matches to MK359334 (Mycobacterium phage Delilah, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

600. spacer 15.26|2271065|29|NC_018524|CRT matches to NC_023696 (Mycobacterium phage Dandelion, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

601. spacer 15.26|2271065|29|NC_018524|CRT matches to MN276192 (Mycobacterium phage Trinitium, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

602. spacer 15.26|2271065|29|NC_018524|CRT matches to MK359324 (Mycobacterium phage Tortoise16, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

603. spacer 15.26|2271065|29|NC_018524|CRT matches to MH825713 (Mycobacterium phage Zalkecks, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

604. spacer 15.26|2271065|29|NC_018524|CRT matches to MK359349 (Mycobacterium phage FoxtrotP1, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

605. spacer 15.26|2271065|29|NC_018524|CRT matches to JF704096 (Mycobacterium phage Ghost, complete sequence) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

606. spacer 15.26|2271065|29|NC_018524|CRT matches to MN062707 (Mycobacterium phage Grungle, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

607. spacer 15.26|2271065|29|NC_018524|CRT matches to MK359344 (Mycobacterium phage Napoleon13, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

608. spacer 15.26|2271065|29|NC_018524|CRT matches to MH727558 (Mycobacterium phage Salacia, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

609. spacer 15.26|2271065|29|NC_018524|CRT matches to MK359363 (Mycobacterium phage Fludd, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

610. spacer 15.26|2271065|29|NC_018524|CRT matches to KX831080 (Mycobacterium phage Lukilu, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

611. spacer 15.26|2271065|29|NC_018524|CRT matches to MK359329 (Mycobacterium phage Kamryn, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

612. spacer 15.26|2271065|29|NC_018524|CRT matches to JQ911768 (Mycobacterium phage Ava3, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

613. spacer 15.26|2271065|29|NC_018524|CRT matches to NC_004687 (Mycobacterium phage Bxz1, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

614. spacer 15.26|2271065|29|NC_018524|CRT matches to NC_011270 (Mycobacterium phage Spud, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

615. spacer 15.26|2271065|29|NC_018524|CRT matches to MN183280 (Mycobacteriophage LolaVinca, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

616. spacer 15.26|2271065|29|NC_018524|CRT matches to MK359345 (Mycobacterium phage QBert, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

617. spacer 15.26|2271065|29|NC_018524|CRT matches to GQ303260 (Mycobacterium phage ET08, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

618. spacer 15.26|2271065|29|NC_018524|CRT matches to MH744422 (Mycobacterium phage Roots515, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

619. spacer 15.26|2271065|29|NC_018524|CRT matches to MK359321 (Mycobacterium phage Phusco, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

620. spacer 15.26|2271065|29|NC_018524|CRT matches to MK359362 (Mycobacterium phage Atlantean, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

621. spacer 15.26|2271065|29|NC_018524|CRT matches to EU826469 (Mycobacterium phage ScottMcG, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

622. spacer 15.26|2271065|29|NC_018524|CRT matches to MK310143 (Mycobacterium phage Dietrick, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

623. spacer 15.26|2271065|29|NC_018524|CRT matches to MK450429 (Mycobacterium phage Bipolarisk, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

624. spacer 15.26|2271065|29|NC_018524|CRT matches to MH051266 (Mycobacterium phage MikeLiesIn, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

625. spacer 15.26|2271065|29|NC_018524|CRT matches to NC_029044 (Mycobacterium phage Breeniome, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

626. spacer 15.26|2271065|29|NC_018524|CRT matches to MH669008 (Mycobacterium phage Megamind, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

627. spacer 15.26|2271065|29|NC_018524|CRT matches to MK878897 (Mycobacterium phage Blackbrain, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

628. spacer 15.26|2271065|29|NC_018524|CRT matches to MK450434 (Mycobacterium phage DrPhinkDaddy, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

629. spacer 15.26|2271065|29|NC_018524|CRT matches to MK359359 (Mycobacterium phage Colt, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
cgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

630. spacer 15.26|2271065|29|NC_018524|CRT matches to MF919527 (Mycobacterium phage Phox, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

631. spacer 15.26|2271065|29|NC_018524|CRT matches to MT818416 (Mycobacterium phage BackyardAgain, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

632. spacer 15.26|2271065|29|NC_018524|CRT matches to MK359330 (Mycobacterium phage Iota, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

633. spacer 15.26|2271065|29|NC_018524|CRT matches to KT365398 (Mycobacterium phage DTDevon, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

634. spacer 15.26|2271065|29|NC_018524|CRT matches to KX369583 (Mycobacterium phage Littleton, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

635. spacer 15.26|2271065|29|NC_018524|CRT matches to MF919494 (Mycobacterium phage BeanWater, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

636. spacer 15.26|2271065|29|NC_018524|CRT matches to NC_028869 (Mycobacterium phage HyRo, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

637. spacer 15.26|2271065|29|NC_018524|CRT matches to KT365400 (Mycobacterium phage ErnieJ, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

638. spacer 15.26|2271065|29|NC_018524|CRT matches to KC691257 (Mycobacterium phage Astraea, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

639. spacer 15.26|2271065|29|NC_018524|CRT matches to MG872839 (Mycobacterium phage LifeSavor, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

640. spacer 15.26|2271065|29|NC_018524|CRT matches to KC748968 (Mycobacterium phage Gizmo, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

641. spacer 15.26|2271065|29|NC_018524|CRT matches to KC748970 (Mycobacterium phage ArcherS7, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

642. spacer 15.26|2271065|29|NC_018524|CRT matches to MK359353 (Mycobacterium phage BadAgartude, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

643. spacer 15.26|2271065|29|NC_018524|CRT matches to MH697590 (Mycobacterium phage Phlegm, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

644. spacer 15.26|2271065|29|NC_018524|CRT matches to MK359317 (Mycobacterium phage FrayBell, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

645. spacer 15.26|2271065|29|NC_018524|CRT matches to MT553335 (Mycobacterium phage Ronan, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

646. spacer 15.26|2271065|29|NC_018524|CRT matches to MN428066 (Mycobacterium phage JPickles, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

647. spacer 15.26|2271065|29|NC_018524|CRT matches to MK359305 (Mycobacterium phage Teardrop, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

648. spacer 15.26|2271065|29|NC_018524|CRT matches to DQ398053 (Mycobacteriophage Catera, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

649. spacer 15.26|2271065|29|NC_018524|CRT matches to MF919513 (Mycobacterium phage Koguma, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

650. spacer 15.26|2271065|29|NC_018524|CRT matches to JN699626 (Mycobacterium phage MoMoMixon, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

651. spacer 15.26|2271065|29|NC_018524|CRT matches to NC_028986 (Mycobacterium phage Alice, complete sequence) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

652. spacer 15.26|2271065|29|NC_018524|CRT matches to MK450424 (Mycobacterium phage Melpomini, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

653. spacer 15.26|2271065|29|NC_018524|CRT matches to JN204348 (Mycobacterium phage Sebata, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

654. spacer 15.26|2271065|29|NC_018524|CRT matches to MN183285 (Mycobacterium phage YoungMoneyMata, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

655. spacer 15.26|2271065|29|NC_018524|CRT matches to MK450423 (Mycobacterium phage Stubby, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

656. spacer 15.26|2271065|29|NC_018524|CRT matches to MF919493 (Mycobacterium phage Audrick, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

657. spacer 15.26|2271065|29|NC_018524|CRT matches to NC_008207 (Mycobacterium phage Catera, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

658. spacer 15.26|2271065|29|NC_018524|CRT matches to JN624850 (Mycobacterium phage Pleione, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

659. spacer 15.26|2271065|29|NC_018524|CRT matches to KX752698 (Mycobacterium phage Tonenili, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
cgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

660. spacer 15.26|2271065|29|NC_018524|CRT matches to MK359326 (Mycobacterium phage Pivoine, complete genome) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
tgactcggccatccggcggaacgcggtct	Protospacer
    ***** ********* ******** 

661. spacer 15.26|2271065|29|NC_018524|CRT matches to NZ_CP032324 (Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
gcgcccggcgatgcggcggtacgtggtca	Protospacer
.*  .******* **********.****.

662. spacer 15.26|2271065|29|NC_018524|CRT matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
cgggtcggcgatctggcggtgcgcggacc	Protospacer
   **********.******.***** * 

663. spacer 15.26|2271065|29|NC_018524|CRT matches to NZ_CP032054 (Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
cgggtcggcgatctggcggtgcgcggacc	Protospacer
   **********.******.***** * 

664. spacer 15.26|2271065|29|NC_018524|CRT matches to NZ_CP032054 (Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
cgggtcggcgatctggcggtgcgcggacc	Protospacer
   **********.******.***** * 

665. spacer 15.26|2271065|29|NC_018524|CRT matches to NZ_CP016560 (Streptomyces clavuligerus strain F613-1 plasmid pSCL4, complete sequence) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
cgggtcggcgatctggcggtgcgcggacc	Protospacer
   **********.******.***** * 

666. spacer 15.26|2271065|29|NC_018524|CRT matches to NZ_CP029452 (Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
atcgtcggcgatctgtcggtacgcgaaaa	Protospacer
*.***********.* *********.  .

667. spacer 15.26|2271065|29|NC_018524|CRT matches to NZ_CP023071 (Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
atcgtcggcgatctgtcggtacgcgaaaa	Protospacer
*.***********.* *********.  .

668. spacer 15.26|2271065|29|NC_018524|CRT matches to NZ_CP023976 (Streptomyces alboflavus strain MDJK44 plasmid pMDJK44.1, complete sequence) position: , mismatch: 7, identity: 0.759

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
gccctcggcgatccggcggtaggcagcga	Protospacer
.** ***************** **.*. .

669. spacer 18.2|2357908|28|NC_018524|CRISPRCasFinder matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 7, identity: 0.75

cgccgggccgcccggggccggctccgcg	CRISPR spacer
ggccgggccgcccgggaccggccgcagc	Protospacer
 ***************.*****. *.  

670. spacer 18.2|2357908|28|NC_018524|CRISPRCasFinder matches to NC_015314 (Pseudonocardia dioxanivorans CB1190 plasmid pPSED01, complete sequence) position: , mismatch: 7, identity: 0.75

cgccgggccgcccggggccggctccgcg	CRISPR spacer
atgctggccgcccggggccggctgcgaa	Protospacer
   * ****************** ** .

671. spacer 18.2|2357908|28|NC_018524|CRISPRCasFinder matches to NC_017958 (Tistrella mobilis KA081020-065 plasmid pTM3, complete sequence) position: , mismatch: 7, identity: 0.75

cgccgggccgcccggggccggctccgcg	CRISPR spacer
gtagaggccgcccggtgccggcgccgcg	Protospacer
    .********** ****** *****

672. spacer 19.5|4409022|32|NC_018524|CRT matches to NZ_CP007129 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.781

ttccaccaccgcgccgagcgcgaacgggagcg	CRISPR spacer
gctcgccgccgcgccgagcacgaacgggagca	Protospacer
 ..*.**.***********.***********.

673. spacer 21.12|4582845|33|NC_018524|PILER-CR matches to NZ_CP045120 (Rubrobacter sp. SCSIO 52909 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.788

ggaacgacggccgggtcgtcgtggtcctggccg	CRISPR spacer
gccacgacggccgggtcgtcggggtccaccccc	Protospacer
*  ****************** *****   ** 

674. spacer 21.12|4582845|33|NC_018524|PILER-CR matches to LN997843 (Streptomyces reticuli genome assembly TUE45, plasmid : II) position: , mismatch: 7, identity: 0.788

ggaacgacggccgggtcgtcgtggtcctggccg	CRISPR spacer
gcgccgacggcccggtcgtcgtggtccggggca	Protospacer
* . ******** ************** ** *.

675. spacer 21.18|4582419|32|NC_018524|CRISPRCasFinder,CRT matches to MN445183 (Salmonella phage vB_SalM_SA002, complete genome) position: , mismatch: 7, identity: 0.781

ctgtgggcttgaccagcaggcccttgaagatc	CRISPR spacer
gtgccgtctttaccagcaggaccttgaagacc	Protospacer
 **. * *** ********* *********.*

676. spacer 21.19|4582480|32|NC_018524|CRISPRCasFinder,CRT matches to KX066068 (Pseudomonas phage VSW-3, complete genome) position: , mismatch: 7, identity: 0.781

aacttctccagctccttgtgagcgctctcccg	CRISPR spacer
tgatcctccagctccttgagagcgctctcagg	Protospacer
 . *.************* **********  *

677. spacer 21.20|4582541|32|NC_018524|CRISPRCasFinder,CRT matches to NC_012586 (Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence) position: , mismatch: 7, identity: 0.781

gtcgagtgccgtggcctcacggtcgtcggcga	CRISPR spacer
ccggaaggacgcggcctcacggtcgtcggcga	Protospacer
 . **. * **.********************

678. spacer 21.20|4582541|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP029452 (Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence) position: , mismatch: 7, identity: 0.781

gtcgagtgccgtggcctcacggtcgtcggcga	CRISPR spacer
ccggatggccgcggcctcacggtcgtgggcga	Protospacer
 . **  ****.************** *****

679. spacer 21.20|4582541|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP023071 (Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence) position: , mismatch: 7, identity: 0.781

gtcgagtgccgtggcctcacggtcgtcggcga	CRISPR spacer
ccggatggccgcggcctcacggtcgtgggcga	Protospacer
 . **  ****.************** *****

680. spacer 21.20|4582541|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP029232 (Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence) position: , mismatch: 7, identity: 0.781

gtcgagtgccgtggcctcacggtcgtcggcga	CRISPR spacer
ccggatggacgcggcctcacggtcgtcggcga	Protospacer
 . **  * **.********************

681. spacer 21.25|4582846|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP045120 (Rubrobacter sp. SCSIO 52909 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

gaacgacggccgggtcgtcgtggtcctggccg	CRISPR spacer
ccacgacggccgggtcgtcggggtccaccccc	Protospacer
  ****************** *****   ** 

682. spacer 21.25|4582846|32|NC_018524|CRISPRCasFinder,CRT matches to LN997843 (Streptomyces reticuli genome assembly TUE45, plasmid : II) position: , mismatch: 7, identity: 0.781

gaacgacggccgggtcgtcgtggtcctggccg	CRISPR spacer
cgccgacggcccggtcgtcgtggtccggggca	Protospacer
 . ******** ************** ** *.

683. spacer 21.25|4582846|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP032685 (Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence) position: , mismatch: 7, identity: 0.781

gaacgacggccgggtcgtcgtggtcctggccg	CRISPR spacer
gaaggacggccgggtcgtcgcggatcgcgctg	Protospacer
*** ****************.** .*  **.*

684. spacer 21.25|4582846|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP032690 (Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence) position: , mismatch: 7, identity: 0.781

gaacgacggccgggtcgtcgtggtcctggccg	CRISPR spacer
gaaggacggccgggtcgtcgcggatcgcgctg	Protospacer
*** ****************.** .*  **.*

685. spacer 21.25|4582846|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_LR134460 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 18, complete sequence) position: , mismatch: 7, identity: 0.781

gaacgacggccgggtcgtcgtggtcctggccg	CRISPR spacer
ggacgacgtccgcgtcgtcgtggtcaaggact	Protospacer
*.****** *** ************  ** * 

686. spacer 23.5|4591847|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP023408 (Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.781

accgacttgccggtgaacgccccgtcggggcc	CRISPR spacer
tcggcccagccgacgaacgccccgtcggggcc	Protospacer
 * * *. ****..******************

687. spacer 23.8|4592030|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_008384 (Rhizobium leguminosarum bv. viciae 3841 plasmid pRL11, complete sequence) position: , mismatch: 7, identity: 0.781

acaaaggcctcccccagcttcttgatctgtcg	CRISPR spacer
ccaagctcgtcctccagcttcttgatctgccg	Protospacer
 ***.  * ***.****************.**

688. spacer 23.8|4592030|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP018230 (Rhizobium leguminosarum strain Vaf-108 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.781

acaaaggcctcccccagcttcttgatctgtcg	CRISPR spacer
ccaagctcgtcctccagcttcttgatctgccg	Protospacer
 ***.  * ***.****************.**

689. spacer 23.8|4592030|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP048282 (Rhizobium leguminosarum bv. viciae 248 plasmid pRle248d, complete sequence) position: , mismatch: 7, identity: 0.781

acaaaggcctcccccagcttcttgatctgtcg	CRISPR spacer
ccaagctcgtcctccagcttcttgatctgccg	Protospacer
 ***.  * ***.****************.**

690. spacer 23.8|4592030|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP053208 (Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1B, complete sequence) position: , mismatch: 7, identity: 0.781

acaaaggcctcccccagcttcttgatctgtcg	CRISPR spacer
ccaagctcgtcctccagcttcttgatctgccg	Protospacer
 ***.  * ***.****************.**

691. spacer 23.9|4592091|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP007797 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p4, complete sequence) position: , mismatch: 7, identity: 0.781

gctcgtcgaaggcggggttcgcgc-caacgacc	CRISPR spacer
cctcgccgaaggcggggttggcgctccgcgat-	Protospacer
 ****.************* **** * .***. 

692. spacer 23.9|4592091|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_AP022319 (Burkholderia sp. THE68 plasmid BTHE68_p1, complete sequence) position: , mismatch: 7, identity: 0.781

gctcgtcgaaggcggggttcgcgccaacgacc	CRISPR spacer
acgcgtcgaaggcggcgctcgcgccactgagc	Protospacer
.* ************ *.******** .** *

693. spacer 23.9|4592091|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032348 (Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence) position: , mismatch: 7, identity: 0.781

gctcgtcgaaggcggggttcgcgcca-acgacc	CRISPR spacer
cctcgccgaaggcggggttggcgctgcgcgac-	Protospacer
 ****.************* ****.. .**** 

694. spacer 25.5|4595383|32|NC_018524|CRISPRCasFinder matches to FJ937737 (Burkholderia cenocepacia phage BcepIL02, complete genome) position: , mismatch: 7, identity: 0.781

cgccgtgt-gtgggccgcgctcggcccgatccg	CRISPR spacer
-accatctcgtggggcgcgctcggctcgatcct	Protospacer
 .**.* * ***** **********.****** 

695. spacer 25.5|4595383|32|NC_018524|CRISPRCasFinder matches to NC_012743 (Burkholderia phage BcepIL02, complete genome) position: , mismatch: 7, identity: 0.781

cgccgtgt-gtgggccgcgctcggcccgatccg	CRISPR spacer
-accatctcgtggggcgcgctcggctcgatcct	Protospacer
 .**.* * ***** **********.****** 

696. spacer 25.7|4595504|32|NC_018524|CRISPRCasFinder matches to NZ_CP030127 (Indioceanicola profundi strain SCSIO 08040 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

gctacgcggaacctcgcgcacatctgatgtgt	CRISPR spacer
gctacgcggaacctgccgcacatcggcggatt	Protospacer
**************  ******** *  *  *

697. spacer 25.8|4595565|32|NC_018524|CRISPRCasFinder matches to NC_005009 (Pseudomonas putida plasmid pYQ39, complete sequence) position: , mismatch: 7, identity: 0.781

gtcgccaagctggatgccagccgccacgcggt	CRISPR spacer
ctggccaagcaggatgacagccgccactgggg	Protospacer
 * ******* ***** **********  ** 

698. spacer 25.8|4595565|32|NC_018524|CRISPRCasFinder matches to NZ_CP028351 (Pantoea vagans strain PV989 plasmid pPV989-167, complete sequence) position: , mismatch: 7, identity: 0.781

gtcgccaagctggatgccagccgccacgcggt	CRISPR spacer
ggcaccggactggatgccagcggccaggcggt	Protospacer
* *.**...************ **** *****

699. spacer 25.8|4595565|32|NC_018524|CRISPRCasFinder matches to NZ_CP038855 (Pantoea vagans strain LMG 24199 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.781

gtcgccaagctggatgccagccgccacgcggt	CRISPR spacer
ggcaccggactggatgccagcggccaggcggt	Protospacer
* *.**...************ **** *****

700. spacer 25.8|4595565|32|NC_018524|CRISPRCasFinder matches to NC_014561 (Pantoea vagans C9-1 plasmid pPag1, complete sequence) position: , mismatch: 7, identity: 0.781

gtcgccaagctggatgccagccgccacgcggt	CRISPR spacer
ggcaccggactggatgccagcggccaggcggt	Protospacer
* *.**...************ **** *****

701. spacer 26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP030841 (Acidisarcina polymorpha strain SBC82 plasmid pACPOL1, complete sequence) position: , mismatch: 7, identity: 0.781

ttgttcgcctgctcggcggtgagcttcacgac	CRISPR spacer
tggcgggcctggtcggcggtgagcttgacgag	Protospacer
* *.  ***** ************** **** 

702. spacer 26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP030842 (Acidisarcina polymorpha strain SBC82 plasmid pACPOL2, complete sequence) position: , mismatch: 7, identity: 0.781

ttgttcgcctgctcggcggtgagcttcacgac	CRISPR spacer
tggcgggcctggtcggcggtgagcttcgcgag	Protospacer
* *.  ***** ***************.*** 

703. spacer 26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP030843 (Acidisarcina polymorpha strain SBC82 plasmid pACPOL4, complete sequence) position: , mismatch: 7, identity: 0.781

ttgttcgcctgctcggcggtgagcttcacgac	CRISPR spacer
tggcgggcctggtcggcggtgagcttcgcgag	Protospacer
* *.  ***** ***************.*** 

704. spacer 26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT matches to MK376962 (Gordonia phage NosilaM, complete genome) position: , mismatch: 7, identity: 0.781

ttgttcgcctgctcggcggtgagcttcacgac	CRISPR spacer
acgcgcgcctgcacgccggtgagcttcacgtc	Protospacer
 .*. ******* ** ************** *

705. spacer 26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_AP021845 (Azospira sp. I09 plasmid pAZI09, complete sequence) position: , mismatch: 7, identity: 0.781

ttgttcgcctgctcggcggtgagcttcacgac	CRISPR spacer
tcgttcgcctgctgggcggtgatctgccggtc	Protospacer
*.*********** ******** ** *  * *

706. spacer 26.18|4598755|32|NC_018524|CRISPRCasFinder,CRT matches to MT498057 (Microbacterium phage Cicada, complete genome) position: , mismatch: 7, identity: 0.781

gaccccgcgttcaccgatgccgtgaccgattg	CRISPR spacer
gccgccgcgttcaccgaggccgtgtccgacga	Protospacer
* * ************* ****** ****. .

707. spacer 26.18|4598755|32|NC_018524|CRISPRCasFinder,CRT matches to MK016497 (Microbacterium phage Johann, complete genome) position: , mismatch: 7, identity: 0.781

gaccccgcgttcaccgatgccgtgaccgattg	CRISPR spacer
gccgccgcgttcaccgaggccgtgtccgacga	Protospacer
* * ************* ****** ****. .

708. spacer 26.18|4598755|32|NC_018524|CRISPRCasFinder,CRT matches to MN369765 (Microbacterium phage Zanella, complete genome) position: , mismatch: 7, identity: 0.781

gaccccgcgttcaccgatgccgtgaccgattg	CRISPR spacer
gccgccgcgttcaccgaggccgtgtccgacga	Protospacer
* * ************* ****** ****. .

709. spacer 26.18|4598755|32|NC_018524|CRISPRCasFinder,CRT matches to MK016495 (Microbacterium phage Goodman, complete genome) position: , mismatch: 7, identity: 0.781

gaccccgcgttcaccgatgccgtgaccgattg	CRISPR spacer
gccgccgcgttcaccgaggccgtgtccgacga	Protospacer
* * ************* ****** ****. .

710. spacer 26.20|4598877|32|NC_018524|CRISPRCasFinder,CRT matches to NC_016585 (Azospirillum lipoferum 4B plasmid AZO_p1, complete sequence) position: , mismatch: 7, identity: 0.781

--caccagacgccgtgctcgtccggctggccgaa	CRISPR spacer
atcgcc--gcgccgtgctcgaccggctggccggc	Protospacer
  *.**  .*********** ***********. 

711. spacer 26.20|4598877|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_LR134456 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 14, complete sequence) position: , mismatch: 7, identity: 0.781

caccagacgccgtgctcgtccggctggccgaa	CRISPR spacer
ccgcggccgccgtgctcgaccggatggccgag	Protospacer
*  *.* *********** **** *******.

712. spacer 26.20|4598877|32|NC_018524|CRISPRCasFinder,CRT matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 7, identity: 0.781

caccag--acgccgtgctcgtccggctggccgaa	CRISPR spacer
--ccaacttcgccacgctcgtccggctggccgac	Protospacer
  ***.   ****..****************** 

713. spacer 26.20|4598877|32|NC_018524|CRISPRCasFinder,CRT matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 7, identity: 0.781

caccag--acgccgtgctcgtccggctggccgaa	CRISPR spacer
--ccaacttcgccacgctcgtccggctggccgac	Protospacer
  ***.   ****..****************** 

714. spacer 26.20|4598877|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP030074 (Streptomyces sp. ZFG47 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

caccagacgccgtgctcgtccggctggccgaa	CRISPR spacer
caccgctgaccgtgctcggccggctgtccgaa	Protospacer
****.   .********* ******* *****

715. spacer 26.21|4598938|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP013381 (Burkholderia sp. Bp5365 strain MSMB43 plasmid pMSMB43, complete sequence) position: , mismatch: 7, identity: 0.781

ggcggcaggccggtacggtgccgccatggatc--	CRISPR spacer
ggcggccgaccggtacggtgccg--atcggccgg	Protospacer
****** *.**************  ** *..*  

716. spacer 26.21|4598938|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP029357 (Azospirillum sp. CFH 70021 plasmid unnamed2) position: , mismatch: 7, identity: 0.781

ggcggcaggccggtacggtgccgccatggatc	CRISPR spacer
ggcggcaggccggtaccgcgccgtaatcgtcc	Protospacer
**************** *.****. ** * .*

717. spacer 26.21|4598938|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP009547 (Burkholderia sp. 2002721687 plasmid pBTU, complete sequence) position: , mismatch: 7, identity: 0.781

ggcggcaggccggtacggtgccgccatggatc--	CRISPR spacer
ggcggccgaccggtacggtgccg--atcggccgg	Protospacer
****** *.**************  ** *..*  

718. spacer 26.23|4599060|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 7, identity: 0.781

caggccctggaggacagccggtccgcccgcgc	CRISPR spacer
cgggacctggaggacggccggtccgctgccga	Protospacer
*.** **********.**********.  ** 

719. spacer 26.23|4599060|32|NC_018524|CRISPRCasFinder,CRT matches to NC_013855 (Azospirillum sp. B510 plasmid pAB510a, complete sequence) position: , mismatch: 7, identity: 0.781

caggccctggaggacagccggtccgccc-gcgc	CRISPR spacer
cgcagcctggaggacagccgggtcgccctgcg-	Protospacer
*. . **************** .***** *** 

720. spacer 26.23|4599060|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP054618 (Azospirillum oryzae strain KACC 14407 plasmid unnamed4, complete sequence) position: , mismatch: 7, identity: 0.781

caggccctggaggacagccggtccgccc-gcgc	CRISPR spacer
cgcagcctggaggacagccgggtcgccctgcg-	Protospacer
*. . **************** .***** *** 

721. spacer 26.23|4599060|32|NC_018524|CRISPRCasFinder,CRT matches to NC_009621 (Sinorhizobium medicae WSM419 plasmid pSMED02, complete sequence) position: , mismatch: 7, identity: 0.781

----caggccctggaggacagccggtccgcccgcgc	CRISPR spacer
agaacagg----agagtgcagccggtccgcccgcgc	Protospacer
    ****    .*** .******************

722. spacer 26.23|4599060|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP016452 (Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence) position: , mismatch: 7, identity: 0.781

caggcc--ctggaggacagccggtccgcccgcgc	CRISPR spacer
--ggccttctggacggcagccggtccgcccggct	Protospacer
  ****  ***** *.***************  .

723. spacer 26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT matches to MG869619 (Polaromonas sp. H1N plasmid pH1NP1, complete sequence) position: , mismatch: 7, identity: 0.781

acctcgaactcgcggcgctcgcggccgtcacg-	CRISPR spacer
tgctcgaacacgccgcgctcgcgg-caccacgc	Protospacer
  ******* *** ********** *..**** 

724. spacer 26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT matches to MG869622 (Polaromonas sp. H8N plasmid pH8NP2, complete sequence) position: , mismatch: 7, identity: 0.781

acctcgaactcgcggcgctcgcggccgtcacg-	CRISPR spacer
tgctcgaacacgccgcgctcgcgg-caccacgc	Protospacer
  ******* *** ********** *..**** 

725. spacer 26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_LN868941 (Nocardia farcinica strain NCTC11134 plasmid 4, complete sequence) position: , mismatch: 7, identity: 0.781

acctcgaactcgcggcgctcgcggccgtcacg	CRISPR spacer
accttccggtcgcggcgctcgcggccgcgacg	Protospacer
****.  . ******************. ***

726. spacer 26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP031419 (Nocardia farcinica strain W6977 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

acctcgaactcgcggcgctcgcggccgtcacg	CRISPR spacer
accttccggtcgcggcgctcgcggccgcgacg	Protospacer
****.  . ******************. ***

727. spacer 26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT matches to NC_006911 (Streptomyces sp. F11 plasmid pFP11, complete sequence) position: , mismatch: 7, identity: 0.781

acctcgaa--ctcgcggcgctcgcggccgtcacg	CRISPR spacer
--cgcggatcctcgcggcgctcccggccgccacc	Protospacer
  * **.*  ************ ******.*** 

728. spacer 27.1|4607990|32|NC_018524|CRISPRCasFinder matches to MH513974 (Gordonia phage LastResort, complete genome) position: , mismatch: 7, identity: 0.781

gctcgcc--agtcccggtcgtggtgggtgtcctc	CRISPR spacer
--tcgacgaggtcccggtcgtggaaggtgtcctg	Protospacer
  *** *  .************* .******** 

729. spacer 27.1|4607990|32|NC_018524|CRISPRCasFinder matches to KX557283 (Gordonia phage Remus, complete genome) position: , mismatch: 7, identity: 0.781

gctcgcc--agtcccggtcgtggtgggtgtcctc	CRISPR spacer
--tcgacgaggtcccggtcgtggaaggtgtcctg	Protospacer
  *** *  .************* .******** 

730. spacer 27.1|4607990|32|NC_018524|CRISPRCasFinder matches to MT522007 (Gordonia phage Epsocamisio, complete genome) position: , mismatch: 7, identity: 0.781

gctcgcc--agtcccggtcgtggtgggtgtcctc	CRISPR spacer
--tcgacgaggtcccggtcgtggaaggtgtcctg	Protospacer
  *** *  .************* .******** 

731. spacer 27.1|4607990|32|NC_018524|CRISPRCasFinder matches to KX557280 (Gordonia phage JSwag, complete genome) position: , mismatch: 7, identity: 0.781

gctcgcc--agtcccggtcgtggtgggtgtcctc	CRISPR spacer
--tcgacgaggtcccggtcgtggaaggtgtcctg	Protospacer
  *** *  .************* .******** 

732. spacer 27.1|4607990|32|NC_018524|CRISPRCasFinder matches to NC_042123 (Gordonia phage Waits, complete genome) position: , mismatch: 7, identity: 0.781

gctcgcc--agtcccggtcgtggtgggtgtcctc	CRISPR spacer
--tcgacgaggtcccggtcgtggaaggtgtcctg	Protospacer
  *** *  .************* .******** 

733. spacer 27.1|4607990|32|NC_018524|CRISPRCasFinder matches to NC_041886 (Gordonia phage Strosahl, complete genome) position: , mismatch: 7, identity: 0.781

gctcgcc--agtcccggtcgtggtgggtgtcctc	CRISPR spacer
--tcgacgaggtcccggtcgtggaaggtgtcctg	Protospacer
  *** *  .************* .******** 

734. spacer 28.1|4608658|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP015739 (Shinella sp. HZN7 plasmid pShin-03, complete sequence) position: , mismatch: 7, identity: 0.781

ccaccgcccgggaggccgcccaccgggccgca	CRISPR spacer
tctcgacccgggaggccgccgaccgggccgtc	Protospacer
.* * .************** *********. 

735. spacer 28.1|4608658|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 7, identity: 0.781

ccaccgcccgggaggccgcccaccgggccgca	CRISPR spacer
acaccgccctggaggccgcccaccgccacgtc	Protospacer
 ******** ***************   **. 

736. spacer 28.1|4608658|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 7, identity: 0.781

ccaccgcccgggaggccgcccaccgggccgca	CRISPR spacer
acaccgccctggaggccgcccaccgccacgtc	Protospacer
 ******** ***************   **. 

737. spacer 28.1|4608658|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013635 (Rhizobium sp. N324 plasmid pRspN324e, complete sequence) position: , mismatch: 7, identity: 0.781

ccaccgcccgggaggccgcccaccgggccgca	CRISPR spacer
gcatggcccgcgaggccgcccagcgggcctcg	Protospacer
 **. ***** *********** ****** *.

738. spacer 28.1|4608658|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_008308 (Sphingomonas sp. KA1 plasmid pCAR3 DNA, complete sequence) position: , mismatch: 7, identity: 0.781

ccaccgcccgggaggccgcccaccgggccgca	CRISPR spacer
gcgcggtccgggacgcctcccaccgggccgcg	Protospacer
 *.* *.****** *** *************.

739. spacer 28.1|4608658|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP054028 (Rhizobium sp. JKLM19E plasmid pPR19E01, complete sequence) position: , mismatch: 7, identity: 0.781

ccaccgcccgggaggccgcccaccgggccgca-	CRISPR spacer
ggcccggccgggaggccgaccacc-ggccgcgg	Protospacer
   *** *********** ***** ******. 

740. spacer 28.2|4608719|33|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_016626 (Burkholderia sp. YI23 plasmid byi_1p, complete sequence) position: , mismatch: 7, identity: 0.788

ggtcgtagcctaccgacgctgccgagccccgga	CRISPR spacer
cgtcgtagcctaccgtcgctgccgcgccactcg	Protospacer
 ************** ******** *** *  .

741. spacer 28.4|4608842|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 7, identity: 0.781

ccggaaccggcacgagcacctgctccggttcc	CRISPR spacer
cggcgacctgcacgagcacctgccccgggccc	Protospacer
* * .*** **************.**** .**

742. spacer 30.2|4637791|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP025013 (Rhizobium leguminosarum strain Norway plasmid pRLN1, complete sequence) position: , mismatch: 7, identity: 0.781

gagggcagtcgatgatgatctcgtcgaactct	CRISPR spacer
gcgggcagtcgatgatgaattcgtcgacgcca	Protospacer
* **************** .*******  .* 

743. spacer 30.2|4637791|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_LR594691 (Variovorax sp. WDL1 plasmid 3) position: , mismatch: 7, identity: 0.781

gagggcagtcgatgatgatctcgtcgaactct	CRISPR spacer
ggggcgtgtcgatgatgatcacgtcgtactcg	Protospacer
*.**   ************* ***** **** 

744. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 7, identity: 0.781

cctcggggc----cggcggtgatcgccccggcccgc	CRISPR spacer
----ggtgcatgacggcggtgagcgccccggccagc	Protospacer
    ** **    ********* ********** **

745. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 7, identity: 0.781

cctcggggc----cggcggtgatcgccccggcccgc	CRISPR spacer
----ggtgcatgacggcggtgagcgccccggccagc	Protospacer
    ** **    ********* ********** **

746. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_008697 (Nocardioides sp. JS614 plasmid pNOCA01, complete sequence) position: , mismatch: 7, identity: 0.781

cctcggggccggcggtgatcgccccggcccgc	CRISPR spacer
ccaacggggcggcggtgatcgacccggcccag	Protospacer
**   *** ************ ********. 

747. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP007792 (Corynebacterium marinum DSM 44953 plasmid pCmarinum1, complete sequence) position: , mismatch: 7, identity: 0.781

cctcggggc----cggcggtgatcgccccggcccgc	CRISPR spacer
----ggggtgcggcggcggtgatcgccgcggccagc	Protospacer
    ****.    ************** ***** **

748. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP015269 (Mycobacterium chimaera strain ZUERICH-2 plasmid unnamed 2, complete sequence) position: , mismatch: 7, identity: 0.781

cctcggggccggcggtgatcgccccggcccgc---	CRISPR spacer
cctgggcgccggcggtgatcgcc---gcccaagtg	Protospacer
*** ** ****************   ****.    

749. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to CP006583 (Mesorhizobium huakuii 7653R plasmid pMHb, complete sequence) position: , mismatch: 7, identity: 0.781

cctcggggccggcggtgatcgccc--cggcccgc	CRISPR spacer
cctcgaggccggcgatgatcgcctggcggtcg--	Protospacer
*****.********.********.  ***.*   

750. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to CP006583 (Mesorhizobium huakuii 7653R plasmid pMHb, complete sequence) position: , mismatch: 7, identity: 0.781

cctcggggccggcggtgatcgccc--cggcccgc	CRISPR spacer
cctcgaggccggcgatgatcgcctggcggtcg--	Protospacer
*****.********.********.  ***.*   

751. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to CP006583 (Mesorhizobium huakuii 7653R plasmid pMHb, complete sequence) position: , mismatch: 7, identity: 0.781

cctcggggccggcggtgatcgccc--cggcccgc	CRISPR spacer
cctcgaggccggcgatgatcgcctggcggtcg--	Protospacer
*****.********.********.  ***.*   

752. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to CP006583 (Mesorhizobium huakuii 7653R plasmid pMHb, complete sequence) position: , mismatch: 7, identity: 0.781

cctcggggccggcggtgatcgccc--cggcccgc	CRISPR spacer
cctcgaggccggcgatgatcgcctggcggtcg--	Protospacer
*****.********.********.  ***.*   

753. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to CP006583 (Mesorhizobium huakuii 7653R plasmid pMHb, complete sequence) position: , mismatch: 7, identity: 0.781

cctcggggccggcggtgatcgccc--cggcccgc	CRISPR spacer
cctcgaggccggcgatgatcgcctggcggtcg--	Protospacer
*****.********.********.  ***.*   

754. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to CP006583 (Mesorhizobium huakuii 7653R plasmid pMHb, complete sequence) position: , mismatch: 7, identity: 0.781

cctcggggccggcggtgatcgccc--cggcccgc	CRISPR spacer
cctcgaggccggcgatgatcgcctggcggtcg--	Protospacer
*****.********.********.  ***.*   

755. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to CP006583 (Mesorhizobium huakuii 7653R plasmid pMHb, complete sequence) position: , mismatch: 7, identity: 0.781

cctcggggccggcggtgatcgccc--cggcccgc	CRISPR spacer
cctcgaggccggcgatgatcgcctggcggtcg--	Protospacer
*****.********.********.  ***.*   

756. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to CP006583 (Mesorhizobium huakuii 7653R plasmid pMHb, complete sequence) position: , mismatch: 7, identity: 0.781

cctcggggccggcggtgatcgccc--cggcccgc	CRISPR spacer
cctcgaggccggcgatgatcgcctggcggtcg--	Protospacer
*****.********.********.  ***.*   

757. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to CP006582 (Mesorhizobium huakuii 7653R plasmid pMHa, complete sequence) position: , mismatch: 7, identity: 0.781

cctcggggccggcggtgatcgccc--cggcccgc	CRISPR spacer
cctcgaggccggcgatgatcgcctggcggtcg--	Protospacer
*****.********.********.  ***.*   

758. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to CP006582 (Mesorhizobium huakuii 7653R plasmid pMHa, complete sequence) position: , mismatch: 7, identity: 0.781

cctcggggccggcggtgatcgccc--cggcccgc	CRISPR spacer
cctcgaggccggcgatgatcgcctggcggtcg--	Protospacer
*****.********.********.  ***.*   

759. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to CP006582 (Mesorhizobium huakuii 7653R plasmid pMHa, complete sequence) position: , mismatch: 7, identity: 0.781

cctcggggccggcggtgatcgccc--cggcccgc	CRISPR spacer
cctcgaggccggcgatgatcgcctggcggtcg--	Protospacer
*****.********.********.  ***.*   

760. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to CP006582 (Mesorhizobium huakuii 7653R plasmid pMHa, complete sequence) position: , mismatch: 7, identity: 0.781

cctcggggccggcggtgatcgccc--cggcccgc	CRISPR spacer
cctcgaggccggcgatgatcgcctggcggtcg--	Protospacer
*****.********.********.  ***.*   

761. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to CP006582 (Mesorhizobium huakuii 7653R plasmid pMHa, complete sequence) position: , mismatch: 7, identity: 0.781

cctcggggccggcggtgatcgccc--cggcccgc	CRISPR spacer
cctcgaggccggcgatgatcgcctggcggtcg--	Protospacer
*****.********.********.  ***.*   

762. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to CP006582 (Mesorhizobium huakuii 7653R plasmid pMHa, complete sequence) position: , mismatch: 7, identity: 0.781

cctcggggccggcggtgatcgccc--cggcccgc	CRISPR spacer
cctcgaggccggcgatgatcgcctggcggtcg--	Protospacer
*****.********.********.  ***.*   

763. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to CP006582 (Mesorhizobium huakuii 7653R plasmid pMHa, complete sequence) position: , mismatch: 7, identity: 0.781

cctcggggccggcggtgatcgccc--cggcccgc	CRISPR spacer
cctcgaggccggcgatgatcgcctggcggtcg--	Protospacer
*****.********.********.  ***.*   

764. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to CP006582 (Mesorhizobium huakuii 7653R plasmid pMHa, complete sequence) position: , mismatch: 7, identity: 0.781

cctcggggccggcggtgatcgccc--cggcccgc	CRISPR spacer
cctcgaggccggcgatgatcgcctggcggtcg--	Protospacer
*****.********.********.  ***.*   

765. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP046454 (Corynebacterium sp. 2019 plasmid pCETAM, complete sequence) position: , mismatch: 7, identity: 0.781

cctcggggc----cggcggtgatcgccccggcccgc	CRISPR spacer
----ggggtgcggcggcggtgatcgccgcggccagc	Protospacer
    ****.    ************** ***** **

766. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to MN871482 (UNVERIFIED: Pseudomonas virus PaSz-6, complete genome) position: , mismatch: 7, identity: 0.781

cctcggggccggcggtgatcgccccggcccgc	CRISPR spacer
tctggaagccggaggtgatcgcccccgccctc	Protospacer
.** *..***** ************ **** *

767. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to MN871486 (UNVERIFIED: Pseudomonas phage PaSz-9_45_61k, complete genome) position: , mismatch: 7, identity: 0.781

cctcggggccggcggtgatcgccccggcccgc	CRISPR spacer
tctggaagccggaggtgatcgcccccgccctc	Protospacer
.** *..***** ************ **** *

768. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to MN234216 (Streptomyces phage Gilgamesh, complete genome) position: , mismatch: 7, identity: 0.781

cctcggggccggcggtgatcgccccggcccgc	CRISPR spacer
gctccagctcggccgtgatcgccccgtcccgc	Protospacer
 *** .* .**** ************ *****

769. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to MN871463 (UNVERIFIED: Pseudomonas phage Pa-L, complete genome) position: , mismatch: 7, identity: 0.781

cctcggggccggcggtgatcgccccggcccgc	CRISPR spacer
tctggaagccggaggtgatcgcccccgccctc	Protospacer
.** *..***** ************ **** *

770. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to MN871456 (UNVERIFIED: Pseudomonas phage Pa-C, complete genome) position: , mismatch: 7, identity: 0.781

cctcggggccggcggtgatcgccccggcccgc	CRISPR spacer
tctggaagccggaggtgatcgcccccgccctc	Protospacer
.** *..***** ************ **** *

771. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to JX131330 (Pseudomonas phage MP1412, complete genome) position: , mismatch: 7, identity: 0.781

cctcggggccggcggtgatcgccccggcccgc	CRISPR spacer
tctggaagccggaggtgatcgcccccgccctc	Protospacer
.** *..***** ************ **** *

772. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to MN871469 (UNVERIFIED: Pseudomonas phage Pa-S, complete genome) position: , mismatch: 7, identity: 0.781

cctcggggccggcggtgatcgccccggcccgc	CRISPR spacer
tctggaagccggaggtgatcgcccccgccctc	Protospacer
.** *..***** ************ **** *

773. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_010116 (Pseudomonas phage YuA, complete genome) position: , mismatch: 7, identity: 0.781

cctcggggccggcggtgatcgccccggcccgc	CRISPR spacer
tctggaagccggaggtgatcgcccccgccctc	Protospacer
.** *..***** ************ **** *

774. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_028980 (Pseudomonas phage PAE1, complete genome) position: , mismatch: 7, identity: 0.781

cctcggggccggcggtgatcgccccggcccgc	CRISPR spacer
tctggaagccggaggtgatcgcccccgccctc	Protospacer
.** *..***** ************ **** *

775. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to MF490239 (Pseudomonas phage vB_PaeS_S218, complete genome) position: , mismatch: 7, identity: 0.781

cctcggggccggcggtgatcgccccggcccgc	CRISPR spacer
tctggaagccggaggtgatcgcccccgccctc	Protospacer
.** *..***** ************ **** *

776. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to DQ163916 (Bacteriophage M6, complete genome) position: , mismatch: 7, identity: 0.781

cctcggggccggcggtgatcgccccggcccgc	CRISPR spacer
tctggaagccggaggtgatcgcccccgccctc	Protospacer
.** *..***** ************ **** *

777. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to DI373496 (KR 1020130142837-A/10: Bacteriophage of Pseudomonas aeruginosa and uses thereof) position: , mismatch: 7, identity: 0.781

cctcggggccggcggtgatcgccccggcccgc	CRISPR spacer
tctggaagccggaggtgatcgcccccgccctc	Protospacer
.** *..***** ************ **** *

778. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to KX198613 (Pseudomonas phage AN14, complete genome) position: , mismatch: 7, identity: 0.781

cctcggggccggcggtgatcgccccggcccgc	CRISPR spacer
tctggaagccggaggtgatcgcccccgccctc	Protospacer
.** *..***** ************ **** *

779. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to KC758116 (Pseudomonas phage LKO4, complete genome) position: , mismatch: 7, identity: 0.781

cctcggggccggcggtgatcgccccggcccgc	CRISPR spacer
tctggaagccggaggtgatcgcccccgccctc	Protospacer
.** *..***** ************ **** *

780. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_007809 (Pseudomonas phage M6, complete genome) position: , mismatch: 7, identity: 0.781

cctcggggccggcggtgatcgccccggcccgc	CRISPR spacer
tctggaagccggaggtgatcgcccccgccctc	Protospacer
.** *..***** ************ **** *

781. spacer 30.5|4637974|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to MK494113 (Mycobacterium phage Refuge, complete genome) position: , mismatch: 7, identity: 0.781

tcgtggtac----atcagctccccgctcacctccag	CRISPR spacer
----ggcacctcgatgagctgcccgctcacctccag	Protospacer
    **.**    ** **** ***************

782. spacer 30.5|4637974|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_048139 (Streptomyces phage Hiyaa, complete genome) position: , mismatch: 7, identity: 0.781

-tcgtggtacatcagctccccgctcacctccag	CRISPR spacer
ctcgcgtcg-atcagctccccgctcagcttcag	Protospacer
 ***.* .. **************** **.***

783. spacer 31.5|4642157|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to JN201525 (Mycobacterium phage Thibault, complete genome) position: , mismatch: 7, identity: 0.781

-aagaccaccgagaaggggtagtggcacgagta	CRISPR spacer
tgcgacc-ccgagaagggattgtggcacgagac	Protospacer
 . **** **********.* **********  

784. spacer 32.11|4653170|33|NC_018524|PILER-CR,CRT matches to NZ_CP035420 (Leisingera sp. NJS204 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.788

gtccaggccgctggccggccggtggctctgccg	CRISPR spacer
ggccaggccgctggccgcccggcggcgcaacct	Protospacer
* *************** ****.*** * .** 

785. spacer 32.15|4652562|32|NC_018524|CRISPRCasFinder matches to NZ_CP015742 (Shinella sp. HZN7 plasmid pShin-06, complete sequence) position: , mismatch: 7, identity: 0.781

tctggacgatcgaccaggtcaccgagttcctg	CRISPR spacer
tggggacgatcgaccagctcaccgtgtcgccg	Protospacer
*  ************** ****** **. *.*

786. spacer 32.15|4652562|32|NC_018524|CRISPRCasFinder matches to NZ_CP013381 (Burkholderia sp. Bp5365 strain MSMB43 plasmid pMSMB43, complete sequence) position: , mismatch: 7, identity: 0.781

tctggacga-----tcgaccaggtcaccgagttcctg	CRISPR spacer
-----acgacaacgtcgaccaggtcatcgcgttcctg	Protospacer
     ****     ************.** *******

787. spacer 32.15|4652562|32|NC_018524|CRISPRCasFinder matches to NZ_CP009547 (Burkholderia sp. 2002721687 plasmid pBTU, complete sequence) position: , mismatch: 7, identity: 0.781

tctggacga-----tcgaccaggtcaccgagttcctg	CRISPR spacer
-----acgacaacgtcgaccaggtcatcgcgttcctg	Protospacer
     ****     ************.** *******

788. spacer 32.15|4652562|32|NC_018524|CRISPRCasFinder matches to EU982300 (Pseudomonas phage DVM-2008, genomic sequence) position: , mismatch: 7, identity: 0.781

tctggacgatcgaccaggtcaccg--agttcctg	CRISPR spacer
gctggtcgatcgacaaggtcaccgccagtggc--	Protospacer
 **** ******** *********  ***  *  

789. spacer 32.16|4652623|32|NC_018524|CRISPRCasFinder matches to MT114163 (Mycobacterium phage Settecandela, complete genome) position: , mismatch: 7, identity: 0.781

ttcgagttccagaccaaggagctcatcgccgc	CRISPR spacer
ttcatcgcccaggccaaggagctcgtcgccgc	Protospacer
***.   .****.***********.*******

790. spacer 32.16|4652623|32|NC_018524|CRISPRCasFinder matches to MK937592 (Mycobacterium phage Phrappuccino, complete genome) position: , mismatch: 7, identity: 0.781

ttcgagttccagaccaaggagctcatcgccgc	CRISPR spacer
ttcatcgcccaggccaaggagctcgtcgccgc	Protospacer
***.   .****.***********.*******

791. spacer 32.19|4652806|32|NC_018524|CRISPRCasFinder matches to NZ_CP032520 (Cupriavidus oxalaticus strain T2 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

cacgaactacgcccacggaacgatgcaggact	CRISPR spacer
ctcgcccgccgtccacggcacgatgcaggact	Protospacer
* **  *  **.****** *************

792. spacer 32.21|4652927|32|NC_018524|CRISPRCasFinder matches to NZ_CP025613 (Niveispirillum cyanobacteriorum strain TH16 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

gaggagcctcggtttcgggccggtcaggccct	CRISPR spacer
ggaattgctgggtttcgggccggtcaggccct	Protospacer
*...   ** **********************

793. spacer 32.21|4652927|32|NC_018524|CRISPRCasFinder matches to MN234199 (Mycobacterium phage Ekdilam, complete genome) position: , mismatch: 7, identity: 0.781

gaggagcctcggtttcgggccggtcaggccct	CRISPR spacer
gggcaatctcggtttcgtgccggtcacgcccg	Protospacer
*.* *..********** ******** **** 

794. spacer 32.22|4652988|32|NC_018524|CRISPRCasFinder matches to NZ_CP032325 (Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence) position: , mismatch: 7, identity: 0.781

cagatcatccacgccctggacgaggccccctc	CRISPR spacer
ctgatcacccacgcgctggacgaggcggccat	Protospacer
* *****.****** ***********  ** .

795. spacer 32.22|4652988|32|NC_018524|CRISPRCasFinder matches to NZ_CP022369 (Azospirillum sp. TSH58 plasmid TSH58_p05, complete sequence) position: , mismatch: 7, identity: 0.781

cagatcatccacgccctggacgaggccccctc	CRISPR spacer
ctgatcacccacgcgctggacgaggcggccat	Protospacer
* *****.****** ***********  ** .

796. spacer 32.22|4652988|32|NC_018524|CRISPRCasFinder matches to NZ_CP007796 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p3, complete sequence) position: , mismatch: 7, identity: 0.781

cagatcatccacgccctggacgaggccccctc	CRISPR spacer
ctgatcacccacgcgctggacgaggcggccat	Protospacer
* *****.****** ***********  ** .

797. spacer 32.22|4652988|32|NC_018524|CRISPRCasFinder matches to NZ_CP032342 (Azospirillum brasilense strain MTCC4038 plasmid p3, complete sequence) position: , mismatch: 7, identity: 0.781

cagatcatccacgccctggacgaggccccctc	CRISPR spacer
ctgatcacccacgcgctggacgaggcggccat	Protospacer
* *****.****** ***********  ** .

798. spacer 32.22|4652988|32|NC_018524|CRISPRCasFinder matches to NZ_CP033321 (Azospirillum brasilense strain Cd plasmid p3, complete sequence) position: , mismatch: 7, identity: 0.781

cagatcatccacgccctggacgaggccccctc	CRISPR spacer
ctgatcacccacgcgctggacgaggcggccat	Protospacer
* *****.****** ***********  ** .

799. spacer 32.22|4652988|32|NC_018524|CRISPRCasFinder matches to NZ_CP033315 (Azospirillum brasilense strain Sp 7 plasmid p3, complete sequence) position: , mismatch: 7, identity: 0.781

cagatcatccacgccctggacgaggccccctc	CRISPR spacer
ctgatcacccacgcgctggacgaggcggccat	Protospacer
* *****.****** ***********  ** .

800. spacer 32.25|4653171|32|NC_018524|CRISPRCasFinder matches to NZ_CP014126 (Pantoea vagans strain FDAARGOS_160 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

tccaggccgctggccggccggtggctctgccg	CRISPR spacer
tgccggccgctggccgtccggtggatctgtta	Protospacer
* * ************ ******* ****...

801. spacer 32.25|4653171|32|NC_018524|CRISPRCasFinder matches to NC_014304 (Erwinia billingiae Eb661 plasmid pEB102, complete sequence) position: , mismatch: 7, identity: 0.781

tccaggccgctggccggccggtggctctgccg	CRISPR spacer
tgccggccgctggccgtccggtggatctgtta	Protospacer
* * ************ ******* ****...

802. spacer 32.25|4653171|32|NC_018524|CRISPRCasFinder matches to NZ_CP022726 (Erwinia persicina strain B64 plasmid pEP1, complete sequence) position: , mismatch: 7, identity: 0.781

tccaggccgctggccggccggtggctctgccg	CRISPR spacer
tgccggccgctggccgtccggtggatctgtta	Protospacer
* * ************ ******* ****...

803. spacer 32.25|4653171|32|NC_018524|CRISPRCasFinder matches to NZ_CP034473 (Pantoea agglomerans strain CFSAN047153 plasmid pCFSAN047153_4, complete sequence) position: , mismatch: 7, identity: 0.781

tccaggccgctggccggccggtggctctgccg	CRISPR spacer
tgccggccgctggccgtccggtggatctgtta	Protospacer
* * ************ ******* ****...

804. spacer 32.25|4653171|32|NC_018524|CRISPRCasFinder matches to NZ_CP034478 (Pantoea agglomerans strain CFSAN047154 plasmid pCFSAN047154_4, complete sequence) position: , mismatch: 7, identity: 0.781

tccaggccgctggccggccggtggctctgccg	CRISPR spacer
tgccggccgctggccgtccggtggatctgtta	Protospacer
* * ************ ******* ****...

805. spacer 32.25|4653171|32|NC_018524|CRISPRCasFinder matches to NC_019310 (Erwinia amylovora plasmid pEM65, complete sequence) position: , mismatch: 7, identity: 0.781

tccaggccgctggccggccggtggctctgccg	CRISPR spacer
tgccggccgctggccgtccggtggttctgtta	Protospacer
* * ************ *******.****...

806. spacer 32.25|4653171|32|NC_018524|CRISPRCasFinder matches to NZ_CP035420 (Leisingera sp. NJS204 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.781

tccaggccgctggccggccggtggctctgccg	CRISPR spacer
gccaggccgctggccgcccggcggcgcaacct	Protospacer
 *************** ****.*** * .** 

807. spacer 34.4|5116657|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP048421 (Sphingomonas insulae strain KCTC 12872 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.781

ccgggcga--cgccgaggcggtgtggaacatccg	CRISPR spacer
--ggacggatcgccgaggcggtgtcgaacctcca	Protospacer
  **.**.  ************** **** ***.

808. spacer 34.5|5116718|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NC_009453 (Arthrobacter sp. Rue61a plasmid pAL1, complete sequence) position: , mismatch: 7, identity: 0.781

---cttgccttcgagggcttcctcgatctcccggt	CRISPR spacer
aagcatg---gcgcgggcttcctcgatctgccggt	Protospacer
   * **    ** *************** *****

809. spacer 34.5|5116718|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP042998 (Aquisphaera giovannonii strain OJF2 plasmid pOJF2_1, complete sequence) position: , mismatch: 7, identity: 0.781

cttgccttcgagggcttcctcgatctcccggt	CRISPR spacer
cttgccgtcgagggcttcctggatggcgatgt	Protospacer
****** ************* ***  *   **

810. spacer 34.5|5116718|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP017565 (Paraburkholderia sprentiae WSM5005 plasmid pl2WSM5005, complete sequence) position: , mismatch: 7, identity: 0.781

cttgccttcgagggcttcctcgatctcccggt	CRISPR spacer
catgccctcgatggcttcctcgatcctgcggc	Protospacer
* ****.**** *************.. ***.

811. spacer 34.6|5116779|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 7, identity: 0.781

ggaggcgctgctggaggccccggcagtctggg	CRISPR spacer
ggaggcgctgcgggaggccacgggcggccgcg	Protospacer
*********** ******* ***  * *.* *

812. spacer 34.6|5116779|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP030127 (Indioceanicola profundi strain SCSIO 08040 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

ggaggcgctgctggaggccccggcagtctggg	CRISPR spacer
ggaggcgctgctggcggcccaggcggaactgg	Protospacer
************** ***** ***.*  . **

813. spacer 34.6|5116779|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP029833 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.781

ggaggcgctgctggaggccccggcagtctggg	CRISPR spacer
cgaggcgctgctggaggatccggcgctgtcgg	Protospacer
 **************** .*****. * * **

814. spacer 34.6|5116779|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP034186 (Deinococcus sp. S14-83 strain S14-83T plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.781

ggaggcgctgctggaggccccggcagtctggg	CRISPR spacer
ggtgctgctgctggtggccccggcaggctacg	Protospacer
** * .******** *********** **. *

815. spacer 34.8|5116901|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP006257 (Pseudomonas syringae pv. syringae HS191 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

gagctcgtgcagatagatagccccgccggcct	CRISPR spacer
ggtcaggtgcagatacatagccccgcctgcgt	Protospacer
*. *  ********* *********** ** *

816. spacer 34.10|5117024|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NC_042098 (Erwinia phage vB_EamM_Desertfox, complete genome) position: , mismatch: 7, identity: 0.781

ggtggcgcaggcggccactccgggccagtggc--	CRISPR spacer
ggtggcgcaggtggctactccgg--tgatggcgg	Protospacer
***********.***.*******  ...****  

817. spacer 34.10|5117024|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MG655267 (Erwinia phage vB_EamM_Bosolaphorus, complete genome) position: , mismatch: 7, identity: 0.781

ggtggcgcaggcggccactccgggccagtggc--	CRISPR spacer
ggtggcgcaggtggctactccgg--tgatggcgg	Protospacer
***********.***.*******  ...****  

818. spacer 34.10|5117024|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MG655269 (Erwinia phage vB_EamM_MadMel, complete genome) position: , mismatch: 7, identity: 0.781

ggtggcgcaggcggccactccgggccagtggc--	CRISPR spacer
ggtggcgcaggtggctactccgg--tgatggcgg	Protospacer
***********.***.*******  ...****  

819. spacer 34.10|5117024|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to KF806589 (Erwinia phage Ea35-70, complete genome) position: , mismatch: 7, identity: 0.781

ggtggcgcaggcggccactccgggccagtggc--	CRISPR spacer
ggtggcgcaggtggctactccgg--tgatggcgg	Protospacer
***********.***.*******  ...****  

820. spacer 34.10|5117024|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to KU886223 (Erwinia phage vB_EamM_Simmy50, complete genome) position: , mismatch: 7, identity: 0.781

ggtggcgcaggcggccactccgggccagtggc--	CRISPR spacer
ggtggcgcaggtggctactccgg--tgatggcgg	Protospacer
***********.***.*******  ...****  

821. spacer 1.2|311687|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_AP022602 (Mycobacterium gallinarum strain JCM 6399 plasmid pJCM6399) position: , mismatch: 8, identity: 0.75

ccggttgatctcgtcgaatacggctgcgaggt	CRISPR spacer
gcggtagatctcgccgaatacggcgggtttgt	Protospacer
 **** *******.********** *    **

822. spacer 1.2|311687|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_AP022602 (Mycobacterium gallinarum strain JCM 6399 plasmid pJCM6399) position: , mismatch: 8, identity: 0.75

ccggttgatctcgtcgaatacggctgcgaggt	CRISPR spacer
gcggtagatctcgccgaatacggcgggtttgt	Protospacer
 **** *******.********** *    **

823. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP044976 (Hydrogenophaga sp. PBL-H3 substr. PBL-H3(B2) plasmid pPBL-H3_B2-1, complete sequence) position: , mismatch: 8, identity: 0.75

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
gtgccgctggcgatcaccatcgtcgagccacg	Protospacer
*********** *** *********. .* ..

824. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_LR594663 (Variovorax sp. RA8 plasmid 2) position: , mismatch: 8, identity: 0.75

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
ctgccgctggccatctcgatcttcgggctgaa	Protospacer
 **************** *** **** ..  *

825. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP021449 (Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence) position: , mismatch: 8, identity: 0.75

gtgccgctggccatctccatcgtc----ggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggggggct----	Protospacer
  ********  ************    ****    

826. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP049358 (Deinococcus wulumuqiensis R12 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

gtgccgctggccatctccatcgtcggctccta----	CRISPR spacer
ttgccgctggcaatctccaccgtcg----ccagggc	Protospacer
 ********** *******.*****    *.*    

827. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_010408 (Clavibacter michiganensis subsp. sepedonicus plasmid pCSL1, complete sequence) position: , mismatch: 8, identity: 0.75

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
gctccgctgaccatctccatcgtcagcatcag	Protospacer
*. ******.**************.** .* .

828. spacer 1.4|311809|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_AP022849 (Bosea sp. ANAM02 plasmid pANAM02, complete sequence) position: , mismatch: 8, identity: 0.75

cgttcatccgggcgggtctgttctgggtgagc-	CRISPR spacer
cgatgatccgggcgggtctgttc-gattacgtc	Protospacer
** * ****************** *. *. *. 

829. spacer 1.5|311870|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP020084 (Blastomonas fulva strain T2 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

aagccaca-aagccagctccgtacatgcgtcag	CRISPR spacer
-gtcggcacaagccagctccgcacaggcgtcat	Protospacer
 . * .** ************.*** ****** 

830. spacer 1.6|311931|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to CP042595 (Streptomyces albogriseolus strain LBX-2 plasmid pSALBX2, complete sequence) position: , mismatch: 8, identity: 0.75

accatcatgtcgccgaacgcggagccggccca	CRISPR spacer
tcgcccaggtcgccgaacacggagccggcctg	Protospacer
 *  .** **********.***********..

831. spacer 1.6|311931|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP025613 (Niveispirillum cyanobacteriorum strain TH16 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

accatcatgtcgccgaacgcggagccggccca	CRISPR spacer
agagccatttcgccgaacacggagccggcacc	Protospacer
*  ..*** *********.********** * 

832. spacer 1.7|311992|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013526 (Rhizobium phaseoli strain R744 plasmid pRphaR744d, complete sequence) position: , mismatch: 8, identity: 0.75

ttcttcatccagggggcgcg-----ggagacgatctc	CRISPR spacer
ttcttcatccagggggcgcgctagaatggacg-----	Protospacer
********************     . .****     

833. spacer 1.7|311992|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013556 (Rhizobium phaseoli strain N931 plasmid pRphaN931d, complete sequence) position: , mismatch: 8, identity: 0.75

ttcttcatccagggggcgcg-----ggagacgatctc	CRISPR spacer
ttcttcatccagggggcgcgctagaatggacg-----	Protospacer
********************     . .****     

834. spacer 1.7|311992|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013579 (Rhizobium phaseoli strain N671 plasmid pRphaN671e, complete sequence) position: , mismatch: 8, identity: 0.75

ttcttcatccagggggcgcg-----ggagacgatctc	CRISPR spacer
ttcttcatccagggggcgcgctagaatggacg-----	Protospacer
********************     . .****     

835. spacer 1.7|311992|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013531 (Rhizobium phaseoli strain R723 plasmid pRphaR723d, complete sequence) position: , mismatch: 8, identity: 0.75

ttcttcatccagggggcgcg-----ggagacgatctc	CRISPR spacer
ttcttcatccagggggcgcgctagaatggacg-----	Protospacer
********************     . .****     

836. spacer 1.7|311992|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013536 (Rhizobium phaseoli strain R650 plasmid pRphaR650d, complete sequence) position: , mismatch: 8, identity: 0.75

ttcttcatccagggggcgcg-----ggagacgatctc	CRISPR spacer
ttcttcatccagggggcgcgctagaatggacg-----	Protospacer
********************     . .****     

837. spacer 1.7|311992|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013546 (Rhizobium phaseoli strain R620 plasmid pRphaR620d, complete sequence) position: , mismatch: 8, identity: 0.75

ttcttcatccagggggcgcg-----ggagacgatctc	CRISPR spacer
ttcttcatccagggggcgcgctagaatggacg-----	Protospacer
********************     . .****     

838. spacer 1.7|311992|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013567 (Rhizobium phaseoli strain N831 plasmid pRphaN831d, complete sequence) position: , mismatch: 8, identity: 0.75

ttcttcatccagggggcgcg-----ggagacgatctc	CRISPR spacer
ttcttcatccagggggcgcgctagaatggacg-----	Protospacer
********************     . .****     

839. spacer 1.7|311992|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013584 (Rhizobium phaseoli strain N261 plasmid pRphaN261d, complete sequence) position: , mismatch: 8, identity: 0.75

ttcttcatccagggggcgcg-----ggagacgatctc	CRISPR spacer
ttcttcatccagggggcgcgctagaatggacg-----	Protospacer
********************     . .****     

840. spacer 1.7|311992|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013573 (Rhizobium phaseoli strain N771 plasmid pRphaN771e, complete sequence) position: , mismatch: 8, identity: 0.75

ttcttcatccagggggcgcg-----ggagacgatctc	CRISPR spacer
ttcttcatccagggggcgcgctagaatggacg-----	Protospacer
********************     . .****     

841. spacer 1.8|312053|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to KC252997 (Halovirus PH1, complete genome) position: , mismatch: 8, identity: 0.75

tctggtcgggagagccgaagtagtcgggttcg	CRISPR spacer
acccgagccgagcgccgaagtagtcgggttcg	Protospacer
 *. *    *** *******************

842. spacer 1.8|312053|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_020159 (Halovirus HSTV-2, complete genome) position: , mismatch: 8, identity: 0.75

tctggtcgggagagccgaagtagtcgggttcg	CRISPR spacer
gttcgactggagggccgaagtagtcgagttca	Protospacer
 .* * * ****.*************.****.

843. spacer 1.9|312114|37|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_LR134451 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 9, complete sequence) position: , mismatch: 8, identity: 0.784

tatgacgaggcgtgccgtcgcgcgggccggaccttgg	CRISPR spacer
tccgccgaggcgaaccgtcgcgcgggccggacggtga	Protospacer
* .* ******* .******************  **.

844. spacer 1.10|312180|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP045223 (Achromobacter xylosoxidans strain DN002 plasmid unnamed) position: , mismatch: 8, identity: 0.75

taggcggcctcggcggtaaaggcgggggcgtc	CRISPR spacer
caggtggcctgggcggtaaaggcggcgaaagc	Protospacer
.***.***** ************** *. . *

845. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 8, identity: 0.75

tcctccggcgcctcgtcggcgacgtcggcgac	CRISPR spacer
cccccgtccgcctgatcggcgacgtcggcgag	Protospacer
.**.*   ***** .**************** 

846. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to MN234183 (Mycobacterium phage Antsirabe, complete genome) position: , mismatch: 8, identity: 0.75

tcctccggcgcctcgtcggcgacgtcggcgac	CRISPR spacer
acctggacggcctggtccgcgacgtcggcgac	Protospacer
 ***  .  **** *** **************

847. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 8, identity: 0.75

tcctccggcgcctcgtcggcgacgtcggcgac	CRISPR spacer
ccgatccacgactcgtcggcgaggtcggcgac	Protospacer
.*  .* .** *********** *********

848. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 8, identity: 0.75

tcctccggcgcctcgtcggcgacgtcggcgac	CRISPR spacer
ccgatccacgactcgtcggcgaggtcggcgac	Protospacer
.*  .* .** *********** *********

849. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_025427 (Rhizobium phage vB_RleM_PPF1, complete genome) position: , mismatch: 8, identity: 0.75

tcctccggcgcctcgtcggcgacgtcggcgac	CRISPR spacer
cggcgctgcgcctcgtcagcgacgtcgacgac	Protospacer
.  . * **********.*********.****

850. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP016083 (Streptomyces sp. SAT1 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.75

tcctccggcgcctcgtcggcgacgtcggcgac	CRISPR spacer
gcaccgtacgcctcgtcggcgacctcgccgac	Protospacer
 * .*  .*************** *** ****

851. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032322 (Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.75

tcctccggcgcctcgtcggcgacgtcggcgac	CRISPR spacer
cgcaccgccgcctcgtcggccacgtcgagcac	Protospacer
. * *** ************ ******.  **

852. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP007129 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence) position: , mismatch: 8, identity: 0.75

tcctccggcgcctcgtcggcgacgtcggcgac	CRISPR spacer
agcgcgcgcacctcgtcggcgacgacggcgaa	Protospacer
  * *  **.************** ****** 

853. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP016354 (Prauserella marina strain DSM 45268 plasmid pPmarDSM45268, complete sequence) position: , mismatch: 8, identity: 0.75

tcctccgg------cgcctcgtcggcgacgtcggcgac	CRISPR spacer
------ggagtgatcgcatcgtcggcgaggtcggcgac	Protospacer
      **      *** ********** *********

854. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP033582 (Streptomyces sp. ADI95-16 plasmid pADI95-16a, complete sequence) position: , mismatch: 8, identity: 0.75

tcctccggcgcctcgtcggcgacgtcggcgac	CRISPR spacer
tcggccgacgcctcgtcggtgacgtcgaggtg	Protospacer
**  ***.***********.*******. *  

855. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP017242 (Rhizobium etli 8C-3 plasmid pRsp8C3a, complete sequence) position: , mismatch: 8, identity: 0.75

tcctccggcgcctcgtcggcgacgtcggcgac	CRISPR spacer
gcgcgcagcgccccgtcggcgacgtcgtcgag	Protospacer
 * . *.*****.************** *** 

856. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_016586 (Azospirillum lipoferum 4B plasmid AZO_p2, complete sequence) position: , mismatch: 8, identity: 0.75

tcctccggcgcctcgtcggcgacgtcggcgac	CRISPR spacer
gccaacgccgcctcgtcggcgaggtcggcctg	Protospacer
 **  ** ************** ******   

857. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to X80164 (Bacteriophage phi-H dcm4, dcm5a and dcm5b genes for cytosine methylase) position: , mismatch: 8, identity: 0.75

tcctccggcgcctcgtcggcgacgtcggcgac	CRISPR spacer
accaggaacggctcgtcgacgacgtcggcgac	Protospacer
 **   ..** *******.*************

858. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to MK002701 (Halobacterium phage phiH variant phiH1, complete genome) position: , mismatch: 8, identity: 0.75

tcctccggcgcctcgtcggcgacgtcggcgac	CRISPR spacer
accaggaacggctcgtcgacgacgtcggcgac	Protospacer
 **   ..** *******.*************

859. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to FJ937737 (Burkholderia cenocepacia phage BcepIL02, complete genome) position: , mismatch: 8, identity: 0.75

tcctccggcgcctcgtcggcgacgtcggcgac	CRISPR spacer
tcgatgtgcgcctcgtccacgacgtcggcgag	Protospacer
**  .  ********** .************ 

860. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_012743 (Burkholderia phage BcepIL02, complete genome) position: , mismatch: 8, identity: 0.75

tcctccggcgcctcgtcggcgacgtcggcgac	CRISPR spacer
tcgatgtgcgcctcgtccacgacgtcggcgag	Protospacer
**  .  ********** .************ 

861. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP044283 (Rhodococcus erythropolis strain X5 plasmid pRhX5, complete sequence) position: , mismatch: 8, identity: 0.75

tcctccggc-----gcctcgtcggcgacgtcggcgac	CRISPR spacer
-----aggcggcaggcatcgtcgtcgacgtcggcgac	Protospacer
      ***     ** ****** *************

862. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP026974 (Achromobacter insolitus strain FDAARGOS_88 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

tcctccggcgcctcgtcggcgacgtcggcgac	CRISPR spacer
gcgacctgtgcctcgtcggcgacgtcgcacac	Protospacer
 *  ** *.******************   **

863. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_AP022333 (Methylosinus sp. C49 isolate Methylosinus sp. C49 plasmid pMSC49a, complete sequence) position: , mismatch: 8, identity: 0.75

tcctccggcgcctcgtcggcgacgtcggcgac	CRISPR spacer
gcgacgcgcgcctcgtcggcggcgacggcggc	Protospacer
 *  *  **************.** *****.*

864. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP011665 (Streptomyces sp. Mg1 plasmid pSMg1-1, complete sequence) position: , mismatch: 8, identity: 0.75

tcctccggcgcctcgtcggcgacgtcggcgac	CRISPR spacer
gcgttgcgggccgcgtcggcgaagtcggcgac	Protospacer
 * *.  * *** ********* *********

865. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP011665 (Streptomyces sp. Mg1 plasmid pSMg1-1, complete sequence) position: , mismatch: 8, identity: 0.75

tcctccggcgcctcgtcggcgacgtcggcgac	CRISPR spacer
tcggccgacgcctcgtcggtgacgtcgaggtg	Protospacer
**  ***.***********.*******. *  

866. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_017966 (Tistrella mobilis KA081020-065 plasmid pTM2, complete sequence) position: , mismatch: 8, identity: 0.75

tcctccggcgcctcgtcggcgacgtcggcgac	CRISPR spacer
cgcgccagcacctcgtcggcgacgtcgcgggc	Protospacer
. * **.**.*****************  *.*

867. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP024309 (Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3b, complete sequence) position: , mismatch: 8, identity: 0.75

tcctccggcgcctcgtcggcgacgtcggcgac	CRISPR spacer
tctaacggcgccgcgtcggcgtcgtcggaggg	Protospacer
**.  ******* ******** ****** *. 

868. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP014797 (Salipiger profundus strain JLT2016 plasmid pTPRO1, complete sequence) position: , mismatch: 8, identity: 0.75

tcctccggcgcctcgtcggcgacgtcggcgac	CRISPR spacer
gcggcgggcgcctcgtcgccgtcgtcggcccc	Protospacer
 *  * ************ ** *******  *

869. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to MN329675 (Microbacterium phage SansAfet, complete genome) position: , mismatch: 8, identity: 0.75

tcctccggcgcctcgtcggcgacgtcggcgac	CRISPR spacer
aacttgagcgggtcgtcggcgacgtcggcgcc	Protospacer
  **. .***  ****************** *

870. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to MN813686 (Mycobacterium phage BirdsNest, complete genome) position: , mismatch: 8, identity: 0.75

tcctccggcgcctcgtcggcgacgtcggcgac	CRISPR spacer
gcgttggtcgccgcgttggcgacgtcggcgat	Protospacer
 * *. * **** ***.**************.

871. spacer 2.4|313399|32|NC_018524|CRISPRCasFinder matches to NZ_AP012556 (Mycobacterium avium subsp. hominissuis TH135 plasmid pMAH135, complete sequence) position: , mismatch: 8, identity: 0.75

cacaccaccccggcctggccacggccggcgtc	CRISPR spacer
gccaccgccccggcctgggcacggccgctgct	Protospacer
  ****.*********** ******** .*..

872. spacer 2.4|313399|32|NC_018524|CRISPRCasFinder matches to NZ_CP041964 (Xanthomonas citri pv. glycines strain 1157 plasmid unnamed1) position: , mismatch: 8, identity: 0.75

cacacca-ccccggcctggccacggccggcgtc	CRISPR spacer
-aggccgtccccggcttgtccacggccggcgcg	Protospacer
 * .**. *******.** ************. 

873. spacer 2.4|313399|32|NC_018524|CRISPRCasFinder matches to NZ_CP041964 (Xanthomonas citri pv. glycines strain 1157 plasmid unnamed1) position: , mismatch: 8, identity: 0.75

cacacca-ccccggcctggccacggccggcgtc	CRISPR spacer
-aggccgtccccggcttgtccacggccggcgcg	Protospacer
 * .**. *******.** ************. 

874. spacer 2.4|313399|32|NC_018524|CRISPRCasFinder matches to NZ_CP019227 (Xanthomonas oryzae pv. oryzae strain IX-280 plasmid pXOO43, complete sequence) position: , mismatch: 8, identity: 0.75

cacacca-ccccggcctggccacggccggcgtc	CRISPR spacer
-aggccgtccccggcttgtccacggccggcgcg	Protospacer
 * .**. *******.** ************. 

875. spacer 2.4|313399|32|NC_018524|CRISPRCasFinder matches to NZ_CP020883 (Xanthomonas citri pv. citri strain TX160042 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

cacacca-ccccggcctggccacggccggcgtc	CRISPR spacer
-aggccgtccccggcttgtccacggccggcgcg	Protospacer
 * .**. *******.** ************. 

876. spacer 2.4|313399|32|NC_018524|CRISPRCasFinder matches to NZ_CP021007 (Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6975 plasmid pC, complete sequence) position: , mismatch: 8, identity: 0.75

cacacca-ccccggcctggccacggccggcgtc	CRISPR spacer
-aggccgtccccggcttgtccacggccggcgcg	Protospacer
 * .**. *******.** ************. 

877. spacer 2.4|313399|32|NC_018524|CRISPRCasFinder matches to NZ_CP021007 (Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6975 plasmid pC, complete sequence) position: , mismatch: 8, identity: 0.75

cacacca-ccccggcctggccacggccggcgtc	CRISPR spacer
-aggccgtccccggcttgtccacggccggcgcg	Protospacer
 * .**. *******.** ************. 

878. spacer 2.4|313399|32|NC_018524|CRISPRCasFinder matches to NZ_CP021007 (Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6975 plasmid pC, complete sequence) position: , mismatch: 8, identity: 0.75

cacacca-ccccggcctggccacggccggcgtc	CRISPR spacer
-aggccgtccccggcttgtccacggccggcgcg	Protospacer
 * .**. *******.** ************. 

879. spacer 2.4|313399|32|NC_018524|CRISPRCasFinder matches to NZ_CP020994 (Xanthomonas citri pv. phaseoli var. fuscans strain CFBP4885 plasmid pC, complete sequence) position: , mismatch: 8, identity: 0.75

cacacca-ccccggcctggccacggccggcgtc	CRISPR spacer
-aggccgtccccggcttgtccacggccggcgcg	Protospacer
 * .**. *******.** ************. 

880. spacer 2.4|313399|32|NC_018524|CRISPRCasFinder matches to NZ_CP020994 (Xanthomonas citri pv. phaseoli var. fuscans strain CFBP4885 plasmid pC, complete sequence) position: , mismatch: 8, identity: 0.75

cacacca-ccccggcctggccacggccggcgtc	CRISPR spacer
-aggccgtccccggcttgtccacggccggcgcg	Protospacer
 * .**. *******.** ************. 

881. spacer 2.4|313399|32|NC_018524|CRISPRCasFinder matches to NC_010509 (Methylobacterium radiotolerans JCM 2831 plasmid pMRAD02, complete sequence) position: , mismatch: 8, identity: 0.75

cacacca-ccccggcctggccacggccggcgtc	CRISPR spacer
-aggccgtccccggcttgtccacggccggcgcg	Protospacer
 * .**. *******.** ************. 

882. spacer 2.4|313399|32|NC_018524|CRISPRCasFinder matches to NC_010509 (Methylobacterium radiotolerans JCM 2831 plasmid pMRAD02, complete sequence) position: , mismatch: 8, identity: 0.75

cacacca-ccccggcctggccacggccggcgtc	CRISPR spacer
-aggccgtccccggcttgtccacggccggcgcg	Protospacer
 * .**. *******.** ************. 

883. spacer 2.4|313399|32|NC_018524|CRISPRCasFinder matches to NZ_CP020886 (Xanthomonas citri pv. citri strain TX160149 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

cacacca-ccccggcctggccacggccggcgtc	CRISPR spacer
-aggccgtccccggcttgtccacggccggcgcg	Protospacer
 * .**. *******.** ************. 

884. spacer 2.4|313399|32|NC_018524|CRISPRCasFinder matches to NZ_CP021020 (Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6167 plasmid pC, complete sequence) position: , mismatch: 8, identity: 0.75

cacacca-ccccggcctggccacggccggcgtc	CRISPR spacer
-aggccgtccccggcttgtccacggccggcgcg	Protospacer
 * .**. *******.** ************. 

885. spacer 2.4|313399|32|NC_018524|CRISPRCasFinder matches to NZ_CP020977 (Xanthomonas phaseoli pv. phaseoli strain CFBP6982 plasmid pC) position: , mismatch: 8, identity: 0.75

cacacca-ccccggcctggccacggccggcgtc	CRISPR spacer
-aggccgtccccggcttgtccacggccggcgcg	Protospacer
 * .**. *******.** ************. 

886. spacer 2.4|313399|32|NC_018524|CRISPRCasFinder matches to NZ_CP012056 (Xanthomonas citri pv. fuscans strain ISO12C3 plasmid pXff45, complete sequence) position: , mismatch: 8, identity: 0.75

cacacca-ccccggcctggccacggccggcgtc	CRISPR spacer
-aggccgtccccggcttgtccacggccggcgcg	Protospacer
 * .**. *******.** ************. 

887. spacer 2.4|313399|32|NC_018524|CRISPRCasFinder matches to NZ_CP012054 (Xanthomonas citri pv. fuscans strain ISO118C1 plasmid pXff45, complete sequence) position: , mismatch: 8, identity: 0.75

cacacca-ccccggcctggccacggccggcgtc	CRISPR spacer
-aggccgtccccggcttgtccacggccggcgcg	Protospacer
 * .**. *******.** ************. 

888. spacer 2.4|313399|32|NC_018524|CRISPRCasFinder matches to NZ_CP013007 (Xanthomonas citri pv. malvacearum strain XcmN1003 plasmid pXcmN, complete sequence) position: , mismatch: 8, identity: 0.75

cacacca-ccccggcctggccacggccggcgtc	CRISPR spacer
-aggccgtccccggcttgtccacggccggcgcg	Protospacer
 * .**. *******.** ************. 

889. spacer 2.4|313399|32|NC_018524|CRISPRCasFinder matches to NZ_CP021003 (Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6166 plasmid pC, complete sequence) position: , mismatch: 8, identity: 0.75

cacacca-ccccggcctggccacggccggcgtc	CRISPR spacer
-aggccgtccccggcttgtccacggccggcgcg	Protospacer
 * .**. *******.** ************. 

890. spacer 2.4|313399|32|NC_018524|CRISPRCasFinder matches to NZ_CP012052 (Xanthomonas citri pv. fuscans strain ISO118C5 plasmid pXff45, complete sequence) position: , mismatch: 8, identity: 0.75

cacacca-ccccggcctggccacggccggcgtc	CRISPR spacer
-aggccgtccccggcttgtccacggccggcgcg	Protospacer
 * .**. *******.** ************. 

891. spacer 2.4|313399|32|NC_018524|CRISPRCasFinder matches to NZ_CP020890 (Xanthomonas citri pv. citri strain TX160197 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

cacacca-ccccggcctggccacggccggcgtc	CRISPR spacer
-aggccgtccccggcttgtccacggccggcgcg	Protospacer
 * .**. *******.** ************. 

892. spacer 2.4|313399|32|NC_018524|CRISPRCasFinder matches to CP021014 (Xanthomonas citri pv. phaseoli var. fuscans strain CFBP7767 plasmid pC, complete sequence) position: , mismatch: 8, identity: 0.75

cacacca-ccccggcctggccacggccggcgtc	CRISPR spacer
-aggccgtccccggcttgtccacggccggcgcg	Protospacer
 * .**. *******.** ************. 

893. spacer 2.4|313399|32|NC_018524|CRISPRCasFinder matches to NC_022542 (Xanthomonas citri pv. fuscans plasmid plc, complete sequence) position: , mismatch: 8, identity: 0.75

cacacca-ccccggcctggccacggccggcgtc	CRISPR spacer
-aggccgtccccggcttgtccacggccggcgcg	Protospacer
 * .**. *******.** ************. 

894. spacer 2.10|313401|30|NC_018524|PILER-CR matches to NZ_CP041964 (Xanthomonas citri pv. glycines strain 1157 plasmid unnamed1) position: , mismatch: 8, identity: 0.733

acaccaccccggcctggccacggccggcgt	CRISPR spacer
ggccgtccccggcttgtccacggccggcgc	Protospacer
.  *  *******.** ************.

895. spacer 2.10|313401|30|NC_018524|PILER-CR matches to NZ_CP041964 (Xanthomonas citri pv. glycines strain 1157 plasmid unnamed1) position: , mismatch: 8, identity: 0.733

acaccaccccggcctggccacggccggcgt	CRISPR spacer
ggccgtccccggcttgtccacggccggcgc	Protospacer
.  *  *******.** ************.

896. spacer 2.10|313401|30|NC_018524|PILER-CR matches to NZ_CP019227 (Xanthomonas oryzae pv. oryzae strain IX-280 plasmid pXOO43, complete sequence) position: , mismatch: 8, identity: 0.733

acaccaccccggcctggccacggccggcgt	CRISPR spacer
ggccgtccccggcttgtccacggccggcgc	Protospacer
.  *  *******.** ************.

897. spacer 2.10|313401|30|NC_018524|PILER-CR matches to NZ_CP020883 (Xanthomonas citri pv. citri strain TX160042 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

acaccaccccggcctggccacggccggcgt	CRISPR spacer
ggccgtccccggcttgtccacggccggcgc	Protospacer
.  *  *******.** ************.

898. spacer 2.10|313401|30|NC_018524|PILER-CR matches to NZ_CP021007 (Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6975 plasmid pC, complete sequence) position: , mismatch: 8, identity: 0.733

acaccaccccggcctggccacggccggcgt	CRISPR spacer
ggccgtccccggcttgtccacggccggcgc	Protospacer
.  *  *******.** ************.

899. spacer 2.10|313401|30|NC_018524|PILER-CR matches to NZ_CP021007 (Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6975 plasmid pC, complete sequence) position: , mismatch: 8, identity: 0.733

acaccaccccggcctggccacggccggcgt	CRISPR spacer
ggccgtccccggcttgtccacggccggcgc	Protospacer
.  *  *******.** ************.

900. spacer 2.10|313401|30|NC_018524|PILER-CR matches to NZ_CP021007 (Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6975 plasmid pC, complete sequence) position: , mismatch: 8, identity: 0.733

acaccaccccggcctggccacggccggcgt	CRISPR spacer
ggccgtccccggcttgtccacggccggcgc	Protospacer
.  *  *******.** ************.

901. spacer 2.10|313401|30|NC_018524|PILER-CR matches to NZ_CP020994 (Xanthomonas citri pv. phaseoli var. fuscans strain CFBP4885 plasmid pC, complete sequence) position: , mismatch: 8, identity: 0.733

acaccaccccggcctggccacggccggcgt	CRISPR spacer
ggccgtccccggcttgtccacggccggcgc	Protospacer
.  *  *******.** ************.

902. spacer 2.10|313401|30|NC_018524|PILER-CR matches to NZ_CP020994 (Xanthomonas citri pv. phaseoli var. fuscans strain CFBP4885 plasmid pC, complete sequence) position: , mismatch: 8, identity: 0.733

acaccaccccggcctggccacggccggcgt	CRISPR spacer
ggccgtccccggcttgtccacggccggcgc	Protospacer
.  *  *******.** ************.

903. spacer 2.10|313401|30|NC_018524|PILER-CR matches to NC_010509 (Methylobacterium radiotolerans JCM 2831 plasmid pMRAD02, complete sequence) position: , mismatch: 8, identity: 0.733

acaccaccccggcctggccacggccggcgt	CRISPR spacer
ggccgtccccggcttgtccacggccggcgc	Protospacer
.  *  *******.** ************.

904. spacer 2.10|313401|30|NC_018524|PILER-CR matches to NC_010509 (Methylobacterium radiotolerans JCM 2831 plasmid pMRAD02, complete sequence) position: , mismatch: 8, identity: 0.733

acaccaccccggcctggccacggccggcgt	CRISPR spacer
ggccgtccccggcttgtccacggccggcgc	Protospacer
.  *  *******.** ************.

905. spacer 2.10|313401|30|NC_018524|PILER-CR matches to NZ_CP020886 (Xanthomonas citri pv. citri strain TX160149 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

acaccaccccggcctggccacggccggcgt	CRISPR spacer
ggccgtccccggcttgtccacggccggcgc	Protospacer
.  *  *******.** ************.

906. spacer 2.10|313401|30|NC_018524|PILER-CR matches to NZ_CP040821 (Paraoceanicella profunda strain D4M1 plasmid pD4M1C, complete sequence) position: , mismatch: 8, identity: 0.733

acaccaccccggcctggccacggccggcgt	CRISPR spacer
tggacgccccggcctggccccggcaggcgc	Protospacer
  . *.************* **** ****.

907. spacer 2.10|313401|30|NC_018524|PILER-CR matches to NZ_CP021020 (Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6167 plasmid pC, complete sequence) position: , mismatch: 8, identity: 0.733

acaccaccccggcctggccacggccggcgt	CRISPR spacer
ggccgtccccggcttgtccacggccggcgc	Protospacer
.  *  *******.** ************.

908. spacer 2.10|313401|30|NC_018524|PILER-CR matches to NZ_CP020977 (Xanthomonas phaseoli pv. phaseoli strain CFBP6982 plasmid pC) position: , mismatch: 8, identity: 0.733

acaccaccccggcctggccacggccggcgt	CRISPR spacer
ggccgtccccggcttgtccacggccggcgc	Protospacer
.  *  *******.** ************.

909. spacer 2.10|313401|30|NC_018524|PILER-CR matches to NZ_CP012056 (Xanthomonas citri pv. fuscans strain ISO12C3 plasmid pXff45, complete sequence) position: , mismatch: 8, identity: 0.733

acaccaccccggcctggccacggccggcgt	CRISPR spacer
ggccgtccccggcttgtccacggccggcgc	Protospacer
.  *  *******.** ************.

910. spacer 2.10|313401|30|NC_018524|PILER-CR matches to NZ_CP022482 (Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence) position: , mismatch: 8, identity: 0.733

acaccaccccggcctggccacggccggcgt	CRISPR spacer
gtgcggcccgggcctggcgacggccggcgg	Protospacer
...* .*** ******** ********** 

911. spacer 2.10|313401|30|NC_018524|PILER-CR matches to NZ_CP012054 (Xanthomonas citri pv. fuscans strain ISO118C1 plasmid pXff45, complete sequence) position: , mismatch: 8, identity: 0.733

acaccaccccggcctggccacggccggcgt	CRISPR spacer
ggccgtccccggcttgtccacggccggcgc	Protospacer
.  *  *******.** ************.

912. spacer 2.10|313401|30|NC_018524|PILER-CR matches to NZ_CP013007 (Xanthomonas citri pv. malvacearum strain XcmN1003 plasmid pXcmN, complete sequence) position: , mismatch: 8, identity: 0.733

acaccaccccggcctggccacggccggcgt	CRISPR spacer
ggccgtccccggcttgtccacggccggcgc	Protospacer
.  *  *******.** ************.

913. spacer 2.10|313401|30|NC_018524|PILER-CR matches to NZ_CP021003 (Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6166 plasmid pC, complete sequence) position: , mismatch: 8, identity: 0.733

acaccaccccggcctggccacggccggcgt	CRISPR spacer
ggccgtccccggcttgtccacggccggcgc	Protospacer
.  *  *******.** ************.

914. spacer 2.10|313401|30|NC_018524|PILER-CR matches to NZ_CP012052 (Xanthomonas citri pv. fuscans strain ISO118C5 plasmid pXff45, complete sequence) position: , mismatch: 8, identity: 0.733

acaccaccccggcctggccacggccggcgt	CRISPR spacer
ggccgtccccggcttgtccacggccggcgc	Protospacer
.  *  *******.** ************.

915. spacer 2.10|313401|30|NC_018524|PILER-CR matches to NZ_CP020890 (Xanthomonas citri pv. citri strain TX160197 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

acaccaccccggcctggccacggccggcgt	CRISPR spacer
ggccgtccccggcttgtccacggccggcgc	Protospacer
.  *  *******.** ************.

916. spacer 2.10|313401|30|NC_018524|PILER-CR matches to CP021014 (Xanthomonas citri pv. phaseoli var. fuscans strain CFBP7767 plasmid pC, complete sequence) position: , mismatch: 8, identity: 0.733

acaccaccccggcctggccacggccggcgt	CRISPR spacer
ggccgtccccggcttgtccacggccggcgc	Protospacer
.  *  *******.** ************.

917. spacer 2.10|313401|30|NC_018524|PILER-CR matches to NC_022542 (Xanthomonas citri pv. fuscans plasmid plc, complete sequence) position: , mismatch: 8, identity: 0.733

acaccaccccggcctggccacggccggcgt	CRISPR spacer
ggccgtccccggcttgtccacggccggcgc	Protospacer
.  *  *******.** ************.

918. spacer 3.1|318517|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 8, identity: 0.75

gcccagggggccggtctggtcgagttctccat	CRISPR spacer
gcccagggggccggtccagtcgaactcccgga	Protospacer
****************..*****..**.* . 

919. spacer 3.2|318578|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP040096 (Pantoea sp. SO10 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

tcgggcggcggtgagcagatgcccaaggagtt	CRISPR spacer
ctgggcagcggtgagctgatgcccagcgtggt	Protospacer
..****.********* ********. * * *

920. spacer 3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP040764 (Paracoccus sp. 2251 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.75

atgaccgcccatttcgccgaccggctcgccgc	CRISPR spacer
atgaccgcccatgacgccgaccgctacgcgca	Protospacer
************  ********* . ***   

921. spacer 3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP024310 (Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3c, complete sequence) position: , mismatch: 8, identity: 0.75

atgaccgcccatttcgccgaccggctcgccgc	CRISPR spacer
gaggccttccatctcgccgaccggatcgccgt	Protospacer
. *.** .****.*********** ******.

922. spacer 3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013054 (Sinorhizobium americanum CCGM7 plasmid C, complete sequence) position: , mismatch: 8, identity: 0.75

atgaccgcccatttcgccgaccggctcgccgc	CRISPR spacer
gaggccttccatctcgccgaccggatcgccgt	Protospacer
. *.** .****.*********** ******.

923. spacer 3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NC_011887 (Methylobacterium nodulans ORS 2060 plasmid pMNOD02, complete sequence) position: , mismatch: 8, identity: 0.75

atgaccgcccatttcgccgaccggctcgccgc	CRISPR spacer
ctgttcggccatttcggcgaccggctcggccg	Protospacer
 ** .** ******** *********** *  

924. spacer 3.7|318883|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP020951 (Rhizobium sp. CIAT894 plasmid pRheCIAT894d, complete sequence) position: , mismatch: 8, identity: 0.75

gaccctgcccctccgcgccgcccttcatcagg	CRISPR spacer
cgcacattcccttcgcgccgcccttcctcagg	Protospacer
 .* *  .****.************* *****

925. spacer 3.7|318883|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP040765 (Paracoccus sp. 2251 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

gaccctgcc--cctccgcgccgcccttcatcagg	CRISPR spacer
--ccacatcggcctcggcgccgccctgcatcagg	Protospacer
  ** ...*  **** ********** *******

926. spacer 3.7|318883|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MK967384 (Gordonia phage Sidious, complete genome) position: , mismatch: 8, identity: 0.75

-gaccctgcccctccgcgccgcccttcatcagg	CRISPR spacer
tggtggtg-ccctccgcgtcggccttcatcagc	Protospacer
 *..  ** *********.** ********** 

927. spacer 3.8|318944|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NC_017958 (Tistrella mobilis KA081020-065 plasmid pTM3, complete sequence) position: , mismatch: 8, identity: 0.75

ggctgtggagcgcgcggcggctgcgcggggtg	CRISPR spacer
cacggtggatcgcgcggcggatgcgcggatag	Protospacer
 .* ***** ********** *******.  *

928. spacer 3.8|318944|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP025614 (Niveispirillum cyanobacteriorum strain TH16 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

ggctg--tggagcgcgcggcggctgcgcggggtg	CRISPR spacer
--ctggcgggcgcgcgcggcgggtgcgcgggtgc	Protospacer
  ***   ** *********** ********   

929. spacer 3.8|318944|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP029357 (Azospirillum sp. CFH 70021 plasmid unnamed2) position: , mismatch: 8, identity: 0.75

ggctgtggagcgcgcggcggctgcgcggggtg	CRISPR spacer
gcgcatgcggcgcgcggctgctgcgcggcgtg	Protospacer
*  ..** .********* ********* ***

930. spacer 3.8|318944|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP011772 (Croceicoccus naphthovorans strain PQ-2 plasmid p2, complete sequence) position: , mismatch: 8, identity: 0.75

ggctgtgg-agcgcgcggcggctgcgcggggtg	CRISPR spacer
-ctcgcggtagcgcgcggcggcggcgcggcgtt	Protospacer
  ..*.** ************* ****** ** 

931. spacer 3.9|319005|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP049244 (Rhizobium pseudoryzae strain DSM 19479 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.75

cagagagagctggtccgcgcacagggcgcagc	CRISPR spacer
gaggattacctggtccgcgcacaggaagcagc	Protospacer
 **..  * ****************. *****

932. spacer 3.12|319187|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP021083 (Deinococcus ficus strain CC-FR2-10 plasmid pDFI2, complete sequence) position: , mismatch: 8, identity: 0.75

tggggtggccaccgggaccccctcctggccgt	CRISPR spacer
gtcggagagcaccgggacgccctgctggccgt	Protospacer
   ** *. ********* **** ********

933. spacer 3.13|319248|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP014276 (Martelella sp. AD-3 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

gctaggcagggagatctcgatgccgctgtcgg	CRISPR spacer
tgtcggctgggcgatctcgatgccgctgcaag	Protospacer
  * *** *** ****************. .*

934. spacer 3.13|319248|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP016291 (Rhizobium leguminosarum strain Vaf10 plasmid unnamed6, complete sequence) position: , mismatch: 8, identity: 0.75

--gctaggcagggagatctcgatgccgctgtcgg	CRISPR spacer
cggccgag--aggcgatctcgaggccgctgtcgg	Protospacer
  **...*  .** ******** ***********

935. spacer 4.6|321675|32|NC_018524|CRISPRCasFinder,CRT matches to NC_023316 (Streptomyces sp. 14R-10 plasmid pZL1, complete sequence) position: , mismatch: 8, identity: 0.75

cgcaggtgggacagggcgcacaaggccggatg	CRISPR spacer
gaacggtcggacagggcgcgcaaggccgaagg	Protospacer
 .  *** ***********.********.* *

936. spacer 4.6|321675|32|NC_018524|CRISPRCasFinder,CRT matches to NC_023316 (Streptomyces sp. 14R-10 plasmid pZL1, complete sequence) position: , mismatch: 8, identity: 0.75

cgcaggtgggacagggcgcacaaggccggatg	CRISPR spacer
gaacggtcggacagggcgcgcaaggccgaagg	Protospacer
 .  *** ***********.********.* *

937. spacer 4.7|321736|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP019603 (Croceicoccus marinus strain E4A9 plasmid pCME4A9I, complete sequence) position: , mismatch: 8, identity: 0.75

ttgttcgccgccgaggccacggcatccgccaa	CRISPR spacer
ttgttcgccgacgagaccacggcaccggtgct	Protospacer
********** ****.********.* *.   

938. spacer 4.7|321736|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP019604 (Croceicoccus marinus strain E4A9 plasmid pCME4A9II, complete sequence) position: , mismatch: 8, identity: 0.75

ttgttcgccgccgaggccacggcatccgccaa	CRISPR spacer
ttgttcgccgacgagaccacggcaccggtgct	Protospacer
********** ****.********.* *.   

939. spacer 4.9|321858|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP032325 (Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence) position: , mismatch: 8, identity: 0.75

ggggtgcggccgggggtgccggtgtcgggggt	CRISPR spacer
gagcggcagccggtggtgccggtgtcggccat	Protospacer
*.*  **.***** **************  .*

940. spacer 4.9|321858|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP027239 (Dietzia sp. oral taxon 368 strain W5195 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ggggtgcggccgggggtgccggtgtcgggggt	CRISPR spacer
gtgacctggcaggtggtgccggtgtcgggggc	Protospacer
* *.. .*** ** *****************.

941. spacer 4.9|321858|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP041156 (Leisingera aquaemixtae strain R2C4 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ggggtgcggccgggggtgccggtgtcgggggt	CRISPR spacer
ccgccgtggctgggggtgccggtgccgggggc	Protospacer
  * .*.***.*************.******.

942. spacer 4.9|321858|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP007796 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p3, complete sequence) position: , mismatch: 8, identity: 0.75

ggggtgcggccgggggtgccggtgtcgggggt	CRISPR spacer
gagcggcagccggtggtgccggtgtcggccat	Protospacer
*.*  **.***** **************  .*

943. spacer 4.9|321858|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP018865 (Arthrobacter crystallopoietes strain DSM 20117 plasmid pLDW-10, complete sequence) position: , mismatch: 8, identity: 0.75

ggggtgcggccgggggtgccggtgtcgggggt	CRISPR spacer
ggtagccggccggccgtgccggtgtcggggaa	Protospacer
** .  *******  ***************. 

944. spacer 4.9|321858|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP018865 (Arthrobacter crystallopoietes strain DSM 20117 plasmid pLDW-10, complete sequence) position: , mismatch: 8, identity: 0.75

ggggtgcggccgggggtgccggtgtcgggggt	CRISPR spacer
ggtagccggccggccgtgccggtgtcggggaa	Protospacer
** .  *******  ***************. 

945. spacer 4.9|321858|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP032349 (Azospirillum brasilense strain MTCC4039 plasmid p3, complete sequence) position: , mismatch: 8, identity: 0.75

ggggtgcggccgggggtgccggtgtcgggggt	CRISPR spacer
gagcggcagccggtggtgccggtgtcggccat	Protospacer
*.*  **.***** **************  .*

946. spacer 4.9|321858|32|NC_018524|CRISPRCasFinder,CRT matches to MN234234 (Arthrobacter phage Lymara, complete genome) position: , mismatch: 8, identity: 0.75

ggggtgcggccgggggtgccggtgtcgggggt	CRISPR spacer
gtcggccggctgggggtgccggggtcggggtg	Protospacer
*  *  ****.*********** *******  

947. spacer 4.9|321858|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP032342 (Azospirillum brasilense strain MTCC4038 plasmid p3, complete sequence) position: , mismatch: 8, identity: 0.75

ggggtgcggccgggggtgccggtgtcgggggt	CRISPR spacer
gagcggcagccggtggtgccggtgtcggccat	Protospacer
*.*  **.***** **************  .*

948. spacer 4.9|321858|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP046573 (Rhodococcus sp. WAY2 plasmid pRWAY01, complete sequence) position: , mismatch: 8, identity: 0.75

ggggtgcggccgggggtgccggtgtcgggggt	CRISPR spacer
caggtgcggccgggggcgcgggtgttgtcggg	Protospacer
 .**************.** *****.*  ** 

949. spacer 4.9|321858|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP033321 (Azospirillum brasilense strain Cd plasmid p3, complete sequence) position: , mismatch: 8, identity: 0.75

ggggtgcggccgggggtgccggtgtcgggggt	CRISPR spacer
gagcggcagccggtggtgccggtgtcggccat	Protospacer
*.*  **.***** **************  .*

950. spacer 4.9|321858|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP033323 (Azospirillum brasilense strain Cd plasmid p5, complete sequence) position: , mismatch: 8, identity: 0.75

ggggtgcggccgggggtgccggtgtcgggggt	CRISPR spacer
gagcggcagccggtggtgccggtgtcggccat	Protospacer
*.*  **.***** **************  .*

951. spacer 4.9|321858|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP033315 (Azospirillum brasilense strain Sp 7 plasmid p3, complete sequence) position: , mismatch: 8, identity: 0.75

ggggtgcggccgggggtgccggtgtcgggggt	CRISPR spacer
gagcggcagccggtggtgccggtgtcggccat	Protospacer
*.*  **.***** **************  .*

952. spacer 4.9|321858|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP026517 (Deinococcus sp. NW-56 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ggggtgcggccgggggtgccggtgtcgggggt	CRISPR spacer
ggacggcggccgggggtgccgctgccggagag	Protospacer
**.  **************** **.***.*. 

953. spacer 4.9|321858|32|NC_018524|CRISPRCasFinder,CRT matches to NC_003903 (Streptomyces coelicolor A3(2) plasmid SCP1, complete sequence) position: , mismatch: 8, identity: 0.75

ggggtgcggccgggggtgccggtgtcgggggt	CRISPR spacer
tggccgcggccgcgggtgccggtctcggtgcc	Protospacer
 ** .******* ********** **** * .

954. spacer 4.11|322003|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP030828 (Neorhizobium sp. NCHU2750 plasmid pNCHU2750a, complete sequence) position: , mismatch: 8, identity: 0.75

ttcggcgattttccgtggctggatcaagcgtc	CRISPR spacer
ctcggcgatgttccgtggctcgatttatgatc	Protospacer
.******** ********** ***. *  .**

955. spacer 4.22|322065|28|NC_018524|PILER-CR matches to MT713136 (Aeromonas phage AP1, complete genome) position: , mismatch: 8, identity: 0.714

agatgttggacccaggatgcgattttca	CRISPR spacer
tgatgttggactcaggatgcgacgcatg	Protospacer
 **********.**********. . ..

956. spacer 5.1|326532|32|NC_018524|CRISPRCasFinder matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 8, identity: 0.75

ggcgtcctccagcacgttcatgtaggcggcga	CRISPR spacer
ggacgaatccagcacgttcatgaaggtggcca	Protospacer
**     *************** ***.*** *

957. spacer 5.5|326776|32|NC_018524|CRISPRCasFinder matches to CP054934 (Nocardiopsis flavescens strain NA01583 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

gacaagctgttcaacgcgcgcgaactcgccgc	CRISPR spacer
gccgagctgttcatcgcgggcgaactcctcaa	Protospacer
* *.********* **** ******** .*. 

958. spacer 5.6|326837|32|NC_018524|CRISPRCasFinder matches to NZ_CP038636 (Cupriavidus oxalaticus strain X32 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ccgagggcgacgcaggcacgacgccaggtcca	CRISPR spacer
ccgaggcccacgcaggcacgacgccgctgcgg	Protospacer
****** * ****************.   * .

959. spacer 5.6|326837|32|NC_018524|CRISPRCasFinder matches to CP000663 (Rhodobacter sphaeroides ATCC 17025 plasmid pRSPA02, complete sequence) position: , mismatch: 8, identity: 0.75

ccgagggcgacgcaggcacgacgccaggtcca	CRISPR spacer
acgaggtcgacgaaggcacgacgccggatgtc	Protospacer
 ***** ***** ************.*.* . 

960. spacer 5.6|326837|32|NC_018524|CRISPRCasFinder matches to NZ_CP031752 (Rhodobacter sphaeroides strain EBL0706 plasmid p.A, complete sequence) position: , mismatch: 8, identity: 0.75

ccgagggcgacgcaggcacgacgccaggtcca	CRISPR spacer
acgaggtcgacgaaggcacgacgccggatgtc	Protospacer
 ***** ***** ************.*.* . 

961. spacer 5.8|326593|33|NC_018524|CRT matches to NC_012849 (Ralstonia pickettii 12D plasmid pRp12D02, complete sequence) position: , mismatch: 8, identity: 0.758

ccacaaggccccgcccccgaaaggggcggggcc	CRISPR spacer
cctgtgagccacgcccccgaaaggggcgtggca	Protospacer
**   ..*** ***************** *** 

962. spacer 5.11|326776|33|NC_018524|CRT matches to NC_019848 (Sinorhizobium meliloti GR4 plasmid pRmeGR4c, complete sequence) position: , mismatch: 8, identity: 0.758

gacaagctgttcaacgcgcgcgaactcgccgcc	CRISPR spacer
accaagccgttcaacccgcgcgaactcctggca	Protospacer
. *****.******* *********** . ** 

963. spacer 5.11|326776|33|NC_018524|CRT matches to NZ_CP021813 (Sinorhizobium meliloti strain M270 plasmid psymA, complete sequence) position: , mismatch: 8, identity: 0.758

gacaagctgttcaacgcgcgcgaactcgccgcc	CRISPR spacer
accaagccgttcaacccgcgcgaactcctggca	Protospacer
. *****.******* *********** . ** 

964. spacer 5.11|326776|33|NC_018524|CRT matches to NZ_CP021805 (Sinorhizobium meliloti strain T073 plasmid psymA, complete sequence) position: , mismatch: 8, identity: 0.758

gacaagctgttcaacgcgcgcgaactcgccgcc	CRISPR spacer
accaagccgttcaacccgcgcgaactcctggca	Protospacer
. *****.******* *********** . ** 

965. spacer 5.11|326776|33|NC_018524|CRT matches to NZ_CP054625 (Cupriavidus gilardii strain FDAARGOS_639 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.758

gacaagctgttcaacgcgcgcgaactcgccgcc	CRISPR spacer
cccaagccgttcaacccgcgcgaactgatcgcg	Protospacer
  *****.******* ********** ..*** 

966. spacer 5.12|326837|33|NC_018524|CRT matches to NZ_CP038636 (Cupriavidus oxalaticus strain X32 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.758

ccgagggcgacgcaggcacgacgccaggtccac	CRISPR spacer
ccgaggcccacgcaggcacgacgccgctgcggc	Protospacer
****** * ****************.   * .*

967. spacer 5.16|326777|32|NC_018524|PILER-CR matches to CP054934 (Nocardiopsis flavescens strain NA01583 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

gacaagctgttcaacgcgcgcgaactcgccgc	CRISPR spacer
gccgagctgttcatcgcgggcgaactcctcaa	Protospacer
* *.********* **** ******** .*. 

968. spacer 5.17|326838|32|NC_018524|PILER-CR matches to NZ_CP038636 (Cupriavidus oxalaticus strain X32 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ccgagggcgacgcaggcacgacgccaggtcca	CRISPR spacer
ccgaggcccacgcaggcacgacgccgctgcgg	Protospacer
****** * ****************.   * .

969. spacer 5.17|326838|32|NC_018524|PILER-CR matches to CP000663 (Rhodobacter sphaeroides ATCC 17025 plasmid pRSPA02, complete sequence) position: , mismatch: 8, identity: 0.75

ccgagggcgacgcaggcacgacgccaggtcca	CRISPR spacer
acgaggtcgacgaaggcacgacgccggatgtc	Protospacer
 ***** ***** ************.*.* . 

970. spacer 5.17|326838|32|NC_018524|PILER-CR matches to NZ_CP031752 (Rhodobacter sphaeroides strain EBL0706 plasmid p.A, complete sequence) position: , mismatch: 8, identity: 0.75

ccgagggcgacgcaggcacgacgccaggtcca	CRISPR spacer
acgaggtcgacgaaggcacgacgccggatgtc	Protospacer
 ***** ***** ************.*.* . 

971. spacer 9.8|1460493|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP017077 (Novosphingobium resinovorum strain SA1 plasmid pSA2, complete sequence) position: , mismatch: 8, identity: 0.75

cggtggtagtcgaccacctgcgccgtagacgc	CRISPR spacer
cggtagtagtcggccacctgcgccaccggcag	Protospacer
****.*******.***********.. *.*. 

972. spacer 9.8|1460493|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP054613 (Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence) position: , mismatch: 8, identity: 0.75

cggtggta-gtcgaccacctgcgccgtagacgc	CRISPR spacer
-gtgaatacgtcggccgcctgcgccgtagacga	Protospacer
 *  ..** ****.**.*************** 

973. spacer 9.18|1460494|32|NC_018524|PILER-CR matches to NZ_CP017077 (Novosphingobium resinovorum strain SA1 plasmid pSA2, complete sequence) position: , mismatch: 8, identity: 0.75

cggtggtagtcgaccacctgcgccgtagacgc	CRISPR spacer
cggtagtagtcggccacctgcgccaccggcag	Protospacer
****.*******.***********.. *.*. 

974. spacer 9.18|1460494|32|NC_018524|PILER-CR matches to NZ_CP054613 (Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence) position: , mismatch: 8, identity: 0.75

cggtggta-gtcgaccacctgcgccgtagacgc	CRISPR spacer
-gtgaatacgtcggccgcctgcgccgtagacga	Protospacer
 *  ..** ****.**.*************** 

975. spacer 11.3|2251146|32|NC_018524|PILER-CR,CRT matches to NZ_CP007130 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 2, complete sequence) position: , mismatch: 8, identity: 0.75

cgcggcggcgcctgcgcgacctgctcaacgag	CRISPR spacer
aagggcggcgcatgcgcgacctgctccgccac	Protospacer
 . ******** ************** .* * 

976. spacer 11.3|2251146|32|NC_018524|PILER-CR,CRT matches to NC_016624 (Azospirillum lipoferum 4B plasmid AZO_p5, complete sequence) position: , mismatch: 8, identity: 0.75

cgcggcggcgcctgcgcgacctgct-caacgag	CRISPR spacer
gaaggcggcgccggcgggacctgctcccacca-	Protospacer
 . ********* *** ******** * ** * 

977. spacer 11.3|2251146|32|NC_018524|PILER-CR,CRT matches to NZ_CP040821 (Paraoceanicella profunda strain D4M1 plasmid pD4M1C, complete sequence) position: , mismatch: 8, identity: 0.75

cgcggcggcgcctgcgcgacctgctcaacgag	CRISPR spacer
cgggcaagcggctgcgcgacctgcgcaacggc	Protospacer
** *  .*** ************* *****. 

978. spacer 11.3|2251146|32|NC_018524|PILER-CR,CRT matches to MH271308 (Microbacterium phage Percival, complete genome) position: , mismatch: 8, identity: 0.75

cgcggcggcgcctgcgcgacctgctcaacgag	CRISPR spacer
agctggagcgcctccgcgaccagctcaacgcc	Protospacer
 ** * .****** ******* ********  

979. spacer 11.3|2251146|32|NC_018524|PILER-CR,CRT matches to MH553517 (Serratia phage Scapp, complete genome) position: , mismatch: 8, identity: 0.75

cgcggcg----gcgcctgcgcgacctgctcaacgag	CRISPR spacer
----gcgtcccacgcctgcgcgatctgcgcaacgaa	Protospacer
    ***    .***********.**** ******.

980. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 8, identity: 0.75

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
tggttctggatgacgtcgcgcgccgcaccgac	Protospacer
  **  .*****.******* ********** 

981. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to MT522004 (Mycobacterium phage Gail, complete genome) position: , mismatch: 8, identity: 0.75

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
tctactcagatggcggcgcgggccgcatcgag	Protospacer
 *    *.******* ***********.****

982. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NC_028849 (Mycobacterium phage Luchador, complete genome) position: , mismatch: 8, identity: 0.75

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
tctactcagatggcggcgcgggccgcatcgag	Protospacer
 *    *.******* ***********.****

983. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP013578 (Rhizobium phaseoli strain N671 plasmid pRphaN671d, complete sequence) position: , mismatch: 8, identity: 0.75

acgtggcggatggcgtcgcgggcc----gcaccgag	CRISPR spacer
gcgtggcggatgtcgtcgccggcctgaagcgc----	Protospacer
.*********** ****** ****    **.*    

984. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP013550 (Rhizobium phaseoli strain R611 plasmid pRetR611c, complete sequence) position: , mismatch: 8, identity: 0.75

acgtggcggatggcgtcgcgggcc----gcaccgag	CRISPR spacer
gcgtggcggatgtcgtcgccggcctgaagcgc----	Protospacer
.*********** ****** ****    **.*    

985. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP013530 (Rhizobium phaseoli strain R723 plasmid pRphaR723c, complete sequence) position: , mismatch: 8, identity: 0.75

acgtggcggatggcgtcgcgggcc----gcaccgag	CRISPR spacer
gcgtggcggatgtcgtcgccggcctgaagcgc----	Protospacer
.*********** ****** ****    **.*    

986. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP013535 (Rhizobium phaseoli strain R650 plasmid pRphaR650c, complete sequence) position: , mismatch: 8, identity: 0.75

acgtggcggatggcgtcgcgggcc----gcaccgag	CRISPR spacer
gcgtggcggatgtcgtcgccggcctgaagcgc----	Protospacer
.*********** ****** ****    **.*    

987. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP013540 (Rhizobium phaseoli strain R630 plasmid pRphaR630c, complete sequence) position: , mismatch: 8, identity: 0.75

acgtggcggatggcgtcgcgggcc----gcaccgag	CRISPR spacer
gcgtggcggatgtcgtcgccggcctgaagcgc----	Protospacer
.*********** ****** ****    **.*    

988. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP013583 (Rhizobium phaseoli strain N261 plasmid pRphaN261c, complete sequence) position: , mismatch: 8, identity: 0.75

acgtggcggatggcgtcgcgggcc----gcaccgag	CRISPR spacer
gcgtggcggatgtcgtcgccggcctgaagcgc----	Protospacer
.*********** ****** ****    **.*    

989. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP013572 (Rhizobium phaseoli strain N771 plasmid pRphaN671d, complete sequence) position: , mismatch: 8, identity: 0.75

acgtggcggatggcgtcgcgggcc----gcaccgag	CRISPR spacer
gcgtggcggatgtcgtcgccggcctgaagcgc----	Protospacer
.*********** ****** ****    **.*    

990. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP012399 (Chelatococcus sp. CO-6 plasmid pCO-6, complete sequence) position: , mismatch: 8, identity: 0.75

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
ccgtggcggatgtcgtcgcggccctcgcgcgg	Protospacer
 *********** ******** ** *.*  .*

991. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NC_016626 (Burkholderia sp. YI23 plasmid byi_1p, complete sequence) position: , mismatch: 8, identity: 0.75

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
ggctgatgcatggcgtcgcgggccgcgtcgag	Protospacer
.  **..* *****************..****

992. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP046475 (Janibacter melonis strain M714 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
tcgtagcggatggcctcgcgggcctcgtcggc	Protospacer
 ***.********* ********* *..**. 

993. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP017243 (Rhizobium etli 8C-3 plasmid pRsp8C3b, complete sequence) position: , mismatch: 8, identity: 0.75

acgtggcggatggcgtcgcgggcc----gcaccgag	CRISPR spacer
gcgtggcggatgtcgtcgccggcctgaagcgc----	Protospacer
.*********** ****** ****    **.*    

994. spacer 11.7|2251390|33|NC_018524|PILER-CR,CRT matches to KT287080 (Enterobacter phage phiEap-2, complete genome) position: , mismatch: 8, identity: 0.758

cttgagaagctcccgcgcgacctggagtccgag	CRISPR spacer
ctggagaagctcctgcgcgacctggaagacatc	Protospacer
** **********.************.  *.  

995. spacer 11.18|2251513|32|NC_018524|CRT matches to MH271305 (Gordonia phage Morrissey, complete genome) position: , mismatch: 8, identity: 0.75

gcgtacgcgtccatgtcctccacaccaccgcg	CRISPR spacer
gcgaacgcgtccatggcctccacggacccgtt	Protospacer
*** *********** *******.   ***. 

996. spacer 12.1|2254172|29|NC_018524|PILER-CR matches to MN856119 (Siphoviridae sp. isolate 149, complete genome) position: , mismatch: 8, identity: 0.724

actcccacgtcaacgtcctgccactgtgg	CRISPR spacer
atccccacgtctacgtcctgccacaactc	Protospacer
*..******** ************ ..  

997. spacer 12.1|2254172|29|NC_018524|PILER-CR matches to MT006236 (Bifidobacterium phage BitterVaud1, complete genome) position: , mismatch: 8, identity: 0.724

actcccacgtcaacgtcctgccactgtgg	CRISPR spacer
atccccacgtctacgtcctgccacaactc	Protospacer
*..******** ************ ..  

998. spacer 12.5|2254293|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP021083 (Deinococcus ficus strain CC-FR2-10 plasmid pDFI2, complete sequence) position: , mismatch: 8, identity: 0.75

----tgcgtcatgtgctggccaggccccgcacgtac	CRISPR spacer
cggtggcgc----tgctggccgggcccggcacgtac	Protospacer
     ***.    ********.***** ********

999. spacer 13.1|2254469|32|NC_018524|CRISPRCasFinder matches to MT711888 (Pseudomonas phage Dolphis, complete genome) position: , mismatch: 8, identity: 0.75

cgacgacggcaacgccctacgcctagtcgacg	CRISPR spacer
cgacgacggcgacgccctgcgcctggcggtga	Protospacer
**********.*******.*****.*. *  .

1000. spacer 14.2|2268321|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to LN997843 (Streptomyces reticuli genome assembly TUE45, plasmid : II) position: , mismatch: 8, identity: 0.75

ccgattcgccgccgtggccgccacactcaccg	CRISPR spacer
ggtcctcgacgccgtggccgccaaactcaccc	Protospacer
    .*** ************** ******* 

1001. spacer 14.2|2268321|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP034329 (Tabrizicola piscis strain K13M18 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ccgattcgccgccgtggccgccacactcaccg	CRISPR spacer
ccgcttcgccgccggggccgccagcaactcca	Protospacer
*** ********** ********    * **.

1002. spacer 14.2|2268321|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP034329 (Tabrizicola piscis strain K13M18 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ccgattcgccgccgtggccgccacactcaccg	CRISPR spacer
ccgcttcgccgccggggccgccagcaactcca	Protospacer
*** ********** ********    * **.

1003. spacer 14.2|2268321|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP034351 (Streptomyces sp. W1SF4 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.75

ccgattcgccgccgtggccgccacactcaccg	CRISPR spacer
cagctccgccgccgtgtccgccacacccaggt	Protospacer
* * *.********** *********.**   

1004. spacer 14.2|2268321|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP045548 (Streptomyces sp. SYP-A7193 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ccgattcgccgccgtggccgccacactcaccg	CRISPR spacer
cctgcccaacgccgtgaccgccactctcaccg	Protospacer
** ...*. *******.******* *******

1005. spacer 14.3|2268382|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to MH669006 (Streptomyces phage LibertyBell, complete genome) position: , mismatch: 8, identity: 0.75

gcgcacccggacctcaccaaggagttcacccg	CRISPR spacer
gtctacacggacctctccaaggagttcccggg	Protospacer
*. .** ******** *********** *  *

1006. spacer 14.7|2268626|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP020883 (Xanthomonas citri pv. citri strain TX160042 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

gtcgagacggtccggcacgaggtcgaacacaa	CRISPR spacer
gtcgggacggtccggcacgaggacgccgggga	Protospacer
****.***************** **   . .*

1007. spacer 14.7|2268626|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP020886 (Xanthomonas citri pv. citri strain TX160149 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

gtcgagacggtccggcacgaggtcgaacacaa	CRISPR spacer
gtcgggacggtccggcacgaggacgccgggga	Protospacer
****.***************** **   . .*

1008. spacer 14.7|2268626|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP020890 (Xanthomonas citri pv. citri strain TX160197 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

gtcgagacggtccggcacgaggtcgaacacaa	CRISPR spacer
gtcgggacggtccggcacgaggacgccgggga	Protospacer
****.***************** **   . .*

1009. spacer 14.7|2268626|32|NC_018524|CRISPRCasFinder,CRT matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 8, identity: 0.75

gtcgagacggtccggcacgaggtcgaacacaa-	CRISPR spacer
ggcgagacggtccgggacgacgtcg-acgtggt	Protospacer
* ************* **** **** **.... 

1010. spacer 14.7|2268626|32|NC_018524|CRISPRCasFinder,CRT matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 8, identity: 0.75

gtcgagacggtccggcacgaggtcgaacacaa-	CRISPR spacer
ggcgagacggtccgggacgacgtcg-acgtggt	Protospacer
* ************* **** **** **.... 

1011. spacer 14.7|2268626|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP032676 (Rhodococcus rhodochrous strain ATCC BAA870 plasmid pNit, complete sequence) position: , mismatch: 8, identity: 0.75

gtcgagacggtccggcacgaggtcgaacacaa	CRISPR spacer
gctggcaaggtccgctacgaggtcgaacacat	Protospacer
*..*. * ****** .*************** 

1012. spacer 14.7|2268626|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_AP022320 (Burkholderia sp. THE68 plasmid BTHE68_p2, complete sequence) position: , mismatch: 8, identity: 0.75

gtcgagacggtccggcacgaggtcgaacacaa	CRISPR spacer
ctcgtgccggtccggcacgaggtccccggcaa	Protospacer
 *** * *****************    .***

1013. spacer 15.1|2270337|32|NC_018524|CRISPRCasFinder matches to LN997843 (Streptomyces reticuli genome assembly TUE45, plasmid : II) position: , mismatch: 8, identity: 0.75

ggctcgttgaaggcgatcgtgtactcgttgga	CRISPR spacer
gtgccagtgaaggcgatcgtgtacgcgtcggt	Protospacer
*  .*. ***************** ***.** 

1014. spacer 15.1|2270337|32|NC_018524|CRISPRCasFinder matches to NZ_LR134456 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 14, complete sequence) position: , mismatch: 8, identity: 0.75

ggctcgttgaaggcgatcgtgtactcgttgga	CRISPR spacer
gtcgcgttgaaggcgaccgtgtacgcgaggtt	Protospacer
* * ************.******* **  *  

1015. spacer 15.3|2270459|32|NC_018524|CRISPRCasFinder matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 8, identity: 0.75

gagcacagcgacggcaccgccaacggctggtg	CRISPR spacer
ccggacagcggcgccaccgccaacggcggctc	Protospacer
  * ******.** ************* * * 

1016. spacer 15.3|2270459|32|NC_018524|CRISPRCasFinder matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 8, identity: 0.75

gagcacagcgacggcaccgccaacggctggtg	CRISPR spacer
ccggacagcggcgccaccgccaacggcggctc	Protospacer
  * ******.** ************* * * 

1017. spacer 15.26|2271065|29|NC_018524|CRT matches to MT657336 (Microbacterium phage ClearAsMud, complete genome) position: , mismatch: 8, identity: 0.724

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
cttcgcggcgagcccgcggtacgcggtca	Protospacer
 ..  ****** ** *************.

1018. spacer 15.26|2271065|29|NC_018524|CRT matches to KJ538722 (Mycobacterium phage HH92, complete genome) position: , mismatch: 8, identity: 0.724

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
gacgtcgccgatccggcggtacgtcgcgc	Protospacer
. ***** ***************. *.  

1019. spacer 15.26|2271065|29|NC_018524|CRT matches to KT222940 (Mycobacterium phage Kinbote, complete genome) position: , mismatch: 8, identity: 0.724

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
gacgtcgccgatccggcggtacgtcgcgc	Protospacer
. ***** ***************. *.  

1020. spacer 15.26|2271065|29|NC_018524|CRT matches to MH727549 (Mycobacterium phage Gancho, complete genome) position: , mismatch: 8, identity: 0.724

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
gacgtcgccgatccggcggtacgtcgcgc	Protospacer
. ***** ***************. *.  

1021. spacer 15.26|2271065|29|NC_018524|CRT matches to MK919482 (Mycobacterium phage DeepSoil15, complete genome) position: , mismatch: 8, identity: 0.724

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
gacgtcgccgatccggcggtacgtcgcgc	Protospacer
. ***** ***************. *.  

1022. spacer 15.26|2271065|29|NC_018524|CRT matches to MT657330 (Mycobacterium phage Webster2, complete genome) position: , mismatch: 8, identity: 0.724

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
gacgtcgccgatccggcggtacgtcgcgc	Protospacer
. ***** ***************. *.  

1023. spacer 15.26|2271065|29|NC_018524|CRT matches to MF919517 (Mycobacterium phage LilHazelnut, complete genome) position: , mismatch: 8, identity: 0.724

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
gacgtcgccgatccggcggtacgtcgcgc	Protospacer
. ***** ***************. *.  

1024. spacer 15.26|2271065|29|NC_018524|CRT matches to EU203571 (Mycobacterium phage Giles, complete genome) position: , mismatch: 8, identity: 0.724

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
gacgtcgccgatccggcggtacgtcgcgc	Protospacer
. ***** ***************. *.  

1025. spacer 15.26|2271065|29|NC_018524|CRT matches to MK494095 (Mycobacterium phage Daegal, complete genome) position: , mismatch: 8, identity: 0.724

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
gacgtcgccgatccggcggtacgtcgcgc	Protospacer
. ***** ***************. *.  

1026. spacer 15.26|2271065|29|NC_018524|CRT matches to MT818421 (Mycobacterium phage Luke, complete genome) position: , mismatch: 8, identity: 0.724

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
gacgtcgccgatccggcggtacgtcgcgc	Protospacer
. ***** ***************. *.  

1027. spacer 15.26|2271065|29|NC_018524|CRT matches to MH697577 (Mycobacterium phage Amochick, complete genome) position: , mismatch: 8, identity: 0.724

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
gacgtcgccgatccggcggtacgtcgcgc	Protospacer
. ***** ***************. *.  

1028. spacer 15.26|2271065|29|NC_018524|CRT matches to MT684594 (Mycobacterium phage Hadrien, complete genome) position: , mismatch: 8, identity: 0.724

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
gacgtcgccgatccggcggtacgtcgcgc	Protospacer
. ***** ***************. *.  

1029. spacer 15.26|2271065|29|NC_018524|CRT matches to MT114159 (Mycobacterium phage Ein37, complete genome) position: , mismatch: 8, identity: 0.724

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
gacgtcgccgatccggcggtacgtcgcgc	Protospacer
. ***** ***************. *.  

1030. spacer 15.26|2271065|29|NC_018524|CRT matches to KT454972 (Mycobacterium phage Evanesce, complete genome) position: , mismatch: 8, identity: 0.724

accgtcggcgatccggcggtacgcggtcg	CRISPR spacer
gacgtcgccgatccggcggtacgtcgcgc	Protospacer
. ***** ***************. *.  

1031. spacer 18.2|2357908|28|NC_018524|CRISPRCasFinder matches to NZ_CP007794 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence) position: , mismatch: 8, identity: 0.714

cgccgggccgcccggggccggctccgcg	CRISPR spacer
gatcgggccgcccagggccggctcatgt	Protospacer
 ..**********.**********    

1032. spacer 19.5|4409022|32|NC_018524|CRT matches to NZ_CP021083 (Deinococcus ficus strain CC-FR2-10 plasmid pDFI2, complete sequence) position: , mismatch: 8, identity: 0.75

ttccaccaccgcgccgagcgcgaacgggagcg	CRISPR spacer
ttccaccgccgcgccgcgcgcgagcagttcgg	Protospacer
*******.******** ******.*.*    *

1033. spacer 19.5|4409022|32|NC_018524|CRT matches to NZ_CP007129 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence) position: , mismatch: 8, identity: 0.75

ttccaccaccgcgccgagcgcgaacgggagcg	CRISPR spacer
ataggccaccgcgccgagcgcgtactggtccg	Protospacer
 *  .***************** ** **  **

1034. spacer 19.5|4409022|32|NC_018524|CRT matches to NZ_CP020399 (Burkholderia multivorans strain FDAARGOS_246 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

ttccaccaccgcgccgagcgcgaacgggagcg	CRISPR spacer
gagcgcgagcgcggcgagcgcgaacggcagcg	Protospacer
   *.* * **** ************* ****

1035. spacer 19.5|4409022|32|NC_018524|CRT matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 8, identity: 0.75

ttccaccaccgcgccgagcgcgaacgggagcg	CRISPR spacer
gacgaacgccgcgccgagcgcgaacgtcagca	Protospacer
  * * *.******************  ***.

1036. spacer 19.5|4409022|32|NC_018524|CRT matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 8, identity: 0.75

ttccaccaccgcgccgagcgcgaacgggagcg	CRISPR spacer
gacgaacgccgcgccgagcgcgaacgtcagca	Protospacer
  * * *.******************  ***.

1037. spacer 19.5|4409022|32|NC_018524|CRT matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

ttccaccaccgcgccgagcgcgaacgggagcg	CRISPR spacer
cgtcgccaccgcgccgagcgcgatcgtgatca	Protospacer
. .*.****************** ** ** *.

1038. spacer 19.5|4409022|32|NC_018524|CRT matches to NZ_AP017656 (Sphingobium cloacae strain JCM 10874 plasmid pSCLO_2, complete sequence) position: , mismatch: 8, identity: 0.75

ttccaccaccgcgccgagcgcgaacgggagcg	CRISPR spacer
cgcaatcacctcgtcgagcgcgaacgggatca	Protospacer
. * *.**** **.*************** *.

1039. spacer 19.5|4409022|32|NC_018524|CRT matches to NZ_CP043961 (Streptomyces tendae strain 139 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

ttccaccaccgcgccgagcgcgaacgggagcg	CRISPR spacer
gggcaagagcgggccgaccgcgaacgggagcg	Protospacer
   **  * ** ***** **************

1040. spacer 21.6|4582479|33|NC_018524|PILER-CR matches to KX066068 (Pseudomonas phage VSW-3, complete genome) position: , mismatch: 8, identity: 0.758

gaacttctccagctccttgtgagcgctctcccg	CRISPR spacer
atgatcctccagctccttgagagcgctctcagg	Protospacer
. . *.************* **********  *

1041. spacer 21.17|4582358|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP037897 (Thermaerobacter sp. FW80 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

ccacgtgcggtggccagctcctcccagttcga	CRISPR spacer
tcacgggcggcggccagctcctcccggagccg	Protospacer
.**** ****.**************.*  * .

1042. spacer 21.17|4582358|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 8, identity: 0.75

ccacgtgcggtggccagctcctcccagttcga	CRISPR spacer
gcacgggcggcggccagctcctcctcgctgaa	Protospacer
 **** ****.*************. *.* .*

1043. spacer 21.18|4582419|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP032326 (Azospirillum brasilense strain MTCC4035 plasmid p5, complete sequence) position: , mismatch: 8, identity: 0.75

ctgtgggcttgaccagcaggcccttgaagatc	CRISPR spacer
cgcccgcctcgaccagcaggtccttgaagagc	Protospacer
*  . * **.**********.********* *

1044. spacer 21.18|4582419|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP021468 (Komagataeibacter europaeus strain SRCM101446 plasmid pKE1446-1) position: , mismatch: 8, identity: 0.75

ctgtgggcttgaccagcaggcccttgaagatc	CRISPR spacer
cgcagagattgaccagcaggcccgcgaagatg	Protospacer
*   *.* *************** .****** 

1045. spacer 21.18|4582419|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP015171 (Acetobacter ascendens strain LMG 1591 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.75

ctgtgggcttgaccagcaggcccttgaagatc	CRISPR spacer
cgcagagattgaccagcaggcccgcgaagatg	Protospacer
*   *.* *************** .****** 

1046. spacer 21.18|4582419|32|NC_018524|CRISPRCasFinder,CRT matches to NC_016029 (Komagataeibacter medellinensis NBRC 3288 plasmid pGXY050, complete sequence) position: , mismatch: 8, identity: 0.75

ctgtgggcttgaccagcaggcccttgaagatc	CRISPR spacer
cgcagagattgaccagcaggcccgcgaagatg	Protospacer
*   *.* *************** .****** 

1047. spacer 21.18|4582419|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP021513 (Acetobacter pasteurianus subsp. pasteurianus strain SRCM101342 plasmid pAP1342-4, complete sequence) position: , mismatch: 8, identity: 0.75

ctgtgggcttgaccagcaggcccttgaagatc	CRISPR spacer
cacagagattgaccagcaggcccgcgaagatg	Protospacer
*   *.* *************** .****** 

1048. spacer 21.20|4582541|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP009145 (Sinorhizobium meliloti strain RMO17 plasmid pSymA, complete sequence) position: , mismatch: 8, identity: 0.75

gtcgagtgccgtggcctcacggtcgtcggcga	CRISPR spacer
cccggcgggcgcggcctgacggtcgtcggcga	Protospacer
 .**.  * **.***** **************

1049. spacer 21.20|4582541|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP021827 (Sinorhizobium meliloti strain KH35c plasmid psymA, complete sequence) position: , mismatch: 8, identity: 0.75

gtcgagtgccgtggcctcacggtcgtcggcga	CRISPR spacer
cccggcgggcgcggcctgacggtcgtcggcga	Protospacer
 .**.  * **.***** **************

1050. spacer 21.20|4582541|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP019483 (Sinorhizobium meliloti strain B401 plasmid pSymA, complete sequence) position: , mismatch: 8, identity: 0.75

gtcgagtgccgtggcctcacggtcgtcggcga	CRISPR spacer
cccggcgggcgcggcctgacggtcgtcggcga	Protospacer
 .**.  * **.***** **************

1051. spacer 21.20|4582541|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP019486 (Sinorhizobium meliloti strain B399 plasmid pSymA, complete sequence) position: , mismatch: 8, identity: 0.75

gtcgagtgccgtggcctcacggtcgtcggcga	CRISPR spacer
cccggcgggcgcggcctgacggtcgtcggcga	Protospacer
 .**.  * **.***** **************

1052. spacer 21.25|4582846|32|NC_018524|CRISPRCasFinder,CRT matches to NC_019959 (Mycobacterium sp. JS623 plasmid pMYCSM03, complete sequence) position: , mismatch: 8, identity: 0.75

gaacgac--ggccgggtcgtcgtggtcctggccg	CRISPR spacer
--cctgctgggcctggtcgtcgcggtcctggcca	Protospacer
   * .*  **** ********.**********.

1053. spacer 21.25|4582846|32|NC_018524|CRISPRCasFinder,CRT matches to NC_008382 (Rhizobium leguminosarum bv. viciae 3841 plasmid pRL7, complete sequence) position: , mismatch: 8, identity: 0.75

gaacgacggccgggtcgtcgtggtcctggccg	CRISPR spacer
ctataacggccaggtcgtcgttgtcctgcctg	Protospacer
  *..******.********* ****** *.*

1054. spacer 21.25|4582846|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP015867 (Streptomyces parvulus strain 2297 plasmid pSPA1, complete sequence) position: , mismatch: 8, identity: 0.75

gaacgacggccgggtcgtcgtggtcctggccg	CRISPR spacer
cgtcgacggccggaccgtcgtggtccgcgacg	Protospacer
 . **********..***********  * **

1055. spacer 21.25|4582846|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP049735 (Rhizobium leguminosarum strain A1 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

gaacgacggccgggtcgtcgtggtcctggccg	CRISPR spacer
ctataacggccaggtcgtcgttgtcctgcctg	Protospacer
  *..******.********* ****** *.*

1056. spacer 21.25|4582846|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP027299 (Streptomyces sp. SGAir0924 plasmid unnamed_5) position: , mismatch: 8, identity: 0.75

gaacgacggccgggtcgtcgtggtcctggccg	CRISPR spacer
cgtcgacggctgggccgtcgtggtccgcgacg	Protospacer
 . *******.***.***********  * **

1057. spacer 21.25|4582846|32|NC_018524|CRISPRCasFinder,CRT matches to CP049735 (Rhizobium leguminosarum strain A1 plasmid pRLa12, complete sequence) position: , mismatch: 8, identity: 0.75

gaacgacggccgggtcgtcgtggtcctggccg	CRISPR spacer
ctataacggccaggtcgtcgttgtcctgcctg	Protospacer
  *..******.********* ****** *.*

1058. spacer 21.25|4582846|32|NC_018524|CRISPRCasFinder,CRT matches to MT889365 (Microbacterium phage Quenya, complete genome) position: , mismatch: 8, identity: 0.75

gaacgacggccgggtcgtcgtggtcctggccg	CRISPR spacer
ggtcgacggccggctcgccgtggtccagacgc	Protospacer
*. ********** ***.******** *.*  

1059. spacer 21.27|4582968|32|NC_018524|CRISPRCasFinder,CRT matches to NC_019849 (Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence) position: , mismatch: 8, identity: 0.75

ccttgtgccaggtcgcggcggtggtgagtgac	CRISPR spacer
gcatgtgccaggtcgcggcgctcgtgaagttc	Protospacer
 * ***************** * ****.   *

1060. spacer 21.27|4582968|32|NC_018524|CRISPRCasFinder,CRT matches to NC_003078 (Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

ccttgtgccaggtcgcggcggtggtgagtgac	CRISPR spacer
gcatgtgccaggtcgcggcgctcgtgaagttc	Protospacer
 * ***************** * ****.   *

1061. spacer 21.27|4582968|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP019586 (Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

ccttgtgccaggtcgcggcggtggtgagtgac	CRISPR spacer
gcatgtgccaggtcgcggcgctcgtgaagttc	Protospacer
 * ***************** * ****.   *

1062. spacer 21.27|4582968|32|NC_018524|CRISPRCasFinder,CRT matches to NC_017326 (Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence) position: , mismatch: 8, identity: 0.75

ccttgtgccaggtcgcggcggtggtgagtgac	CRISPR spacer
gcatgtgccaggtcgcggcgctcgtgaagttc	Protospacer
 * ***************** * ****.   *

1063. spacer 21.27|4582968|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP021799 (Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

ccttgtgccaggtcgcggcggtggtgagtgac	CRISPR spacer
gcatgtgccaggtcgcggcgctcgtgaagttc	Protospacer
 * ***************** * ****.   *

1064. spacer 21.27|4582968|32|NC_018524|CRISPRCasFinder,CRT matches to NC_017323 (Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence) position: , mismatch: 8, identity: 0.75

ccttgtgccaggtcgcggcggtggtgagtgac	CRISPR spacer
gcatgtgccaggtcgcggcgctcgtgaagttc	Protospacer
 * ***************** * ****.   *

1065. spacer 21.27|4582968|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP009146 (Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

ccttgtgccaggtcgcggcggtggtgagtgac	CRISPR spacer
gcatgtgccaggtcgcggcgctcgtgaagttc	Protospacer
 * ***************** * ****.   *

1066. spacer 21.27|4582968|32|NC_018524|CRISPRCasFinder,CRT matches to NC_018701 (Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence) position: , mismatch: 8, identity: 0.75

ccttgtgccaggtcgcggcggtggtgagtgac	CRISPR spacer
gcatgtgccaggtcgcggcgctcgtgaagttc	Protospacer
 * ***************** * ****.   *

1067. spacer 21.27|4582968|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP021828 (Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

ccttgtgccaggtcgcggcggtggtgagtgac	CRISPR spacer
gcatgtgccaggtcgcggcgctcgtgaagttc	Protospacer
 * ***************** * ****.   *

1068. spacer 21.27|4582968|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP021820 (Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

ccttgtgccaggtcgcggcggtggtgagtgac	CRISPR spacer
gcatgtgccaggtcgcggcgctcgtgaagttc	Protospacer
 * ***************** * ****.   *

1069. spacer 21.27|4582968|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP021831 (Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

ccttgtgccaggtcgcggcggtggtgagtgac	CRISPR spacer
gcatgtgccaggtcgcggcgctcgtgaagttc	Protospacer
 * ***************** * ****.   *

1070. spacer 21.27|4582968|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP021823 (Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

ccttgtgccaggtcgcggcggtggtgagtgac	CRISPR spacer
gcatgtgccaggtcgcggcgctcgtgaagttc	Protospacer
 * ***************** * ****.   *

1071. spacer 21.27|4582968|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP021814 (Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

ccttgtgccaggtcgcggcggtggtgagtgac	CRISPR spacer
gcatgtgccaggtcgcggcgctcgtgaagttc	Protospacer
 * ***************** * ****.   *

1072. spacer 21.27|4582968|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP021795 (Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

ccttgtgccaggtcgcggcggtggtgagtgac	CRISPR spacer
gcatgtgccaggtcgcggcgctcgtgaagttc	Protospacer
 * ***************** * ****.   *

1073. spacer 21.27|4582968|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP021810 (Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

ccttgtgccaggtcgcggcggtggtgagtgac	CRISPR spacer
gcatgtgccaggtcgcggcgctcgtgaagttc	Protospacer
 * ***************** * ****.   *

1074. spacer 21.27|4582968|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP021806 (Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

ccttgtgccaggtcgcggcggtggtgagtgac	CRISPR spacer
gcatgtgccaggtcgcggcgctcgtgaagttc	Protospacer
 * ***************** * ****.   *

1075. spacer 21.27|4582968|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP021218 (Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

ccttgtgccaggtcgcggcggtggtgagtgac	CRISPR spacer
gcatgtgccaggtcgcggcgctcgtgaagttc	Protospacer
 * ***************** * ****.   *

1076. spacer 21.27|4582968|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP026527 (Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

ccttgtgccaggtcgcggcggtggtgagtgac	CRISPR spacer
gcatgtgccaggtcgcggcgctcgtgaagttc	Protospacer
 * ***************** * ****.   *

1077. spacer 21.27|4582968|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP019484 (Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

ccttgtgccaggtcgcggcggtggtgagtgac	CRISPR spacer
gcatgtgccaggtcgcggcgctcgtgaagttc	Protospacer
 * ***************** * ****.   *

1078. spacer 21.27|4582968|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP019487 (Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence) position: , mismatch: 8, identity: 0.75

ccttgtgccaggtcgcggcggtggtgagtgac	CRISPR spacer
gcatgtgccaggtcgcggcgctcgtgaagttc	Protospacer
 * ***************** * ****.   *

1079. spacer 21.27|4582968|32|NC_018524|CRISPRCasFinder,CRT matches to NC_020560 (Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

ccttgtgccaggtcgcggcggtggtgagtgac	CRISPR spacer
gcatgtgccaggtcgcggcgctcgtgaagttc	Protospacer
 * ***************** * ****.   *

1080. spacer 21.27|4582968|32|NC_018524|CRISPRCasFinder,CRT matches to NC_009508 (Sphingomonas wittichii RW1 plasmid pSWIT02, complete sequence) position: , mismatch: 8, identity: 0.75

ccttgtgccaggtcgcggcggtggtgagtgac-	CRISPR spacer
ccttgtgccacgtcgcgtcggtgac-ctcgaca	Protospacer
********** ****** *****..   .*** 

1081. spacer 23.5|4591847|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to CP054917 (Streptomyces sp. NA02950 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

accgacttgccggtgaacgccccgtcggggcc	CRISPR spacer
gcccgcttgccggtgaaggcgccgtcggtgat	Protospacer
.** .************ ** ******* * .

1082. spacer 23.6|4591908|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP025617 (Micrococcus luteus strain SGAir0127 plasmid pSGAir0127) position: , mismatch: 8, identity: 0.75

cgggaaataacggtgatcttcgacgagtactc	CRISPR spacer
ccgtggttgacggtgatcctcgacgactactc	Protospacer
* * .. *.*********.******* *****

1083. spacer 23.6|4591908|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_024972 (Micrococcus sp. A1 plasmid pLMA1, complete sequence) position: , mismatch: 8, identity: 0.75

cgggaaataacggtgatcttcgacgagtactc	CRISPR spacer
ccgtggttgacggtgatcctcgacgactactc	Protospacer
* * .. *.*********.******* *****

1084. spacer 23.8|4592030|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP049732 (Rhizobium leguminosarum strain A1 plasmid pRL11, complete sequence) position: , mismatch: 8, identity: 0.75

acaaaggcctcccccagcttcttgatctgtcg	CRISPR spacer
ccgagctcgtcctccagcttcttgatctgccg	Protospacer
 *.*.  * ***.****************.**

1085. spacer 23.8|4592030|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032695 (Rhizobium jaguaris strain CCGE525 plasmid pRCCGE525c, complete sequence) position: , mismatch: 8, identity: 0.75

acaaaggcctcccccagcttcttgatctgtcg	CRISPR spacer
ccgagctcatcctccagcttcttgatctgccg	Protospacer
 *.*.  * ***.****************.**

1086. spacer 23.9|4592091|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_015951 (Streptomyces violaceusniger Tu 4113 plasmid pSTRVI01, complete sequence) position: , mismatch: 8, identity: 0.75

gctcgtcgaaggcggggttcgcgccaacgacc	CRISPR spacer
gctcgtcgaagacgaggttcgcgtatacctcg	Protospacer
***********.**.********.  **  * 

1087. spacer 23.9|4592091|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032324 (Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence) position: , mismatch: 8, identity: 0.75

gctcgtcgaaggcggggttcgcgcca-acgacc	CRISPR spacer
cctcgccgaaggcggggttggcgctgcgcgat-	Protospacer
 ****.************* ****.. .***. 

1088. spacer 23.9|4592091|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022366 (Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence) position: , mismatch: 8, identity: 0.75

gctcgtcgaaggcggggttcgcgc-caacgacc	CRISPR spacer
cctcgccgaaggcggggttggcgcttcgcgat-	Protospacer
 ****.************* **** . .***. 

1089. spacer 23.9|4592091|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP008945 (Corynebacterium atypicum strain R2070 plasmid phiCATYP2070I, complete sequence) position: , mismatch: 8, identity: 0.75

gctcgtcgaaggcggggttcgcgccaacgacc	CRISPR spacer
ccacacagaaggccgggttcgcgcccacgagc	Protospacer
 * *.. ****** *********** **** *

1090. spacer 24.1|4593189|32|NC_018524|CRISPRCasFinder,CRT matches to NC_023285 (Streptomyces sp. F8 plasmid pFRL5, complete sequence) position: , mismatch: 8, identity: 0.75

gctatggccgccattctcgcggccgctgggat	CRISPR spacer
gacatggccgccattctcgcctccgcgaggcc	Protospacer
* .*****************  **** .** .

1091. spacer 25.8|4595565|32|NC_018524|CRISPRCasFinder matches to NZ_CP032685 (Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence) position: , mismatch: 8, identity: 0.75

gtcgccaagctggatgccagccgccacgcggt	CRISPR spacer
gtcgccaagctggacaccagccggctccagcc	Protospacer
**************..******* * *  * .

1092. spacer 25.8|4595565|32|NC_018524|CRISPRCasFinder matches to NZ_CP032690 (Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence) position: , mismatch: 8, identity: 0.75

gtcgccaagctggatgccagccgccacgcggt	CRISPR spacer
gtcgccaagctggacaccagccggctccagcc	Protospacer
**************..******* * *  * .

1093. spacer 26.15|4598572|32|NC_018524|CRISPRCasFinder,CRT matches to NC_012987 (Methylorubrum extorquens AM1 plasmid p1METDI, complete sequence) position: , mismatch: 8, identity: 0.75

cgtaggtgaggcgtccggccgtcgggcgcctc	CRISPR spacer
ggcccgtagggcgtccagccgtcgggcgtctc	Protospacer
 *.  **..*******.***********.***

1094. spacer 26.15|4598572|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP017427 (Methylobacterium sp. XJLW plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

cgtaggtgaggcgtccggccgtcgggcgcctc	CRISPR spacer
ggcccgtagggcgtccagccgtcgggcgtctc	Protospacer
 *.  **..*******.***********.***

1095. spacer 26.15|4598572|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP029174 (Methylobacterium sp. DM1 plasmid pLVM1, complete sequence) position: , mismatch: 8, identity: 0.75

cgtaggtgaggcgtccggccgtcgggcgcctc	CRISPR spacer
ggcccgtagggcgtccagccgtcgggcgtctc	Protospacer
 *.  **..*******.***********.***

1096. spacer 26.15|4598572|32|NC_018524|CRISPRCasFinder,CRT matches to NC_011758 (Methylorubrum extorquens CM4 plasmid pCMU01, complete sequence) position: , mismatch: 8, identity: 0.75

cgtaggtgaggcgtccggccgtcgggcgcctc	CRISPR spacer
ggcccgtagggcgtccagccgtcgggcgtctc	Protospacer
 *.  **..*******.***********.***

1097. spacer 26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT matches to NC_007353 (Sphingomonas sp. A1 plasmid pA1 DNA, complete sequence) position: , mismatch: 8, identity: 0.75

ttgttcgcctgctcggcggtgagcttcacgac	CRISPR spacer
tggttcgcctgctgggcggcgagctggttggc	Protospacer
* *********** *****.*****   .*.*

1098. spacer 26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT matches to NC_009427 (Novosphingobium aromaticivorans DSM 12444 plasmid pNL2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgttcgcctgctcggcggtgagcttcacgac	CRISPR spacer
tcgcccgcctgctcggcggcgaacttcaggtg	Protospacer
*.*..**************.**.***** *  

1099. spacer 26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP013109 (Sinorhizobium americanum strain CFNEI 73 plasmid B, complete sequence) position: , mismatch: 8, identity: 0.75

ttgttcgcctgctcggcggtgagcttcacgac	CRISPR spacer
tcccgcacctgctcggcggcgagcttgacgcc	Protospacer
*. . *.************.****** *** *

1100. spacer 26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP017759 (Cupriavidus necator strain NH9 plasmid pENH92, complete sequence) position: , mismatch: 8, identity: 0.75

ttgttcgcctgctcggcggtgagcttcacgac	CRISPR spacer
cagtgcaactgctcgacggtgagcttgacgat	Protospacer
. ** *. *******.********** ****.

1101. spacer 26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_AP022338 (Mameliella alba strain KU6B plasmid pKUB257, complete sequence) position: , mismatch: 8, identity: 0.75

ttgttcgcctgctcggcggtgagcttcacgac	CRISPR spacer
tggttcgcctgctcggcgaagagctgcgccgt	Protospacer
* ****************. ***** *.* ..

1102. spacer 26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT matches to MT952845 (Microbacterium phage GardenState, complete genome) position: , mismatch: 8, identity: 0.75

ttgttcgcctgctcggcggtgagcttcacgac	CRISPR spacer
aagttgcgctgctcggcggtgagcttgatgag	Protospacer
  ***   ****************** *.** 

1103. spacer 26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT matches to MK880124 (Microbacterium phage IAmGroot, complete genome) position: , mismatch: 8, identity: 0.75

ttgttcgcctgctcggcggtgagcttcacgac	CRISPR spacer
aagttgcgctgctcggcggtgagcttgatgag	Protospacer
  ***   ****************** *.** 

1104. spacer 26.18|4598755|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP038636 (Cupriavidus oxalaticus strain X32 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

gacccc---gcgttcaccgatgccgtgaccgattg	CRISPR spacer
---cccgaagccttcgccgatgccgtgaccgaaca	Protospacer
   ***   ** ***.**************** ..

1105. spacer 26.20|4598877|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP006991 (Rhizobium sp. IE4771 plasmid pRetIE4771e, complete sequence) position: , mismatch: 8, identity: 0.75

caccagacgccgtgctcgtccggctggccgaa	CRISPR spacer
tggctgacgccgtgctcgacctgctggccgcc	Protospacer
.. * ************* ** ********  

1106. spacer 26.20|4598877|32|NC_018524|CRISPRCasFinder,CRT matches to NC_007763 (Rhizobium etli CFN 42 plasmid p42b, complete sequence) position: , mismatch: 8, identity: 0.75

caccagacgccgtgctcgtccggctggccgaa	CRISPR spacer
tggctgacgccgtgctcgccctgctggccgcc	Protospacer
.. * *************.** ********  

1107. spacer 26.20|4598877|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP020907 (Rhizobium etli strain NXC12 plasmid pRetNXC12a, complete sequence) position: , mismatch: 8, identity: 0.75

caccagacgccgtgctcgtccggctggccgaa	CRISPR spacer
tggctgacgccgtgctcgccctgctggccgcc	Protospacer
.. * *************.** ********  

1108. spacer 26.20|4598877|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP013531 (Rhizobium phaseoli strain R723 plasmid pRphaR723d, complete sequence) position: , mismatch: 8, identity: 0.75

caccagacgccgtgctcgtccggctggccgaa	CRISPR spacer
tcgctgacgccgtgctcggcctgctggccgcc	Protospacer
.  * ************* ** ********  

1109. spacer 26.20|4598877|32|NC_018524|CRISPRCasFinder,CRT matches to NC_021906 (Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1a, complete sequence) position: , mismatch: 8, identity: 0.75

caccagacgccgtgctcgtccggctggccgaa	CRISPR spacer
tggctgacgccgtgctcgccctgctggccgcc	Protospacer
.. * *************.** ********  

1110. spacer 26.20|4598877|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP013584 (Rhizobium phaseoli strain N261 plasmid pRphaN261d, complete sequence) position: , mismatch: 8, identity: 0.75

caccagacgccgtgctcgtccggctggccgaa	CRISPR spacer
tcgctgacgccgtgctcggcctgctggccgcc	Protospacer
.  * ************* ** ********  

1111. spacer 26.20|4598877|32|NC_018524|CRISPRCasFinder,CRT matches to NC_016585 (Azospirillum lipoferum 4B plasmid AZO_p1, complete sequence) position: , mismatch: 8, identity: 0.75

caccagacgccgtgctcgtccggctggccgaa	CRISPR spacer
ccaagggcgccgtgctggtccggctggacgac	Protospacer
*   .*.********* ********** *** 

1112. spacer 26.20|4598877|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP039697 (Novosphingobium sp. ABRDHK2 plasmid pABRDHK22, complete sequence) position: , mismatch: 8, identity: 0.75

caccagacgccgtgctcgtccggctggccgaa	CRISPR spacer
tatgcgccaccgcgctcgaccggctggccgaa	Protospacer
.*.  * *.***.***** *************

1113. spacer 26.20|4598877|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_LR134459 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 17, complete sequence) position: , mismatch: 8, identity: 0.75

caccagac---gccgtgctcgtccggctggccgaa	CRISPR spacer
---gtgacgtagccgtcctcgtcctgctggccgac	Protospacer
     ***   ***** ******* ********* 

1114. spacer 26.20|4598877|32|NC_018524|CRISPRCasFinder,CRT matches to MH229865 (Streptomyces phage LazerLemon, complete genome) position: , mismatch: 8, identity: 0.75

caccagacgccgtgctcgtccggctggccgaa	CRISPR spacer
ccgtacacgccgtcctcgtccggctcgcccca	Protospacer
*  .* ******* *********** ***  *

1115. spacer 26.21|4598938|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_LT904879 (Salmonella enterica subsp. enterica serovar Typhi strain ty3-193 genome assembly, plasmid: 2) position: , mismatch: 8, identity: 0.75

ggcggcaggccggtacggtgccgccatggatc----	CRISPR spacer
ggcggcaggcaggtgcggtgccg----gggtttcct	Protospacer
********** ***.********    **.*.    

1116. spacer 26.21|4598938|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP029645 (Salmonella enterica subsp. enterica serovar Typhi strain 311189_217186 plasmid pHCM1, complete sequence) position: , mismatch: 8, identity: 0.75

ggcggcaggccggtacggtgccgccatggatc----	CRISPR spacer
ggcggcaggcaggtgcggtgccg----gggtttcct	Protospacer
********** ***.********    **.*.    

1117. spacer 26.21|4598938|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP029895 (Salmonella enterica subsp. enterica serovar Typhi strain 311189_252186 plasmid pHCM1, complete sequence) position: , mismatch: 8, identity: 0.75

ggcggcaggccggtacggtgccgccatggatc----	CRISPR spacer
ggcggcaggcaggtgcggtgccg----gggtttcct	Protospacer
********** ***.********    **.*.    

1118. spacer 26.21|4598938|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP029877 (Salmonella enterica subsp. enterica serovar Typhi strain 311189_224186 plasmid pHCM1, complete sequence) position: , mismatch: 8, identity: 0.75

ggcggcaggccggtacggtgccgccatggatc----	CRISPR spacer
ggcggcaggcaggtgcggtgccg----gggtttcct	Protospacer
********** ***.********    **.*.    

1119. spacer 26.21|4598938|32|NC_018524|CRISPRCasFinder,CRT matches to LT905061 (Salmonella enterica subsp. enterica serovar Typhi isolate ISP_03_07467_SGB110-sc-1979083 genome assembly, plasmid: 2) position: , mismatch: 8, identity: 0.75

ggcggcaggccggtacggtgccgccatggatc----	CRISPR spacer
ggcggcaggcaggtgcggtgccg----gggtttcct	Protospacer
********** ***.********    **.*.    

1120. spacer 26.21|4598938|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP029926 (Salmonella enterica subsp. enterica serovar Typhi strain 311189_218186 plasmid pHCM1, complete sequence) position: , mismatch: 8, identity: 0.75

ggcggcaggccggtacggtgccgccatggatc----	CRISPR spacer
ggcggcaggcaggtgcggtgccg----gggtttcct	Protospacer
********** ***.********    **.*.    

1121. spacer 26.21|4598938|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP029947 (Salmonella enterica subsp. enterica serovar Typhi strain 311189_210186 plasmid pHCM1, complete sequence) position: , mismatch: 8, identity: 0.75

ggcggcaggccggtacggtgccgccatggatc----	CRISPR spacer
ggcggcaggcaggtgcggtgccg----gggtttcct	Protospacer
********** ***.********    **.*.    

1122. spacer 26.21|4598938|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP017759 (Cupriavidus necator strain NH9 plasmid pENH92, complete sequence) position: , mismatch: 8, identity: 0.75

ggcggcaggccggtacggtgccgccatggatc	CRISPR spacer
gacggcaggccggtaaggggccgcccggtaga	Protospacer
*.************* ** ******  * *  

1123. spacer 26.21|4598938|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP029943 (Salmonella enterica subsp. enterica serovar Typhi strain 311189_212186 plasmid pHCM1, complete sequence) position: , mismatch: 8, identity: 0.75

ggcggcaggccggtacggtgccgccatggatc----	CRISPR spacer
ggcggcaggcaggtgcggtgccg----gggtttcct	Protospacer
********** ***.********    **.*.    

1124. spacer 26.21|4598938|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP029953 (Salmonella enterica subsp. enterica serovar Typhi strain 311189_204186 plasmid pHCM1, complete sequence) position: , mismatch: 8, identity: 0.75

ggcggcaggccggtacggtgccgccatggatc----	CRISPR spacer
ggcggcaggcaggtgcggtgccg----gggtttcct	Protospacer
********** ***.********    **.*.    

1125. spacer 26.21|4598938|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP029955 (Salmonella enterica subsp. enterica serovar Typhi strain 311189_202186 plasmid pHCM1, complete sequence) position: , mismatch: 8, identity: 0.75

ggcggcaggccggtacggtgccgccatggatc----	CRISPR spacer
ggcggcaggcaggtgcggtgccg----gggtttcct	Protospacer
********** ***.********    **.*.    

1126. spacer 26.21|4598938|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP029924 (Salmonella enterica subsp. enterica serovar Typhi strain 311189_221186 plasmid pHCM1, complete sequence) position: , mismatch: 8, identity: 0.75

ggcggcaggccggtacggtgccgccatggatc----	CRISPR spacer
ggcggcaggcaggtgcggtgccg----gggtttcct	Protospacer
********** ***.********    **.*.    

1127. spacer 26.21|4598938|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP029934 (Salmonella enterica subsp. enterica serovar Typhi strain 311189_214186 plasmid pHCM1, complete sequence) position: , mismatch: 8, identity: 0.75

ggcggcaggccggtacggtgccgccatggatc----	CRISPR spacer
ggcggcaggcaggtgcggtgccg----gggtttcct	Protospacer
********** ***.********    **.*.    

1128. spacer 26.21|4598938|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP029939 (Salmonella enterica subsp. enterica serovar Typhi strain 311189_206186 plasmid pHCM1, complete sequence) position: , mismatch: 8, identity: 0.75

ggcggcaggccggtacggtgccgccatggatc----	CRISPR spacer
ggcggcaggcaggtgcggtgccg----gggtttcct	Protospacer
********** ***.********    **.*.    

1129. spacer 26.21|4598938|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP029957 (Salmonella enterica subsp. enterica serovar Typhi strain 311189_201186 plasmid pHCM1, complete sequence) position: , mismatch: 8, identity: 0.75

ggcggcaggccggtacggtgccgccatggatc----	CRISPR spacer
ggcggcaggcaggtgcggtgccg----gggtttcct	Protospacer
********** ***.********    **.*.    

1130. spacer 26.21|4598938|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP029941 (Salmonella enterica subsp. enterica serovar Typhi strain 311189_203186 plasmid pHCM1, complete sequence) position: , mismatch: 8, identity: 0.75

ggcggcaggccggtacggtgccgccatggatc----	CRISPR spacer
ggcggcaggcaggtgcggtgccg----gggtttcct	Protospacer
********** ***.********    **.*.    

1131. spacer 26.21|4598938|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP029910 (Salmonella enterica subsp. enterica serovar Typhi strain 311189_219186 plasmid pHCM1, complete sequence) position: , mismatch: 8, identity: 0.75

ggcggcaggccggtacggtgccgccatggatc----	CRISPR spacer
ggcggcaggcaggtgcggtgccg----gggtttcct	Protospacer
********** ***.********    **.*.    

1132. spacer 26.21|4598938|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP029887 (Salmonella enterica subsp. enterica serovar Typhi strain 311189_220186 plasmid pHCM1, complete sequence) position: , mismatch: 8, identity: 0.75

ggcggcaggccggtacggtgccgccatggatc----	CRISPR spacer
ggcggcaggcaggtgcggtgccg----gggtttcct	Protospacer
********** ***.********    **.*.    

1133. spacer 26.21|4598938|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP029948 (Salmonella enterica subsp. enterica serovar Typhi strain 311189_208186 plasmid pHCM1, complete sequence) position: , mismatch: 8, identity: 0.75

ggcggcaggccggtacggtgccgccatggatc----	CRISPR spacer
ggcggcaggcaggtgcggtgccg----gggtttcct	Protospacer
********** ***.********    **.*.    

1134. spacer 26.21|4598938|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP029937 (Salmonella enterica subsp. enterica serovar Typhi strain 311189_207186 plasmid pHCM1, complete sequence) position: , mismatch: 8, identity: 0.75

ggcggcaggccggtacggtgccgccatggatc----	CRISPR spacer
ggcggcaggcaggtgcggtgccg----gggtttcct	Protospacer
********** ***.********    **.*.    

1135. spacer 26.21|4598938|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP029879 (Salmonella enterica subsp. enterica serovar Typhi strain 311189_223186 plasmid pHCM1, complete sequence) position: , mismatch: 8, identity: 0.75

ggcggcaggccggtacggtgccgccatggatc----	CRISPR spacer
ggcggcaggcaggtgcggtgccg----gggtttcct	Protospacer
********** ***.********    **.*.    

1136. spacer 26.21|4598938|32|NC_018524|CRISPRCasFinder,CRT matches to NC_016825 (Salmonella enterica subsp. enterica serovar Typhi str. P-stx-12 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

ggcggcaggccggtacggtgccgccatggatc----	CRISPR spacer
ggcggcaggcaggtgcggtgccg----gggtttcct	Protospacer
********** ***.********    **.*.    

1137. spacer 26.21|4598938|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP029931 (Salmonella enterica subsp. enterica serovar Typhi strain 311189_215186 plasmid pHCM1, complete sequence) position: , mismatch: 8, identity: 0.75

ggcggcaggccggtacggtgccgccatggatc----	CRISPR spacer
ggcggcaggcaggtgcggtgccg----gggtttcct	Protospacer
********** ***.********    **.*.    

1138. spacer 26.21|4598938|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP029935 (Salmonella enterica subsp. enterica serovar Typhi strain 311189_213186 plasmid pHCM1, complete sequence) position: , mismatch: 8, identity: 0.75

ggcggcaggccggtacggtgccgccatggatc----	CRISPR spacer
ggcggcaggcaggtgcggtgccg----gggtttcct	Protospacer
********** ***.********    **.*.    

1139. spacer 26.22|4598999|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

cgcgtt-cgcggctggacacgctcacgatcatc	CRISPR spacer
-gcttcgcgcggctggacacgctcaagttccag	Protospacer
 ** *. ****************** * **   

1140. spacer 26.23|4599060|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP032323 (Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence) position: , mismatch: 8, identity: 0.75

caggccctggaggacagccggtccgcccgcgc	CRISPR spacer
tggagcttcgaggacatctggtccgcccgcgc	Protospacer
..*. *.* ******* *.*************

1141. spacer 26.23|4599060|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP007795 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence) position: , mismatch: 8, identity: 0.75

caggccctggaggacagccggtccgcccgcgc	CRISPR spacer
tggagcttcgaggacatctggtccgcccgcgc	Protospacer
..*. *.* ******* *.*************

1142. spacer 26.23|4599060|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP022363 (Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence) position: , mismatch: 8, identity: 0.75

caggccctggaggacagccggtccgcccgcgc	CRISPR spacer
tggagcttcgaggacatctggtccgcccgcgc	Protospacer
..*. *.* ******* *.*************

1143. spacer 26.23|4599060|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP032341 (Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence) position: , mismatch: 8, identity: 0.75

caggccctggaggacagccggtccgcccgcgc	CRISPR spacer
tggagcttcgaggacatctggtccgcccgcgc	Protospacer
..*. *.* ******* *.*************

1144. spacer 26.23|4599060|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP033321 (Azospirillum brasilense strain Cd plasmid p3, complete sequence) position: , mismatch: 8, identity: 0.75

caggccctggaggacagccggtccgcccgcgc	CRISPR spacer
tggagcttcgaggacatctggtccgcccgcgc	Protospacer
..*. *.* ******* *.*************

1145. spacer 26.23|4599060|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP033315 (Azospirillum brasilense strain Sp 7 plasmid p3, complete sequence) position: , mismatch: 8, identity: 0.75

caggccctggaggacagccggtccgcccgcgc	CRISPR spacer
tggagcttcgaggacatctggtccgcccgcgc	Protospacer
..*. *.* ******* *.*************

1146. spacer 26.23|4599060|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP032347 (Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence) position: , mismatch: 8, identity: 0.75

caggccctggaggacagccggtccgcccgcgc	CRISPR spacer
tggagcttcgaggacatctggtccgcccgcgc	Protospacer
..*. *.* ******* *.*************

1147. spacer 26.23|4599060|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP012916 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence) position: , mismatch: 8, identity: 0.75

caggccctggaggacagccggtccgcccgcgc	CRISPR spacer
tggagcttcgaggacatctggtccgcccgcgc	Protospacer
..*. *.* ******* *.*************

1148. spacer 26.24|4599121|32|NC_018524|CRISPRCasFinder,CRT matches to NC_014663 (Acinetobacter phage Acj9, complete genome) position: , mismatch: 8, identity: 0.75

----aagccctacaagctctcggtgtcatggctgcc	CRISPR spacer
ttcatag----ataagctgtcggtgtcatggttgcc	Protospacer
     **    *.***** ************.****

1149. spacer 26.25|4599182|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP017300 (Rhodococcus sp. YL-1 plasmid pYLC1, complete sequence) position: , mismatch: 8, identity: 0.75

acggagctcgtcgagctcgacatcgcgggctc	CRISPR spacer
tcgaagttcgtcgagctcgacatcgtgaccgt	Protospacer
 **.**.******************.*. * .

1150. spacer 26.25|4599182|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP034154 (Rhodococcus sp. NJ-530 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

acggagctcgtcgagctcgacatcgcgggctc	CRISPR spacer
tcgaagttcgtcgagctcgacatcgtgaccgt	Protospacer
 **.**.******************.*. * .

1151. spacer 26.25|4599182|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_LR134452 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 10, complete sequence) position: , mismatch: 8, identity: 0.75

acggagctcgtcgagctcgacatcg---cgggctc	CRISPR spacer
tgggagcccgtcgggctcgacatcgacacgga---	Protospacer
  *****.*****.***********   ***.   

1152. spacer 26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP050953 (Rhodococcus sp. DMU1 plasmid unnamed) position: , mismatch: 8, identity: 0.75

acctcgaactcgcggcgctcgcggccgtcacg	CRISPR spacer
gcaacgaactcggggcgctctcggccgttgcc	Protospacer
.*  ******** ******* *******..* 

1153. spacer 26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP024310 (Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3c, complete sequence) position: , mismatch: 8, identity: 0.75

acctcgaactcgcggcgctcgcggccgtcacg	CRISPR spacer
tcctcgaactcgcggcggtcccggccattgac	Protospacer
 **************** ** *****.*..  

1154. spacer 26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP013054 (Sinorhizobium americanum CCGM7 plasmid C, complete sequence) position: , mismatch: 8, identity: 0.75

acctcgaactcgcggcgctcgcggccgtcacg	CRISPR spacer
tcctcgaactcgcggcggtcccggccattgac	Protospacer
 **************** ** *****.*..  

1155. spacer 26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP023064 (Sinorhizobium sp. CCBAU 05631 plasmid pSS05631b, complete sequence) position: , mismatch: 8, identity: 0.75

acctcgaactcgcggcgctcgcggccgtcacg	CRISPR spacer
tcctcgaactcgcggcggtcccggccattgac	Protospacer
 **************** ** *****.*..  

1156. spacer 26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP040764 (Paracoccus sp. 2251 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.75

acctcgaactcgcggcgctcgcggccgtcacg	CRISPR spacer
gcctcgatctcgcggcgctggcggcgcgagcg	Protospacer
.****** *********** *****    .**

1157. spacer 26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_HG813238 (Erwinia amylovora strain 692 plasmid pEA68, complete sequence) position: , mismatch: 8, identity: 0.75

acctcgaactcgcggcgctcgcggccgtcacg-	CRISPR spacer
gcctcaaactcgcggccctcgcggaca-agcgc	Protospacer
.****.********** ******* *.  .** 

1158. spacer 26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP026745 (Nocardia cyriacigeorgica strain MDA3349 isolate MDA3349 ancestor plasmid p_unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

acctcgaactcgcggcgctcgcggccgtcacg	CRISPR spacer
aacttcgggtcgcggcgctcgcggccgcgacg	Protospacer
* **. .. ******************. ***

1159. spacer 26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP050138 (Sphingomonas sp. CL5.1 plasmid pTSSC1, complete sequence) position: , mismatch: 8, identity: 0.75

acctcgaactcgcggcgctcgcggccgtcacg	CRISPR spacer
gcttctctttcgcggcgatcgcggcggtcacg	Protospacer
.*.**   .******** ******* ******

1160. spacer 26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP030074 (Streptomyces sp. ZFG47 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

acctcgaactcgcggcgctcgcggccgtcacg	CRISPR spacer
tcaccgtcctcgccgcgctcgccgccgtcacc	Protospacer
 * .**  ***** ******** ******** 

1161. spacer 28.1|4608658|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to LN997843 (Streptomyces reticuli genome assembly TUE45, plasmid : II) position: , mismatch: 8, identity: 0.75

ccaccgcccgggaggccgcccaccgggccgca	CRISPR spacer
gatccgcccgggcggccgcccactgggccagc	Protospacer
   ********* **********.*****.  

1162. spacer 28.1|4608658|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP054841 (Acidovorax sp. 16-35-5 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ccaccgcccgggaggccgcccaccgggccgca	CRISPR spacer
tcgtagcccggcaggccgcccagcgggccgtc	Protospacer
.*.. ****** ********** *******. 

1163. spacer 28.1|4608658|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013069 (Pannonibacter phragmitetus strain 31801 plasmid p.p-1, complete sequence) position: , mismatch: 8, identity: 0.75

ccaccgcccgggaggccgcccaccgggccgca	CRISPR spacer
cccatgcgcgggaggccgcgcaccgggccttt	Protospacer
**  .** *********** ********* . 

1164. spacer 28.1|4608658|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032313 (Pannonibacter phragmitetus BB plasmid p.BB_1, complete sequence) position: , mismatch: 8, identity: 0.75

ccaccgcccgggaggccgcccaccgggccgca	CRISPR spacer
cccatgcgcgggaggccgcgcaccgggccttc	Protospacer
**  .** *********** ********* . 

1165. spacer 28.1|4608658|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP012698 (Microbacterium sp. No. 7 plasmid A, complete sequence) position: , mismatch: 8, identity: 0.75

ccaccgcccgggaggccgcccaccgggccgca	CRISPR spacer
atcccgcccgggaggccgccaacggggtcacc	Protospacer
 . ***************** ** ***.*.* 

1166. spacer 28.1|4608658|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP020568 (Kitasatospora aureofaciens strain DM-1 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ccaccgcccgggaggccgcccaccgggccgca	CRISPR spacer
ccgcgcccggggaggccgccgaccgggccctg	Protospacer
**.*  ** *********** ******** ..

1167. spacer 28.1|4608658|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_019846 (Sinorhizobium meliloti GR4 plasmid pRmeGR4a, complete sequence) position: , mismatch: 8, identity: 0.75

ccaccgcccgggaggccgcccaccgggccgca-	CRISPR spacer
ggcccggccgggaggccgcccgcc-ggcagcgg	Protospacer
   *** **************.** *** **. 

1168. spacer 30.2|4637791|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP028348 (Novosphingobium sp. THN1 plasmid pTHN, complete sequence) position: , mismatch: 8, identity: 0.75

gagggcagtcgatgatgatctcgtcgaactct	CRISPR spacer
cgggaaagtcgacgatgatcgcgtcgaactgg	Protospacer
 .**. ******.******* *********  

1169. spacer 30.2|4637791|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP042825 (Rhizobium sp. WL3 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

gagggcagtcgatgatgatctcgtcgaactct	CRISPR spacer
gcgggaagtcgatgatgatcacgtcatgctgc	Protospacer
* *** ************** ****. .** .

1170. spacer 30.2|4637791|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP042825 (Rhizobium sp. WL3 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

gagggcagtcgatgatgatctcgtcgaactct	CRISPR spacer
gcgggaagtcgatgatgatcacgtcatgctgc	Protospacer
* *** ************** ****. .** .

1171. spacer 30.2|4637791|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP029830 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

gagggcagtcgatgatgatctcgtcgaactct	CRISPR spacer
gcggcgagtcgatgatgaccgcgtcgaacatc	Protospacer
* **  ************.* ******** ..

1172. spacer 30.2|4637791|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP054622 (Azospirillum oryzae strain KACC 14407 plasmid unnamed7, complete sequence) position: , mismatch: 8, identity: 0.75

gagggcagtcgatgatgatctcgtcgaactct	CRISPR spacer
gtgggcagtcgatgatgataacgtcatacgac	Protospacer
* *****************  ****. **  .

1173. spacer 30.2|4637791|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP039651 (Azospirillum sp. TSA2s plasmid p1) position: , mismatch: 8, identity: 0.75

gagggcagtcgatgatgatctcgtcgaactct	CRISPR spacer
gtgggcagtcgatgatgataacgtcatacgac	Protospacer
* *****************  ****. **  .

1174. spacer 30.2|4637791|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_019307 (Streptomyces sp. W75 plasmid pCQ4, complete sequence) position: , mismatch: 8, identity: 0.75

gagggcagtcgatgatgatctcgtcgaactct	CRISPR spacer
cggggcagtcgacgatgatcacgtcatagtcg	Protospacer
 .**********.******* ****. * ** 

1175. spacer 30.2|4637791|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to KF024734 (Mycobacterium phage Shrimp, complete genome) position: , mismatch: 8, identity: 0.75

gagggcagtcgatgatgatctcgtcgaactct	CRISPR spacer
tcgggcagtcgatgacgatcttgtccagcgcc	Protospacer
  *************.*****.*** *.* *.

1176. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 8, identity: 0.75

cctcggggccggcggtgatcgccccggcccgc	CRISPR spacer
cctcggggcgggcggcgatcgccagcgccttg	Protospacer
********* *****.*******   ***.  

1177. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_023283 (Streptomyces sp. FR1 plasmid pFRL3, complete sequence) position: , mismatch: 8, identity: 0.75

cctcggggccggcggtgatcgccccggcccgc	CRISPR spacer
cgcccaggccggcggtgagcgccccggccacg	Protospacer
* .* .************ **********   

1178. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_023284 (Streptomyces sp. F2 plasmid pFRL4, complete sequence) position: , mismatch: 8, identity: 0.75

cctcggggccggcggtgatcgccccggcccgc	CRISPR spacer
cgcccaggccggcggtgagcgccccggccacg	Protospacer
* .* .************ **********   

1179. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 8, identity: 0.75

cctcggggccggcggtgatcgccccggcccgc	CRISPR spacer
cctcggggcgggcggcgatcgccagcgccttg	Protospacer
********* *****.*******   ***.  

1180. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP005086 (Sphingobium sp. TKS plasmid pTK2, complete sequence) position: , mismatch: 8, identity: 0.75

cctcggggccggcggtgatcgccccggcccgc	CRISPR spacer
cgatgatgccgccggggatcgccccggcccgg	Protospacer
*  .*. **** *** *************** 

1181. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 8, identity: 0.75

cctcggggccggcggtgatcgccccggcccgc	CRISPR spacer
agtcgggggcggcggtcatcgccccgccgtcc	Protospacer
  ****** ******* ********* * . *

1182. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP005087 (Sphingobium sp. TKS plasmid pTK3, complete sequence) position: , mismatch: 8, identity: 0.75

cctcggggccggcggtgatcgccccggcccgc	CRISPR spacer
cgatgatgccgccggggatcgccccggcccgg	Protospacer
*  .*. **** *** *************** 

1183. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_009475 (Bradyrhizobium sp. BTAi1 plasmid pBBta01, complete sequence) position: , mismatch: 8, identity: 0.75

cctcggggccggcggtgatcgccccggcccgc-	CRISPR spacer
cctcgaggccggcggcgatcg-cctgcttcacg	Protospacer
*****.*********.***** **.* ..*.* 

1184. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_004320 (Corynebacterium efficiens YS-314 plasmid pCE3, complete sequence) position: , mismatch: 8, identity: 0.75

cctcggggc----cggcggtgatcgccccggcccgc	CRISPR spacer
----ggagtgcggcggcggtgatcgccgcggccagc	Protospacer
    **.*.    ************** ***** **

1185. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP025114 (Bradyrhizobium sp. SK17 strain CBNU plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

cctcggggccggcggtgatcgccccggcccgc-	CRISPR spacer
cctcgaggccggcggcgatcg-cctgcttcacg	Protospacer
*****.*********.***** **.* ..*.* 

1186. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_013531 (Xylanimonas cellulosilytica DSM 15894 plasmid pXCEL01, complete sequence) position: , mismatch: 8, identity: 0.75

cctcggggccggcggtgatcgccccggcccgc	CRISPR spacer
cggccagtgcgccggtgatcgccccggccagc	Protospacer
*  * .*  ** ***************** **

1187. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP044544 (Bradyrhizobium betae strain PL7HG1 plasmid pBbPL7HG1, complete sequence) position: , mismatch: 8, identity: 0.75

cctcggggccggcggtgatcgccccggcccgc-	CRISPR spacer
cctcgaggccggcggcgatcg-cctgcttcaca	Protospacer
*****.*********.***** **.* ..*.* 

1188. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_001387 (Streptomyces lividans plasmid pIJ101, complete sequence) position: , mismatch: 8, identity: 0.75

cctcggggccggcggtgatcgccccggcccgc	CRISPR spacer
cgaccacggcggcggtgatctcctcggcccgc	Protospacer
*  * . * *********** **.********

1189. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_001425 (Streptomyces flavovirens plasmid pSN22 DNA, complete sequence) position: , mismatch: 8, identity: 0.75

cctcggggccggcggtgatcgccccggcccgc	CRISPR spacer
cgaccacggcggcggtgatctcctcggcccgc	Protospacer
*  * . * *********** **.********

1190. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to MT118302 (Pseudomonas phage Epa38, complete genome) position: , mismatch: 8, identity: 0.75

cctcggggccggcggtgatcgccccggcccgc	CRISPR spacer
tctggaagccagaggtgatcgccccggccctt	Protospacer
.** *..***.* ***************** .

1191. spacer 30.5|4637974|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to CP021131 (Meiothermus taiwanensis strain WR-220 plasmid pMtWR-220, complete sequence) position: , mismatch: 8, identity: 0.75

tcgtggtacatcagctccccgctcacctccag	CRISPR spacer
tagagccccatcagctcccggctcaccgccaa	Protospacer
* * * . *********** ******* ***.

1192. spacer 32.1|4652561|33|NC_018524|PILER-CR,CRT matches to NZ_CP015742 (Shinella sp. HZN7 plasmid pShin-06, complete sequence) position: , mismatch: 8, identity: 0.758

ctctggacgatcgaccaggtcaccgagttcctg	CRISPR spacer
ttggggacgatcgaccagctcaccgtgtcgccg	Protospacer
.*  ************** ****** **. *.*

1193. spacer 32.2|4652622|33|NC_018524|PILER-CR,CRT matches to MT114163 (Mycobacterium phage Settecandela, complete genome) position: , mismatch: 8, identity: 0.758

gttcgagttccagaccaaggagctcatcgccgc	CRISPR spacer
cttcatcgcccaggccaaggagctcgtcgccgc	Protospacer
 ***.   .****.***********.*******

1194. spacer 32.2|4652622|33|NC_018524|PILER-CR,CRT matches to MK937592 (Mycobacterium phage Phrappuccino, complete genome) position: , mismatch: 8, identity: 0.758

gttcgagttccagaccaaggagctcatcgccgc	CRISPR spacer
cttcatcgcccaggccaaggagctcgtcgccgc	Protospacer
 ***.   .****.***********.*******

1195. spacer 32.7|4652926|33|NC_018524|PILER-CR,CRT matches to NZ_CP025613 (Niveispirillum cyanobacteriorum strain TH16 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.758

ggaggagcctcggtttcgggccggtcaggccct	CRISPR spacer
cggaattgctgggtttcgggccggtcaggccct	Protospacer
 *...   ** **********************

1196. spacer 32.7|4652926|33|NC_018524|PILER-CR,CRT matches to MN234199 (Mycobacterium phage Ekdilam, complete genome) position: , mismatch: 8, identity: 0.758

ggaggagcctcggtttcgggccggtcaggccct	CRISPR spacer
cgggcaatctcggtttcgtgccggtcacgcccg	Protospacer
 *.* *..********** ******** **** 

1197. spacer 32.9|4653048|33|NC_018524|PILER-CR,CRT matches to NZ_CP045421 (Maribius sp. THAF1 plasmid pTHAF1_a, complete sequence) position: , mismatch: 8, identity: 0.758

gaacacgaagaacccgccgctggtcgttgacca	CRISPR spacer
gaacacgaagaacccgccgttgatccaggtctc	Protospacer
*******************.**.**   * *. 

1198. spacer 32.15|4652562|32|NC_018524|CRISPRCasFinder matches to NZ_CP015882 (Ensifer adhaerens strain Casida A plasmid pCasidaAB, complete sequence) position: , mismatch: 8, identity: 0.75

tctggacgatcgaccaggtcaccgagttcctg	CRISPR spacer
cgaggtccttcgaccaggtcgccgagttcttg	Protospacer
.  ** *  ***********.********.**

1199. spacer 32.16|4652623|32|NC_018524|CRISPRCasFinder matches to NZ_CP031163 (Deinococcus wulumuqiensis strain NEB 479 plasmid pDrdI, complete sequence) position: , mismatch: 8, identity: 0.75

ttcgagttccagaccaaggagctcatcgccgc	CRISPR spacer
gccctgcgccagaccaaggaggtcttcgccgc	Protospacer
 .*  *. ************* ** *******

1200. spacer 32.16|4652623|32|NC_018524|CRISPRCasFinder matches to NZ_CP017105 (Rhizobium gallicum strain IE4872 plasmid pRgalIE4872d, complete sequence) position: , mismatch: 8, identity: 0.75

-----ttcgagttccagaccaaggagctcatcgccgc	CRISPR spacer
aacattccg-----cagatcaaggcgctcatcgccgc	Protospacer
     *.**     ****.***** ************

1201. spacer 32.22|4652988|32|NC_018524|CRISPRCasFinder matches to NZ_AP018520 (Sphingobium sp. YG1 plasmid pYGP1, complete sequence) position: , mismatch: 8, identity: 0.75

cagatcatccacgccctggacgaggccccctc	CRISPR spacer
gggatcgtccacgccctgaacgaggccctgca	Protospacer
 .****.***********.*********. . 

1202. spacer 32.22|4652988|32|NC_018524|CRISPRCasFinder matches to NZ_CP032342 (Azospirillum brasilense strain MTCC4038 plasmid p3, complete sequence) position: , mismatch: 8, identity: 0.75

cagatcatccacgccctggacgaggccccctc	CRISPR spacer
ctgatcacccacgcgctggacgaggcggcgat	Protospacer
* *****.****** ***********  *  .

1203. spacer 32.23|4653049|32|NC_018524|CRISPRCasFinder matches to NZ_CP045421 (Maribius sp. THAF1 plasmid pTHAF1_a, complete sequence) position: , mismatch: 8, identity: 0.75

aacacgaagaacccgccgctggtcgttgacca	CRISPR spacer
aacacgaagaacccgccgttgatccaggtctc	Protospacer
******************.**.**   * *. 

1204. spacer 32.24|4653110|32|NC_018524|CRISPRCasFinder matches to CP021188 (Sphingomonas wittichii DC-6 plasmid pDC07, complete sequence) position: , mismatch: 8, identity: 0.75

ggcttccagctctcccgcgaacaactcggtgc	CRISPR spacer
gccgtccagctctcccgcgacgaactcgacat	Protospacer
* * ****************  ******....

1205. spacer 32.24|4653110|32|NC_018524|CRISPRCasFinder matches to NZ_CP010990 (Pseudonocardia sp. EC080625-04 plasmid pFRP1-1, complete sequence) position: , mismatch: 8, identity: 0.75

ggcttccagctctcccgcgaacaactcggtgc	CRISPR spacer
gcccaccagctctcccacgagcaactcgaggg	Protospacer
* *. ***********.***.*******. * 

1206. spacer 32.24|4653110|32|NC_018524|CRISPRCasFinder matches to NZ_CP012186 (Pseudonocardia sp. EC080619-01 plasmid pBCI1-1, complete sequence) position: , mismatch: 8, identity: 0.75

ggcttccagctctcccgcgaacaactcggtgc	CRISPR spacer
gcccaccagctctcccacgagcaactcgaggg	Protospacer
* *. ***********.***.*******. * 

1207. spacer 32.24|4653110|32|NC_018524|CRISPRCasFinder matches to NZ_CP012186 (Pseudonocardia sp. EC080619-01 plasmid pBCI1-1, complete sequence) position: , mismatch: 8, identity: 0.75

ggcttccagctctcccgcgaacaactcggtgc	CRISPR spacer
gcccaccagctctcccacgagcaactcgaggg	Protospacer
* *. ***********.***.*******. * 

1208. spacer 32.24|4653110|32|NC_018524|CRISPRCasFinder matches to NZ_CP012186 (Pseudonocardia sp. EC080619-01 plasmid pBCI1-1, complete sequence) position: , mismatch: 8, identity: 0.75

ggcttccagctctcccgcgaacaactcggtgc	CRISPR spacer
gcccaccagctctcccacgagcaactcgaggg	Protospacer
* *. ***********.***.*******. * 

1209. spacer 32.24|4653110|32|NC_018524|CRISPRCasFinder matches to NZ_CP012186 (Pseudonocardia sp. EC080619-01 plasmid pBCI1-1, complete sequence) position: , mismatch: 8, identity: 0.75

ggcttccagctctcccgcgaacaactcggtgc	CRISPR spacer
gcccaccagctctcccacgagcaactcgaggg	Protospacer
* *. ***********.***.*******. * 

1210. spacer 32.25|4653171|32|NC_018524|CRISPRCasFinder matches to NZ_CP022775 (Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

tccaggccgctggccggccggtggctctgccg	CRISPR spacer
atctggccgatggccggctggtggctccggag	Protospacer
 .* ***** ********.********.*  *

1211. spacer 32.25|4653171|32|NC_018524|CRISPRCasFinder matches to NZ_CP022762 (Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

tccaggccgctggccggccggtggctctgccg	CRISPR spacer
atctggccgatggccggctggtggctccggag	Protospacer
 .* ***** ********.********.*  *

1212. spacer 32.25|4653171|32|NC_018524|CRISPRCasFinder matches to NZ_CP023017 (Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

tccaggccgctggccggccggtggctctgccg	CRISPR spacer
atctggccgatggccggctggtggctccggag	Protospacer
 .* ***** ********.********.*  *

1213. spacer 32.25|4653171|32|NC_018524|CRISPRCasFinder matches to NZ_CP014703 (Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence) position: , mismatch: 8, identity: 0.75

tccaggccgctggccggccggtggctctgccg	CRISPR spacer
atctggccgatggccggctggtggctccggag	Protospacer
 .* ***** ********.********.*  *

1214. spacer 32.25|4653171|32|NC_018524|CRISPRCasFinder matches to NZ_CP022771 (Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

tccaggccgctggccggccggtggctctgccg	CRISPR spacer
atctggccgatggccggctggtggctccggag	Protospacer
 .* ***** ********.********.*  *

1215. spacer 32.25|4653171|32|NC_018524|CRISPRCasFinder matches to NZ_CP022777 (Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

tccaggccgctggccggccggtggctctgccg	CRISPR spacer
atctggccgatggccggctggtggctccggag	Protospacer
 .* ***** ********.********.*  *

1216. spacer 32.25|4653171|32|NC_018524|CRISPRCasFinder matches to NZ_CP022799 (Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

tccaggccgctggccggccggtggctctgccg	CRISPR spacer
atctggccgatggccggctggtggctccggag	Protospacer
 .* ***** ********.********.*  *

1217. spacer 32.25|4653171|32|NC_018524|CRISPRCasFinder matches to NZ_CP022764 (Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

tccaggccgctggccggccggtggctctgccg	CRISPR spacer
atctggccgatggccggctggtggctccggag	Protospacer
 .* ***** ********.********.*  *

1218. spacer 32.25|4653171|32|NC_018524|CRISPRCasFinder matches to NZ_CP022797 (Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

tccaggccgctggccggccggtggctctgccg	CRISPR spacer
atctggccgatggccggctggtggctccggag	Protospacer
 .* ***** ********.********.*  *

1219. spacer 32.25|4653171|32|NC_018524|CRISPRCasFinder matches to NZ_CP022758 (Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

tccaggccgctggccggccggtggctctgccg	CRISPR spacer
atctggccgatggccggctggtggctccggag	Protospacer
 .* ***** ********.********.*  *

1220. spacer 32.27|4653293|32|NC_018524|CRISPRCasFinder matches to NC_008242 (Chelativorans sp. BNC1 plasmid 1, complete sequence) position: , mismatch: 8, identity: 0.75

tttcggtgggtgacgtgcacggcctcgacgtt	CRISPR spacer
tcggcgtgggtggcgtgcagggcctcgacgac	Protospacer
*.   *******.****** ********** .

1221. spacer 32.27|4653293|32|NC_018524|CRISPRCasFinder matches to NC_008270 (Rhodococcus jostii RHA1 plasmid pRHL2, complete sequence) position: , mismatch: 8, identity: 0.75

tttcggtgggtgacgtgcacggcctcgacgtt	CRISPR spacer
tgtgcgtgggtgatgagcacggcctcgatgcc	Protospacer
* *  ********.* ************.*..

1222. spacer 34.1|5116474|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_KY494864 (Pseudomonas aeruginosa strain FFUP_PS_37 plasmid pJB37, complete sequence) position: , mismatch: 8, identity: 0.75

aaccgggaggcggtcagatcgatgtaggcctc	CRISPR spacer
agcttgagcgcggtcagatcgatttagccctc	Protospacer
*.*. *.. ************** *** ****

1223. spacer 34.1|5116474|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_KT935446 (Klebsiella pneumoniae strain Kp2964 plasmid 2964TF, complete sequence) position: , mismatch: 8, identity: 0.75

aaccgggaggcggtcagatcgatgtaggcctc	CRISPR spacer
agcttgagcgcggtcagatcgatttagccctc	Protospacer
*.*. *.. ************** *** ****

1224. spacer 34.1|5116474|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP010380 (Enterobacter hormaechei subsp. hormaechei strain 34983 plasmid p34983-328.905kb, complete sequence) position: , mismatch: 8, identity: 0.75

aaccgggaggcggtcagatcgatgtaggcctc	CRISPR spacer
agcttgagcgcggtcagatcgatttagccctc	Protospacer
*.*. *.. ************** *** ****

1225. spacer 34.1|5116474|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP042479 (Citrobacter freundii strain C50 plasmid pC50_001, complete sequence) position: , mismatch: 8, identity: 0.75

aaccgggaggcggtcagatcgatgtaggcctc	CRISPR spacer
agcttgagcgcggtcagatcgatttagccctc	Protospacer
*.*. *.. ************** *** ****

1226. spacer 34.1|5116474|32|NC_018524|CRISPRCasFinder,CRT matches to CP049311 (Salmonella enterica subsp. enterica serovar Heidelberg strain CVM N53023 plasmid pN53023, complete sequence) position: , mismatch: 8, identity: 0.75

aaccgggaggcggtcagatcgatgtaggcctc	CRISPR spacer
agcttgagcgcggtcagatcgatttagccctc	Protospacer
*.*. *.. ************** *** ****

1227. spacer 34.1|5116474|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP026208 (Escherichia coli strain ECONIH5 plasmid pECO-109b, complete sequence) position: , mismatch: 8, identity: 0.75

aaccgggaggcggtcagatcgatgtaggcctc	CRISPR spacer
agcttgagcgcggtcagatcgatttagccctc	Protospacer
*.*. *.. ************** *** ****

1228. spacer 34.1|5116474|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP010360 (Enterobacter roggenkampii strain 35734 plasmid p35734-141.404kb, complete sequence) position: , mismatch: 8, identity: 0.75

aaccgggaggcggtcagatcgatgtaggcctc	CRISPR spacer
agcttgagcgcggtcagatcgatttagccctc	Protospacer
*.*. *.. ************** *** ****

1229. spacer 34.1|5116474|32|NC_018524|CRISPRCasFinder,CRT matches to CP049307 (Salmonella enterica subsp. enterica serovar Heidelberg strain CVM N58631 plasmid p58631, complete sequence) position: , mismatch: 8, identity: 0.75

aaccgggaggcggtcagatcgatgtaggcctc	CRISPR spacer
agcttgagcgcggtcagatcgatttagccctc	Protospacer
*.*. *.. ************** *** ****

1230. spacer 34.1|5116474|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP012168 (Enterobacter hormaechei subsp. steigerwaltii strain 34998 plasmid p34998-239.973kb, complete sequence) position: , mismatch: 8, identity: 0.75

aaccgggaggcggtcagatcgatgtaggcctc	CRISPR spacer
agcttgagcgcggtcagatcgatttagccctc	Protospacer
*.*. *.. ************** *** ****

1231. spacer 34.1|5116474|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP032179 (Citrobacter freundii strain AR_0116 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

aaccgggaggcggtcagatcgatgtaggcctc	CRISPR spacer
agcttgagcgcggtcagatcgatttagccctc	Protospacer
*.*. *.. ************** *** ****

1232. spacer 34.1|5116474|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP017294 (Pseudomonas aeruginosa strain PA83 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

aaccgggaggcggtcagatcgatgtaggcctc	CRISPR spacer
agcttgagcgcggtcagatcgatttagccctc	Protospacer
*.*. *.. ************** *** ****

1233. spacer 34.1|5116474|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP031135 (Escherichia coli strain CFSAN064035 plasmid pGMI17-003_1, complete sequence) position: , mismatch: 8, identity: 0.75

aaccgggaggcggtcagatcgatgtaggcctc	CRISPR spacer
agcttgagcgcggtcagatcgatttagccctc	Protospacer
*.*. *.. ************** *** ****

1234. spacer 34.2|5116535|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NC_048021 (Gordonia phage Daredevil, complete genome) position: , mismatch: 8, identity: 0.75

acgatcgacacccgtaccggctggctgctgat	CRISPR spacer
gcgatcgagacccgttccggctggtcgcggta	Protospacer
.******* ****** ********..** *  

1235. spacer 34.4|5116657|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP049734 (Rhizobium leguminosarum strain A1 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ccgggcgacgccgaggcggtgtggaacatccg-----	CRISPR spacer
tcgagcgatgccgaggcggtgtgg-----ccgccggg	Protospacer
.**.****.***************     ***     

1236. spacer 34.4|5116657|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to CP049734 (Rhizobium leguminosarum strain A1 plasmid pRLa11, complete sequence) position: , mismatch: 8, identity: 0.75

ccgggcgacgccgaggcggtgtggaacatccg-----	CRISPR spacer
tcgagcgatgccgaggcggtgtgg-----ccgccggg	Protospacer
.**.****.***************     ***     

1237. spacer 34.4|5116657|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP054024 (Rhizobium sp. JKLM12A2 plasmid pPR12A203, complete sequence) position: , mismatch: 8, identity: 0.75

ccgggcgacgccgaggcggtgtggaacatccg-----	CRISPR spacer
tcgagcgatgccgaggcggtgtgg-----ccgccggg	Protospacer
.**.****.***************     ***     

1238. spacer 34.4|5116657|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP054035 (Rhizobium sp. JKLM13E plasmid pPR13E04, complete sequence) position: , mismatch: 8, identity: 0.75

ccgggcgacgccgaggcggtgtggaacatccg-----	CRISPR spacer
tcgagcgatgccgaggcggtgtgg-----ccgccggg	Protospacer
.**.****.***************     ***     

1239. spacer 34.5|5116718|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP050098 (Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b4, complete sequence) position: , mismatch: 8, identity: 0.75

cttgccttcgagggcttcctcgatctcccggt	CRISPR spacer
ccggatttcgaggacttcctcgatctgccgca	Protospacer
*. * .*******.************ ***  

1240. spacer 34.5|5116718|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP025013 (Rhizobium leguminosarum strain Norway plasmid pRLN1, complete sequence) position: , mismatch: 8, identity: 0.75

cttgccttcgagggcttcctcgatctcccggt	CRISPR spacer
ccggatttcgaggacttcctcgatctgccgca	Protospacer
*. * .*******.************ ***  

1241. spacer 34.5|5116718|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP053440 (Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eF, complete sequence) position: , mismatch: 8, identity: 0.75

cttgccttcgagggcttcctcgatctcccggt	CRISPR spacer
ccggatttcgaggacttcctcgatctgccgca	Protospacer
*. * .*******.************ ***  

1242. spacer 34.5|5116718|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP035092 (Paracoccus denitrificans strain ATCC 19367 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

cttgccttcgagggcttcctcgatctcccggt	CRISPR spacer
gtggcattcgatggcttcctcgatcttctcga	Protospacer
 * ** ***** **************.*. * 

1243. spacer 34.5|5116718|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NC_008688 (Paracoccus denitrificans PD1222 plasmid 1, complete sequence) position: , mismatch: 8, identity: 0.75

cttgccttcgagggcttcctcgatctcccggt	CRISPR spacer
gtggcattcgatggcttcctcgatcttctcga	Protospacer
 * ** ***** **************.*. * 

1244. spacer 34.6|5116779|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_AP014863 (Pseudomonas furukawaii strain KF707 plasmid pKF707, complete sequence) position: , mismatch: 8, identity: 0.75

ggaggcgctgctggaggccccggcagtctggg	CRISPR spacer
ggaggcgctgcaggaggccctggcgggcgtcc	Protospacer
*********** ********.***.* *    

1245. spacer 34.6|5116779|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_AP014863 (Pseudomonas furukawaii strain KF707 plasmid pKF707, complete sequence) position: , mismatch: 8, identity: 0.75

ggaggcgctgctggaggccccggcagtctggg	CRISPR spacer
ggaggcgctgcaggaggccctggcgggcgtcc	Protospacer
*********** ********.***.* *    

1246. spacer 34.6|5116779|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to AP021850 (Deinococcus grandis ATCC 43672 plasmid: pDEGR-1 DNA, complete genome) position: , mismatch: 8, identity: 0.75

ggaggcgctgctggaggccccggcagtctggg	CRISPR spacer
ggagccgctgctggaggccctggcgctggcga	Protospacer
**** ***************.***. *   *.

1247. spacer 34.6|5116779|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP015446 (Streptomyces sp. S8 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

ggaggcgctgctggaggccccgg---cagtctggg	CRISPR spacer
gggggcgctgctggaggcaccggagaaggcct---	Protospacer
**.*************** ****    .*.**   

1248. spacer 34.7|5116840|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 8, identity: 0.75

aaccgtggccagcgccagacggtacacccaaa	CRISPR spacer
caccgtggccagcgccagccggtaggaccgcg	Protospacer
 ***************** ***** . **. .

1249. spacer 34.10|5117024|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP032703 (Pantoea dispersa strain DSM 32899 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ggtggcgcaggcggccactccgggccagtggc	CRISPR spacer
ggtggcgcagccggccacgccggccgaagcgg	Protospacer
********** ******* **** * *.  * 

1250. spacer 34.10|5117024|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MT310869 (Microbacterium phage Truong, complete genome) position: , mismatch: 8, identity: 0.75

ggtggcgcaggcggccactccgggccagtggc	CRISPR spacer
cggggcacaggcggccactccggacctccgtc	Protospacer
 * ***.****************.**  .* *

1251. spacer 34.10|5117024|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MT310875 (Microbacterium phage Ashton, complete genome) position: , mismatch: 8, identity: 0.75

ggtggcgcaggcggccactccgggccagtggc	CRISPR spacer
cggggcacaggcggccactccggacctccgtc	Protospacer
 * ***.****************.**  .* *

1252. spacer 34.10|5117024|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MN310546 (Microbacterium phage PhriedRice, complete genome) position: , mismatch: 8, identity: 0.75

ggtggcgcaggcggccactccgggccagtggc	CRISPR spacer
cggggcacaggcggccactccggacctccgtc	Protospacer
 * ***.****************.**  .* *

1253. spacer 34.10|5117024|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MT657337 (Microbacterium phage Mazun, complete genome) position: , mismatch: 8, identity: 0.75

ggtggcgcaggcggccactccgggccagtggc	CRISPR spacer
cggggcacaggcggccactccggacctccgtc	Protospacer
 * ***.****************.**  .* *

1254. spacer 34.10|5117024|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MT310890 (Microbacterium phage Phedro, complete genome) position: , mismatch: 8, identity: 0.75

ggtggcgcaggcggccactccgggccagtggc	CRISPR spacer
cggggcacaggcggccactccggacctccgtc	Protospacer
 * ***.****************.**  .* *

1255. spacer 34.10|5117024|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MT310889 (Microbacterium phage Phractured, complete genome) position: , mismatch: 8, identity: 0.75

ggtggcgcaggcggccactccgggccagtggc	CRISPR spacer
cggggcacaggcggccactccggacctccgtc	Protospacer
 * ***.****************.**  .* *

1256. spacer 34.10|5117024|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NC_048761 (Microbacterium phage Akoni, complete genome) position: , mismatch: 8, identity: 0.75

ggtggcgcaggcggccactccgggccagtggc	CRISPR spacer
cggggcacaggcggccactccggacctccgtc	Protospacer
 * ***.****************.**  .* *

1257. spacer 34.10|5117024|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MT310891 (Microbacterium phage Pharky, complete genome) position: , mismatch: 8, identity: 0.75

ggtggcgcaggcggccactccgggccagtggc	CRISPR spacer
cggggcacaggcggccactccggacctccgtc	Protospacer
 * ***.****************.**  .* *

1258. spacer 35.2|5118353|33|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_014213 (Meiothermus silvanus DSM 9946 plasmid pMESIL01, complete sequence) position: , mismatch: 8, identity: 0.758

accccctggcaggccctggggctgctcccgatg	CRISPR spacer
ttcccctggcaggccctggcggtgctcctggcc	Protospacer
 .***************** * ******.*.. 

1259. spacer 35.3|5118415|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP015204 (Rhodococcus sp. 008 plasmid pR8C1, complete sequence) position: , mismatch: 8, identity: 0.75

tcccaggcgtgtccgtgcttggtgtcccggtg	CRISPR spacer
tcccaggcgtgttcgagcttggtcttctcccg	Protospacer
************.** ******* *.*.  .*

1260. spacer 35.3|5118415|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_007486 (Rhodococcus erythropolis PR4 plasmid pREC1, complete sequence) position: , mismatch: 8, identity: 0.75

tcccaggcgtgtccgtgcttggtgtcccggtg	CRISPR spacer
tcccaggcgtgttcgagcttggtcttctcccg	Protospacer
************.** ******* *.*.  .*

1261. spacer 35.3|5118415|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP042916 (Rhodococcus qingshengii strain RL1 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

tcccaggcgtgtccgtgcttggtgtcccggtg	CRISPR spacer
tcccaggcgtgttcgagcttggtcttctcccg	Protospacer
************.** ******* *.*.  .*

1262. spacer 35.3|5118415|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP042916 (Rhodococcus qingshengii strain RL1 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

tcccaggcgtgtccgtgcttggtgtcccggtg	CRISPR spacer
tcccaggcgtgttcgagcttggtcttctcccg	Protospacer
************.** ******* *.*.  .*

1263. spacer 35.5|5118537|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP023976 (Streptomyces alboflavus strain MDJK44 plasmid pMDJK44.1, complete sequence) position: , mismatch: 8, identity: 0.75

acccagagcacgagcttgccggggtggtcctc	CRISPR spacer
aacgctcctacgagcttgccgcggtggtcctc	Protospacer
* *     .************ **********

1264. spacer 35.5|5118537|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to MT740733 (Ralstonia phage Dimitile, complete genome) position: , mismatch: 8, identity: 0.75

acccagagc---acgagcttgccggggtggtcctc	CRISPR spacer
---taggccgcgacgatcttgccggggtcgtcctc	Protospacer
   .**. *   **** *********** ******

1265. spacer 35.5|5118537|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to MT740738 (Ralstonia phage Gamede, complete genome) position: , mismatch: 8, identity: 0.75

acccagagc---acgagcttgccggggtggtcctc	CRISPR spacer
---taggccgcgacgatcttgccggggtcgtcctc	Protospacer
   .**. *   **** *********** ******

1266. spacer 35.5|5118537|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to MT740736 (Ralstonia phage Eline, complete genome) position: , mismatch: 8, identity: 0.75

acccagagc---acgagcttgccggggtggtcctc	CRISPR spacer
---taggccgcgacgatcttgccggggtcgtcctc	Protospacer
   .**. *   **** *********** ******

1267. spacer 35.5|5118537|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to MT740730 (Ralstonia phage Cimandef, complete genome) position: , mismatch: 8, identity: 0.75

acccagagc---acgagcttgccggggtggtcctc	CRISPR spacer
---taggccgcgacgatcttgccggggtcgtcctc	Protospacer
   .**. *   **** *********** ******

1268. spacer 35.5|5118537|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to MT740739 (Ralstonia phage Gerry, complete genome) position: , mismatch: 8, identity: 0.75

acccagagc---acgagcttgccggggtggtcctc	CRISPR spacer
---taggccgcgacgatcttgccggggtcgtcctc	Protospacer
   .**. *   **** *********** ******

1269. spacer 35.5|5118537|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to MT740742 (Ralstonia phage Heva, complete genome) position: , mismatch: 8, identity: 0.75

acccagagc---acgagcttgccggggtggtcctc	CRISPR spacer
---taggccgcgacgatcttgccggggtcgtcctc	Protospacer
   .**. *   **** *********** ******

1270. spacer 35.7|5118659|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_008270 (Rhodococcus jostii RHA1 plasmid pRHL2, complete sequence) position: , mismatch: 8, identity: 0.75

ggtgacggtctcgcggatgacctcccgcacgg	CRISPR spacer
ctcgcgggtctcggggatgacctcccgcaacg	Protospacer
  .*  ******* ***************  *

1271. spacer 35.7|5118659|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP033582 (Streptomyces sp. ADI95-16 plasmid pADI95-16a, complete sequence) position: , mismatch: 8, identity: 0.75

ggtgacggtctcgcggatgacctcccgcacgg	CRISPR spacer
gggttcggcctcgcggatgacctcgcgcgtga	Protospacer
**   ***.*************** ***..*.

1272. spacer 35.7|5118659|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP033582 (Streptomyces sp. ADI95-16 plasmid pADI95-16a, complete sequence) position: , mismatch: 8, identity: 0.75

ggtgacggtctcgcggatgacctcccgcacgg	CRISPR spacer
ggtgacggtctcgtgggtgacctggcggtaga	Protospacer
*************.**.******  **   *.

1273. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP017076 (Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctgggcatcgccatcgtcggcgggct	Protospacer
  ******** **** ***********   . 

1274. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP016613 (Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1275. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022775 (Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1276. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to CP023013 (Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1277. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_014310 (Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1278. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022762 (Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1279. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP049790 (Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1280. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP049790 (Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
gccgcgctgggcatccccatcgtcggcaaccc	Protospacer
*.  ****** ****.***********  *. 

1281. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP049794 (Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1282. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP049794 (Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
gccgcgctgggcatccccatcgtcggcaaccc	Protospacer
*.  ****** ****.***********  *. 

1283. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP049788 (Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1284. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP049788 (Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
gccgcgctgggcatccccatcgtcggcaaccc	Protospacer
*.  ****** ****.***********  *. 

1285. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022363 (Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctgggcatcgccatcgtcggcgggct	Protospacer
  ******** **** ***********   . 

1286. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022766 (Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1287. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022766 (Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
gccgcgctgggcatccccatcgtcggcaaccc	Protospacer
*.  ****** ****.***********  *. 

1288. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP039340 (Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctgggcatctccattgtcggcgggct	Protospacer
  ******** *********.******   . 

1289. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP039340 (Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
gccgcgctgggcatccccatcgtcggcaaccc	Protospacer
*.  ****** ****.***********  *. 

1290. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP021763 (Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1291. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP021763 (Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
gccgcgctgggcatccccatcgtcggcaaccc	Protospacer
*.  ****** ****.***********  *. 

1292. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP015116 (Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1293. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP015116 (Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
gccgcgctgggcatccccatcgtcggcaaccc	Protospacer
*.  ****** ****.***********  *. 

1294. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP016555 (Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1295. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP049792 (Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1296. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP049792 (Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
gccgcgctgggcatccccatcgtcggcaaccc	Protospacer
*.  ****** ****.***********  *. 

1297. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052069 (Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1298. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP016915 (Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1299. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP016915 (Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
gccgcgctgggcatccccatcgtcggcaaccc	Protospacer
*.  ****** ****.***********  *. 

1300. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP016905 (Ralstonia solanacearum strain KACC 10709 plasmid unnamed1) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1301. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1302. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
gccgcgctgggcatccccatcgtcggcaaccc	Protospacer
*.  ****** ****.***********  *. 

1303. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022769 (Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1304. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022769 (Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
gccgcgctgggcatccccatcgtcggcaaccc	Protospacer
*.  ****** ****.***********  *. 

1305. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP023017 (Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1306. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP015851 (Ralstonia solanacearum strain YC40-M plasmid, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1307. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022773 (Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1308. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022773 (Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
gccgcgctgggcatccccatcgtcggcaaccc	Protospacer
*.  ****** ****.***********  *. 

1309. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022783 (Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1310. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022783 (Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
gccgcgctgggcatccccatcgtcggcaaccc	Protospacer
*.  ****** ****.***********  *. 

1311. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022791 (Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1312. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP014703 (Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1313. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022760 (Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1314. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022789 (Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1315. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022795 (Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1316. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052071 (Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1317. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052071 (Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
gccgcgctgggcatccccatcgtcggcaaccc	Protospacer
*.  ****** ****.***********  *. 

1318. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022771 (Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1319. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022777 (Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1320. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022799 (Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1321. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022482 (Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1322. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP009763 (Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1323. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP009763 (Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
gccgcgctgggcatccccatcgtcggcaaccc	Protospacer
*.  ****** ****.***********  *. 

1324. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to CP023015 (Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1325. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to CP023015 (Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
gccgcgctgggcatccccatcgtcggcaaccc	Protospacer
*.  ****** ****.***********  *. 

1326. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022779 (Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1327. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022779 (Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
gccgcgctgggcatccccatcgtcggcaaccc	Protospacer
*.  ****** ****.***********  *. 

1328. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052075 (Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1329. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052075 (Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
gccgcgctgggcatccccatcgtcggcaaccc	Protospacer
*.  ****** ****.***********  *. 

1330. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052085 (Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1331. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052095 (Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1332. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052105 (Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1333. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052077 (Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1334. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052087 (Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1335. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052097 (Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1336. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052115 (Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1337. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052127 (Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1338. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022764 (Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1339. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052079 (Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1340. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052089 (Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1341. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052093 (Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1342. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052101 (Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1343. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052099 (Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1344. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052107 (Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1345. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032347 (Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctgggcatcgccatcgtcggcggtct	Protospacer
  ******** **** ***********  .. 

1346. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022781 (Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1347. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022781 (Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
gccgcgctgggcatccccatcgtcggcaaccc	Protospacer
*.  ****** ****.***********  *. 

1348. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052117 (Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1349. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052125 (Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1350. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022793 (Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1351. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022793 (Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
gccgcgctgggcatccccatcgtcggcaaccc	Protospacer
*.  ****** ****.***********  *. 

1352. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022797 (Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1353. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022785 (Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1354. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022785 (Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
gccgcgctgggcatccccatcgtcggcaaccc	Protospacer
*.  ****** ****.***********  *. 

1355. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022787 (Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1356. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022787 (Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
gccgcgctgggcatccccatcgtcggcaaccc	Protospacer
*.  ****** ****.***********  *. 

1357. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022756 (Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1358. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022756 (Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
gccgcgctgggcatccccatcgtcggcaaccc	Protospacer
*.  ****** ****.***********  *. 

1359. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052129 (Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1360. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052121 (Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1361. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052123 (Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1362. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052131 (Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1363. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to CP011998 (Ralstonia solanacearum strain YC45 plasmid, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1364. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to CP011998 (Ralstonia solanacearum strain YC45 plasmid, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
gccgcgctgggcatccccatcgtcggcaaccc	Protospacer
*.  ****** ****.***********  *. 

1365. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052073 (Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1366. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052073 (Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
gccgcgctgggcatccccatcgtcggcaaccc	Protospacer
*.  ****** ****.***********  *. 

1367. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052081 (Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1368. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052083 (Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1369. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052109 (Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1370. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052091 (Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1371. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052111 (Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1372. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052103 (Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1373. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052119 (Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1374. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052113 (Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1375. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022758 (Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggcgggct	Protospacer
  ********  ***************   . 

1376. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP021449 (Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
gccgcgctgggcatccccatcgtcggcaaccc	Protospacer
*.  ****** ****.***********  *. 

1377. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP016593 (Ketogulonicigenium vulgare strain SKV plasmid pKvSKV1, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
ctgatgctggccatcgccatcgtcgcctttat	Protospacer
 ** .********** ********* **..  

1378. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_017386 (Ketogulonicigenium vulgare WSH-001 plasmid 1, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
ctgatgctggccatcgccatcgtcgcctttat	Protospacer
 ** .********** ********* **..  

1379. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_014621 (Ketogulonicigenium vulgare Y25 plasmid pYP1, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
ctgatgctggccatcgccatcgtcgcctttat	Protospacer
 ** .********** ********* **..  

1380. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP012909 (Ketogulonicigenium vulgare strain Hbe602 plasmid 1, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
ctgatgctggccatcgccatcgtcgcctttat	Protospacer
 ** .********** ********* **..  

1381. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP021029 (Rhizobium sp. TAL182 plasmid pRetTAL182e, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
gagggcgaggtcatctccatcatcggctcctc	Protospacer
* *     **.**********.********* 

1382. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013600 (Rhizobium sp. N741 plasmid pRspN741e, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
gagggcgaggtcatctccatcatcggctcctc	Protospacer
* *     **.**********.********* 

1383. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013504 (Rhizobium esperanzae strain N561 plasmid pRspN561d, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
gagggcgaggtcatctccatcatcggctcctc	Protospacer
* *     **.**********.********* 

1384. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013510 (Rhizobium sp. N1341 plasmid pRspN1341e, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
gagggcgaggtcatctccatcatcggctcctc	Protospacer
* *     **.**********.********* 

1385. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013521 (Rhizobium sp. N113 plasmid pRspN113d, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
gagggcgaggtcatctccatcatcggctcctc	Protospacer
* *     **.**********.********* 

1386. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013494 (Rhizobium sp. N6212 plasmid pRspN6212d, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
gagggcgaggtcatctccatcatcggctcctc	Protospacer
* *     **.**********.********* 

1387. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013594 (Rhizobium sp. N871 plasmid pRspN871d, complete sequence) position: , mismatch: 9, identity: 0.719

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
gagggcgaggtcatctccatcatcggctcctc	Protospacer
* *     **.**********.********* 

1388. spacer 1.6|311931|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_LR134465 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 23, complete sequence) position: , mismatch: 9, identity: 0.719

accatcatgtcgccgaacgcggagccggccca	CRISPR spacer
gcgctgatgtcggcgagcgcggagccggcgtc	Protospacer
.*  * ****** ***.************ . 

1389. spacer 1.8|312053|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to KR560069 (Stenotrophomonas phage IME-SM1, complete genome) position: , mismatch: 9, identity: 0.719

tctggtcgggagagccgaagtagtcgggttcg	CRISPR spacer
ggagcacatgagcgccgaagtagtcgggatcg	Protospacer
   *  *. *** *************** ***

1390. spacer 1.8|312053|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to MK580972 (Stenotrophomonas phage YB07, complete genome) position: , mismatch: 9, identity: 0.719

tctggtcgggagagccgaagtagtcgggttcg	CRISPR spacer
ggagcacatgagcgccgaagtagtcgggatcg	Protospacer
   *  *. *** *************** ***

1391. spacer 1.10|312180|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP028919 (Gemmobacter sp. HYN0069 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

taggcggcctcggcggtaaaggcgggggcgtc	CRISPR spacer
acgctggcctcggcgttgaaggcgggggccga	Protospacer
  * .********** *.***********   

1392. spacer 1.10|312180|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP054029 (Rhizobium sp. JKLM19E plasmid pPR19E02, complete sequence) position: , mismatch: 9, identity: 0.719

taggcggcctcggcggtaaaggcgggggcgtc	CRISPR spacer
ccggtggcctcggcggcaaaggcggcattggc	Protospacer
. **.***********.******** . .* *

1393. spacer 1.10|312180|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to AP018487 (Mycobacterium phage HC DNA, complete genome) position: , mismatch: 9, identity: 0.719

taggcggcctcggcggtaaaggcgggggcgtc	CRISPR spacer
cgggcggccgcggcggtaacggcggcttgttc	Protospacer
..******* ********* *****     **

1394. spacer 1.10|312180|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to MT024866 (Mycobacterium phage Willsammy, complete genome) position: , mismatch: 9, identity: 0.719

taggcggcctcggcggtaaaggcgggggcgtc	CRISPR spacer
cgggcggccgcggcggtaacggcggcctgttc	Protospacer
..******* ********* *****     **

1395. spacer 1.10|312180|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to MN892486 (Mycobacterium phage KilKor, complete genome) position: , mismatch: 9, identity: 0.719

taggcggcctcggcggtaaaggcgggggcgtc	CRISPR spacer
cgggcggccgcggcggtaacggcggcctgttc	Protospacer
..******* ********* *****     **

1396. spacer 1.10|312180|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to MN908683 (Mycobacterium phage StressBall, complete genome) position: , mismatch: 9, identity: 0.719

taggcggcctcggcggtaaaggcgggggcgtc	CRISPR spacer
cgggcggccgcggcggtaacggcggcctgttc	Protospacer
..******* ********* *****     **

1397. spacer 1.10|312180|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to MT498042 (Mycobacterium phage Rebel, complete genome) position: , mismatch: 9, identity: 0.719

taggcggcctcggcggtaaaggcgggggcgtc	CRISPR spacer
cgggcggccgcggcggtaacggcggcctgttc	Protospacer
..******* ********* *****     **

1398. spacer 1.10|312180|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to MK820639 (Mycobacterium phage Phineas, complete genome) position: , mismatch: 9, identity: 0.719

taggcggcctcggcggtaaaggcgggggcgtc	CRISPR spacer
cgggcggccgcggcggtaacggcggcctgttc	Protospacer
..******* ********* *****     **

1399. spacer 1.10|312180|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to MN892484 (Mycobacterium phage CactusJack, complete genome) position: , mismatch: 9, identity: 0.719

taggcggcctcggcggtaaaggcgggggcgtc	CRISPR spacer
cgggcggccgcggcggtaacggcggcctgttc	Protospacer
..******* ********* *****     **

1400. spacer 1.10|312180|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to MN807249 (Mycobacterium phage Megiddo, complete genome) position: , mismatch: 9, identity: 0.719

taggcggcctcggcggtaaaggcgggggcgtc	CRISPR spacer
cgggcggccgcggcggtaacggcggcctgttc	Protospacer
..******* ********* *****     **

1401. spacer 1.10|312180|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to MN807250 (Mycobacterium phage Glaske, complete genome) position: , mismatch: 9, identity: 0.719

taggcggcctcggcggtaaaggcgggggcgtc	CRISPR spacer
cgggcggccgcggcggtaacggcggcctgttc	Protospacer
..******* ********* *****     **

1402. spacer 1.10|312180|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to MG099936 (Mycobacterium phage Andies, complete genome) position: , mismatch: 9, identity: 0.719

taggcggcctcggcggtaaaggcgggggcgtc	CRISPR spacer
cgggcggccgcggcggtaacggcggcctgttc	Protospacer
..******* ********* *****     **

1403. spacer 1.10|312180|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to KX621007 (Mycobacterium phage Taquito, complete genome) position: , mismatch: 9, identity: 0.719

taggcggcctcggcggtaaaggcgggggcgtc	CRISPR spacer
cgggcggccgcggcggtaacggcggcctgttc	Protospacer
..******* ********* *****     **

1404. spacer 1.10|312180|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to MN807248 (Mycobacterium phage Phalm, complete genome) position: , mismatch: 9, identity: 0.719

taggcggcctcggcggtaaaggcgggggcgtc	CRISPR spacer
cgggcggccgcggcggtaacggcggcctgttc	Protospacer
..******* ********* *****     **

1405. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to MN234183 (Mycobacterium phage Antsirabe, complete genome) position: , mismatch: 9, identity: 0.719

tcctccggcgcctcgtcggcgacgtcggcgac	CRISPR spacer
ggggtcggcgcctcgtcggcgacgacggcctg	Protospacer
    .******************* ****   

1406. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 9, identity: 0.719

tcctccggcgcctcgtcggcgacgtcggcgac	CRISPR spacer
tcggtgaccgcctcgtcggtgaagtcggcgag	Protospacer
**  . . ***********.** ******** 

1407. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP050953 (Rhodococcus sp. DMU1 plasmid unnamed) position: , mismatch: 9, identity: 0.719

tcctccggcgcctcgtcggcgacgtcggcgac	CRISPR spacer
cgaatctgcgcctcgtcggtgacgtcggcggt	Protospacer
.   .* ************.**********..

1408. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_010510 (Methylobacterium radiotolerans JCM 2831 plasmid pMRAD01, complete sequence) position: , mismatch: 9, identity: 0.719

tcctccggcgcctcgtcggcgacgtcggcgac	CRISPR spacer
aagatcggcaccgcgtcggcgacgtcggcgtg	Protospacer
    .****.** *****************  

1409. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 9, identity: 0.719

tcctccggcgcctcgtcggcgacgtcggcgac	CRISPR spacer
tcggtgaccgcctcgtcggtgaagtcggcgag	Protospacer
**  . . ***********.** ******** 

1410. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_LR134460 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 18, complete sequence) position: , mismatch: 9, identity: 0.719

tcctccggcgcctcgtcggcgacgtcggcgac	CRISPR spacer
gcggtgagcgccgcgtcggcgaggtcggcgag	Protospacer
 *  . .***** ********* ******** 

1411. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP047174 (Rathayibacter sp. VKM Ac-2760 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

tcctccggcgcctcgtcggcgacgtcggcgac	CRISPR spacer
tcctcgggcgcctcgtcggcggcgatcttgcg	Protospacer
***** ***************.** .  .*  

1412. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP007129 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence) position: , mismatch: 9, identity: 0.719

tcctccggcgcctcgtcggcgacgtcggcgac	CRISPR spacer
cgcatgcgcgcctcgtcgccgccgtcggcgcc	Protospacer
. * .  *********** ** ******** *

1413. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_AP014705 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence) position: , mismatch: 9, identity: 0.719

tcctccggcgcctcgtcggcgacgtcggcgac	CRISPR spacer
agcggcatcgcctcgagggcgacgtcggcgat	Protospacer
  *  *. *******  **************.

1414. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_047973 (Microbacterium phage Hyperion, complete genome) position: , mismatch: 9, identity: 0.719

tcctccggcgcctcgtcggcgacgtcggcgac	CRISPR spacer
ggggcgagcggctcgtcggcgaggtcggcgag	Protospacer
    * .*** *********** ******** 

1415. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to KY945355 (Mycobacterium phage Shandong1, complete genome) position: , mismatch: 9, identity: 0.719

tcctccggcgcctcgtcggcgacgtcggcgac	CRISPR spacer
acggcgtgcacctcgtcggcgacctcggcgcg	Protospacer
 *  *  **.************* ******  

1416. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_047975 (Microbacterium phage Squash, complete genome) position: , mismatch: 9, identity: 0.719

tcctccggcgcctcgtcggcgacgtcggcgac	CRISPR spacer
ggggcgagcggctcgtcggcgaggtcggcgag	Protospacer
    * .*** *********** ******** 

1417. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP046906 (Streptomyces sp. QHH-9511 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

tcctccggcgcctcgtcggcgacgtcggcgac	CRISPR spacer
ggcttgaacgcctgctcggcgacgtcggcgag	Protospacer
  **. ..*****  **************** 

1418. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP029835 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed5, complete sequence) position: , mismatch: 9, identity: 0.719

tcctccgg------cgcctcgtcggcgacgtcggcgac	CRISPR spacer
------ggatggtccgcctcgtcggcgccgacggcgag	Protospacer
      **      ************* ** ****** 

1419. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_019959 (Mycobacterium sp. JS623 plasmid pMYCSM03, complete sequence) position: , mismatch: 9, identity: 0.719

tcctccggcgcctcgtcggcgacgtcggcgac	CRISPR spacer
ctcgggcgcgcctcgtcggtgacgtcgacgcc	Protospacer
..*    ************.*******.** *

1420. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP004394 (Celeribacter indicus strain P73 plasmid pP73A, complete sequence) position: , mismatch: 9, identity: 0.719

tcctccggcgcctcgtcggcgacgtcggcgac	CRISPR spacer
acgatccgcgccgcggcggcgacgtcggcggg	Protospacer
 *  .* ***** ** **************. 

1421. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_003904 (Streptomyces coelicolor A3(2) plasmid SCP2, complete sequence) position: , mismatch: 9, identity: 0.719

tcctccggcgcctcgtcggcgacgtcggcgac	CRISPR spacer
agttgcagcgccttgtcggcgaggtcggcgca	Protospacer
  .* *.******.******** *******  

1422. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to MK937594 (Gordonia phage Galadriel, complete genome) position: , mismatch: 9, identity: 0.719

tcctccggcg-cctcgtcggcga--cgtcggcgac	CRISPR spacer
---tcgggcgacgtcgccggcgagccgccggcgca	Protospacer
   ** **** * ***.******  **.*****  

1423. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to MT723934 (Gordonia phage Love, complete genome) position: , mismatch: 9, identity: 0.719

tcctccggcg-cctcgtcggcga--cgtcggcgac	CRISPR spacer
---tcgggcgacgtcgccggcgagccgccggcgca	Protospacer
   ** **** * ***.******  **.*****  

1424. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to MK977702 (Gordonia terrae phage McKinley, complete genome) position: , mismatch: 9, identity: 0.719

tcctccggcg-cctcgtcggcga--cgtcggcgac	CRISPR spacer
---tcgggcgacgtcgccggcgagccgccggcgca	Protospacer
   ** **** * ***.******  **.*****  

1425. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to MH976514 (Gordonia phage Nordenberg, complete genome) position: , mismatch: 9, identity: 0.719

tcctccggcg-cctcgtcggcga--cgtcggcgac	CRISPR spacer
---tcgggcgacgtcgccggcgagccgccggcgca	Protospacer
   ** **** * ***.******  **.*****  

1426. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to MH976508 (Gordonia phage Bibwit, complete genome) position: , mismatch: 9, identity: 0.719

tcctccggcg-cctcgtcggcga--cgtcggcgac	CRISPR spacer
---tcgggcgacgtcgccggcgagccgccggcgca	Protospacer
   ** **** * ***.******  **.*****  

1427. spacer 2.4|313399|32|NC_018524|CRISPRCasFinder matches to NZ_CP016613 (Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

cacaccaccccggcctggccacggccggcgtc	CRISPR spacer
tgcgcggcccgggcctggcgacggccggcgga	Protospacer
..*.* .*** ******** **********  

1428. spacer 2.4|313399|32|NC_018524|CRISPRCasFinder matches to NZ_CP022766 (Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

cacaccaccccggcctggccacggccggcgtc	CRISPR spacer
tgcgcggcccgggcctggcgacggccggcgga	Protospacer
..*.* .*** ******** **********  

1429. spacer 2.4|313399|32|NC_018524|CRISPRCasFinder matches to NZ_CP016555 (Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence) position: , mismatch: 9, identity: 0.719

cacaccaccccggcctggccacggccggcgtc	CRISPR spacer
tgcgcggcccgggcctggcgacggccggcgga	Protospacer
..*.* .*** ******** **********  

1430. spacer 2.4|313399|32|NC_018524|CRISPRCasFinder matches to NZ_CP052069 (Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

cacaccaccccggcctggccacggccggcgtc	CRISPR spacer
tgcgcggcccgggcctggcgacggccggcgga	Protospacer
..*.* .*** ******** **********  

1431. spacer 2.4|313399|32|NC_018524|CRISPRCasFinder matches to NZ_CP016905 (Ralstonia solanacearum strain KACC 10709 plasmid unnamed1) position: , mismatch: 9, identity: 0.719

cacaccaccccggcctggccacggccggcgtc	CRISPR spacer
tgcgcggcccgggcctggcgacggccggcgga	Protospacer
..*.* .*** ******** **********  

1432. spacer 2.4|313399|32|NC_018524|CRISPRCasFinder matches to NZ_CP022769 (Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

cacaccaccccggcctggccacggccggcgtc	CRISPR spacer
tgcgcggcccgggcctggcgacggccggcgga	Protospacer
..*.* .*** ******** **********  

1433. spacer 2.4|313399|32|NC_018524|CRISPRCasFinder matches to NZ_CP015851 (Ralstonia solanacearum strain YC40-M plasmid, complete sequence) position: , mismatch: 9, identity: 0.719

cacaccaccccggcctggccacggccggcgtc	CRISPR spacer
tgcgcggcccgggcctggcgacggccggcgga	Protospacer
..*.* .*** ******** **********  

1434. spacer 2.4|313399|32|NC_018524|CRISPRCasFinder matches to NZ_CP022773 (Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

cacaccaccccggcctggccacggccggcgtc	CRISPR spacer
tgcgcggcccgggcctggcgacggccggcgga	Protospacer
..*.* .*** ******** **********  

1435. spacer 2.4|313399|32|NC_018524|CRISPRCasFinder matches to NZ_CP022791 (Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

cacaccaccccggcctggccacggccggcgtc	CRISPR spacer
tgcgcggcccgggcctggcgacggccggcgga	Protospacer
..*.* .*** ******** **********  

1436. spacer 2.4|313399|32|NC_018524|CRISPRCasFinder matches to NZ_CP052071 (Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

cacaccaccccggcctggccacggccggcgtc	CRISPR spacer
tgcgcggcccgggcctggcgacggccggcgga	Protospacer
..*.* .*** ******** **********  

1437. spacer 2.4|313399|32|NC_018524|CRISPRCasFinder matches to NZ_CP022779 (Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

cacaccaccccggcctggccacggccggcgtc	CRISPR spacer
tgcgcggcccgggcctggcgacggccggcgga	Protospacer
..*.* .*** ******** **********  

1438. spacer 2.4|313399|32|NC_018524|CRISPRCasFinder matches to NZ_CP052075 (Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

cacaccaccccggcctggccacggccggcgtc	CRISPR spacer
tgcgcggcccgggcctggcgacggccggcgga	Protospacer
..*.* .*** ******** **********  

1439. spacer 2.4|313399|32|NC_018524|CRISPRCasFinder matches to NZ_CP052085 (Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

cacaccaccccggcctggccacggccggcgtc	CRISPR spacer
tgcgcggcccgggcctggcgacggccggcgga	Protospacer
..*.* .*** ******** **********  

1440. spacer 2.4|313399|32|NC_018524|CRISPRCasFinder matches to NZ_CP052105 (Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

cacaccaccccggcctggccacggccggcgtc	CRISPR spacer
tgcgcggcccgggcctggcgacggccggcgga	Protospacer
..*.* .*** ******** **********  

1441. spacer 2.4|313399|32|NC_018524|CRISPRCasFinder matches to NZ_CP052087 (Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

cacaccaccccggcctggccacggccggcgtc	CRISPR spacer
tgcgcggcccgggcctggcgacggccggcgga	Protospacer
..*.* .*** ******** **********  

1442. spacer 2.4|313399|32|NC_018524|CRISPRCasFinder matches to NZ_CP052115 (Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

cacaccaccccggcctggccacggccggcgtc	CRISPR spacer
tgcgcggcccgggcctggcgacggccggcgga	Protospacer
..*.* .*** ******** **********  

1443. spacer 2.4|313399|32|NC_018524|CRISPRCasFinder matches to NZ_CP052127 (Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

cacaccaccccggcctggccacggccggcgtc	CRISPR spacer
tgcgcggcccgggcctggcgacggccggcgga	Protospacer
..*.* .*** ******** **********  

1444. spacer 2.4|313399|32|NC_018524|CRISPRCasFinder matches to NZ_CP052089 (Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

cacaccaccccggcctggccacggccggcgtc	CRISPR spacer
tgcgcggcccgggcctggcgacggccggcgga	Protospacer
..*.* .*** ******** **********  

1445. spacer 2.4|313399|32|NC_018524|CRISPRCasFinder matches to NZ_CP052107 (Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

cacaccaccccggcctggccacggccggcgtc	CRISPR spacer
tgcgcggcccgggcctggcgacggccggcgga	Protospacer
..*.* .*** ******** **********  

1446. spacer 2.4|313399|32|NC_018524|CRISPRCasFinder matches to NZ_CP031163 (Deinococcus wulumuqiensis strain NEB 479 plasmid pDrdI, complete sequence) position: , mismatch: 9, identity: 0.719

cacaccaccccggcctggccacggccggcgtc	CRISPR spacer
cgaaccagcccggcatggccacggccatgccc	Protospacer
*. **** ****** ***********.   .*

1447. spacer 2.4|313399|32|NC_018524|CRISPRCasFinder matches to NZ_CP022781 (Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

cacaccaccccggcctggccacggccggcgtc	CRISPR spacer
tgcgcggcccgggcctggcgacggccggcgga	Protospacer
..*.* .*** ******** **********  

1448. spacer 2.4|313399|32|NC_018524|CRISPRCasFinder matches to NZ_CP052117 (Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

cacaccaccccggcctggccacggccggcgtc	CRISPR spacer
tgcgcggcccgggcctggcgacggccggcgga	Protospacer
..*.* .*** ******** **********  

1449. spacer 2.4|313399|32|NC_018524|CRISPRCasFinder matches to NZ_CP022793 (Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

cacaccaccccggcctggccacggccggcgtc	CRISPR spacer
tgcgcggcccgggcctggcgacggccggcgga	Protospacer
..*.* .*** ******** **********  

1450. spacer 2.4|313399|32|NC_018524|CRISPRCasFinder matches to NZ_CP022785 (Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

cacaccaccccggcctggccacggccggcgtc	CRISPR spacer
tgcgcggcccgggcctggcgacggccggcgga	Protospacer
..*.* .*** ******** **********  

1451. spacer 2.4|313399|32|NC_018524|CRISPRCasFinder matches to NZ_CP022787 (Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

cacaccaccccggcctggccacggccggcgtc	CRISPR spacer
tgcgcggcccgggcctggcgacggccggcgga	Protospacer
..*.* .*** ******** **********  

1452. spacer 2.4|313399|32|NC_018524|CRISPRCasFinder matches to NZ_CP022756 (Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

cacaccaccccggcctggccacggccggcgtc	CRISPR spacer
tgcgcggcccgggcctggcgacggccggcgga	Protospacer
..*.* .*** ******** **********  

1453. spacer 2.4|313399|32|NC_018524|CRISPRCasFinder matches to NZ_CP052121 (Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

cacaccaccccggcctggccacggccggcgtc	CRISPR spacer
tgcgcggcccgggcctggcgacggccggcgga	Protospacer
..*.* .*** ******** **********  

1454. spacer 2.4|313399|32|NC_018524|CRISPRCasFinder matches to NZ_CP052131 (Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

cacaccaccccggcctggccacggccggcgtc	CRISPR spacer
tgcgcggcccgggcctggcgacggccggcgga	Protospacer
..*.* .*** ******** **********  

1455. spacer 2.4|313399|32|NC_018524|CRISPRCasFinder matches to NZ_CP052073 (Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

cacaccaccccggcctggccacggccggcgtc	CRISPR spacer
tgcgcggcccgggcctggcgacggccggcgga	Protospacer
..*.* .*** ******** **********  

1456. spacer 2.4|313399|32|NC_018524|CRISPRCasFinder matches to NZ_CP052109 (Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

cacaccaccccggcctggccacggccggcgtc	CRISPR spacer
tgcgcggcccgggcctggcgacggccggcgga	Protospacer
..*.* .*** ******** **********  

1457. spacer 2.4|313399|32|NC_018524|CRISPRCasFinder matches to NZ_CP052111 (Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

cacaccaccccggcctggccacggccggcgtc	CRISPR spacer
tgcgcggcccgggcctggcgacggccggcgga	Protospacer
..*.* .*** ******** **********  

1458. spacer 2.4|313399|32|NC_018524|CRISPRCasFinder matches to NZ_CP052103 (Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

cacaccaccccggcctggccacggccggcgtc	CRISPR spacer
tgcgcggcccgggcctggcgacggccggcgga	Protospacer
..*.* .*** ******** **********  

1459. spacer 2.4|313399|32|NC_018524|CRISPRCasFinder matches to NZ_CP052119 (Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

cacaccaccccggcctggccacggccggcgtc	CRISPR spacer
tgcgcggcccgggcctggcgacggccggcgga	Protospacer
..*.* .*** ******** **********  

1460. spacer 2.4|313399|32|NC_018524|CRISPRCasFinder matches to NZ_CP052113 (Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.719

cacaccaccccggcctggccacggccggcgtc	CRISPR spacer
tgcgcggcccgggcctggcgacggccggcgga	Protospacer
..*.* .*** ******** **********  

1461. spacer 2.4|313399|32|NC_018524|CRISPRCasFinder matches to MG593802 (Streptomyces phage Omar, complete genome) position: , mismatch: 9, identity: 0.719

cacaccaccccggcctggccacggccggcgtc	CRISPR spacer
tggccgtcgccggcctggcctcggccggcctc	Protospacer
..  *  * *********** ******** **

1462. spacer 2.8|313399|33|NC_018524|CRT matches to NZ_AP012556 (Mycobacterium avium subsp. hominissuis TH135 plasmid pMAH135, complete sequence) position: , mismatch: 9, identity: 0.727

cacaccaccccggcctggccacggccggcgtcg	CRISPR spacer
gccaccgccccggcctgggcacggccgctgctc	Protospacer
  ****.*********** ******** .*.. 

1463. spacer 2.8|313399|33|NC_018524|CRT matches to MG593802 (Streptomyces phage Omar, complete genome) position: , mismatch: 9, identity: 0.727

cacaccaccccggcctggccacggccggcgtcg	CRISPR spacer
tggccgtcgccggcctggcctcggccggcctcg	Protospacer
..  *  * *********** ******** ***

1464. spacer 2.10|313401|30|NC_018524|PILER-CR matches to NZ_CP031163 (Deinococcus wulumuqiensis strain NEB 479 plasmid pDrdI, complete sequence) position: , mismatch: 9, identity: 0.7

acaccaccccggcctggccacggccggcgt	CRISPR spacer
gaaccagcccggcatggccacggccatgcc	Protospacer
. **** ****** ***********.   .

1465. spacer 3.1|318517|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP005190 (Sphingobium sp. MI1205 plasmid pMI1, complete sequence) position: , mismatch: 9, identity: 0.719

gcccagggggccggtctggtcgagttctccat	CRISPR spacer
gcccagcgggccggtctggccgaaggcggaaa	Protospacer
****** ************.***.  *   * 

1466. spacer 3.1|318517|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_HG938354 (Neorhizobium galegae bv. orientalis str. HAMBI 540 plasmid pHAMBI540a, complete sequence) position: , mismatch: 9, identity: 0.719

gcccagggggccggtctggtcgagttctccat	CRISPR spacer
tatcgggcggccggtctggtcgagtgctgcgg	Protospacer
  .*.** ***************** ** *. 

1467. spacer 3.1|318517|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP032676 (Rhodococcus rhodochrous strain ATCC BAA870 plasmid pNit, complete sequence) position: , mismatch: 9, identity: 0.719

gcccagggggccggtctggtcgagttctccat	CRISPR spacer
gcccagggcgccggtctggtggacctgatgag	Protospacer
******** *********** ** .*  . * 

1468. spacer 3.1|318517|32|NC_018524|CRISPRCasFinder,CRT matches to NC_020542 (Sphingomonas sp. MM-1 plasmid pISP0, complete sequence) position: , mismatch: 9, identity: 0.719

gcccagggggccggtctggtcgagttctccat	CRISPR spacer
gcccagcgggccggtctggccgaaggcggaaa	Protospacer
****** ************.***.  *   * 

1469. spacer 3.2|318578|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP031227 (Pseudomonas amygdali pv. lachrymans str. M301315 plasmid pPla107-1, complete sequence) position: , mismatch: 9, identity: 0.719

tcgggcggcggtgagcagatgcccaaggagtt	CRISPR spacer
tcgggcggcggtgggcagacgcccttatcaat	Protospacer
*************.*****.****  .  . *

1470. spacer 3.2|318578|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP011808 (Pandoraea faecigallinarum strain DSM 23572 plasmid pPF72-1, complete sequence) position: , mismatch: 9, identity: 0.719

tcgggcggcggtgagcagatgcccaaggagtt	CRISPR spacer
ttagggggcggtgagcagatgaccaaacaaca	Protospacer
*..** *************** ****. *.. 

1471. spacer 3.2|318578|32|NC_018524|CRISPRCasFinder,CRT matches to MN908693 (Gordonia phage AnClar, complete genome) position: , mismatch: 9, identity: 0.719

tcgggcggcggtgagcagatgcccaaggagtt	CRISPR spacer
gtcgtcggcgctgagcagatgaccaaggcgcg	Protospacer
 . * ***** ********** ****** *. 

1472. spacer 3.2|318578|32|NC_018524|CRISPRCasFinder,CRT matches to MK801725 (Gordonia phage Yago84, complete genome) position: , mismatch: 9, identity: 0.719

tcgggcggcggtgagcagatgcccaaggagtt	CRISPR spacer
gtcgtcggcgctgagcagatgaccaaggcgcg	Protospacer
 . * ***** ********** ****** *. 

1473. spacer 3.4|318700|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP043057 (Dolichospermum sp. UHCC 0315A plasmid pUHCC0315a, complete sequence) position: , mismatch: 9, identity: 0.719

cggatcaagttctggggcgggatggtcccgtt	CRISPR spacer
gggatcaagttcaggggagggatgataaagac	Protospacer
 *********** **** ******.*   * .

1474. spacer 3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NC_009621 (Sinorhizobium medicae WSM419 plasmid pSMED02, complete sequence) position: , mismatch: 9, identity: 0.719

atgaccgcccatttcgccgaccggctcgccgc	CRISPR spacer
gaagtcgcccatctcgccgaccggctcggcat	Protospacer
. ...*******.*************** *..

1475. spacer 3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NC_012586 (Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence) position: , mismatch: 9, identity: 0.719

atgaccgcccatttcgccgaccggctcgccgc	CRISPR spacer
gaggctttccatctcgccgaccggatcgccgt	Protospacer
. *.*. .****.*********** ******.

1476. spacer 3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013110 (Sinorhizobium americanum strain CFNEI 73 plasmid C, complete sequence) position: , mismatch: 9, identity: 0.719

atgaccgcccatttcgccgaccggctcgccgc	CRISPR spacer
gaggctttccatctcgccgaccggatcgccgt	Protospacer
. *.*. .****.*********** ******.

1477. spacer 3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP029452 (Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence) position: , mismatch: 9, identity: 0.719

atgaccgcccatttcgccgaccggctcgccgc	CRISPR spacer
gaagccttccatctcgccgaccggatcgccgt	Protospacer
. ..** .****.*********** ******.

1478. spacer 3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to CP000662 (Rhodobacter sphaeroides ATCC 17025 plasmid pRSPA01, complete sequence) position: , mismatch: 9, identity: 0.719

atgaccgcccatttcgccgaccggctcgccgc	CRISPR spacer
cgcaccgcctatgtcgccgaccggctgtccca	Protospacer
   ******.** *************  **  

1479. spacer 3.7|318883|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NC_018022 (Mycolicibacterium chubuense NBB4 plasmid pMYCCH.01, complete sequence) position: , mismatch: 9, identity: 0.719

gaccctgcccctccgcgccgcccttcatcagg	CRISPR spacer
caccctgccccgccgcgacgccctcaaagtgc	Protospacer
 ********** ***** ******. *   * 

1480. spacer 3.8|318944|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP029831 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed7, complete sequence) position: , mismatch: 9, identity: 0.719

ggctgtggagcgcgcggcggctgcgcggggtg	CRISPR spacer
ctgggcggagcgcgcggcggcggcgcgggaat	Protospacer
    *.*************** *******.  

1481. spacer 3.8|318944|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NC_015952 (Streptomyces violaceusniger Tu 4113 plasmid pSTRVI02, complete sequence) position: , mismatch: 9, identity: 0.719

ggctgtggagcgcgcggcggctgcgcggggtg	CRISPR spacer
tgcgcgggagcgtgcggaggctgcgcgggagc	Protospacer
 **   ******.**** ***********.  

1482. spacer 3.8|318944|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NC_014309 (Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome) position: , mismatch: 9, identity: 0.719

ggctgtggagcgcgcggcggctgcgcggggtg	CRISPR spacer
ccgggcggcgcgcgcggcgggtgcgcgggagg	Protospacer
    *.** *********** ********. *

1483. spacer 3.8|318944|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP028348 (Novosphingobium sp. THN1 plasmid pTHN, complete sequence) position: , mismatch: 9, identity: 0.719

ggctgtgg-agcgcgcggcggctgcgcggggtg	CRISPR spacer
-ctcgcgatagcgcgcggcggcggcgcggcgtt	Protospacer
  ..*.*. ************* ****** ** 

1484. spacer 3.9|319005|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP035092 (Paracoccus denitrificans strain ATCC 19367 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

cagagagagctggtccgcgcacagggcgcagc	CRISPR spacer
gtgggctcgctggcccgcgcgcagggcgcagg	Protospacer
  *.*   *****.******.********** 

1485. spacer 3.9|319005|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NC_008688 (Paracoccus denitrificans PD1222 plasmid 1, complete sequence) position: , mismatch: 9, identity: 0.719

cagagagagctggtccgcgcacagggcgcagc	CRISPR spacer
gtgggctcgctggcccgcgcgcagggcgcagg	Protospacer
  *.*   *****.******.********** 

1486. spacer 3.9|319005|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP020883 (Xanthomonas citri pv. citri strain TX160042 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

cagagagagctggtccgcgcacagggcgcagc	CRISPR spacer
ctgctggagctggtccgggcgcagggcgccat	Protospacer
* *  .*********** **.******** ..

1487. spacer 3.9|319005|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP020886 (Xanthomonas citri pv. citri strain TX160149 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

cagagagagctggtccgcgcacagggcgcagc	CRISPR spacer
ctgctggagctggtccgggcgcagggcgccat	Protospacer
* *  .*********** **.******** ..

1488. spacer 3.9|319005|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP021016 (Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6991 plasmid pF, complete sequence) position: , mismatch: 9, identity: 0.719

cagagagagctggtccgcgcacagggcgcagc	CRISPR spacer
ctgctggagctggtccgggcgcagggcgccat	Protospacer
* *  .*********** **.******** ..

1489. spacer 3.9|319005|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP020890 (Xanthomonas citri pv. citri strain TX160197 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

cagagagagctggtccgcgcacagggcgcagc	CRISPR spacer
ctgctggagctggtccgggcgcagggcgccat	Protospacer
* *  .*********** **.******** ..

1490. spacer 4.2|321431|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP010024 (Paraburkholderia fungorum strain ATCC BAA-463 plasmid pBIL, complete sequence) position: , mismatch: 9, identity: 0.719

ggagtcct------gggcgagggtgtacatcatttcgt	CRISPR spacer
------ctgcatgagggcgagggtgtacatcgcttcgc	Protospacer
      **      *****************..****.

1491. spacer 4.7|321736|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP020041 (Streptomyces sp. 3211 isolate 3 plasmid p3211-2, complete sequence) position: , mismatch: 9, identity: 0.719

ttgttcgccgccgaggccacggcatccgccaa	CRISPR spacer
agccccgccgccgaggcccctgcatccgccct	Protospacer
   ..************* * *********  

1492. spacer 4.7|321736|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 9, identity: 0.719

ttgttcgccgccgaggccacggcatccgccaa	CRISPR spacer
gtgagcgccgccaaggccgcggcatccgatgc	Protospacer
 **  *******.*****.********* .. 

1493. spacer 4.7|321736|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

ttgttcgccgccgaggccacggcatccgccaa	CRISPR spacer
tccggcgccgccgaggccacggcggccgcgcc	Protospacer
*.   ******************. ****   

1494. spacer 4.7|321736|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP050083 (Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b3, complete sequence) position: , mismatch: 9, identity: 0.719

ttgttcgccgccgaggccacggcatccgccaa	CRISPR spacer
ccgttcgccgccgatggcacggcatcgaagag	Protospacer
..************ * ********* .  *.

1495. spacer 4.7|321736|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP049733 (Rhizobium leguminosarum strain A1 plasmid pRL10, complete sequence) position: , mismatch: 9, identity: 0.719

ttgttcgccgccgaggccacggcatccgccaa	CRISPR spacer
ccgttcgccgccgatggcacggcatcgaagag	Protospacer
..************ * ********* .  *.

1496. spacer 4.7|321736|32|NC_018524|CRISPRCasFinder,CRT matches to CP054917 (Streptomyces sp. NA02950 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

ttgttcgccgccgaggccacggcatccgccaa	CRISPR spacer
gcgaccgccgccgaggcccccgcatccgcggg	Protospacer
 .* .************* * ******** ..

1497. spacer 4.7|321736|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP053207 (Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1C, complete sequence) position: , mismatch: 9, identity: 0.719

ttgttcgccgccgaggccacggcatccgccaa	CRISPR spacer
ccgttcgccgccgatggcacggcatcgaagag	Protospacer
..************ * ********* .  *.

1498. spacer 4.7|321736|32|NC_018524|CRISPRCasFinder,CRT matches to CP006880 (Rhizobium gallicum bv. gallicum R602 plasmid pRgalR602c, complete sequence) position: , mismatch: 9, identity: 0.719

ttgttcgccgccgaggccacggcatccgccaa	CRISPR spacer
ggctgcgccgccgaggccgccgcatccggctc	Protospacer
   * *************.* ******* *  

1499. spacer 4.8|321797|32|NC_018524|CRISPRCasFinder,CRT matches to CP011998 (Ralstonia solanacearum strain YC45 plasmid, complete sequence) position: , mismatch: 9, identity: 0.719

gaacttggtggtgttgatgaccacggtgtttc	CRISPR spacer
cacgctgctggtggtgatgaccacggtgtcgt	Protospacer
 *  .** ***** ***************. .

1500. spacer 4.9|321858|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 9, identity: 0.719

ggggtgcggccgggggtgccggtgtcgggggt	CRISPR spacer
atcggctggccgggggtgccggtgaccggggc	Protospacer
.  *  .***************** * ****.

1501. spacer 4.9|321858|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_AP014705 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence) position: , mismatch: 9, identity: 0.719

ggggtgcggccgggggtgccggtgtcgggggt	CRISPR spacer
ggcgcgcggccgggggtgccggtggccatctc	Protospacer
** *.******************* * .   .

1502. spacer 4.9|321858|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_LR134445 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 3, complete sequence) position: , mismatch: 9, identity: 0.719

ggggtgcggccgggggtgccggtgtcgggggt	CRISPR spacer
cgggtgaggccgggggtgacggtgcccgcctc	Protospacer
 ***** *********** *****.* *   .

1503. spacer 4.9|321858|32|NC_018524|CRISPRCasFinder,CRT matches to NC_008269 (Rhodococcus jostii RHA1 plasmid pRHL1, complete sequence) position: , mismatch: 9, identity: 0.719

ggggtgcggccgggggtgccggtgtcgggggt	CRISPR spacer
agggtgcggcggagggtgccggtggtcgcttt	Protospacer
.********* *.*********** . *   *

1504. spacer 4.9|321858|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP012886 (Mycobacterium chimaera strain AH16 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

ggggtgcggccgggggtgccggtgtcgggggt	CRISPR spacer
gcggcgcggccggcggtgccggtgtggactcg	Protospacer
* **.******** *********** *.    

1505. spacer 4.9|321858|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP012886 (Mycobacterium chimaera strain AH16 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

ggggtgcggccgggggtgccggtgtcgggggt	CRISPR spacer
gcggcgcggccggcggtgccggtgtggactcg	Protospacer
* **.******** *********** *.    

1506. spacer 4.9|321858|32|NC_018524|CRISPRCasFinder,CRT matches to MK433264 (Gordonia phage Tiamoceli, complete genome) position: , mismatch: 9, identity: 0.719

ggggtgcggccgggggtgccggtgtcgggggt	CRISPR spacer
ccggtgcggccggcggtgtcggtgtagtgaac	Protospacer
  *********** ****.****** * *...

1507. spacer 4.9|321858|32|NC_018524|CRISPRCasFinder,CRT matches to MT952843 (Gordonia phage Twonlo, complete genome) position: , mismatch: 9, identity: 0.719

ggggtgcggccgggggtgccggtgtcgggggt	CRISPR spacer
ccggtgcggccggcggtgtcggtgtagtgaac	Protospacer
  *********** ****.****** * *...

1508. spacer 4.9|321858|32|NC_018524|CRISPRCasFinder,CRT matches to MK977704 (Gordonia Terrae phage RoadKill, complete genome) position: , mismatch: 9, identity: 0.719

ggggtgcggccgggggtgccggtgtcgggggt	CRISPR spacer
ccggtgcggccggcggtgtcggtgtagtgaac	Protospacer
  *********** ****.****** * *...

1509. spacer 4.9|321858|32|NC_018524|CRISPRCasFinder,CRT matches to KR053200 (Gordonia phage GTE6, complete genome) position: , mismatch: 9, identity: 0.719

ggggtgcggccgggggtgccggtgtcgggggt	CRISPR spacer
ccggtgcggccggcggtgtcggtgtagtgaac	Protospacer
  *********** ****.****** * *...

1510. spacer 4.9|321858|32|NC_018524|CRISPRCasFinder,CRT matches to MN813693 (Mycobacterium phage Imvubu, complete genome) position: , mismatch: 9, identity: 0.719

ggggtgcggccgggggtgccggtgtcgggggt	CRISPR spacer
cccttgcggtcgggggtgccggtgacgatggc	Protospacer
    *****.************** **. **.

1511. spacer 4.9|321858|32|NC_018524|CRISPRCasFinder,CRT matches to MK977705 (Gordonia Phage Mollymur, complete genome) position: , mismatch: 9, identity: 0.719

ggggtgcggccgggggtgccggtgtcgggggt	CRISPR spacer
ccggtgccgccgggggtgccggagttgaccga	Protospacer
  ***** ************** **.*.  * 

1512. spacer 4.18|321675|33|NC_018524|PILER-CR matches to NC_023316 (Streptomyces sp. 14R-10 plasmid pZL1, complete sequence) position: , mismatch: 9, identity: 0.727

cgcaggtgggacagggcgcacaaggccggatgg	CRISPR spacer
gaacggtcggacagggcgcgcaaggccgaaggt	Protospacer
 .  *** ***********.********.* * 

1513. spacer 4.18|321675|33|NC_018524|PILER-CR matches to NC_023316 (Streptomyces sp. 14R-10 plasmid pZL1, complete sequence) position: , mismatch: 9, identity: 0.727

cgcaggtgggacagggcgcacaaggccggatgg	CRISPR spacer
gaacggtcggacagggcgcgcaaggccgaaggt	Protospacer
 .  *** ***********.********.* * 

1514. spacer 4.19|321736|33|NC_018524|PILER-CR matches to NZ_CP019603 (Croceicoccus marinus strain E4A9 plasmid pCME4A9I, complete sequence) position: , mismatch: 9, identity: 0.727

ttgttcgccgccgaggccacggcatccgccaaa	CRISPR spacer
ttgttcgccgacgagaccacggcaccggtgctc	Protospacer
********** ****.********.* *.    

1515. spacer 4.19|321736|33|NC_018524|PILER-CR matches to NZ_CP019604 (Croceicoccus marinus strain E4A9 plasmid pCME4A9II, complete sequence) position: , mismatch: 9, identity: 0.727

ttgttcgccgccgaggccacggcatccgccaaa	CRISPR spacer
ttgttcgccgacgagaccacggcaccggtgctc	Protospacer
********** ****.********.* *.    

1516. spacer 5.3|326654|32|NC_018524|CRISPRCasFinder matches to NZ_CP021028 (Rhizobium sp. TAL182 plasmid pRetTAL182d, complete sequence) position: , mismatch: 9, identity: 0.719

atgaggacaccgaccgagaggccgtcgcactg	CRISPR spacer
atgaggccaccgaccgataggccgcagatgac	Protospacer
****** ********** ******. *     

1517. spacer 5.3|326654|32|NC_018524|CRISPRCasFinder matches to NZ_CP013503 (Rhizobium esperanzae strain N561 plasmid pRspN561c, complete sequence) position: , mismatch: 9, identity: 0.719

atgaggacaccgaccgagaggccgtcgcactg	CRISPR spacer
atgaggccaccgaccgataggccgcagatgac	Protospacer
****** ********** ******. *     

1518. spacer 5.3|326654|32|NC_018524|CRISPRCasFinder matches to NZ_CP013509 (Rhizobium sp. N1341 plasmid pRspN1341d, complete sequence) position: , mismatch: 9, identity: 0.719

atgaggacaccgaccgagaggccgtcgcactg	CRISPR spacer
atgaggccaccgaccgataggccgcagatgac	Protospacer
****** ********** ******. *     

1519. spacer 5.3|326654|32|NC_018524|CRISPRCasFinder matches to NZ_CP013520 (Rhizobium sp. N113 plasmid pRspN113c, complete sequence) position: , mismatch: 9, identity: 0.719

atgaggacaccgaccgagaggccgtcgcactg	CRISPR spacer
atgaggccaccgaccgataggccgcagatgac	Protospacer
****** ********** ******. *     

1520. spacer 5.3|326654|32|NC_018524|CRISPRCasFinder matches to NZ_CP029357 (Azospirillum sp. CFH 70021 plasmid unnamed2) position: , mismatch: 9, identity: 0.719

atgaggacaccgaccgagaggccgtcgcactg	CRISPR spacer
accaggacaccgaccacgaggccgtcgaggct	Protospacer
*. ************. ********** . . 

1521. spacer 5.3|326654|32|NC_018524|CRISPRCasFinder matches to NZ_CP013493 (Rhizobium sp. N6212 plasmid pRspN6212c, complete sequence) position: , mismatch: 9, identity: 0.719

atgaggacaccgaccgagaggccgtcgcactg	CRISPR spacer
atgaggccaccgaccgataggccgcagatgac	Protospacer
****** ********** ******. *     

1522. spacer 5.3|326654|32|NC_018524|CRISPRCasFinder matches to NZ_CP013516 (Rhizobium sp. N1314 plasmid pRspN1314e, complete sequence) position: , mismatch: 9, identity: 0.719

atgaggacaccgaccgagaggccgtcgcactg	CRISPR spacer
atgaggccaccgaccgataggccgcagatgac	Protospacer
****** ********** ******. *     

1523. spacer 5.3|326654|32|NC_018524|CRISPRCasFinder matches to MN813693 (Mycobacterium phage Imvubu, complete genome) position: , mismatch: 9, identity: 0.719

atgaggacaccgaccgagaggccgtcgcactg	CRISPR spacer
gcggcgacaccgaccggcaggccgtcgcggtc	Protospacer
..*. ***********. **********. * 

1524. spacer 5.4|326715|32|NC_018524|CRISPRCasFinder matches to CP047389 (Agrobacterium sp. CGMCC 11546 plasmid pA) position: , mismatch: 9, identity: 0.719

caaaggagttcaccggcgggcaccggatggac	CRISPR spacer
ctgtagagttcaccgacgggcacccgattctc	Protospacer
* . .**********.******** ***   *

1525. spacer 5.4|326715|32|NC_018524|CRISPRCasFinder matches to NZ_CP033036 (Agrobacterium fabrum strain 12D13 plasmid pAt12D13a, complete sequence) position: , mismatch: 9, identity: 0.719

caaaggagttcaccggcgggcaccggatggac	CRISPR spacer
ctgtagagttcaccgacgggcacccgattctc	Protospacer
* . .**********.******** ***   *

1526. spacer 5.4|326715|32|NC_018524|CRISPRCasFinder matches to NZ_CP033024 (Agrobacterium fabrum strain 1D132 plasmid pAt1D132a, complete sequence) position: , mismatch: 9, identity: 0.719

caaaggagttcaccggcgggcaccggatggac	CRISPR spacer
ctgtagagttcaccgacgggcacccgattctc	Protospacer
* . .**********.******** ***   *

1527. spacer 5.6|326837|32|NC_018524|CRISPRCasFinder matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 9, identity: 0.719

ccgagggcgacgcaggcacgacgccaggtcca	CRISPR spacer
tggccggcaacgcaggcacgacgcccggctcg	Protospacer
. *  ***.**************** **..*.

1528. spacer 5.6|326837|32|NC_018524|CRISPRCasFinder matches to NZ_CP034351 (Streptomyces sp. W1SF4 plasmid p1, complete sequence) position: , mismatch: 9, identity: 0.719

ccgagggcgacgcaggcacgacgccaggtcca	CRISPR spacer
cgagcggcgacgcagccacgacgcgaggccgg	Protospacer
* .. ********** ******** ***.* .

1529. spacer 5.9|326654|33|NC_018524|CRT matches to NZ_CP021028 (Rhizobium sp. TAL182 plasmid pRetTAL182d, complete sequence) position: , mismatch: 9, identity: 0.727

atgaggacaccgaccgagaggccgtcgcactgc	CRISPR spacer
atgaggccaccgaccgataggccgcagatgacc	Protospacer
****** ********** ******. *     *

1530. spacer 5.9|326654|33|NC_018524|CRT matches to NZ_CP013503 (Rhizobium esperanzae strain N561 plasmid pRspN561c, complete sequence) position: , mismatch: 9, identity: 0.727

atgaggacaccgaccgagaggccgtcgcactgc	CRISPR spacer
atgaggccaccgaccgataggccgcagatgacc	Protospacer
****** ********** ******. *     *

1531. spacer 5.9|326654|33|NC_018524|CRT matches to NZ_CP013509 (Rhizobium sp. N1341 plasmid pRspN1341d, complete sequence) position: , mismatch: 9, identity: 0.727

atgaggacaccgaccgagaggccgtcgcactgc	CRISPR spacer
atgaggccaccgaccgataggccgcagatgacc	Protospacer
****** ********** ******. *     *

1532. spacer 5.9|326654|33|NC_018524|CRT matches to NZ_CP013520 (Rhizobium sp. N113 plasmid pRspN113c, complete sequence) position: , mismatch: 9, identity: 0.727

atgaggacaccgaccgagaggccgtcgcactgc	CRISPR spacer
atgaggccaccgaccgataggccgcagatgacc	Protospacer
****** ********** ******. *     *

1533. spacer 5.9|326654|33|NC_018524|CRT matches to NZ_CP013493 (Rhizobium sp. N6212 plasmid pRspN6212c, complete sequence) position: , mismatch: 9, identity: 0.727

atgaggacaccgaccgagaggccgtcgcactgc	CRISPR spacer
atgaggccaccgaccgataggccgcagatgacc	Protospacer
****** ********** ******. *     *

1534. spacer 5.9|326654|33|NC_018524|CRT matches to NZ_CP013516 (Rhizobium sp. N1314 plasmid pRspN1314e, complete sequence) position: , mismatch: 9, identity: 0.727

atgaggacaccgaccgagaggccgtcgcactgc	CRISPR spacer
atgaggccaccgaccgataggccgcagatgacc	Protospacer
****** ********** ******. *     *

1535. spacer 5.12|326837|33|NC_018524|CRT matches to CP000663 (Rhodobacter sphaeroides ATCC 17025 plasmid pRSPA02, complete sequence) position: , mismatch: 9, identity: 0.727

ccgagggcgacgcaggcacgacgccaggtccac	CRISPR spacer
acgaggtcgacgaaggcacgacgccggatgtcg	Protospacer
 ***** ***** ************.*.* .  

1536. spacer 5.12|326837|33|NC_018524|CRT matches to NZ_CP031752 (Rhodobacter sphaeroides strain EBL0706 plasmid p.A, complete sequence) position: , mismatch: 9, identity: 0.727

ccgagggcgacgcaggcacgacgccaggtccac	CRISPR spacer
acgaggtcgacgaaggcacgacgccggatgtcg	Protospacer
 ***** ***** ************.*.* .  

1537. spacer 5.14|326655|32|NC_018524|PILER-CR matches to NZ_CP021028 (Rhizobium sp. TAL182 plasmid pRetTAL182d, complete sequence) position: , mismatch: 9, identity: 0.719

atgaggacaccgaccgagaggccgtcgcactg	CRISPR spacer
atgaggccaccgaccgataggccgcagatgac	Protospacer
****** ********** ******. *     

1538. spacer 5.14|326655|32|NC_018524|PILER-CR matches to NZ_CP013503 (Rhizobium esperanzae strain N561 plasmid pRspN561c, complete sequence) position: , mismatch: 9, identity: 0.719

atgaggacaccgaccgagaggccgtcgcactg	CRISPR spacer
atgaggccaccgaccgataggccgcagatgac	Protospacer
****** ********** ******. *     

1539. spacer 5.14|326655|32|NC_018524|PILER-CR matches to NZ_CP013509 (Rhizobium sp. N1341 plasmid pRspN1341d, complete sequence) position: , mismatch: 9, identity: 0.719

atgaggacaccgaccgagaggccgtcgcactg	CRISPR spacer
atgaggccaccgaccgataggccgcagatgac	Protospacer
****** ********** ******. *     

1540. spacer 5.14|326655|32|NC_018524|PILER-CR matches to NZ_CP013520 (Rhizobium sp. N113 plasmid pRspN113c, complete sequence) position: , mismatch: 9, identity: 0.719

atgaggacaccgaccgagaggccgtcgcactg	CRISPR spacer
atgaggccaccgaccgataggccgcagatgac	Protospacer
****** ********** ******. *     

1541. spacer 5.14|326655|32|NC_018524|PILER-CR matches to NZ_CP029357 (Azospirillum sp. CFH 70021 plasmid unnamed2) position: , mismatch: 9, identity: 0.719

atgaggacaccgaccgagaggccgtcgcactg	CRISPR spacer
accaggacaccgaccacgaggccgtcgaggct	Protospacer
*. ************. ********** . . 

1542. spacer 5.14|326655|32|NC_018524|PILER-CR matches to NZ_CP013493 (Rhizobium sp. N6212 plasmid pRspN6212c, complete sequence) position: , mismatch: 9, identity: 0.719

atgaggacaccgaccgagaggccgtcgcactg	CRISPR spacer
atgaggccaccgaccgataggccgcagatgac	Protospacer
****** ********** ******. *     

1543. spacer 5.14|326655|32|NC_018524|PILER-CR matches to NZ_CP013516 (Rhizobium sp. N1314 plasmid pRspN1314e, complete sequence) position: , mismatch: 9, identity: 0.719

atgaggacaccgaccgagaggccgtcgcactg	CRISPR spacer
atgaggccaccgaccgataggccgcagatgac	Protospacer
****** ********** ******. *     

1544. spacer 5.14|326655|32|NC_018524|PILER-CR matches to MN813693 (Mycobacterium phage Imvubu, complete genome) position: , mismatch: 9, identity: 0.719

atgaggacaccgaccgagaggccgtcgcactg	CRISPR spacer
gcggcgacaccgaccggcaggccgtcgcggtc	Protospacer
..*. ***********. **********. * 

1545. spacer 5.15|326716|32|NC_018524|PILER-CR matches to CP047389 (Agrobacterium sp. CGMCC 11546 plasmid pA) position: , mismatch: 9, identity: 0.719

caaaggagttcaccggcgggcaccggatggac	CRISPR spacer
ctgtagagttcaccgacgggcacccgattctc	Protospacer
* . .**********.******** ***   *

1546. spacer 5.15|326716|32|NC_018524|PILER-CR matches to NZ_CP033036 (Agrobacterium fabrum strain 12D13 plasmid pAt12D13a, complete sequence) position: , mismatch: 9, identity: 0.719

caaaggagttcaccggcgggcaccggatggac	CRISPR spacer
ctgtagagttcaccgacgggcacccgattctc	Protospacer
* . .**********.******** ***   *

1547. spacer 5.15|326716|32|NC_018524|PILER-CR matches to NZ_CP033024 (Agrobacterium fabrum strain 1D132 plasmid pAt1D132a, complete sequence) position: , mismatch: 9, identity: 0.719

caaaggagttcaccggcgggcaccggatggac	CRISPR spacer
ctgtagagttcaccgacgggcacccgattctc	Protospacer
* . .**********.******** ***   *

1548. spacer 5.17|326838|32|NC_018524|PILER-CR matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 9, identity: 0.719

ccgagggcgacgcaggcacgacgccaggtcca	CRISPR spacer
tggccggcaacgcaggcacgacgcccggctcg	Protospacer
. *  ***.**************** **..*.

1549. spacer 5.17|326838|32|NC_018524|PILER-CR matches to NZ_CP034351 (Streptomyces sp. W1SF4 plasmid p1, complete sequence) position: , mismatch: 9, identity: 0.719

ccgagggcgacgcaggcacgacgccaggtcca	CRISPR spacer
cgagcggcgacgcagccacgacgcgaggccgg	Protospacer
* .. ********** ******** ***.* .

1550. spacer 9.1|1460065|32|NC_018524|CRISPRCasFinder,CRT matches to MN657146 (Cryobacterium sp. strain ANT_H28B plasmid pA28BH2, complete sequence) position: , mismatch: 9, identity: 0.719

accgggtggcatcgcacggccgctcaggtcgt	CRISPR spacer
acctggtggcatcggacggccgcgatccacgg	Protospacer
*** ********** ********      ** 

1551. spacer 9.1|1460065|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP016283 (Cryobacterium arcticum strain PAMC 27867 plasmid pP27867_1, complete sequence) position: , mismatch: 9, identity: 0.719

accgggtggcatcgcacggccgctcaggtcgt	CRISPR spacer
acctggtggcatcggacggccgcgatccacgg	Protospacer
*** ********** ********      ** 

1552. spacer 9.1|1460065|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP032625 (Gryllotalpicola sp. 2DFW10M-5 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

accgggtggcatcgcacggccgctcaggtcgt	CRISPR spacer
acctggtggcaccgcacggccgcgatccgcgc	Protospacer
*** *******.***********      **.

1553. spacer 9.11|1460066|32|NC_018524|PILER-CR matches to MN657146 (Cryobacterium sp. strain ANT_H28B plasmid pA28BH2, complete sequence) position: , mismatch: 9, identity: 0.719

accgggtggcatcgcacggccgctcaggtcgt	CRISPR spacer
acctggtggcatcggacggccgcgatccacgg	Protospacer
*** ********** ********      ** 

1554. spacer 9.11|1460066|32|NC_018524|PILER-CR matches to NZ_CP016283 (Cryobacterium arcticum strain PAMC 27867 plasmid pP27867_1, complete sequence) position: , mismatch: 9, identity: 0.719

accgggtggcatcgcacggccgctcaggtcgt	CRISPR spacer
acctggtggcatcggacggccgcgatccacgg	Protospacer
*** ********** ********      ** 

1555. spacer 9.11|1460066|32|NC_018524|PILER-CR matches to NZ_CP032625 (Gryllotalpicola sp. 2DFW10M-5 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

accgggtggcatcgcacggccgctcaggtcgt	CRISPR spacer
acctggtggcaccgcacggccgcgatccgcgc	Protospacer
*** *******.***********      **.

1556. spacer 11.2|2251085|32|NC_018524|PILER-CR,CRT matches to NZ_CP022366 (Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence) position: , mismatch: 9, identity: 0.719

gagggcagcctcgaaccgacctgggtgtgctt	CRISPR spacer
acggccagccgcgaaccgacctgggaccgcgc	Protospacer
. ** ***** **************  .** .

1557. spacer 11.3|2251146|32|NC_018524|PILER-CR,CRT matches to NZ_CP016082 (Streptomyces sp. SAT1 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

cgcggcggcgcctgcgcgacctgctcaacgag	CRISPR spacer
aacggcggcgcctgcgcggactgctcgccctc	Protospacer
 .****************. ******. *   

1558. spacer 11.3|2251146|32|NC_018524|PILER-CR,CRT matches to NZ_CP030772 (Streptomyces sp. YIM 121038 plasmid pSSP121038, complete sequence) position: , mismatch: 9, identity: 0.719

cgcggcggcgcctgcgcgacctgctcaacgag	CRISPR spacer
gcctacggcgcctgtgcgacctgctgaacatc	Protospacer
  * .*********.********** ***.  

1559. spacer 11.3|2251146|32|NC_018524|PILER-CR,CRT matches to NZ_CP007129 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence) position: , mismatch: 9, identity: 0.719

cgcggcggcgcctgcgcgacctgctcaacgag	CRISPR spacer
agcggcgccgcctgcgcgacccgctgctgctg	Protospacer
 ****** *************.***      *

1560. spacer 11.3|2251146|32|NC_018524|PILER-CR,CRT matches to NC_012528 (Deinococcus deserti VCD115 plasmid 3, complete sequence) position: , mismatch: 9, identity: 0.719

cgcggcggcgcctgcgcgacctgctcaacgag	CRISPR spacer
cgggacggcgcctgcgcgacctgtcgagtgct	Protospacer
** *.******************.. *..*  

1561. spacer 11.3|2251146|32|NC_018524|PILER-CR,CRT matches to NZ_CP029209 (Nitratireductor sp. OM-1 plasmid pOM-1, complete sequence) position: , mismatch: 9, identity: 0.719

cgcggcggcgcctgcgcgacctgctcaacgag	CRISPR spacer
attcacagcgcctgcgcgccctgctcgacggg	Protospacer
  . .*.*********** *******.***.*

1562. spacer 11.3|2251146|32|NC_018524|PILER-CR,CRT matches to MN304824 (Catenulispora phage 69_17, complete genome) position: , mismatch: 9, identity: 0.719

cgcggcggcgcctgcgcgacctgctcaacgag	CRISPR spacer
gaccgctgcgccttcgcgacctgctcagccga	Protospacer
 .* ** ****** *************.* ..

1563. spacer 11.4|2251207|32|NC_018524|PILER-CR,CRT matches to NC_011961 (Thermomicrobium roseum DSM 5159 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gccacgatcgaccggtgcgcctcggtctctcg	CRISPR spacer
tctccttctgaccggtccggctcggtctctcg	Protospacer
 *. *  ..******* ** ************

1564. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP012886 (Mycobacterium chimaera strain AH16 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
ttgtggcggatggcgtcgcggatcgcggtgct	Protospacer
 .*******************..***. .*  

1565. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP016453 (Sphingobium sp. RAC03 plasmid pBSY17_1, complete sequence) position: , mismatch: 9, identity: 0.719

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
tagtggcggatcgcgtcgcgggtcgcttcata	Protospacer
  ********* **********.*** .*. .

1566. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_AP022566 (Mycolicibacterium alvei strain JCM 12272 plasmid pJCM12272, complete sequence) position: , mismatch: 9, identity: 0.719

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
agatggcggtcggcgtcgcgggccgccattcg	Protospacer
* .****** .***************  .  *

1567. spacer 11.7|2251390|33|NC_018524|PILER-CR,CRT matches to MN855815 (Bacteriophage sp. isolate 146, partial genome) position: , mismatch: 9, identity: 0.727

cttgagaagctcccgcgcgacctggagtccgag	CRISPR spacer
ctggagaagctcctgcgcgacctggaagatatc	Protospacer
** **********.************.  ..  

1568. spacer 11.7|2251390|33|NC_018524|PILER-CR,CRT matches to JX163858 (Caulobacter phage phiCbK, complete genome) position: , mismatch: 9, identity: 0.727

cttgagaagctcccgcgcgacctggagtccgag	CRISPR spacer
cttgagaagctcccgcgtggcctgcggcaggtc	Protospacer
*****************.*.**** .*.  *  

1569. spacer 11.7|2251390|33|NC_018524|PILER-CR,CRT matches to KY555147 (Caulobacter phage Ccr34, complete genome) position: , mismatch: 9, identity: 0.727

cttgagaagctcccgcgcgacctggagtccgag	CRISPR spacer
cttgagaagctcccgcgtggcctgcggcaggtc	Protospacer
*****************.*.**** .*.  *  

1570. spacer 11.7|2251390|33|NC_018524|PILER-CR,CRT matches to NC_019410 (Caulobacter phage CcrKarma, complete genome) position: , mismatch: 9, identity: 0.727

cttgagaagctcccgcgcgacctggagtccgag	CRISPR spacer
cttgagaagctcccgcgtggcctgcggcaggtc	Protospacer
*****************.*.**** .*.  *  

1571. spacer 11.7|2251390|33|NC_018524|PILER-CR,CRT matches to KY555146 (Caulobacter phage Ccr32, complete genome) position: , mismatch: 9, identity: 0.727

cttgagaagctcccgcgcgacctggagtccgag	CRISPR spacer
cttgagaagctcccgcgtggcctgcggcaggtc	Protospacer
*****************.*.**** .*.  *  

1572. spacer 11.7|2251390|33|NC_018524|PILER-CR,CRT matches to NC_019407 (Caulobacter phage CcrMagneto, complete genome) position: , mismatch: 9, identity: 0.727

cttgagaagctcccgcgcgacctggagtccgag	CRISPR spacer
cttgagaagctcccgcgtggcctgcggcaggtc	Protospacer
*****************.*.**** .*.  *  

1573. spacer 11.7|2251390|33|NC_018524|PILER-CR,CRT matches to KY555144 (Caulobacter phage Ccr5, complete genome) position: , mismatch: 9, identity: 0.727

cttgagaagctcccgcgcgacctggagtccgag	CRISPR spacer
cttgagaagctcccgcgtggcctgcggcaggtc	Protospacer
*****************.*.**** .*.  *  

1574. spacer 11.7|2251390|33|NC_018524|PILER-CR,CRT matches to NC_019411 (Caulobacter phage CcrSwift, complete genome) position: , mismatch: 9, identity: 0.727

cttgagaagctcccgcgcgacctggagtccgag	CRISPR spacer
cttgagaagctcccgcgtggcctgcggcaggtc	Protospacer
*****************.*.**** .*.  *  

1575. spacer 11.8|2251452|32|NC_018524|PILER-CR,CRT matches to NZ_CP023068 (Ensifer sojae CCBAU 05684 plasmid pSJ05684b, complete sequence) position: , mismatch: 9, identity: 0.719

cagtgtgggcaggagattaccgagatcggcgt	CRISPR spacer
gctcgcgagcaggagataaccgagatcgccga	Protospacer
   .*.*.********* ********** ** 

1576. spacer 12.4|2254232|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP044979 (Bacillus thuringiensis strain BT62 plasmid pBT62A, complete sequence) position: , mismatch: 9, identity: 0.719

actcgtcgggggctttttcacgcccttattcc	CRISPR spacer
agctttttggggctttttcactccctttttct	Protospacer
* .. *. ************* ***** ***.

1577. spacer 14.2|2268321|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP040723 (Rhodococcus pyridinivorans strain YF3 plasmid unnamed4, complete sequence) position: , mismatch: 9, identity: 0.719

ccgattcgccgccgtggccgccacactcaccg	CRISPR spacer
cgttctcgccgccgtgatcgccacactcccac	Protospacer
*   .***********..********** *  

1578. spacer 14.2|2268321|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP024936 (Paraburkholderia graminis strain PHS1 plasmid pPHS1_P, complete sequence) position: , mismatch: 9, identity: 0.719

ccgattcgccgccgtggccgccacactcaccg	CRISPR spacer
tgggcgcatcgccgtggccgccatactcgccg	Protospacer
. *.. *..**************.****.***

1579. spacer 14.2|2268321|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP016820 (Rhodococcus sp. p52 plasmid pDF02, complete sequence) position: , mismatch: 9, identity: 0.719

ccgattcgccgccgtggccgccacactcaccg	CRISPR spacer
cgttctcgccgccgtgatcgccacactcccgc	Protospacer
*   .***********..********** *  

1580. spacer 14.2|2268321|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP023713 (Rhodococcus ruber strain YC-YT1 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

ccgattcgccgccgtggccgccacactcaccg	CRISPR spacer
cgttctcgccgccgtgatcgccacactcccgc	Protospacer
*   .***********..********** *  

1581. spacer 14.4|2268443|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to MN693068 (Marine virus AFVG_25M252, complete genome) position: , mismatch: 9, identity: 0.719

gactatggtcccattcaggccgctcgggccac	CRISPR spacer
tggcgctgtcccgctcaggccgctcgggccac	Protospacer
 . ... *****..******************

1582. spacer 14.6|2268565|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP016083 (Streptomyces sp. SAT1 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.719

aacaccggtctcgcgaccggagacgaggtcat	CRISPR spacer
cgcaccggtcacgcgaccggacacgcgaccgg	Protospacer
 .******** ********** *** *..*. 

1583. spacer 14.7|2268626|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP021016 (Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6991 plasmid pF, complete sequence) position: , mismatch: 9, identity: 0.719

gtcgagacggtccggcacgaggtcgaacacaa	CRISPR spacer
gccgggacggtccggcacgaggacgccgggga	Protospacer
*.**.***************** **   . .*

1584. spacer 15.3|2270459|32|NC_018524|CRISPRCasFinder matches to NZ_CP016082 (Streptomyces sp. SAT1 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

gagcacagcgacggcaccgccaacggctggtg	CRISPR spacer
gtcagcgacgacggcaccgccgccggctggtc	Protospacer
*   .*..*************. ******** 

1585. spacer 15.3|2270459|32|NC_018524|CRISPRCasFinder matches to NZ_CP016369 (Phaeobacter porticola strain P97 plasmid pP97_e, complete sequence) position: , mismatch: 9, identity: 0.719

gagcacagcgacggcaccgccaacggctggtg	CRISPR spacer
aacgacaacgacggcaccgccaatggcggcga	Protospacer
.*  ***.***************.*** *  .

1586. spacer 15.3|2270459|32|NC_018524|CRISPRCasFinder matches to NC_041926 (Escherichia phage vB_EcoM_ECOO78, complete genome) position: , mismatch: 9, identity: 0.719

gagcacagcgacggcaccgccaacggctggtg	CRISPR spacer
gcctacagcgaaggcaccgacaacggcagaca	Protospacer
*  .******* ******* ******* *...

1587. spacer 15.5|2270581|32|NC_018524|CRISPRCasFinder matches to KX752698 (Mycobacterium phage Tonenili, complete genome) position: , mismatch: 9, identity: 0.719

gtctcggcagacggggacagcgagggctacca	CRISPR spacer
tcatcggcgtacggggacagcgaggggtgctc	Protospacer
 . *****. **************** *.*. 

1588. spacer 15.10|2270886|32|NC_018524|CRISPRCasFinder matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

cgctggacggcgatcggcagtcgctgccgtct	CRISPR spacer
tgatggaaggcgatcgggagtcgctgctcaag	Protospacer
.* **** ********* *********.    

1589. spacer 15.10|2270886|32|NC_018524|CRISPRCasFinder matches to NZ_CP029452 (Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence) position: , mismatch: 9, identity: 0.719

cgctggacggcgatcggcagtcgc----tgccgtct	CRISPR spacer
tgctcgacggcgatcggctgtcgcgcaacgcg----	Protospacer
.*** ************* *****    .**     

1590. spacer 15.10|2270886|32|NC_018524|CRISPRCasFinder matches to NZ_CP023071 (Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence) position: , mismatch: 9, identity: 0.719

cgctggacggcgatcggcagtcgc----tgccgtct	CRISPR spacer
tgctcgacggcgatcggctgtcgcgcaacgcg----	Protospacer
.*** ************* *****    .**     

1591. spacer 15.10|2270886|32|NC_018524|CRISPRCasFinder matches to NZ_CP029232 (Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence) position: , mismatch: 9, identity: 0.719

cgctggacggcgatcggcagtcgc----tgccgtct	CRISPR spacer
tgctcgacggcgatcggctgtcgcgcaacgcg----	Protospacer
.*** ************* *****    .**     

1592. spacer 15.10|2270886|32|NC_018524|CRISPRCasFinder matches to NC_017969 (Escherichia phage bV_EcoS_AKFV33, complete genome) position: , mismatch: 9, identity: 0.719

cgctggacggcgatcggcagtcgctgccgtct	CRISPR spacer
tgctgcacggcgttcggcagtcgcctgatgct	Protospacer
.**** ****** ***********.     **

1593. spacer 19.4|4408960|33|NC_018524|CRT matches to NC_006363 (Nocardia farcinica IFM 10152 plasmid pNF2, complete sequence) position: , mismatch: 9, identity: 0.727

gtccatcccggccccgggagatctcatagcggg	CRISPR spacer
ccacatcccggcgccgggcgatctcattccgcc	Protospacer
 . ********* ***** ********  **  

1594. spacer 19.5|4409022|32|NC_018524|CRT matches to NC_007959 (Nitrobacter hamburgensis X14 plasmid 1, complete sequence) position: , mismatch: 9, identity: 0.719

ttccaccaccgcgccgagcgcgaacgggagcg	CRISPR spacer
ctccagaaccgcgccgagcgcgaacccggcga	Protospacer
.****  ******************  *.  .

1595. spacer 19.5|4409022|32|NC_018524|CRT matches to KT887559 (Pseudomonas phage phi3, complete genome) position: , mismatch: 9, identity: 0.719

ttccaccaccgcgccgagcgcgaacgggagcg	CRISPR spacer
ccggaagcccgcgccgagcgcggccgggagcg	Protospacer
..  *   **************. ********

1596. spacer 19.5|4409022|32|NC_018524|CRT matches to NZ_CP013855 (Pseudonocardia sp. HH130630-07 plasmid pLS2-1, complete sequence) position: , mismatch: 9, identity: 0.719

ttccaccaccgcgccgagcgcgaacgggagcg	CRISPR spacer
ggccaccgccgcgccgagcgcggacagtgccc	Protospacer
  *****.**************.**.* . * 

1597. spacer 19.5|4409022|32|NC_018524|CRT matches to NZ_AP014579 (Burkholderia sp. RPE67 plasmid p1, complete sequence) position: , mismatch: 9, identity: 0.719

ttccaccaccgcgccgagcgcgaacgggagcg	CRISPR spacer
cacgcacgacgcgccgagcgcgaacttgagcg	Protospacer
. *   *. ****************  *****

1598. spacer 19.5|4409022|32|NC_018524|CRT matches to NZ_CP023068 (Ensifer sojae CCBAU 05684 plasmid pSJ05684b, complete sequence) position: , mismatch: 9, identity: 0.719

ttccaccaccgcgccgagcgcgaacgggagcg	CRISPR spacer
ttccagcaccgcgccgggcgcgacctcagagg	Protospacer
***** **********.****** *  ... *

1599. spacer 19.5|4409022|32|NC_018524|CRT matches to NC_016626 (Burkholderia sp. YI23 plasmid byi_1p, complete sequence) position: , mismatch: 9, identity: 0.719

ttccaccaccgcgccgagcgcgaacgggagcg	CRISPR spacer
gtaaagacccgcgccgagcgcgaccggcagcc	Protospacer
 *  *   *************** *** *** 

1600. spacer 19.5|4409022|32|NC_018524|CRT matches to NC_016626 (Burkholderia sp. YI23 plasmid byi_1p, complete sequence) position: , mismatch: 9, identity: 0.719

ttccaccaccgcgccgagcgcgaacgggagcg	CRISPR spacer
cacgcacgacgcgccgagcgcgaacttgagcg	Protospacer
. *   *. ****************  *****

1601. spacer 19.5|4409022|32|NC_018524|CRT matches to NZ_CP009572 (Sphingomonas taxi strain ATCC 55669 plasmid STP1, complete sequence) position: , mismatch: 9, identity: 0.719

ttccaccaccgcgccgagcgcgaacgggagcg	CRISPR spacer
cccctccgccgcgccgagcgcgaacagccggc	Protospacer
..** **.*****************.*  *  

1602. spacer 19.5|4409022|32|NC_018524|CRT matches to MK416010 (Klebsiella phage ST11-OXA245phi3.2, complete genome) position: , mismatch: 9, identity: 0.719

ttccaccaccgcgccgagcgcgaacgggagcg-	CRISPR spacer
ttccaccaccgcgccgag-gccgataaaaccaa	Protospacer
****************** ** .*....* *. 

1603. spacer 19.5|4409022|32|NC_018524|CRT matches to MK422448 (Klebsiella phage ST512-KPC3phi13.3, complete genome) position: , mismatch: 9, identity: 0.719

ttccaccaccgcgccgagcgcgaacgggagcg-	CRISPR spacer
ttccaccaccgcgccgag-gccgataaaaccaa	Protospacer
****************** ** .*....* *. 

1604. spacer 21.4|4582357|33|NC_018524|PILER-CR matches to NZ_CP037897 (Thermaerobacter sp. FW80 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.727

tccacgtgcggtggccagctcctcccagttcga	CRISPR spacer
ctcacgggcggcggccagctcctcccggagccg	Protospacer
..**** ****.**************.*  * .

1605. spacer 21.18|4582419|32|NC_018524|CRISPRCasFinder,CRT matches to KU873925 (Pseudomonas phage pf16, complete genome) position: , mismatch: 9, identity: 0.719

ctgtgggcttgaccagcaggcccttgaagatc	CRISPR spacer
tttccagctggaacagcaggcccttgaagcgc	Protospacer
.* . .*** ** ****************  *

1606. spacer 21.20|4582541|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP049319 (Caballeronia sp. SBC2 plasmid pSBC2-3, complete sequence) position: , mismatch: 9, identity: 0.719

gtcgagtgccgtggcctcacggtcgtcggcga	CRISPR spacer
accgagtgcagtggcctcacggtcgttcaatg	Protospacer
..******* ****************. .  .

1607. spacer 21.21|4582602|32|NC_018524|CRISPRCasFinder,CRT matches to MK977696 (Gordonia phage SCentae, complete genome) position: , mismatch: 9, identity: 0.719

gtgcttggacaccttcatggccttccgggcga	CRISPR spacer
gcgcttggacagcttcacggccttctcgaact	Protospacer
*.********* *****.*******. *.   

1608. spacer 21.21|4582602|32|NC_018524|CRISPRCasFinder,CRT matches to MK977695 (Gordonia phage Pupper, complete genome) position: , mismatch: 9, identity: 0.719

gtgcttggacaccttcatggccttccgggcga	CRISPR spacer
gcgcttggacagcttcacggccttctcgaact	Protospacer
*.********* *****.*******. *.   

1609. spacer 21.22|4582663|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP039965 (Pseudorhodobacter sp. S12M18 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

ggctc---gtcgacacacgtcagcagggcagcacg	CRISPR spacer
---tcagggtcgacaccggtcagcagggcagttgc	Protospacer
   **   ********  *************.   

1610. spacer 21.25|4582846|32|NC_018524|CRISPRCasFinder,CRT matches to MT723940 (Mycobacterium phage Ellie, complete genome) position: , mismatch: 9, identity: 0.719

gaacgacggccgggtcgtcgtggtcctggccg	CRISPR spacer
tgtcgacggcctggtcgtcgtcgtcctgcatc	Protospacer
 . ******** ********* ******  . 

1611. spacer 21.25|4582846|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP011869 (Pseudonocardia sp. HH130629-09 plasmid pLS1-1, complete sequence) position: , mismatch: 9, identity: 0.719

gaacgacggccgggtcgtcgtggtcctggccg-	CRISPR spacer
ccgcgacggccgggtggtcctggtcc-acctgc	Protospacer
  .************ *** ****** . *.* 

1612. spacer 21.27|4582968|32|NC_018524|CRISPRCasFinder,CRT matches to NC_009620 (Sinorhizobium medicae WSM419 plasmid pSMED01, complete sequence) position: , mismatch: 9, identity: 0.719

ccttgtgccaggtcgcggcggtggtgagtgac	CRISPR spacer
gtatgtgccaggtcgcggcgctcgtgaaattc	Protospacer
 . ***************** * ****.   *

1613. spacer 21.27|4582968|32|NC_018524|CRISPRCasFinder,CRT matches to NC_016588 (Azospirillum lipoferum 4B plasmid AZO_p6, complete sequence) position: , mismatch: 9, identity: 0.719

ccttgtgccaggtcgcggcggtggtgagtgac	CRISPR spacer
tgccccggcaggtcgcggcggtggtgaccgac	Protospacer
. .. .* ******************* .***

1614. spacer 21.27|4582968|32|NC_018524|CRISPRCasFinder,CRT matches to NC_014838 (Pantoea sp. At-9b plasmid pPAT9B01, complete sequence) position: , mismatch: 9, identity: 0.719

ccttgtgccaggtcgcggcggtggtgagtgac	CRISPR spacer
taacgatcctggtcgcggcgctggtgagtgcc	Protospacer
.  .*  ** ********** ********* *

1615. spacer 21.27|4582968|32|NC_018524|CRISPRCasFinder,CRT matches to NC_011892 (Methylobacterium nodulans ORS 2060 plasmid pMNOD01, complete sequence) position: , mismatch: 9, identity: 0.719

ccttgtgccaggtcgcggcggtggtgagtgac	CRISPR spacer
gccggcgccaggtcgcggcggtgaagagtttg	Protospacer
 *. *.*****************. ****   

1616. spacer 21.29|4583089|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP040819 (Paraoceanicella profunda strain D4M1 plasmid pD4M1A, complete sequence) position: , mismatch: 9, identity: 0.719

gactgaccgtgatccagttcgggatccgggtc	CRISPR spacer
tgaaggcgttgatccagtgcgtgatccgggtc	Protospacer
 .  *.*  ********* ** **********

1617. spacer 21.29|4583089|32|NC_018524|CRISPRCasFinder,CRT matches to MF476925 (Klebsiella phage YMC16/01/N133_KPN_BP, complete genome) position: , mismatch: 9, identity: 0.719

gactgaccgtgatccagttcgggatccgggtc	CRISPR spacer
agacgtcgctgatccagttcggcttccgggtc	Protospacer
.. .* *  *************  ********

1618. spacer 23.5|4591847|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_014310 (Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence) position: , mismatch: 9, identity: 0.719

accgacttgccggtgaacgccccgtcggggcc	CRISPR spacer
ggccgcttgccggtgatcgccccggcgggcta	Protospacer
. * .*********** ******* **** . 

1619. spacer 23.5|4591847|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022760 (Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

accgacttgccggtgaacgccccgtcggggcc	CRISPR spacer
ggccgcttgccggtgatcgccccggcgggcta	Protospacer
. * .*********** ******* **** . 

1620. spacer 23.5|4591847|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022789 (Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

accgacttgccggtgaacgccccgtcggggcc	CRISPR spacer
ggccgcttgccggtgatcgccccggcgggcta	Protospacer
. * .*********** ******* **** . 

1621. spacer 23.5|4591847|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP025547 (Mycobacterium paragordonae strain 49061 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

accgacttgccggtgaacgccccgtcggggcc	CRISPR spacer
gatggttcgccggtgaccgcgccgtcggggca	Protospacer
. .*..*.******** *** ********** 

1622. spacer 23.9|4592091|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013052 (Sinorhizobium americanum CCGM7 plasmid A, complete sequence) position: , mismatch: 9, identity: 0.719

gctcgtcgaaggcggggttcgcgccaacgacc	CRISPR spacer
gctcgtcgaaagcggggttcccgtcgcggtga	Protospacer
**********.********* **.*.  *   

1623. spacer 23.9|4592091|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP021813 (Sinorhizobium meliloti strain M270 plasmid psymA, complete sequence) position: , mismatch: 9, identity: 0.719

gctcgtcgaaggcggggttcgcgccaacgacc	CRISPR spacer
gctcgtcgaaggcgccgttcgcgtcgcgcatg	Protospacer
**************  *******.*.   *. 

1624. spacer 24.1|4593189|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP030828 (Neorhizobium sp. NCHU2750 plasmid pNCHU2750a, complete sequence) position: , mismatch: 9, identity: 0.719

gctatggccgccattctcgcggccgctgggat	CRISPR spacer
ggcatggccgccatgctcgcgcccgcgccgtc	Protospacer
* .*********** ****** ****   * .

1625. spacer 24.2|4593250|32|NC_018524|CRISPRCasFinder,CRT matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 9, identity: 0.719

gcggggggcttgaacgaaggccttgcgcagag	CRISPR spacer
acgatcggctcgaaggaaggccttgcgcacct	Protospacer
.**.  ****.*** **************   

1626. spacer 24.2|4593250|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 9, identity: 0.719

gcggggggcttgaacgaaggccttgcgcagag	CRISPR spacer
acgatcggctcgaaggaaggccttgcgcacct	Protospacer
.**.  ****.*** **************   

1627. spacer 25.3|4595499|37|NC_018524|PILER-CR,CRT matches to NZ_CP030127 (Indioceanicola profundi strain SCSIO 08040 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.757

accccgctacgcggaacctcgcgcacatctgatgtgt	CRISPR spacer
ccgccgctacgcggaacctgccgcacatcggcggatt	Protospacer
 * ****************  ******** *  *  *

1628. spacer 25.5|4595383|32|NC_018524|CRISPRCasFinder matches to NZ_CP019586 (Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence) position: , mismatch: 9, identity: 0.719

cgccgtgtgtgggccgcgctcggcccgatccg	CRISPR spacer
gacgatcagtggaccgcgctcggcgcgatccc	Protospacer
 .* .*  ****.*********** ****** 

1629. spacer 25.5|4595383|32|NC_018524|CRISPRCasFinder matches to NC_017326 (Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence) position: , mismatch: 9, identity: 0.719

cgccgtgtgtgggccgcgctcggcccgatccg	CRISPR spacer
gacgatcagtggaccgcgctcggcgcgatccc	Protospacer
 .* .*  ****.*********** ****** 

1630. spacer 25.5|4595383|32|NC_018524|CRISPRCasFinder matches to NZ_CP009146 (Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence) position: , mismatch: 9, identity: 0.719

cgccgtgtgtgggccgcgctcggcccgatccg	CRISPR spacer
gacgatcagtggaccgcgctcggcgcgatccc	Protospacer
 .* .*  ****.*********** ****** 

1631. spacer 25.5|4595383|32|NC_018524|CRISPRCasFinder matches to NC_018701 (Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence) position: , mismatch: 9, identity: 0.719

cgccgtgtgtgggccgcgctcggcccgatccg	CRISPR spacer
gacgatcagtggaccgcgctcggcgcgatccc	Protospacer
 .* .*  ****.*********** ****** 

1632. spacer 25.5|4595383|32|NC_018524|CRISPRCasFinder matches to NZ_CP021828 (Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.719

cgccgtgtgtgggccgcgctcggcccgatccg	CRISPR spacer
gacgatcagtggaccgcgctcggcgcgatccc	Protospacer
 .* .*  ****.*********** ****** 

1633. spacer 25.5|4595383|32|NC_018524|CRISPRCasFinder matches to NZ_CP021802 (Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.719

cgccgtgtgtgggccgcgctcggcccgatccg	CRISPR spacer
gacgatcagtggaccgcgctcggcgcgatccc	Protospacer
 .* .*  ****.*********** ****** 

1634. spacer 25.5|4595383|32|NC_018524|CRISPRCasFinder matches to NZ_CP021831 (Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.719

cgccgtgtgtgggccgcgctcggcccgatccg	CRISPR spacer
gacgatcagtggaccgcgctcggcgcgatccc	Protospacer
 .* .*  ****.*********** ****** 

1635. spacer 25.5|4595383|32|NC_018524|CRISPRCasFinder matches to NZ_CP021823 (Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.719

cgccgtgtgtgggccgcgctcggcccgatccg	CRISPR spacer
gacgatcagtggaccgcgctcggcgcgatccc	Protospacer
 .* .*  ****.*********** ****** 

1636. spacer 25.5|4595383|32|NC_018524|CRISPRCasFinder matches to NZ_CP021814 (Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.719

cgccgtgtgtgggccgcgctcggcccgatccg	CRISPR spacer
gacgatcagtggaccgcgctcggcgcgatccc	Protospacer
 .* .*  ****.*********** ****** 

1637. spacer 25.5|4595383|32|NC_018524|CRISPRCasFinder matches to NZ_CP021795 (Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.719

cgccgtgtgtgggccgcgctcggcccgatccg	CRISPR spacer
gacgatcagtggaccgcgctcggcgcgatccc	Protospacer
 .* .*  ****.*********** ****** 

1638. spacer 25.5|4595383|32|NC_018524|CRISPRCasFinder matches to NZ_CP021810 (Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.719

cgccgtgtgtgggccgcgctcggcccgatccg	CRISPR spacer
gacgatcagtggaccgcgctcggcgcgatccc	Protospacer
 .* .*  ****.*********** ****** 

1639. spacer 25.5|4595383|32|NC_018524|CRISPRCasFinder matches to NZ_CP021806 (Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.719

cgccgtgtgtgggccgcgctcggcccgatccg	CRISPR spacer
gacgatcagtggaccgcgctcggcgcgatccc	Protospacer
 .* .*  ****.*********** ****** 

1640. spacer 25.5|4595383|32|NC_018524|CRISPRCasFinder matches to NZ_CP021218 (Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence) position: , mismatch: 9, identity: 0.719

cgccgtgtgtgggccgcgctcggcccgatccg	CRISPR spacer
gacgatcagtggaccgcgctcggcgcgatccc	Protospacer
 .* .*  ****.*********** ****** 

1641. spacer 25.5|4595383|32|NC_018524|CRISPRCasFinder matches to NZ_CP026527 (Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence) position: , mismatch: 9, identity: 0.719

cgccgtgtgtgggccgcgctcggcccgatccg	CRISPR spacer
gacgatcagtggaccgcgctcggcgcgatccc	Protospacer
 .* .*  ****.*********** ****** 

1642. spacer 25.5|4595383|32|NC_018524|CRISPRCasFinder matches to NZ_CP019484 (Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence) position: , mismatch: 9, identity: 0.719

cgccgtgtgtgggccgcgctcggcccgatccg	CRISPR spacer
gacgatcagtggaccgcgctcggcgcgatccc	Protospacer
 .* .*  ****.*********** ****** 

1643. spacer 25.5|4595383|32|NC_018524|CRISPRCasFinder matches to NZ_CP019487 (Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence) position: , mismatch: 9, identity: 0.719

cgccgtgtgtgggccgcgctcggcccgatccg	CRISPR spacer
gacgatcagtggaccgcgctcggcgcgatccc	Protospacer
 .* .*  ****.*********** ****** 

1644. spacer 26.6|4598872|37|NC_018524|PILER-CR matches to NZ_CP036456 (Streptomonospora sp. M2 plasmid phiM2, complete sequence) position: , mismatch: 9, identity: 0.757

acccccaccagacgccgtgctcgtccggctggccgaa	CRISPR spacer
gtgcgccgtagacgccgttctcgtcgggctggccgaa	Protospacer
.. * *  .********* ****** ***********

1645. spacer 26.11|4599177|37|NC_018524|PILER-CR matches to NZ_CP007129 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence) position: , mismatch: 9, identity: 0.757

gacccacggagctcgtcgagctcgacatcgcgggctc	CRISPR spacer
cgcgctccacgctcgtcgcgctcgagatcgcgggctc	Protospacer
 .* * * . ******** ****** ***********

1646. spacer 26.11|4599177|37|NC_018524|PILER-CR matches to NZ_CP045855 (Agrobacterium sp. MA01 plasmid punnamed1, complete sequence) position: , mismatch: 9, identity: 0.757

gacccacggagctcgtcgagctcgacatcgcgggctc	CRISPR spacer
ggctgccggagctcgtcgagctcgtcatggcgcgacc	Protospacer
*.*.  ****************** *** *** * .*

1647. spacer 26.15|4598572|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP037736 (Citrobacter freundii strain CAV1857 plasmid pCAV1857-105, complete sequence) position: , mismatch: 9, identity: 0.719

cgtaggtgaggcgtccggccgtcgggcgcctc	CRISPR spacer
atgatggcaggcgtccggccggagggcgcctg	Protospacer
   * *  *************  ******** 

1648. spacer 26.15|4598572|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP017059 (Citrobacter freundii strain SL151 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

cgtaggtgaggcgtccggccgtcgggcgcctc	CRISPR spacer
atgatggcaggcgtccggccggagggcgcctg	Protospacer
   * *  *************  ******** 

1649. spacer 26.15|4598572|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP026241 (Citrobacter freundii complex sp. CFNIH9 plasmid pCFR-e790, complete sequence) position: , mismatch: 9, identity: 0.719

cgtaggtgaggcgtccggccgtcgggcgcctc	CRISPR spacer
atgatggcaggcgtccggccggagggcgcctg	Protospacer
   * *  *************  ******** 

1650. spacer 26.15|4598572|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP029732 (Citrobacter sp. CRE-46 strain AR_0157 plasmid unnamed4, complete sequence) position: , mismatch: 9, identity: 0.719

cgtaggtgaggcgtccggccgtcgggcgcctc	CRISPR spacer
atgatggcaggcgtccggccggagggcgcctg	Protospacer
   * *  *************  ******** 

1651. spacer 26.15|4598572|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_LS992176 (Citrobacter freundii isolate Citrobacter freundii str. E2614 plasmid 2, complete sequence) position: , mismatch: 9, identity: 0.719

cgtaggtgaggcgtccggccgtcgggcgcctc	CRISPR spacer
atgatggcaggcgtccggccggagggcgcctg	Protospacer
   * *  *************  ******** 

1652. spacer 26.15|4598572|32|NC_018524|CRISPRCasFinder,CRT matches to CP044029 (Klebsiella pneumoniae strain RJY9645 plasmid pY9645-166, complete sequence) position: , mismatch: 9, identity: 0.719

cgtaggtgaggcgtccggccgtcgggcgcctc	CRISPR spacer
atgatggcaggcgtccggccggagggcgcctg	Protospacer
   * *  *************  ******** 

1653. spacer 26.15|4598572|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP042480 (Citrobacter freundii strain C50 plasmid pC50_002, complete sequence) position: , mismatch: 9, identity: 0.719

cgtaggtgaggcgtccggccgtcgggcgcctc	CRISPR spacer
atgatggcaggcgtccggccggagggcgcctg	Protospacer
   * *  *************  ******** 

1654. spacer 26.15|4598572|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP026551 (Citrobacter sp. SL156 plasmid unnamed2) position: , mismatch: 9, identity: 0.719

cgtaggtgaggcgtccggccgtcgggcgcctc	CRISPR spacer
atgatggcaggcgtccggccggagggcgcctg	Protospacer
   * *  *************  ******** 

1655. spacer 26.15|4598572|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP042483 (Klebsiella pneumoniae strain C51 plasmid pC51_002, complete sequence) position: , mismatch: 9, identity: 0.719

cgtaggtgaggcgtccggccgtcgggcgcctc	CRISPR spacer
atgatggcaggcgtccggccggagggcgcctg	Protospacer
   * *  *************  ******** 

1656. spacer 26.15|4598572|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP022697 (Citrobacter farmeri strain AUSMDU00008141 plasmid pAUSMDU8141-2, complete sequence) position: , mismatch: 9, identity: 0.719

cgtaggtgaggcgtccggccgtcgggcgcctc	CRISPR spacer
atgatggcaggcgtccggccggagggcgcctg	Protospacer
   * *  *************  ******** 

1657. spacer 26.15|4598572|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP035277 (Citrobacter freundii strain R17 plasmid pCFR17_1, complete sequence) position: , mismatch: 9, identity: 0.719

cgtaggtgaggcgtccggccgtcgggcgcctc	CRISPR spacer
atgatggcaggcgtccggccggagggcgcctg	Protospacer
   * *  *************  ******** 

1658. spacer 26.15|4598572|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP042553 (Enterobacter hormaechei strain C45 plasmid pC45_002, complete sequence) position: , mismatch: 9, identity: 0.719

cgtaggtgaggcgtccggccgtcgggcgcctc	CRISPR spacer
atgatggcaggcgtccggccggagggcgcctg	Protospacer
   * *  *************  ******** 

1659. spacer 26.15|4598572|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP042519 (Citrobacter freundii strain E33 plasmid pE33_002, complete sequence) position: , mismatch: 9, identity: 0.719

cgtaggtgaggcgtccggccgtcgggcgcctc	CRISPR spacer
atgatggcaggcgtccggccggagggcgcctg	Protospacer
   * *  *************  ******** 

1660. spacer 26.15|4598572|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP011654 (Citrobacter freundii strain CAV1741 plasmid pCAV1741-101, complete sequence) position: , mismatch: 9, identity: 0.719

cgtaggtgaggcgtccggccgtcgggcgcctc	CRISPR spacer
atgatggcaggcgtccggccggagggcgcctg	Protospacer
   * *  *************  ******** 

1661. spacer 26.15|4598572|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP011610 (Citrobacter freundii strain CAV1321 plasmid pCAV1321-135, complete sequence) position: , mismatch: 9, identity: 0.719

cgtaggtgaggcgtccggccgtcgggcgcctc	CRISPR spacer
atgatggcaggcgtccggccggagggcgcctg	Protospacer
   * *  *************  ******** 

1662. spacer 26.15|4598572|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_MH909344 (Enterobacter cloacae strain 12949 plasmid p12949-FIIY, complete sequence) position: , mismatch: 9, identity: 0.719

cgtaggtgaggcgtccggccgtcgggcgcctc	CRISPR spacer
atgatggcaggcgtccggccggagggcgcctg	Protospacer
   * *  *************  ******** 

1663. spacer 26.15|4598572|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_MK124610 (Citrobacter werkmanii strain Cb_CB1_SE1_NDM_08_2017 plasmid pCB1_SE1_NDM, complete sequence) position: , mismatch: 9, identity: 0.719

cgtaggtgaggcgtccggccgtcgggcgcctc	CRISPR spacer
atgatggcaggcgtccggccggagggcgcctg	Protospacer
   * *  *************  ******** 

1664. spacer 26.15|4598572|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP026698 (Citrobacter koseri strain AR_0025 plasmid unitig_2_pilon, complete sequence) position: , mismatch: 9, identity: 0.719

cgtaggtgaggcgtccggccgtcgggcgcctc	CRISPR spacer
atgatggcaggcgtccggccggagggcgcctg	Protospacer
   * *  *************  ******** 

1665. spacer 26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP010990 (Pseudonocardia sp. EC080625-04 plasmid pFRP1-1, complete sequence) position: , mismatch: 9, identity: 0.719

ttgttcgcctgctcggcggtgagcttcacgac	CRISPR spacer
gtcacttcctgctcggcggtgagcgtctcgat	Protospacer
 *  .. ***************** ** ***.

1666. spacer 26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 9, identity: 0.719

ttgttcgcctgctcggcggtgagcttcacgac	CRISPR spacer
cgcgccgcctgctcggcggtgaggtacaccag	Protospacer
.   .****************** * *** * 

1667. spacer 26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 9, identity: 0.719

ttgttcgcctgctcggcggtgagcttcacgac	CRISPR spacer
cgcgccgcctgctcggcggtgaggtacaccag	Protospacer
.   .****************** * *** * 

1668. spacer 26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP011869 (Pseudonocardia sp. HH130629-09 plasmid pLS1-1, complete sequence) position: , mismatch: 9, identity: 0.719

ttgttcgcctgctcggcggtgagcttcacgac	CRISPR spacer
gtcacttcctgctcggcggtgagcgtctcgat	Protospacer
 *  .. ***************** ** ***.

1669. spacer 26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP027794 (Rhodococcus hoagii strain DSSKP-R-001 plasmid plas1, complete sequence) position: , mismatch: 9, identity: 0.719

ttgttcgcctgctcggcggtgagcttcacgac	CRISPR spacer
aacgtcgcgtgctcggcggcgagcttcgcctc	Protospacer
    **** **********.*******.*  *

1670. spacer 26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP023440 (Thauera sp. K11 plasmid pTX1, complete sequence) position: , mismatch: 9, identity: 0.719

ttgttcgcctgctcggcggtgagcttcacgac	CRISPR spacer
tccgccacctgctggccggtgagcttcacgct	Protospacer
*.  .*.****** * ************** .

1671. spacer 26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP054616 (Azospirillum oryzae strain KACC 14407 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

ttgttcgcctgctcggcggtgagcttcacgac	CRISPR spacer
gccgtcgcctgctcggcggtgaagttctggat	Protospacer
 .  ******************. ***  **.

1672. spacer 26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT matches to JF412297 (EBPR siphovirus 2, partial sequence) position: , mismatch: 9, identity: 0.719

ttgttcgcctgctcggcggtgagcttcacgac	CRISPR spacer
tcgaagatttgctcgtcggtgagtttcacgac	Protospacer
*.*   ...****** *******.********

1673. spacer 26.18|4598755|32|NC_018524|CRISPRCasFinder,CRT matches to NC_019917 (Burkholderia phage BcepMigl, complete genome) position: , mismatch: 9, identity: 0.719

gaccccgcgttcaccgatgccgtgaccgattg	CRISPR spacer
tatcaggcgttcatcgatgccgtgacggacaa	Protospacer
 *.*  *******.************ **. .

1674. spacer 26.18|4598755|32|NC_018524|CRISPRCasFinder,CRT matches to NC_005262 (Burkholderia cepacia phage Bcep22, complete genome) position: , mismatch: 9, identity: 0.719

gaccccgcgttcaccgatgccgtgaccgattg	CRISPR spacer
tatcaggcgttcatcgacgccgtgaccgacaa	Protospacer
 *.*  *******.***.***********. .

1675. spacer 26.19|4598816|32|NC_018524|CRISPRCasFinder,CRT matches to NC_017805 (Deinococcus gobiensis I-0 plasmid P1, complete sequence) position: , mismatch: 9, identity: 0.719

cggtagtgtccgccgtctcccggggggtggct	CRISPR spacer
atctggacgccgccttctcccggagggtggct	Protospacer
   *.*   ***** ********.********

1676. spacer 26.20|4598877|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

caccagacgccgtgctcgtccggctggccgaa	CRISPR spacer
tgctgcgcgccgtgctggcccggctggccgac	Protospacer
..*.. .********* *.************ 

1677. spacer 26.20|4598877|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP054841 (Acidovorax sp. 16-35-5 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

caccagacgccgtgctcgtccggctggccgaa	CRISPR spacer
cgcaagacgccgagcgcgtccggctggtgcgc	Protospacer
*.* ******** ** ***********.  . 

1678. spacer 26.20|4598877|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP040821 (Paraoceanicella profunda strain D4M1 plasmid pD4M1C, complete sequence) position: , mismatch: 9, identity: 0.719

caccagacgccgtgctcgtccggctggccgaa	CRISPR spacer
ggctcgccgccctgctcgcccggctggccgcg	Protospacer
 .*. * **** ******.*********** .

1679. spacer 26.20|4598877|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP021128 (Rhizobium sp. Kim5 plasmid pRetKim5d, complete sequence) position: , mismatch: 9, identity: 0.719

caccagacgccgtgctcgtccggctggccgaa	CRISPR spacer
tggctgacgccgtgctcggcctgctggctgcc	Protospacer
.. * ************* ** ******.*  

1680. spacer 26.20|4598877|32|NC_018524|CRISPRCasFinder,CRT matches to CP007645 (Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803d, complete sequence) position: , mismatch: 9, identity: 0.719

caccagacgccgtgctcgtccggctggccgaa	CRISPR spacer
tggctgacgccgtgctcggcctgctggctgcc	Protospacer
.. * ************* ** ******.*  

1681. spacer 26.20|4598877|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP054618 (Azospirillum oryzae strain KACC 14407 plasmid unnamed4, complete sequence) position: , mismatch: 9, identity: 0.719

caccagacgccgtgctcgtccggctggccgaa	CRISPR spacer
tgcgcggcgccgtgttcggccggctggccgcc	Protospacer
..*  *.*******.*** ***********  

1682. spacer 26.20|4598877|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_AP012556 (Mycobacterium avium subsp. hominissuis TH135 plasmid pMAH135, complete sequence) position: , mismatch: 9, identity: 0.719

caccagacgccgtgctcgtccggctggccgaa	CRISPR spacer
ccatctacggcatgctcgtccggctggcccga	Protospacer
*  .  *** *.***************** .*

1683. spacer 26.20|4598877|32|NC_018524|CRISPRCasFinder,CRT matches to JQ067089 (Pseudomonas phage PaMx28, partial genome) position: , mismatch: 9, identity: 0.719

caccagacgccgtgctcgtccggctggccgaa	CRISPR spacer
ggcccctcgccgtccacgtccggctggccgcc	Protospacer
 .**   ****** * **************  

1684. spacer 26.21|4598938|32|NC_018524|CRISPRCasFinder,CRT matches to CP054927 (Streptomyces fulvissimus strain NA06532 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

ggcggcaggccggtacggtgccgccatggatc	CRISPR spacer
ggcggcgggccggtacggcgccgggcggcagg	Protospacer
******.***********.****    * *  

1685. spacer 26.23|4599060|32|NC_018524|CRISPRCasFinder,CRT matches to NC_018580 (Gordonia sp. KTR9 plasmid pGKT2, complete sequence) position: , mismatch: 9, identity: 0.719

caggccctggaggacagccggtccgcccgcgc	CRISPR spacer
tgacgccatgaggacagcgggtccgccctcgc	Protospacer
...  **  ********* ********* ***

1686. spacer 26.23|4599060|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP039340 (Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence) position: , mismatch: 9, identity: 0.719

caggccctggaggacagccggtccgcccgcgc	CRISPR spacer
caggcgctggcggacagccggtcgctgcggta	Protospacer
***** **** ************  . **   

1687. spacer 26.25|4599182|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP009292 (Novosphingobium pentaromativorans US6-1 plasmid pLA3, complete sequence) position: , mismatch: 9, identity: 0.719

acggagctcgtcgagctcgacatcgcgggctc	CRISPR spacer
gcggagctcgtcgaagtcgacatcgatcccct	Protospacer
.*************. *********    *..

1688. spacer 26.25|4599182|32|NC_018524|CRISPRCasFinder,CRT matches to CP003952 (Rhodococcus opacus PD630 plasmid 3, complete sequence) position: , mismatch: 9, identity: 0.719

acggagctcgtcgagctcgacatcgcgggctc	CRISPR spacer
gtgcaggtcgtcgagctcgtcatcgcgtctgc	Protospacer
..* ** ************ *******  . *

1689. spacer 26.25|4599182|32|NC_018524|CRISPRCasFinder,CRT matches to MK310226 (Halobacterium virus ChaoS9, complete genome) position: , mismatch: 9, identity: 0.719

acggagctcgtcgagctcgacatcgcgggctc	CRISPR spacer
atccgggtcgtcgcgctcgacaccgcgggcga	Protospacer
*.  .* ****** ********.*******  

1690. spacer 26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT matches to NC_014309 (Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome) position: , mismatch: 9, identity: 0.719

acctcgaactcgcggcgctcgcggccgtcacg	CRISPR spacer
gtaccgaactggcggcgctcgcggacgtccac	Protospacer
.. .****** ************* ****   

1691. spacer 26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_AP014579 (Burkholderia sp. RPE67 plasmid p1, complete sequence) position: , mismatch: 9, identity: 0.719

acctcgaactcgcggcgctcgcggccgtcacg	CRISPR spacer
tcacgctgctcgcggcgctcgcggccgtgacc	Protospacer
 * .   .******************** ** 

1692. spacer 26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP020331 (Martelella mediterranea DSM 17316 strain MACL11 plasmid pMM593, complete sequence) position: , mismatch: 9, identity: 0.719

acctcgaactcgcggcgctcgcggccgtcacg	CRISPR spacer
cagatgaactcgcggcccacgcggccgtcgtg	Protospacer
    .*********** * **********..*

1693. spacer 26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT matches to MK814750 (Gordonia phage Ewald, complete genome) position: , mismatch: 9, identity: 0.719

acctcgaactcgcggcgctcgcggccgtcacg	CRISPR spacer
ttcaggatctcgcggcgctcgcggcggtcggt	Protospacer
 .*  ** ***************** ***.  

1694. spacer 26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT matches to NC_031004 (Gordonia phage Nyceirae, complete genome) position: , mismatch: 9, identity: 0.719

acctcgaactcgcggcgctcgcggccgtcacg	CRISPR spacer
ttcaggatctcgcggcgctcgcggcggtcggt	Protospacer
 .*  ** ***************** ***.  

1695. spacer 26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT matches to NC_010070 (Burkholderia multivorans ATCC 17616 plasmid pBMUL01, complete sequence) position: , mismatch: 9, identity: 0.719

acctcgaactcgcggcgctcgcggccgtcacg	CRISPR spacer
ccgccgaacgcgcggcgatcgcggccgattct	Protospacer
 * .***** ******* ********* . * 

1696. spacer 26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP046723 (Pantoea agglomerans strain ASB05 plasmid pASB05p1, complete sequence) position: , mismatch: 9, identity: 0.719

acctcgaactcgcggcgctcgcggccgtcacg	CRISPR spacer
tgcgcgaaatcgcggcgctggcggccgaagag	Protospacer
  * **** ********** *******  . *

1697. spacer 26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP051471 (Rhodobacter sphaeroides strain CH10 plasmid pRspCH10B, complete sequence) position: , mismatch: 9, identity: 0.719

----acctcgaactcgcggcgctcgcggccgtcacg	CRISPR spacer
ggtcgctt----ctcgccgcgctctcggccgtcacc	Protospacer
    .*.*    ***** ****** ********** 

1698. spacer 26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP030274 (Rhodobacter sphaeroides 2.4.1 plasmid pB, complete sequence) position: , mismatch: 9, identity: 0.719

----acctcgaactcgcggcgctcgcggccgtcacg	CRISPR spacer
ggtcgctt----ctcgccgcgctctcggccgtcacc	Protospacer
    .*.*    ***** ****** ********** 

1699. spacer 26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT matches to CP047034 (Rhodobacter sphaeroides strain DSM 158 plasmid pB, complete sequence) position: , mismatch: 9, identity: 0.719

----acctcgaactcgcggcgctcgcggccgtcacg	CRISPR spacer
ggtcgctt----ctcgccgcgctctcggccgtcacc	Protospacer
    .*.*    ***** ****** ********** 

1700. spacer 26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP015291 (Rhodobacter sphaeroides strain MBTLJ-20 plasmid c, complete sequence) position: , mismatch: 9, identity: 0.719

----acctcgaactcgcggcgctcgcggccgtcacg	CRISPR spacer
ggtcgctt----ctcgccgcgctctcggccgtcacc	Protospacer
    .*.*    ***** ****** ********** 

1701. spacer 26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP047040 (Rhodobacter sphaeroides strain 2.4.1 substr. H2 plasmid pB, complete sequence) position: , mismatch: 9, identity: 0.719

----acctcgaactcgcggcgctcgcggccgtcacg	CRISPR spacer
ggtcgctt----ctcgccgcgctctcggccgtcacc	Protospacer
    .*.*    ***** ****** ********** 

1702. spacer 26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP034351 (Streptomyces sp. W1SF4 plasmid p1, complete sequence) position: , mismatch: 9, identity: 0.719

acctcgaactcgcggcgctcgcggccgtcacg	CRISPR spacer
cgtccgaactcgcggcgctcgccgacggcctg	Protospacer
  ..****************** * ** * .*

1703. spacer 26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP028965 (Burkholderia sp. IDO3 plasmid p1, complete sequence) position: , mismatch: 9, identity: 0.719

acctcgaactcgcggcgctcgcggccgtcacg	CRISPR spacer
ccgccgaacgcgcggcgatcgcggccgattct	Protospacer
 * .***** ******* ********* . * 

1704. spacer 26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT matches to NC_010802 (Burkholderia multivorans ATCC 17616 plasmid pTGL1, complete sequence) position: , mismatch: 9, identity: 0.719

acctcgaactcgcggcgctcgcggccgtcacg	CRISPR spacer
ccgccgaacgcgcggcgatcgcggccgattct	Protospacer
 * .***** ******* ********* . * 

1705. spacer 26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP031650 (Pantoea agglomerans strain TH81 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

acctcgaactcgcggcgctcgcggccgtcacg	CRISPR spacer
tgcgcgaaatcgcggcgctggcggccgaagag	Protospacer
  * **** ********** *******  . *

1706. spacer 26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT matches to LT559120 (Nonomuraea sp. ATCC 39727 isolate nono1 genome assembly, plasmid: III) position: , mismatch: 9, identity: 0.719

acctcgaactcgcggcgctcgcggccgtcacg	CRISPR spacer
ggcgggaactggcggcggtcgcggccgtgcag	Protospacer
. *  ***** ****** **********   *

1707. spacer 26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP015215 (Rhodobacter sphaeroides strain MBTLJ-13 plasmid d, complete sequence) position: , mismatch: 9, identity: 0.719

----acctcgaactcgcggcgctcgcggccgtcacg	CRISPR spacer
ggtcgctt----ctcgccgcgctctcggccgtcacc	Protospacer
    .*.*    ***** ****** ********** 

1708. spacer 26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT matches to MF417942 (Uncultured Caudovirales phage clone 7F_6, partial genome) position: , mismatch: 9, identity: 0.719

acctcgaactcgcggcgctcgcggccgtcacg	CRISPR spacer
acctggatctcgcggcgctcgcgctgggcgat	Protospacer
**** ** *************** . * *.  

1709. spacer 26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT matches to MF417876 (Uncultured Caudovirales phage clone 3F_6, partial genome) position: , mismatch: 9, identity: 0.719

acctcgaactcgcggcgctcgcggccgtcacg	CRISPR spacer
acctggatctcgcggcgctcgcgctgggcgat	Protospacer
**** ** *************** . * *.  

1710. spacer 26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT matches to MG707188 (Pseudomonas phage TC7, partial genome) position: , mismatch: 9, identity: 0.719

acctcgaactcgcggcgctcgcggccgtcacg-	CRISPR spacer
accttgacctcgcggcgctcgc-gctgctggat	Protospacer
****.** ************** **.*... . 

1711. spacer 26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT matches to MF417869 (Uncultured Caudovirales phage clone 3S_4, partial genome) position: , mismatch: 9, identity: 0.719

acctcgaactcgcggcgctcgcggccgtcacg	CRISPR spacer
acctggatctcgcggcgctcgcgctgggcgat	Protospacer
**** ** *************** . * *.  

1712. spacer 26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT matches to MF417877 (Uncultured Caudovirales phage clone 9F_7, partial genome) position: , mismatch: 9, identity: 0.719

acctcgaactcgcggcgctcgcggccgtcacg	CRISPR spacer
acctggatctcgcggcgctcgcgctgggcgat	Protospacer
**** ** *************** . * *.  

1713. spacer 26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT matches to MF417878 (Uncultured Caudovirales phage clone 8S_7, partial genome) position: , mismatch: 9, identity: 0.719

acctcgaactcgcggcgctcgcggccgtcacg	CRISPR spacer
acctggatctcgcggcgctcgcgctgggcgat	Protospacer
**** ** *************** . * *.  

1714. spacer 27.1|4607990|32|NC_018524|CRISPRCasFinder matches to NZ_CP024309 (Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3b, complete sequence) position: , mismatch: 9, identity: 0.719

gctcgccagtcccggtcgtggtgggtgtcctc	CRISPR spacer
gctcgccagtccctgtcgtgttgctttccacg	Protospacer
************* ****** **  * .* . 

1715. spacer 28.1|4608658|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022193 (Yangia pacifica strain YSBP01 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.719

ccaccgcccgggaggccgcccaccgggccgca	CRISPR spacer
tcaccgcccgagagcccgcccaccggcttttc	Protospacer
.*********.*** *********** .. . 

1716. spacer 28.1|4608658|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP011665 (Streptomyces sp. Mg1 plasmid pSMg1-1, complete sequence) position: , mismatch: 9, identity: 0.719

ccaccgcccgggaggccgcccaccgggccgca	CRISPR spacer
ggcggatccgggaggccgcccaccgggtcgga	Protospacer
     ..********************.** *

1717. spacer 28.1|4608658|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013744 (Streptomyces sp. CdTB01 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

ccaccgcccgggaggccgcccaccgggccgca	CRISPR spacer
cggacttgcggcaggccggccaccgggccgcg	Protospacer
* . * . *** ****** ************.

1718. spacer 30.2|4637791|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_LR594663 (Variovorax sp. RA8 plasmid 2) position: , mismatch: 9, identity: 0.719

gagggcagtcgatgatgatctcgtcgaactct	CRISPR spacer
tgccgtcgtagatgatgacctcgtcgaactcc	Protospacer
 .  *. ** ********.************.

1719. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP019237 (Rhodoferax koreense strain DCY-110 plasmid unnamed1) position: , mismatch: 9, identity: 0.719

cctcggggccggcggtgatcgccccggcccgc	CRISPR spacer
ttgcggcgtcggcggtgatcgccccggcttcg	Protospacer
.. *** *.*******************..  

1720. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP021405 (Celeribacter manganoxidans strain DY25 plasmid pDY25-A, complete sequence) position: , mismatch: 9, identity: 0.719

cctcggggccggcggtgatcgccccggcccgc	CRISPR spacer
ccagcacatcggcgatgatcgcctcggcccgc	Protospacer
**   . ..*****.********.********

1721. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP025613 (Niveispirillum cyanobacteriorum strain TH16 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

cctcggggccggcggtgatcgccccggcccgc	CRISPR spacer
tgccgaccccggcggtgattgcccaggcccgg	Protospacer
. .**.  ***********.**** ****** 

1722. spacer 30.6|4638035|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to MG945447 (UNVERIFIED: Microviridae sp. isolate 5964-1801, complete genome) position: , mismatch: 9, identity: 0.719

caacgtgctgttgtagttcagctcggcgttga	CRISPR spacer
ttctccgctgttgtagttcatcgcggcgttgt	Protospacer
.  . .************** * ******** 

1723. spacer 31.4|4642096|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to JQ680367 (Unidentified phage clone 2203_scaffold802 genomic sequence) position: , mismatch: 9, identity: 0.719

cggatcgcgtaggtgttgcgagccttcatccc	CRISPR spacer
tggatcgcgtaggtgttgcccgcctgtgccga	Protospacer
.******************  **** ...*  

1724. spacer 32.2|4652622|33|NC_018524|PILER-CR,CRT matches to NZ_CP031163 (Deinococcus wulumuqiensis strain NEB 479 plasmid pDrdI, complete sequence) position: , mismatch: 9, identity: 0.727

gttcgagttccagaccaaggagctcatcgccgc	CRISPR spacer
cgccctgcgccagaccaaggaggtcttcgccgc	Protospacer
  .*  *. ************* ** *******

1725. spacer 32.8|4652987|33|NC_018524|PILER-CR,CRT matches to NZ_AP018520 (Sphingobium sp. YG1 plasmid pYGP1, complete sequence) position: , mismatch: 9, identity: 0.727

gcagatcatccacgccctggacgaggccccctc	CRISPR spacer
cgggatcgtccacgccctgaacgaggccctgca	Protospacer
  .****.***********.*********. . 

1726. spacer 32.10|4653109|33|NC_018524|PILER-CR,CRT matches to CP021188 (Sphingomonas wittichii DC-6 plasmid pDC07, complete sequence) position: , mismatch: 9, identity: 0.727

gggcttccagctctcccgcgaacaactcggtgc	CRISPR spacer
cgccgtccagctctcccgcgacgaactcgacat	Protospacer
 * * ****************  ******....

1727. spacer 32.13|4653292|33|NC_018524|PILER-CR,CRT matches to NC_008242 (Chelativorans sp. BNC1 plasmid 1, complete sequence) position: , mismatch: 9, identity: 0.727

gtttcggtgggtgacgtgcacggcctcgacgtt	CRISPR spacer
ctcggcgtgggtggcgtgcagggcctcgacgac	Protospacer
 *.   *******.****** ********** .

1728. spacer 32.15|4652562|32|NC_018524|CRISPRCasFinder matches to NZ_CP021373 (Rhizobium sp. ACO-34A plasmid pRACO34Ac, complete sequence) position: , mismatch: 9, identity: 0.719

tctggacgatcgaccaggtcaccgagttcctg	CRISPR spacer
cctggacgctcgaccaggtcatcgcccgcccc	Protospacer
.******* ************.**  . **. 

1729. spacer 32.17|4652684|32|NC_018524|CRISPRCasFinder matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 9, identity: 0.719

cgctggaggactggtgccgctaccgcctagac	CRISPR spacer
ccgaggaggacgggttccgctaccgccagccc	Protospacer
*   ******* *** *********** .  *

1730. spacer 32.17|4652684|32|NC_018524|CRISPRCasFinder matches to NC_017273 (Thermus thermophilus SG0.5JP17-16 plasmid pTHTHE1601, complete sequence) position: , mismatch: 9, identity: 0.719

cgctggaggactggtgccgctaccgcctagac	CRISPR spacer
ccgaggaggacgggttccgctaccgccagccc	Protospacer
*   ******* *** *********** .  *

1731. spacer 32.17|4652684|32|NC_018524|CRISPRCasFinder matches to NZ_CP014142 (Thermus parvatiensis strain RL plasmid pTP143, complete sequence) position: , mismatch: 9, identity: 0.719

cgctggaggactggtgccgctaccgcctagac	CRISPR spacer
ccgaggaggacgggttccgctaccgccagccc	Protospacer
*   ******* *** *********** .  *

1732. spacer 32.17|4652684|32|NC_018524|CRISPRCasFinder matches to NC_005838 (Thermus thermophilus HB27 plasmid pTT27, complete sequence) position: , mismatch: 9, identity: 0.719

cgctggaggactggtgccgctaccgcctagac	CRISPR spacer
ccgaggaggacgggttccgctaccgccagccc	Protospacer
*   ******* *** *********** .  *

1733. spacer 32.17|4652684|32|NC_018524|CRISPRCasFinder matches to NZ_AP019802 (Thermus thermophilus strain HC11 plasmid pHC11, complete sequence) position: , mismatch: 9, identity: 0.719

cgctggaggactggtgccgctaccgcctagac	CRISPR spacer
ccgaggaggacgggttccgctaccgccagccc	Protospacer
*   ******* *** *********** .  *

1734. spacer 32.17|4652684|32|NC_018524|CRISPRCasFinder matches to NC_017588 (Thermus thermophilus JL-18 plasmid pTTJL1801, complete sequence) position: , mismatch: 9, identity: 0.719

cgctggaggactggtgccgctaccgcctagac	CRISPR spacer
ccgaggaggacgggttccgctaccgccagccc	Protospacer
*   ******* *** *********** .  *

1735. spacer 32.17|4652684|32|NC_018524|CRISPRCasFinder matches to NZ_AP019795 (Thermus thermophilus strain AA2-29 plasmid pAA229, complete sequence) position: , mismatch: 9, identity: 0.719

cgctggaggactggtgccgctaccgcctagac	CRISPR spacer
ccgaggaggacgggttccgctaccgccagccc	Protospacer
*   ******* *** *********** .  *

1736. spacer 32.17|4652684|32|NC_018524|CRISPRCasFinder matches to NZ_LR027520 (Thermus thermophilus isolate TTHNAR1 plasmid 4, complete sequence) position: , mismatch: 9, identity: 0.719

cgctggaggactggtgccgctaccgcctagac	CRISPR spacer
ccgaggaggacgggttccgctaccgccagccc	Protospacer
*   ******* *** *********** .  *

1737. spacer 32.17|4652684|32|NC_018524|CRISPRCasFinder matches to NZ_AP019793 (Thermus thermophilus strain AA2-20 plasmid pAA220, complete sequence) position: , mismatch: 9, identity: 0.719

cgctggaggactggtgccgctaccgcctagac	CRISPR spacer
ccgaggaggacgggttccgctaccgccagccc	Protospacer
*   ******* *** *********** .  *

1738. spacer 32.18|4652745|32|NC_018524|CRISPRCasFinder matches to NC_012848 (Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132501, complete sequence) position: , mismatch: 9, identity: 0.719

ctcatcgctgccatcttcgggtcggtgagtgg	CRISPR spacer
ggcgacgttgccatcttcaggtcggtgacggc	Protospacer
  *. **.**********.*********  * 

1739. spacer 32.21|4652927|32|NC_018524|CRISPRCasFinder matches to NZ_CP022991 (Paraburkholderia aromaticivorans strain BN5 plasmid pBN1, complete sequence) position: , mismatch: 9, identity: 0.719

gaggagcctcggtttcgggccggtcaggccct	CRISPR spacer
ctgccggctcggtttctgtccggtcaggccgc	Protospacer
  *  * ********* * *********** .

1740. spacer 32.21|4652927|32|NC_018524|CRISPRCasFinder matches to NZ_CP031116 (Rubrobacter indicoceani strain SCSIO 08198 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

gaggagcctcggtttcgggccggtcaggccct	CRISPR spacer
ttgcaagctcggtttcggggcggtcaagccag	Protospacer
  * *. ************ ******.***  

1741. spacer 32.22|4652988|32|NC_018524|CRISPRCasFinder matches to NZ_CP023549 (Rhodobacter sp. CZR27 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

cagatcatccacgccctggacgaggccccctc	CRISPR spacer
ttcatcacccacgacctggacgaggccatccg	Protospacer
.  ****.***** ************* .*. 

1742. spacer 32.22|4652988|32|NC_018524|CRISPRCasFinder matches to NZ_LR134452 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 10, complete sequence) position: , mismatch: 9, identity: 0.719

cagatcatccacgccctggacgaggccccctc	CRISPR spacer
aacctcatcgacggcctggacgaggccatcgt	Protospacer
 *  ***** *** ************* .* .

1743. spacer 32.22|4652988|32|NC_018524|CRISPRCasFinder matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 9, identity: 0.719

cagatcatccacgccctggacgaggccccctc	CRISPR spacer
ttcatcacccacgacctggacgaggcgatcgc	Protospacer
.  ****.***** ************  .* *

1744. spacer 32.22|4652988|32|NC_018524|CRISPRCasFinder matches to NZ_CP020372 (Candidatus Thiodictyon syntrophicum strain Cad16T plasmid pTs485, complete sequence) position: , mismatch: 9, identity: 0.719

cagatcatcc------acgccctggacgaggccccctc	CRISPR spacer
------atcctgctcgacggcctggacgaggcccccga	Protospacer
      ****      *** ****************  

1745. spacer 32.22|4652988|32|NC_018524|CRISPRCasFinder matches to KY092484 (Streptomyces phage Raleigh, complete genome) position: , mismatch: 9, identity: 0.719

cagatcatccacgccctggacgaggccccctc	CRISPR spacer
cggatcatccacgccctgtaccaggggagcgg	Protospacer
*.**************** ** ***    *  

1746. spacer 32.23|4653049|32|NC_018524|CRISPRCasFinder matches to MH153808 (Gordonia phage Petra, complete genome) position: , mismatch: 9, identity: 0.719

aacacgaagaacccgccgctggtcgttgacca	CRISPR spacer
gacacgaagaacccgccgcaggccgcgaagtt	Protospacer
.****************** **.**. .* . 

1747. spacer 32.23|4653049|32|NC_018524|CRISPRCasFinder matches to NC_031237 (Gordonia phage Obliviate, complete genome) position: , mismatch: 9, identity: 0.719

aacacgaagaacccgccgctggtcgttgacca	CRISPR spacer
gacacgaagaacccgccgcaggccgcgaagtt	Protospacer
.****************** **.**. .* . 

1748. spacer 32.24|4653110|32|NC_018524|CRISPRCasFinder matches to NZ_CP030772 (Streptomyces sp. YIM 121038 plasmid pSSP121038, complete sequence) position: , mismatch: 9, identity: 0.719

ggcttccagctctcccgcgaacaactcggtgc	CRISPR spacer
ctcacacagctcaccctcgaacaactcggacc	Protospacer
  * . ****** *** ************  *

1749. spacer 32.24|4653110|32|NC_018524|CRISPRCasFinder matches to NZ_CP030772 (Streptomyces sp. YIM 121038 plasmid pSSP121038, complete sequence) position: , mismatch: 9, identity: 0.719

ggcttccagctctcccgcgaacaactcggtgc	CRISPR spacer
ctcacacagctcaccctcgaacaactcggacc	Protospacer
  * . ****** *** ************  *

1750. spacer 32.25|4653171|32|NC_018524|CRISPRCasFinder matches to CP008701 (Klebsiella variicola strain Kp5-1 plasmid pKp5-1, complete sequence) position: , mismatch: 9, identity: 0.719

tccaggcc---gctggccggccggtggctctgccg	CRISPR spacer
---ggactggagctggccggccgctggctcagcca	Protospacer
   .*.*.   ************ ****** ***.

1751. spacer 32.25|4653171|32|NC_018524|CRISPRCasFinder matches to NZ_CP013986 (Klebsiella variicola strain LMG 23571 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

tccaggcc---gctggccggccggtggctctgccg	CRISPR spacer
---ggactggagctggccggccgctggctcagcca	Protospacer
   .*.*.   ************ ****** ***.

1752. spacer 32.27|4653293|32|NC_018524|CRISPRCasFinder matches to NC_024970 (Streptomyces aureofaciens strain CCM3239 plasmid pSA3239, complete sequence) position: , mismatch: 9, identity: 0.719

tttcggtgggtgacgtgcacggcctcgacgtt	CRISPR spacer
atctcgtgggtgacgtgcccggccacgaaggc	Protospacer
 *.. ************* ***** *** * .

1753. spacer 32.27|4653293|32|NC_018524|CRISPRCasFinder matches to NZ_KJ396772 (Streptomyces lavendulae subsp. lavendulae strain CCM3239 plasmid pSA3239, complete sequence) position: , mismatch: 9, identity: 0.719

tttcggtgggtgacgtgcacggcctcgacgtt	CRISPR spacer
atctcgtgggtgacgtgcccggccacgaaggc	Protospacer
 *.. ************* ***** *** * .

1754. spacer 32.27|4653293|32|NC_018524|CRISPRCasFinder matches to NZ_CP017322 (Xanthomonas campestris pv. campestris str. CN18 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.719

tttcggtgggtgacgtgcacggcctcgacgtt	CRISPR spacer
gcttgcagggtgacgtgcacggcctagccgaa	Protospacer
 .*.*  ****************** * **  

1755. spacer 32.27|4653293|32|NC_018524|CRISPRCasFinder matches to NZ_CP017324 (Xanthomonas campestris pv. campestris str. CN15 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

tttcggtgggtgacgtgcacggcctcgacgtt	CRISPR spacer
gcttgcagggtgacgtgcacggcctagccgaa	Protospacer
 .*.*  ****************** * **  

1756. spacer 32.27|4653293|32|NC_018524|CRISPRCasFinder matches to NZ_CP020887 (Xanthomonas citri pv. citri strain TX160149 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

tttcggtgggtgacgtgcacggcctcgacgtt	CRISPR spacer
gcttgcagggtgacgtgcacggcctagccgaa	Protospacer
 .*.*  ****************** * **  

1757. spacer 32.27|4653293|32|NC_018524|CRISPRCasFinder matches to NZ_CP031060 (Xanthomonas axonopodis pv. commiphoreae strain LMG26789 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

tttcggtgggtgacgtgcacggcctcgacgtt	CRISPR spacer
gcttgcagggtgacgtgcacggcctagccgaa	Protospacer
 .*.*  ****************** * **  

1758. spacer 32.27|4653293|32|NC_018524|CRISPRCasFinder matches to NZ_CP024986 (Streptomyces lavendulae subsp. lavendulae strain CCM 3239 plasmid pSA3239, complete sequence) position: , mismatch: 9, identity: 0.719

tttcggtgggtgacgtgcacggcctcgacgtt	CRISPR spacer
atctcgtgggtgacgtgcccggccacgaaggc	Protospacer
 *.. ************* ***** *** * .

1759. spacer 32.27|4653293|32|NC_018524|CRISPRCasFinder matches to NZ_CP017309 (Xanthomonas campestris pv. campestris str. CN03 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

tttcggtgggtgacgtgcacggcctcgacgtt	CRISPR spacer
gcttgcagggtgacgtgcacggcctagccgaa	Protospacer
 .*.*  ****************** * **  

1760. spacer 32.27|4653293|32|NC_018524|CRISPRCasFinder matches to AP019683 (Xanthomonas campestris pv. campestris MAFF106712 pXcc1 plasmid DNA, complete genome) position: , mismatch: 9, identity: 0.719

tttcggtgggtgacgtgcacggcctcgacgtt	CRISPR spacer
gcttgcagggtgacgtgcacggcctagccgaa	Protospacer
 .*.*  ****************** * **  

1761. spacer 32.29|4653415|32|NC_018524|CRISPRCasFinder matches to MT723933 (Streptomyces phage Keanu, complete genome) position: , mismatch: 9, identity: 0.719

cggcggtaccagaggcccgtgaattcggcggc	CRISPR spacer
cgcttgtaccacaggcccgtgtattcggactt	Protospacer
** . ****** ********* ******   .

1762. spacer 34.2|5116535|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP012383 (Streptomyces ambofaciens ATCC 23877 plasmid pSAM1, complete sequence) position: , mismatch: 9, identity: 0.719

acgatcgacacccgtaccggctggctgctgat	CRISPR spacer
gagatcgacacccggcccggctggcggaccgt	Protospacer
. ************  ********* * . .*

1763. spacer 34.2|5116535|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to KP792623 (Rhodoferax phage P26218, complete genome) position: , mismatch: 9, identity: 0.719

acgatcgacacccgtaccggctggctgctgat	CRISPR spacer
actcggtgcacccgtatccgctggctgctgac	Protospacer
**     .********.* ************.

1764. spacer 34.4|5116657|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013381 (Burkholderia sp. Bp5365 strain MSMB43 plasmid pMSMB43, complete sequence) position: , mismatch: 9, identity: 0.719

ccgggcgacgccgaggcggtgtggaacatccg	CRISPR spacer
gcgggcgacgccgacgcgctgtggtcgctgct	Protospacer
 ************* *** *****    * * 

1765. spacer 34.4|5116657|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

ccgggcgacgccgaggcggtgtggaacatccg	CRISPR spacer
gcgggcaacgccgaggcgttgtggcgcaagac	Protospacer
 *****.*********** ***** .**    

1766. spacer 34.4|5116657|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP009547 (Burkholderia sp. 2002721687 plasmid pBTU, complete sequence) position: , mismatch: 9, identity: 0.719

ccgggcgacgccgaggcggtgtggaacatccg	CRISPR spacer
gcgggcgacgccgacgcgctgtggtcgctgct	Protospacer
 ************* *** *****    * * 

1767. spacer 34.5|5116718|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP044976 (Hydrogenophaga sp. PBL-H3 substr. PBL-H3(B2) plasmid pPBL-H3_B2-1, complete sequence) position: , mismatch: 9, identity: 0.719

cttgccttcgagggcttcctcgatctcccggt	CRISPR spacer
gtccagatcgagggctgcctcgatctcgcgtt	Protospacer
 *.    ********* ********** ** *

1768. spacer 34.6|5116779|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_AP014686 (Bradyrhizobium diazoefficiens strain NK6 plasmid pNK6b, complete sequence) position: , mismatch: 9, identity: 0.719

ggaggcgctgctggaggccccggcagtctggg	CRISPR spacer
cgtctcgctgctggtggcctcggcagtcaatg	Protospacer
 *   ********* ****.******** . *

1769. spacer 34.6|5116779|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP049701 (Bradyrhizobium sp. 1S5 strain 323S2 plasmid pB323S2b, complete sequence) position: , mismatch: 9, identity: 0.719

ggaggcgctgctggaggccccggcagtctggg	CRISPR spacer
cgtctcgctgctggtggcctcggcagtcaatg	Protospacer
 *   ********* ****.******** . *

1770. spacer 34.10|5117024|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NC_015583 (Novosphingobium sp. PP1Y plasmid Mpl, complete sequence) position: , mismatch: 9, identity: 0.719

ggtggcgcaggcggccactccgggccagtggc	CRISPR spacer
tctggcgcaggcggtcacaccgggcttctcgg	Protospacer
  ************.*** ******.  * * 

1771. spacer 34.11|5117085|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NC_010335 (Caulobacter sp. K31 plasmid pCAUL01, complete sequence) position: , mismatch: 9, identity: 0.719

tttttcgccggcttgatctcatcctcgaagta	CRISPR spacer
cggatcgcctgcttgatctgatcctcgatctt	Protospacer
.   ***** ********* ********  * 

1772. spacer 35.7|5118659|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP006369 (Aureimonas sp. AU20 plasmid pAU20b, complete sequence) position: , mismatch: 9, identity: 0.719

ggtgacggtctcgcggatgacctcccgcacgg	CRISPR spacer
gaaataggtcttgcggatgacctcgcgcatcg	Protospacer
*. .  *****.************ ****. *

1773. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP026091 (Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggtgggct	Protospacer
  ********  **************.   . 

1774. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_014309 (Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome) position: , mismatch: 10, identity: 0.688

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggtgggct	Protospacer
  ********  **************.   . 

1775. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP021653 (Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggtgggct	Protospacer
  ********  **************.   . 

1776. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP026093 (Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggtgggct	Protospacer
  ********  **************.   . 

1777. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP021767 (Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggtgggct	Protospacer
  ********  **************.   . 

1778. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP012940 (Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggtgggct	Protospacer
  ********  **************.   . 

1779. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP012944 (Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggtgggct	Protospacer
  ********  **************.   . 

1780. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP012688 (Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggtgggct	Protospacer
  ********  **************.   . 

1781. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_017575 (Ralstonia solanacearum Po82 megaplasmid, complete sequence) position: , mismatch: 10, identity: 0.688

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggtgggct	Protospacer
  ********  **************.   . 

1782. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032341 (Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence) position: , mismatch: 10, identity: 0.688

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctgggcatcgccatcgtcggtggtct	Protospacer
  ******** **** **********.  .. 

1783. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP026308 (Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggtgggct	Protospacer
  ********  **************.   . 

1784. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP021765 (Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggtgggct	Protospacer
  ********  **************.   . 

1785. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to CP047139 (Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggtgggct	Protospacer
  ********  **************.   . 

1786. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP051295 (Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence) position: , mismatch: 10, identity: 0.688

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctggggatctccatcgtcggtgggct	Protospacer
  ********  **************.   . 

1787. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP012916 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence) position: , mismatch: 10, identity: 0.688

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
cagccgctgggcatcgccatcgtcggtggtct	Protospacer
  ******** **** **********.  .. 

1788. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_007766 (Rhizobium etli CFN 42 plasmid p42f, complete sequence) position: , mismatch: 10, identity: 0.688

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
gaaggcgaggtcatctccatcatcggctcctc	Protospacer
* .     **.**********.********* 

1789. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP020911 (Rhizobium etli strain NXC12 plasmid pRetNXC12e, complete sequence) position: , mismatch: 10, identity: 0.688

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
gaaggcgaggtcatctccatcatcggctcctc	Protospacer
* .     **.**********.********* 

1790. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_021911 (Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1f, complete sequence) position: , mismatch: 10, identity: 0.688

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
gaaggcgaggtcatctccatcatcggctcctc	Protospacer
* .     **.**********.********* 

1791. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013515 (Rhizobium sp. N1314 plasmid pRspN1314d, complete sequence) position: , mismatch: 10, identity: 0.688

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
gaaggcgaggtcatctccatcatcggctcctc	Protospacer
* .     **.**********.********* 

1792. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_022044 (Paracoccus aminophilus JCM 7686 plasmid pAMI6, complete sequence) position: , mismatch: 10, identity: 0.688

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
ctcgtgctggccatcgccaacgtcggctatct	Protospacer
 *  .********** *** ******** .. 

1793. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013605 (Rhizobium sp. N731 plasmid pRspN731d, complete sequence) position: , mismatch: 10, identity: 0.688

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
gaaggcgaggtcatctccatcatcggctcctc	Protospacer
* .     **.**********.********* 

1794. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to MG812490 (Mycobacterium phage Holeinone, complete genome) position: , mismatch: 10, identity: 0.688

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
ctgctgctggccaactccatcgtcaagctcgg	Protospacer
 ***.******** **********.. ..* .

1795. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to MH051249 (Mycobacterium phage Boyle, complete genome) position: , mismatch: 10, identity: 0.688

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
ctgctgctggccaactccatcgtcaagctcgg	Protospacer
 ***.******** **********.. ..* .

1796. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to MN428049 (Mycobacterium phage West99, complete genome) position: , mismatch: 10, identity: 0.688

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
ctgctgctggccaactccatcgtcaagctcgg	Protospacer
 ***.******** **********.. ..* .

1797. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to MN586045 (Mycobacterium phage Brownie5, complete genome) position: , mismatch: 10, identity: 0.688

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
ctgctgctggccaactccatcgtcaagctcgg	Protospacer
 ***.******** **********.. ..* .

1798. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to MH001452 (Mycobacterium phage Kheth, complete genome) position: , mismatch: 10, identity: 0.688

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
ctgctgctggccaactccatcgtcaagctcgg	Protospacer
 ***.******** **********.. ..* .

1799. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to MH697584 (Mycobacterium phage FrenchFry, complete genome) position: , mismatch: 10, identity: 0.688

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
ctgctgctggccaactccatcgtcaagctcgg	Protospacer
 ***.******** **********.. ..* .

1800. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to MN813678 (Mycobacterium phage Lephleur, complete genome) position: , mismatch: 10, identity: 0.688

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
ctgctgctggccaactccatcgtcaagctcgg	Protospacer
 ***.******** **********.. ..* .

1801. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to MG757162 (Mycobacterium phage Opia, complete genome) position: , mismatch: 10, identity: 0.688

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
ctgctgctggccaactccatcgtcaagctcgg	Protospacer
 ***.******** **********.. ..* .

1802. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to MK814751 (Mycobacterium phage Bananafish, complete genome) position: , mismatch: 10, identity: 0.688

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
ctgctgctggccaactccatcgtcaagctcgg	Protospacer
 ***.******** **********.. ..* .

1803. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to KT365402 (Mycobacterium phage Tres, complete genome) position: , mismatch: 10, identity: 0.688

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
ctgctgctggccaactccatcgtcaagctcgg	Protospacer
 ***.******** **********.. ..* .

1804. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to KM101117 (Mycobacterium phage LizLemon, complete genome) position: , mismatch: 10, identity: 0.688

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
ctgctgctggccaactccatcgtcaagctcgg	Protospacer
 ***.******** **********.. ..* .

1805. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to JN698991 (Mycobacterium phage Hedgerow, complete genome) position: , mismatch: 10, identity: 0.688

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
ctgctgctggccaactccatcgtcaagctcgg	Protospacer
 ***.******** **********.. ..* .

1806. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_043767 (Mycobacterium virus TA17a, complete genome) position: , mismatch: 10, identity: 0.688

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
ctgctgctggccaactccatcgtcaagctcgg	Protospacer
 ***.******** **********.. ..* .

1807. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to MN586046 (Mycobacterium phage Tinciduntsolum, complete genome) position: , mismatch: 10, identity: 0.688

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
ctgctgctggccaactccatcgtcaagctcgg	Protospacer
 ***.******** **********.. ..* .

1808. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to MK620898 (Mycobacterium phage Coffee, complete genome) position: , mismatch: 10, identity: 0.688

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
ctgctgctggccaactccatcgtcaagctcgg	Protospacer
 ***.******** **********.. ..* .

1809. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to JN699004 (Mycobacterium phage Ares, complete genome) position: , mismatch: 10, identity: 0.688

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
ctgctgctggccaactccatcgtcaagctcgg	Protospacer
 ***.******** **********.. ..* .

1810. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to MG812491 (Mycobacterium phage ItsyBitsy1, complete genome) position: , mismatch: 10, identity: 0.688

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
ctgctgctggccaactccatcgtcaagctcgg	Protospacer
 ***.******** **********.. ..* .

1811. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to DQ398048 (Mycobacterium phage Qyrzula, complete genome) position: , mismatch: 10, identity: 0.688

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
ctgctgctggccaactccatcgtcaagctcgg	Protospacer
 ***.******** **********.. ..* .

1812. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to KR997932 (Mycobacterium phage Godines, complete genome) position: , mismatch: 10, identity: 0.688

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
ctgctgctggccaactccatcgtcaagctcgg	Protospacer
 ***.******** **********.. ..* .

1813. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to AY129334 (Mycobacterium phage Rosebush, complete genome) position: , mismatch: 10, identity: 0.688

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
ctgctgctggccaactccatcgtcaagctcgg	Protospacer
 ***.******** **********.. ..* .

1814. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to MH590591 (Mycobacterium phage Sabella, complete genome) position: , mismatch: 10, identity: 0.688

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
ctgctgctggccaactccatcgtcaagctcgg	Protospacer
 ***.******** **********.. ..* .

1815. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to JN618996 (Mycobacterium phage Arbiter, complete genome) position: , mismatch: 10, identity: 0.688

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
ctgctgctggccaactccatcgtcaagctcgg	Protospacer
 ***.******** **********.. ..* .

1816. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to KX443696 (Mycobacterium phage Laurie, complete genome) position: , mismatch: 10, identity: 0.688

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
ctgctgctggccaactccatcgtcaagctcgg	Protospacer
 ***.******** **********.. ..* .

1817. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to MH727546 (Mycobacterium phage Eaglehorse, complete genome) position: , mismatch: 10, identity: 0.688

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
ctgctgctggccaactccatcgtcaagctcgg	Protospacer
 ***.******** **********.. ..* .

1818. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to MK061411 (Mycobacterium phage Faze9, complete genome) position: , mismatch: 10, identity: 0.688

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
ctgctgctggccaactccatcgtcaagctcgg	Protospacer
 ***.******** **********.. ..* .

1819. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to KT880194 (Mycobacterium phage Glass, complete genome) position: , mismatch: 10, identity: 0.688

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
ctgctgctggccaactccatcgtcaagctcgg	Protospacer
 ***.******** **********.. ..* .

1820. spacer 1.10|312180|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP009123 (Sphingopyxis fribergensis strain Kp5.2 plasmid pSfKp5.2, complete sequence) position: , mismatch: 10, identity: 0.688

taggcggcctcggcggtaaaggcgggggcgtc	CRISPR spacer
ccgccggcctcggcgttaagggcggggcaaat	Protospacer
. * *********** ***.*******  . .

1821. spacer 1.10|312180|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_009620 (Sinorhizobium medicae WSM419 plasmid pSMED01, complete sequence) position: , mismatch: 10, identity: 0.688

taggcggcctcggcggtaaaggcgggggcgtc	CRISPR spacer
cgggcggcctcggcggtatgggcggagcacag	Protospacer
..**************** .*****.*     

1822. spacer 1.11|312241|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_021347 (Rhodococcus phage E3, complete genome) position: , mismatch: 10, identity: 0.688

acggctgtaggtgcctccggggccggtgtcgt	CRISPR spacer
cgagtccgaggtgccgccggggctggtgtcgg	Protospacer
  .*..  ******* *******.******* 

1823. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 10, identity: 0.688

tcctccggcgcctcgtcggcgacgtcggcgac	CRISPR spacer
ctgcgcaccgcctcctcggtgacgtcggcgag	Protospacer
.. . *. ****** ****.*********** 

1824. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_LR134465 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 23, complete sequence) position: , mismatch: 10, identity: 0.688

tcctccggcgcctcgtcggcgacgtcggcgac	CRISPR spacer
ggcgtcgacgcctcgacggcgacgtcggtcgt	Protospacer
  * .**.******* ************. ..

1825. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP007129 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence) position: , mismatch: 10, identity: 0.688

tcctccggcgcctcgtcggcgacgtcggcgac	CRISPR spacer
cggcacggcgcctcctccgcgacgtcggtggg	Protospacer
.  . ********* ** **********.*. 

1826. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to KJ410133 (Mycobacterium phage Jolie2, complete genome) position: , mismatch: 10, identity: 0.688

tcctccggcgcctcgtcggcgacgtcggcgac	CRISPR spacer
ggtgtcggcgcctcatcggcgacgacggcctg	Protospacer
  . .*********.********* ****   

1827. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP012185 (Pseudonocardia sp. EC080619-01 plasmid pBCI1-2, complete sequence) position: , mismatch: 10, identity: 0.688

tcctccggcgcctcgtcggcgacgtcggcgac	CRISPR spacer
gagggcaccggctcgtcggcgccgtcggcgat	Protospacer
     *. ** ********** *********.

1828. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013531 (Rhizobium phaseoli strain R723 plasmid pRphaR723d, complete sequence) position: , mismatch: 10, identity: 0.688

tcctccggcgcctcgtcggcgacgtcggcgac	CRISPR spacer
aaatccggcccctcgtcggcggcgtctacccg	Protospacer
   ****** ***********.**** .*   

1829. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013541 (Rhizobium phaseoli strain R630 plasmid pRphaR630d, complete sequence) position: , mismatch: 10, identity: 0.688

tcctccggcgcctcgtcggcgacgtcggcgac	CRISPR spacer
aaatccggcccctcgtcggcggcgtctacccg	Protospacer
   ****** ***********.**** .*   

1830. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013584 (Rhizobium phaseoli strain N261 plasmid pRphaN261d, complete sequence) position: , mismatch: 10, identity: 0.688

tcctccggcgcctcgtcggcgacgtcggcgac	CRISPR spacer
aaatccggcccctcgtcggcggcgtctacccg	Protospacer
   ****** ***********.**** .*   

1831. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_013860 (Azospirillum sp. B510 plasmid pAB510f, complete sequence) position: , mismatch: 10, identity: 0.688

tcctccggcgcctcgtcggcgacgtcggcgac	CRISPR spacer
gtatggtccgcctcgtcggcgccgacggcgag	Protospacer
 . *    ************* ** ****** 

1832. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP054028 (Rhizobium sp. JKLM19E plasmid pPR19E01, complete sequence) position: , mismatch: 10, identity: 0.688

tcctccggcgcctcgtcggcgacgtcggcgac	CRISPR spacer
tgatccggcccctcgtcggcggcgtctatccg	Protospacer
*  ****** ***********.**** ..   

1833. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_AP014580 (Burkholderia sp. RPE67 plasmid p2, complete sequence) position: , mismatch: 10, identity: 0.688

tcctccggcgcctcgtcggcgacgtcggcgac	CRISPR spacer
ggcctgcgcgcctcgtcggcgacgacagcgtt	Protospacer
  *..  ***************** *.*** .

1834. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP054615 (Azospirillum oryzae strain KACC 14407 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.688

tcctccggcgcctcgtcggcgacgtcggcgac	CRISPR spacer
gtatggtccgcctcgtcggcgccgacggcgag	Protospacer
 . *    ************* ** ****** 

1835. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP012182 (Pseudonocardia sp. EC080610-09 plasmid pBCI2-1, complete sequence) position: , mismatch: 10, identity: 0.688

tcctccggcgcctcgtcggcgacgtcggcgac	CRISPR spacer
gagggcaccggctcgtcggcgccgtcggcgat	Protospacer
     *. ** ********** *********.

1836. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP039644 (Azospirillum sp. TSA2s plasmid p2, complete sequence) position: , mismatch: 10, identity: 0.688

tcctccggcgcctcgtcggcgacgtcggcgac	CRISPR spacer
gtatggtccgcctcgtcggcgccgacggcgag	Protospacer
 . *    ************* ** ****** 

1837. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP039640 (Azospirillum sp. TSH100 plasmid p1, complete sequence) position: , mismatch: 10, identity: 0.688

tcctccggcgcctcgtcggcgacgtcggcgac	CRISPR spacer
gtatggtccgcctcgtcggcgccgacggcgag	Protospacer
 . *    ************* ** ****** 

1838. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_016588 (Azospirillum lipoferum 4B plasmid AZO_p6, complete sequence) position: , mismatch: 10, identity: 0.688

tcctccggcgcctcgtcggcgacgtcggcgac	CRISPR spacer
gtatggtccgcctcgtcggcgccgacggcgag	Protospacer
 . *    ************* ** ****** 

1839. spacer 2.4|313399|32|NC_018524|CRISPRCasFinder matches to NZ_CP026091 (Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

cacaccaccccggcctggccacggccggcgtc	CRISPR spacer
tgatggaagccggcctggccacggcctgcttc	Protospacer
..    *  ***************** ** **

1840. spacer 2.4|313399|32|NC_018524|CRISPRCasFinder matches to NC_014309 (Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome) position: , mismatch: 10, identity: 0.688

cacaccaccccggcctggccacggccggcgtc	CRISPR spacer
tgatggaagccggcctggccacggcctgcttc	Protospacer
..    *  ***************** ** **

1841. spacer 2.4|313399|32|NC_018524|CRISPRCasFinder matches to NZ_CP026093 (Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

cacaccaccccggcctggccacggccggcgtc	CRISPR spacer
tgatggaagccggcctggccacggcctgcttc	Protospacer
..    *  ***************** ** **

1842. spacer 2.4|313399|32|NC_018524|CRISPRCasFinder matches to NZ_CP021767 (Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

cacaccaccccggcctggccacggccggcgtc	CRISPR spacer
tgatggaagccggcctggccacggcctgcttc	Protospacer
..    *  ***************** ** **

1843. spacer 2.4|313399|32|NC_018524|CRISPRCasFinder matches to NZ_CP040821 (Paraoceanicella profunda strain D4M1 plasmid pD4M1C, complete sequence) position: , mismatch: 10, identity: 0.688

cacaccaccccggcctggccacggccggcgtc	CRISPR spacer
gtggacgccccggcctggccccggcaggcgct	Protospacer
   . *.************* **** ****..

1844. spacer 2.4|313399|32|NC_018524|CRISPRCasFinder matches to NZ_CP022482 (Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence) position: , mismatch: 10, identity: 0.688

cacaccaccccggcctggccacggccggcgtc	CRISPR spacer
tgtgcggcccgggcctggcgacggccggcgga	Protospacer
....* .*** ******** **********  

1845. spacer 2.8|313399|33|NC_018524|CRT matches to NC_014309 (Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome) position: , mismatch: 10, identity: 0.697

cacaccaccccggcctggccacggccggcgtcg	CRISPR spacer
tgatggaagccggcctggccacggcctgcttcg	Protospacer
..    *  ***************** ** ***

1846. spacer 2.8|313399|33|NC_018524|CRT matches to NZ_CP021767 (Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.697

cacaccaccccggcctggccacggccggcgtcg	CRISPR spacer
tgatggaagccggcctggccacggcctgcttcg	Protospacer
..    *  ***************** ** ***

1847. spacer 2.8|313399|33|NC_018524|CRT matches to NZ_CP026091 (Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.697

cacaccaccccggcctggccacggccggcgtcg	CRISPR spacer
tgatggaagccggcctggccacggcctgcttcg	Protospacer
..    *  ***************** ** ***

1848. spacer 2.8|313399|33|NC_018524|CRT matches to NZ_CP026093 (Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.697

cacaccaccccggcctggccacggccggcgtcg	CRISPR spacer
tgatggaagccggcctggccacggcctgcttcg	Protospacer
..    *  ***************** ** ***

1849. spacer 3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NC_013284 (Cronobacter turicensis z3032 plasmid pCTU2, complete sequence) position: , mismatch: 10, identity: 0.688

atgaccgcccatttcgccgaccggctcgccgc	CRISPR spacer
gttgataaccatttctccgaccggttcgccgg	Protospacer
.* . .. ******* ********.****** 

1850. spacer 3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP019585 (Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymA, complete sequence) position: , mismatch: 10, identity: 0.688

atgaccgcccatttcgccgaccggctcgccgc	CRISPR spacer
gaagtcgcccatctcgccgaccagctcggcat	Protospacer
. ...*******.*********.***** *..

1851. spacer 3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NC_017327 (Sinorhizobium meliloti SM11 plasmid pSmeSM11c, complete sequence) position: , mismatch: 10, identity: 0.688

atgaccgcccatttcgccgaccggctcgccgc	CRISPR spacer
gaagtcgcccatctcgccgaccagctcggcat	Protospacer
. ...*******.*********.***** *..

1852. spacer 3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NC_017324 (Sinorhizobium meliloti BL225C plasmid pSINMEB01, complete sequence) position: , mismatch: 10, identity: 0.688

atgaccgcccatttcgccgaccggctcgccgc	CRISPR spacer
gaagtcgcccatctcgccgaccagctcggcat	Protospacer
. ...*******.*********.***** *..

1853. spacer 3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP009145 (Sinorhizobium meliloti strain RMO17 plasmid pSymA, complete sequence) position: , mismatch: 10, identity: 0.688

atgaccgcccatttcgccgaccggctcgccgc	CRISPR spacer
gaagtcgcccatctcgccgaccagctcggcat	Protospacer
. ...*******.*********.***** *..

1854. spacer 3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NC_015597 (Sinorhizobium meliloti AK83 plasmid pSINME01, complete sequence) position: , mismatch: 10, identity: 0.688

atgaccgcccatttcgccgaccggctcgccgc	CRISPR spacer
gaagtcgcccatctcgccgaccagctcggcat	Protospacer
. ...*******.*********.***** *..

1855. spacer 3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP026388 (Leclercia sp. LSNIH3 plasmid pLEC-2975, complete sequence) position: , mismatch: 10, identity: 0.688

atgaccgcccatttcgccgaccggctcgccgc	CRISPR spacer
gttgataaccattttgccgaccggttcgccgg	Protospacer
.* . .. ******.*********.****** 

1856. spacer 3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP021827 (Sinorhizobium meliloti strain KH35c plasmid psymA, complete sequence) position: , mismatch: 10, identity: 0.688

atgaccgcccatttcgccgaccggctcgccgc	CRISPR spacer
gaagtcgcccatctcgccgaccagctcggcat	Protospacer
. ...*******.*********.***** *..

1857. spacer 3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP015881 (Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence) position: , mismatch: 10, identity: 0.688

atgaccgcccatttcgccgaccggctcgccgc	CRISPR spacer
cgggtcgcccatgtcgccaaccggctcggtta	Protospacer
  *..******* *****.********* .  

1858. spacer 3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP015882 (Ensifer adhaerens strain Casida A plasmid pCasidaAB, complete sequence) position: , mismatch: 10, identity: 0.688

atgaccgcccatttcgccgaccggctcgccgc	CRISPR spacer
gaagtcgcccatctcgccgaccagctcggcat	Protospacer
. ...*******.*********.***** *..

1859. spacer 3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP030264 (Ensifer adhaerens strain Corn53 plasmid AB, complete sequence) position: , mismatch: 10, identity: 0.688

atgaccgcccatttcgccgaccggctcgccgc	CRISPR spacer
gaagtcgcccatctcgccgaccagctcggcat	Protospacer
. ...*******.*********.***** *..

1860. spacer 3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP021801 (Sinorhizobium meliloti strain USDA1021 plasmid psymA, complete sequence) position: , mismatch: 10, identity: 0.688

atgaccgcccatttcgccgaccggctcgccgc	CRISPR spacer
gaagtcgcccatctcgccgaccagctcggcat	Protospacer
. ...*******.*********.***** *..

1861. spacer 3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP021819 (Sinorhizobium meliloti strain M162 plasmid psymA, complete sequence) position: , mismatch: 10, identity: 0.688

atgaccgcccatttcgccgaccggctcgccgc	CRISPR spacer
gaagtcgcccatctcgccgaccagctcggcat	Protospacer
. ...*******.*********.***** *..

1862. spacer 3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP021830 (Sinorhizobium meliloti strain HM006 plasmid psymA, complete sequence) position: , mismatch: 10, identity: 0.688

atgaccgcccatttcgccgaccggctcgccgc	CRISPR spacer
gaagtcgcccatctcgccgaccagctcggcat	Protospacer
. ...*******.*********.***** *..

1863. spacer 3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP021824 (Sinorhizobium meliloti strain KH46 plasmid psymA, complete sequence) position: , mismatch: 10, identity: 0.688

atgaccgcccatttcgccgaccggctcgccgc	CRISPR spacer
gaagtcgcccatctcgccgaccagctcggcat	Protospacer
. ...*******.*********.***** *..

1864. spacer 3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP021813 (Sinorhizobium meliloti strain M270 plasmid psymA, complete sequence) position: , mismatch: 10, identity: 0.688

atgaccgcccatttcgccgaccggctcgccgc	CRISPR spacer
gaagtcgcccatctcgccgaccagctcggcat	Protospacer
. ...*******.*********.***** *..

1865. spacer 3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NC_018683 (Sinorhizobium meliloti Rm41 plasmid pSYMA, complete sequence) position: , mismatch: 10, identity: 0.688

atgaccgcccatttcgccgaccggctcgccgc	CRISPR spacer
gaagtcgcccatctcgccgaccagctcggcat	Protospacer
. ...*******.*********.***** *..

1866. spacer 3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP021794 (Sinorhizobium meliloti strain USDA1157 plasmid psymA, complete sequence) position: , mismatch: 10, identity: 0.688

atgaccgcccatttcgccgaccggctcgccgc	CRISPR spacer
gaagtcgcccatctcgccgaccagctcggcat	Protospacer
. ...*******.*********.***** *..

1867. spacer 3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP021809 (Sinorhizobium meliloti strain Rm41 plasmid psymA, complete sequence) position: , mismatch: 10, identity: 0.688

atgaccgcccatttcgccgaccggctcgccgc	CRISPR spacer
gaagtcgcccatctcgccgaccagctcggcat	Protospacer
. ...*******.*********.***** *..

1868. spacer 3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP021217 (Sinorhizobium meliloti RU11/001 plasmid pSymA, complete sequence) position: , mismatch: 10, identity: 0.688

atgaccgcccatttcgccgaccggctcgccgc	CRISPR spacer
gaagtcgcccatctcgccgaccagctcggcat	Protospacer
. ...*******.*********.***** *..

1869. spacer 3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP026526 (Sinorhizobium meliloti strain AK21 plasmid pSymA, complete sequence) position: , mismatch: 10, identity: 0.688

atgaccgcccatttcgccgaccggctcgccgc	CRISPR spacer
gaagtcgcccatctcgccgaccagctcggcat	Protospacer
. ...*******.*********.***** *..

1870. spacer 3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NC_009779 (Cronobacter sakazakii ATCC BAA-894 plasmid pESA2, complete sequence) position: , mismatch: 10, identity: 0.688

atgaccgcccatttcgccgaccggctcgccgc	CRISPR spacer
gttgataaccatttctccgaccggttcgccgg	Protospacer
.* . .. ******* ********.****** 

1871. spacer 3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP019483 (Sinorhizobium meliloti strain B401 plasmid pSymA, complete sequence) position: , mismatch: 10, identity: 0.688

atgaccgcccatttcgccgaccggctcgccgc	CRISPR spacer
gaagtcgcccatctcgccgaccagctcggcat	Protospacer
. ...*******.*********.***** *..

1872. spacer 3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP019486 (Sinorhizobium meliloti strain B399 plasmid pSymA, complete sequence) position: , mismatch: 10, identity: 0.688

atgaccgcccatttcgccgaccggctcgccgc	CRISPR spacer
gaagtcgcccatctcgccgaccagctcggcat	Protospacer
. ...*******.*********.***** *..

1873. spacer 3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP029232 (Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence) position: , mismatch: 10, identity: 0.688

atgaccgcccatttcgccgaccggctcgccgc	CRISPR spacer
gaagctttccatctcgccgaccggatcgccgt	Protospacer
. ..*. .****.*********** ******.

1874. spacer 3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MN823994 (Leclercia adecarboxylata strain 150707804 plasmid p707804-2FII, complete sequence) position: , mismatch: 10, identity: 0.688

atgaccgcccatttcgccgaccggctcgccgc	CRISPR spacer
gttgataaccattttgccgaccggttcgccgg	Protospacer
.* . .. ******.*********.****** 

1875. spacer 3.7|318883|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP019603 (Croceicoccus marinus strain E4A9 plasmid pCME4A9I, complete sequence) position: , mismatch: 10, identity: 0.688

gaccctgcccctccgcgccgcccttcatcagg	CRISPR spacer
agcagcgcgccgccgcgccgcccttcatcgtc	Protospacer
..*  .** ** *****************.  

1876. spacer 3.9|319005|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LR594663 (Variovorax sp. RA8 plasmid 2) position: , mismatch: 10, identity: 0.688

cagagagagctggtccgcgcacagggcgcagc	CRISPR spacer
accggcaagctggtcagcgcatagggcgcatg	Protospacer
   .* .******** *****.********  

1877. spacer 3.12|319187|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 10, identity: 0.688

tggggtggccaccgggaccccctcctggccgt	CRISPR spacer
aaaccttgccacgggaaccccctcctggccaa	Protospacer
 ..  * ***** **.**************. 

1878. spacer 4.7|321736|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP034352 (Streptomyces sp. W1SF4 plasmid p2, complete sequence) position: , mismatch: 10, identity: 0.688

ttgttcgccgccgaggccacggcatccgccaa	CRISPR spacer
gccgtcgccgtcgaggccacggcctccctgga	Protospacer
 .  ******.************ *** . .*

1879. spacer 4.7|321736|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP032343 (Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence) position: , mismatch: 10, identity: 0.688

ttgttcgccgccgaggccacggcatccgccaa	CRISPR spacer
gcgccgcgcgccgcggccacggcctccgccac	Protospacer
 .*..   ***** ********* ******* 

1880. spacer 4.7|321736|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP012917 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence) position: , mismatch: 10, identity: 0.688

ttgttcgccgccgaggccacggcatccgccaa	CRISPR spacer
gcgccgcgcgccgcggccacggcctccgccac	Protospacer
 .*..   ***** ********* ******* 

1881. spacer 4.7|321736|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP045548 (Streptomyces sp. SYP-A7193 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.688

ttgttcgccgccgaggccacggcatccgccaa	CRISPR spacer
caggccgccgcccagcccacggcatccgttcc	Protospacer
. * .******* ** ************..  

1882. spacer 4.9|321858|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP030772 (Streptomyces sp. YIM 121038 plasmid pSSP121038, complete sequence) position: , mismatch: 10, identity: 0.688

ggggtgcggccgggggtgccggtgtcgggggt	CRISPR spacer
tcggtgcggccggcggtgccggagtactgacg	Protospacer
  *********** ******** **   *.  

1883. spacer 4.9|321858|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP030772 (Streptomyces sp. YIM 121038 plasmid pSSP121038, complete sequence) position: , mismatch: 10, identity: 0.688

ggggtgcggccgggggtgccggtgtcgggggt	CRISPR spacer
tcggtgcggccggcggtgccggagtactgacg	Protospacer
  *********** ******** **   *.  

1884. spacer 4.9|321858|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP030772 (Streptomyces sp. YIM 121038 plasmid pSSP121038, complete sequence) position: , mismatch: 10, identity: 0.688

ggggtgcggccgggggtgccggtgtcgggggt	CRISPR spacer
tcggtgcggccggcggtgccggagtactgacg	Protospacer
  *********** ******** **   *.  

1885. spacer 4.9|321858|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP030772 (Streptomyces sp. YIM 121038 plasmid pSSP121038, complete sequence) position: , mismatch: 10, identity: 0.688

ggggtgcggccgggggtgccggtgtcgggggt	CRISPR spacer
tcggtgcggccggcggtgccggagtactgacg	Protospacer
  *********** ******** **   *.  

1886. spacer 4.9|321858|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP030772 (Streptomyces sp. YIM 121038 plasmid pSSP121038, complete sequence) position: , mismatch: 10, identity: 0.688

ggggtgcggccgggggtgccggtgtcgggggt	CRISPR spacer
tcggtgcggccggcggtgccggagtactgacg	Protospacer
  *********** ******** **   *.  

1887. spacer 4.9|321858|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP015090 (Pelagibaca abyssi strain JLT2014 plasmid pPABY2, complete sequence) position: , mismatch: 10, identity: 0.688

ggggtgcggccgggggtgccggtgtcgggggt	CRISPR spacer
ccacgccgggcgggggtggcggtgtcgggttt	Protospacer
  .   *** ******** **********  *

1888. spacer 4.9|321858|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP013739 (Streptomyces globisporus C-1027 plasmid SGLP1, complete sequence) position: , mismatch: 10, identity: 0.688

ggggtgcggccgggggtgccggtgtcgggggt	CRISPR spacer
tcgaagcggacggaggtgccggtgtcggtttc	Protospacer
  *. **** ***.**************   .

1889. spacer 4.19|321736|33|NC_018524|PILER-CR matches to NZ_CP020041 (Streptomyces sp. 3211 isolate 3 plasmid p3211-2, complete sequence) position: , mismatch: 10, identity: 0.697

ttgttcgccgccgaggccacggcatccgccaaa	CRISPR spacer
agccccgccgccgaggcccctgcatccgccctg	Protospacer
   ..************* * *********  .

1890. spacer 4.19|321736|33|NC_018524|PILER-CR matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.697

ttgttcgccgccgaggccacggcatccgccaaa	CRISPR spacer
tccggcgccgccgaggccacggcggccgcgccg	Protospacer
*.   ******************. ****   .

1891. spacer 4.19|321736|33|NC_018524|PILER-CR matches to NZ_CP050083 (Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b3, complete sequence) position: , mismatch: 10, identity: 0.697

ttgttcgccgccgaggccacggcatccgccaaa	CRISPR spacer
ccgttcgccgccgatggcacggcatcgaagagc	Protospacer
..************ * ********* .  *. 

1892. spacer 4.19|321736|33|NC_018524|PILER-CR matches to NZ_CP049733 (Rhizobium leguminosarum strain A1 plasmid pRL10, complete sequence) position: , mismatch: 10, identity: 0.697

ttgttcgccgccgaggccacggcatccgccaaa	CRISPR spacer
ccgttcgccgccgatggcacggcatcgaagagc	Protospacer
..************ * ********* .  *. 

1893. spacer 4.19|321736|33|NC_018524|PILER-CR matches to CP054917 (Streptomyces sp. NA02950 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.697

ttgttcgccgccgaggccacggcatccgccaaa	CRISPR spacer
gcgaccgccgccgaggcccccgcatccgcgggc	Protospacer
 .* .************* * ******** .. 

1894. spacer 4.19|321736|33|NC_018524|PILER-CR matches to NZ_CP053207 (Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1C, complete sequence) position: , mismatch: 10, identity: 0.697

ttgttcgccgccgaggccacggcatccgccaaa	CRISPR spacer
ccgttcgccgccgatggcacggcatcgaagagc	Protospacer
..************ * ********* .  *. 

1895. spacer 4.20|321797|33|NC_018524|PILER-CR matches to CP011998 (Ralstonia solanacearum strain YC45 plasmid, complete sequence) position: , mismatch: 10, identity: 0.697

gaacttggtggtgttgatgaccacggtgtttcc	CRISPR spacer
cacgctgctggtggtgatgaccacggtgtcgtt	Protospacer
 *  .** ***** ***************. ..

1896. spacer 5.2|326593|32|NC_018524|CRISPRCasFinder matches to NC_009040 (Rhodobacter sphaeroides ATCC 17029 plasmid pRSPH01, complete sequence) position: , mismatch: 10, identity: 0.688

ccacaaggccccgcccccgaaaggggcggggc	CRISPR spacer
gtctccggccccgcccccggagggggcggcgg	Protospacer
 . .  *************.*.******* * 

1897. spacer 5.2|326593|32|NC_018524|CRISPRCasFinder matches to NZ_CP034186 (Deinococcus sp. S14-83 strain S14-83T plasmid unnamed2, complete sequence) position: , mismatch: 10, identity: 0.688

ccacaaggccccgcccccgaaaggggcggggc	CRISPR spacer
tgccgccgccccgcccacgaaagcggcgggca	Protospacer
.  *.  ********* ****** ******  

1898. spacer 5.13|326594|32|NC_018524|PILER-CR matches to NC_009040 (Rhodobacter sphaeroides ATCC 17029 plasmid pRSPH01, complete sequence) position: , mismatch: 10, identity: 0.688

ccacaaggccccgcccccgaaaggggcggggc	CRISPR spacer
gtctccggccccgcccccggagggggcggcgg	Protospacer
 . .  *************.*.******* * 

1899. spacer 5.13|326594|32|NC_018524|PILER-CR matches to NZ_CP034186 (Deinococcus sp. S14-83 strain S14-83T plasmid unnamed2, complete sequence) position: , mismatch: 10, identity: 0.688

ccacaaggccccgcccccgaaaggggcggggc	CRISPR spacer
tgccgccgccccgcccacgaaagcggcgggca	Protospacer
.  *.  ********* ****** ******  

1900. spacer 11.2|2251085|32|NC_018524|PILER-CR,CRT matches to NZ_CP016452 (Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence) position: , mismatch: 10, identity: 0.688

gagggcagcctcgaaccgacctgggtgtgctt	CRISPR spacer
gcaagcagcgtcgaaccgaccagggtgccggc	Protospacer
* ..***** *********** *****.   .

1901. spacer 11.3|2251146|32|NC_018524|PILER-CR,CRT matches to NC_022995 (Burkholderia sp. M701 plasmid pM7012 DNA, complete sequence) position: , mismatch: 10, identity: 0.688

cgcggcggcgcctgcgcgacctgctcaacgag	CRISPR spacer
aatatcgtcgcctgcgcaacctgctcaatgcc	Protospacer
 ... ** *********.**********.*  

1902. spacer 11.3|2251146|32|NC_018524|PILER-CR,CRT matches to MG812496 (Gordonia phage SallySpecial, complete genome) position: , mismatch: 10, identity: 0.688

cgcggcggcgcctgcgcgacctgctcaacgag	CRISPR spacer
ccacctggcgcctgccctacctgctcaactcc	Protospacer
*    .********* * ***********   

1903. spacer 11.4|2251207|32|NC_018524|PILER-CR,CRT matches to NZ_CP046321 (Gordonia bronchialis strain FDAARGOS_676 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.688

gccacgatcgaccggtgcgcctcggtctctcg	CRISPR spacer
cgcccgatcggccgttgcgcctcggtcaggtc	Protospacer
  * ******.*** ************   . 

1904. spacer 11.4|2251207|32|NC_018524|PILER-CR,CRT matches to NC_013442 (Gordonia bronchialis DSM 43247 plasmid pGBRO01, complete sequence) position: , mismatch: 10, identity: 0.688

gccacgatcgaccggtgcgcctcggtctctcg	CRISPR spacer
cgcccgatcggccgttgcgcctcggtcaggtc	Protospacer
  * ******.*** ************   . 

1905. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP022775 (Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
ctctggcggatggcgtcgccggcagcggtgta	Protospacer
 . **************** *** **. .* .

1906. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NC_010580 (Beijerinckia indica subsp. indica ATCC 9039 plasmid pBIND01, complete sequence) position: , mismatch: 10, identity: 0.688

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
tcgtcgcggatggtgtcgcgggccttgtcagt	Protospacer
 *** ********.********** ...*.. 

1907. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NC_013858 (Azospirillum sp. B510 plasmid pAB510d, complete sequence) position: , mismatch: 10, identity: 0.688

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
tgatggcggatggcggcgcggtccgccggctg	Protospacer
  .************ ***** ****     *

1908. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP054621 (Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence) position: , mismatch: 10, identity: 0.688

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
gcgtggcggaaggcgtcgcgcgcctcggtcca	Protospacer
.********* ********* *** *. .  .

1909. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP022764 (Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
ctctggcggatggcgtcgccggcagcggtgta	Protospacer
 . **************** *** **. .* .

1910. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP022797 (Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
ctctggcggatggcgtcgccggcagcggtgta	Protospacer
 . **************** *** **. .* .

1911. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to NZ_CP022758 (Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
ctctggcggatggcgtcgccggcagcggtgta	Protospacer
 . **************** *** **. .* .

1912. spacer 11.6|2251329|32|NC_018524|PILER-CR,CRT matches to AB916497 (Ralstonia phage RS138 DNA, complete genome) position: , mismatch: 10, identity: 0.688

acgtggcggatggcgtcgcgggccgcaccgag	CRISPR spacer
ctctggcggatggcgtcgccggcagcggtgta	Protospacer
 . **************** *** **. .* .

1913. spacer 11.8|2251452|32|NC_018524|PILER-CR,CRT matches to NZ_CP021915 (Sagittula sp. P11 plasmid unnamed2, complete sequence) position: , mismatch: 10, identity: 0.688

cagtgtgggcaggagattaccgagatcggcgt	CRISPR spacer
gacgtccagcaggcgatcaccgagatcggcga	Protospacer
 *   . .***** ***.************* 

1914. spacer 11.8|2251452|32|NC_018524|PILER-CR,CRT matches to NZ_CP018081 (Sulfitobacter sp. AM1-D1 plasmid unnamed5, complete sequence) position: , mismatch: 10, identity: 0.688

cagtgtgggcaggagattaccgagatcggcgt	CRISPR spacer
gacgtccagcaggcgatcaccgagatcggcga	Protospacer
 *   . .***** ***.************* 

1915. spacer 15.1|2270337|32|NC_018524|CRISPRCasFinder matches to MN693668 (Marine virus AFVG_250M1112, complete genome) position: , mismatch: 10, identity: 0.688

ggctcgttgaaggcgatcgtgtactcgttgga	CRISPR spacer
cgggcgttgaaggcgcgcgtgtactcgccctc	Protospacer
 *  ***********  **********..   

1916. spacer 19.5|4409022|32|NC_018524|CRT matches to NC_016626 (Burkholderia sp. YI23 plasmid byi_1p, complete sequence) position: , mismatch: 10, identity: 0.688

ttccaccaccgcgccgagcgcgaacgggagcg	CRISPR spacer
gcgctggctcgcgccgagcgcgatcgcgagcg	Protospacer
 . *    .************** ** *****

1917. spacer 19.5|4409022|32|NC_018524|CRT matches to NZ_CP023408 (Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence) position: , mismatch: 10, identity: 0.688

ttccaccaccgcgccgagcgcgaacgggagcg	CRISPR spacer
gagcaccaccgcgccgaccgcgtacgcgtcac	Protospacer
   ************** **** *** *    

1918. spacer 19.5|4409022|32|NC_018524|CRT matches to NZ_CP016617 (Microvirga ossetica strain V5/3m plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.688

ttccaccaccgcgccgagcgcgaacgggagcg	CRISPR spacer
gccggatgccgcgccgagcgcgagcgcgagct	Protospacer
 .* . ..***************.** **** 

1919. spacer 21.5|4582418|33|NC_018524|PILER-CR matches to NC_014825 (Ruminococcus albus 7 = DSM 20455 plasmid pRUMAL02, complete sequence) position: , mismatch: 10, identity: 0.697

tctgtgggcttgaccagcaggcccttgaagatc	CRISPR spacer
ttcttgggcttgtccagcaggctcttgacctct	Protospacer
*.. ******** *********.*****   ..

1920. spacer 21.7|4582540|33|NC_018524|PILER-CR matches to NZ_CP049319 (Caballeronia sp. SBC2 plasmid pSBC2-3, complete sequence) position: , mismatch: 10, identity: 0.697

tgtcgagtgccgtggcctcacggtcgtcggcga	CRISPR spacer
gaccgagtgcagtggcctcacggtcgttcaatg	Protospacer
 ..******* ****************. .  .

1921. spacer 21.12|4582845|33|NC_018524|PILER-CR matches to MT723940 (Mycobacterium phage Ellie, complete genome) position: , mismatch: 10, identity: 0.697

ggaacgacggccgggtcgtcgtggtcctggccg	CRISPR spacer
atgtcgacggcctggtcgtcgtcgtcctgcatc	Protospacer
. . ******** ********* ******  . 

1922. spacer 21.12|4582845|33|NC_018524|PILER-CR matches to NC_019959 (Mycobacterium sp. JS623 plasmid pMYCSM03, complete sequence) position: , mismatch: 10, identity: 0.697

-------ggaacgacggccgggtcgtcgtggtcctggccg	CRISPR spacer
tcctgctg-------ggcctggtcgtcgcggtcctggcca	Protospacer
       *       **** ********.**********.

1923. spacer 21.18|4582419|32|NC_018524|CRISPRCasFinder,CRT matches to NC_014825 (Ruminococcus albus 7 = DSM 20455 plasmid pRUMAL02, complete sequence) position: , mismatch: 10, identity: 0.688

ctgtgggcttgaccagcaggcccttgaagatc	CRISPR spacer
tcttgggcttgtccagcaggctcttgacctct	Protospacer
.. ******** *********.*****   ..

1924. spacer 21.18|4582419|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP032928 (Agrobacterium tumefaciens strain 1D1460 plasmid pAt1D1460, complete sequence) position: , mismatch: 10, identity: 0.688

ctgtgggcttgaccagcaggcccttgaagatc	CRISPR spacer
gataggtcttgtccagcaggcccttgatcggc	Protospacer
    ** **** ***************  . *

1925. spacer 21.19|4582480|32|NC_018524|CRISPRCasFinder,CRT matches to MF417883 (Uncultured Caudovirales phage clone 7F_11, partial genome) position: , mismatch: 10, identity: 0.688

aacttctccagctccttgtgagcgctctcccg	CRISPR spacer
gccgcctccagctccttgtccgcgctcttgta	Protospacer
. * .**************  *******. ..

1926. spacer 21.19|4582480|32|NC_018524|CRISPRCasFinder,CRT matches to MF417938 (Uncultured Caudovirales phage clone 9AX_4, partial genome) position: , mismatch: 10, identity: 0.688

aacttctccagctccttgtgagcgctctcccg	CRISPR spacer
gccgcctccagctccttgtccgcgctcttgta	Protospacer
. * .**************  *******. ..

1927. spacer 21.19|4582480|32|NC_018524|CRISPRCasFinder,CRT matches to MF417872 (Uncultured phage clone 7AX_2, partial genome) position: , mismatch: 10, identity: 0.688

aacttctccagctccttgtgagcgctctcccg	CRISPR spacer
gccgcctccagctccttgtccgcgctcttgta	Protospacer
. * .**************  *******. ..

1928. spacer 21.19|4582480|32|NC_018524|CRISPRCasFinder,CRT matches to MF417884 (Uncultured Caudovirales phage clone 8AX_2, partial genome) position: , mismatch: 10, identity: 0.688

aacttctccagctccttgtgagcgctctcccg	CRISPR spacer
gccgcctccagctccttgtccgcgctcttgta	Protospacer
. * .**************  *******. ..

1929. spacer 21.19|4582480|32|NC_018524|CRISPRCasFinder,CRT matches to MF417839 (Uncultured Caudovirales phage clone 2AX_2, partial genome) position: , mismatch: 10, identity: 0.688

aacttctccagctccttgtgagcgctctcccg	CRISPR spacer
gccgcctccagctccttgtccgcgctcttgta	Protospacer
. * .**************  *******. ..

1930. spacer 21.19|4582480|32|NC_018524|CRISPRCasFinder,CRT matches to MF417931 (Uncultured Caudovirales phage clone 3S_7, partial genome) position: , mismatch: 10, identity: 0.688

aacttctccagctccttgtgagcgctctcccg	CRISPR spacer
gccgcctccagctccttgtccgcgctcttgta	Protospacer
. * .**************  *******. ..

1931. spacer 21.19|4582480|32|NC_018524|CRISPRCasFinder,CRT matches to MF417873 (Uncultured Caudovirales phage clone 7S_5, partial genome) position: , mismatch: 10, identity: 0.688

aacttctccagctccttgtgagcgctctcccg	CRISPR spacer
gccgcctccagctccttgtccgcgctcttgta	Protospacer
. * .**************  *******. ..

1932. spacer 21.19|4582480|32|NC_018524|CRISPRCasFinder,CRT matches to MF417882 (Uncultured Caudovirales phage clone 10F_10, partial genome) position: , mismatch: 10, identity: 0.688

aacttctccagctccttgtgagcgctctcccg	CRISPR spacer
gccgcctccagctccttgtccgcgctcttgta	Protospacer
. * .**************  *******. ..

1933. spacer 21.25|4582846|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP006373 (Aureimonas sp. AU20 plasmid pAU20f, complete sequence) position: , mismatch: 10, identity: 0.688

gaacgacggccgggtcgtcgtggtcctggccg	CRISPR spacer
cgacgacggccgggtagtcgtcgtcgaccttg	Protospacer
 .************* ***** ***    ..*

1934. spacer 21.27|4582968|32|NC_018524|CRISPRCasFinder,CRT matches to NC_009339 (Mycolicibacterium gilvum PYR-GCK plasmid pMFLV01, complete sequence) position: , mismatch: 10, identity: 0.688

ccttgtgccaggtcgcggcggtggtgagtgac	CRISPR spacer
cggggtgccagatcgcggtggtggtgaccccg	Protospacer
*   *******.******.******** .   

1935. spacer 23.2|4591661|33|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_LN832562 (Paracoccus aminovorans isolate JCM7685 plasmid IV, complete sequence) position: , mismatch: 10, identity: 0.697

atcgccgaccagaacctcaagtacaccggagtc	CRISPR spacer
tgggccgagcagaacctcaaggacaccacgctg	Protospacer
   ***** ************ *****. . * 

1936. spacer 23.8|4592030|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP041206 (Rhizobium sp. NIBRBAC000502774 plasmid pMK-3, complete sequence) position: , mismatch: 10, identity: 0.688

acaaaggcctcccccagcttcttgatctgtcg	CRISPR spacer
cctgtcgcctctcccagcttcttgagctgcaa	Protospacer
 * .  *****.************* ***. .

1937. spacer 24.1|4593189|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP025613 (Niveispirillum cyanobacteriorum strain TH16 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.688

gctatggccgccattctcgcggccgctgggat	CRISPR spacer
cccgccgccgccatcctcgcggccgccggcca	Protospacer
 *... ********.***********.**   

1938. spacer 24.1|4593189|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP033227 (Sphingobium yanoikuyae strain SJTF8 plasmid pF1, complete sequence) position: , mismatch: 10, identity: 0.688

gctatggccgccattctcgcggccgctgggat	CRISPR spacer
catgaacccgccattctcgcggtcgctcggcc	Protospacer
  *. . ***************.**** ** .

1939. spacer 26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP023408 (Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence) position: , mismatch: 10, identity: 0.688

ttgttcgcctgctcggcggtgagcttcacgac	CRISPR spacer
cggccgagctgctccgcggtgagcttctcgaa	Protospacer
. *.. . ****** ************ *** 

1940. spacer 26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT matches to MH588544 (Caulobacter phage CcrBL10, complete genome) position: , mismatch: 10, identity: 0.688

ttgttcgcctgctcggcggtgagcttcacgac	CRISPR spacer
ggaccggcctgctcggcggtgaacttctcgtt	Protospacer
  ... ****************.**** ** .

1941. spacer 26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT matches to KY555147 (Caulobacter phage Ccr34, complete genome) position: , mismatch: 10, identity: 0.688

ttgttcgcctgctcggcggtgagcttcacgac	CRISPR spacer
gtcgtcgcctgcgcggcggtgatcttcggcta	Protospacer
 *  ******** ********* ****.    

1942. spacer 26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT matches to KY555145 (Caulobacter phage Ccr29, complete genome) position: , mismatch: 10, identity: 0.688

ttgttcgcctgctcggcggtgagcttcacgac	CRISPR spacer
gtcgtcgcctgcgcggcggtgatcttcggcta	Protospacer
 *  ******** ********* ****.    

1943. spacer 26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT matches to KY555143 (Caulobacter phage Ccr2, complete genome) position: , mismatch: 10, identity: 0.688

ttgttcgcctgctcggcggtgagcttcacgac	CRISPR spacer
gtcgtcgcctgcgcggcggtgatcttcggcta	Protospacer
 *  ******** ********* ****.    

1944. spacer 26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT matches to NC_048812 (Gordonia phage Gibbin, complete genome) position: , mismatch: 10, identity: 0.688

ttgttcgcctgctcggcggtgagcttcacgac	CRISPR spacer
gcctgggcctgctcgggggtgagctccaccgg	Protospacer
 . *  ********** ********.*** . 

1945. spacer 26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT matches to MN234162 (Gordonia phage GretelLyn, complete genome) position: , mismatch: 10, identity: 0.688

ttgttcgcctgctcggcggtgagcttcacgac	CRISPR spacer
gcctgggcctgctcgggggtgagctccaccgg	Protospacer
 . *  ********** ********.*** . 

1946. spacer 26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT matches to KY555146 (Caulobacter phage Ccr32, complete genome) position: , mismatch: 10, identity: 0.688

ttgttcgcctgctcggcggtgagcttcacgac	CRISPR spacer
gtcgtcgcctgcgcggcggtgatcttcggcta	Protospacer
 *  ******** ********* ****.    

1947. spacer 26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT matches to MN234220 (Gordonia phage Lambo, complete genome) position: , mismatch: 10, identity: 0.688

ttgttcgcctgctcggcggtgagcttcacgac	CRISPR spacer
gcctgggcctgctcgggggtgagctccaccgg	Protospacer
 . *  ********** ********.*** . 

1948. spacer 26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT matches to KY555144 (Caulobacter phage Ccr5, complete genome) position: , mismatch: 10, identity: 0.688

ttgttcgcctgctcggcggtgagcttcacgac	CRISPR spacer
gtcgtcgcctgcgcggcggtgatcttcggcta	Protospacer
 *  ******** ********* ****.    

1949. spacer 26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT matches to NC_028865 (Tsukamurella phage TIN2, complete genome) position: , mismatch: 10, identity: 0.688

ttgttcgcctgctcggcggtgagcttcacgac	CRISPR spacer
gtcacgccctggtcggcggtgagctccacgcg	Protospacer
 *  .  **** *************.****  

1950. spacer 26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT matches to JX163858 (Caulobacter phage phiCbK, complete genome) position: , mismatch: 10, identity: 0.688

ttgttcgcctgctcggcggtgagcttcacgac	CRISPR spacer
gtcgtcgcctgcgcggcggtgatcttcggcta	Protospacer
 *  ******** ********* ****.    

1951. spacer 26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT matches to KY555142 (Caulobacter phage Ccr10, complete genome) position: , mismatch: 10, identity: 0.688

ttgttcgcctgctcggcggtgagcttcacgac	CRISPR spacer
gtcgtcgcctgcgcggcggtgatcttcggcta	Protospacer
 *  ******** ********* ****.    

1952. spacer 26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT matches to MN586003 (Gordonia phage Yikes, complete genome) position: , mismatch: 10, identity: 0.688

ttgttcgcctgctcggcggtgagcttcacgac	CRISPR spacer
gcctgggcctgctcgggggtgagctccaccgg	Protospacer
 . *  ********** ********.*** . 

1953. spacer 26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT matches to NC_019411 (Caulobacter phage CcrSwift, complete genome) position: , mismatch: 10, identity: 0.688

ttgttcgcctgctcggcggtgagcttcacgac	CRISPR spacer
gtcgtcgcctgcgcggcggtgatcttcggcta	Protospacer
 *  ******** ********* ****.    

1954. spacer 26.16|4598633|32|NC_018524|CRISPRCasFinder,CRT matches to NC_048815 (Gordonia phage Sadboi, complete genome) position: , mismatch: 10, identity: 0.688

ttgttcgcctgctcggcggtgagcttcacgac	CRISPR spacer
gcctgggcctgctcgggggtgagctccaccgg	Protospacer
 . *  ********** ********.*** . 

1955. spacer 26.20|4598877|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP022366 (Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence) position: , mismatch: 10, identity: 0.688

caccagacgccgtgctcgtccggctggccgaa	CRISPR spacer
gcatgtgcgccgtgctcgacctgctggccgac	Protospacer
   .. .*********** ** ********* 

1956. spacer 26.20|4598877|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP032348 (Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence) position: , mismatch: 10, identity: 0.688

caccagacgccgtgctcgtccggctggccgaa	CRISPR spacer
ggatgtgcgccgtgctcgacctgctggccgac	Protospacer
 . .. .*********** ** ********* 

1957. spacer 26.20|4598877|32|NC_018524|CRISPRCasFinder,CRT matches to NC_012987 (Methylorubrum extorquens AM1 plasmid p1METDI, complete sequence) position: , mismatch: 10, identity: 0.688

caccagacgccgtgctcgtccggctggccgaa	CRISPR spacer
aggatgcggccctgctcgaccggctggccgag	Protospacer
 .   *  *** ****** ************.

1958. spacer 26.20|4598877|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP043499 (Rhizobium grahamii strain BG7 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

caccagacgccgtgctcgtccggctggccgaa	CRISPR spacer
taggtgacgccgtgttcggccggctggcgcgc	Protospacer
.*   *********.*** *********  . 

1959. spacer 26.23|4599060|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP024424 (Paracoccus yeei strain TT13 plasmid pTT13-2, complete sequence) position: , mismatch: 10, identity: 0.688

caggccctggaggacagccggtccgcccgcgc	CRISPR spacer
gtgatgaccgaggacagccggaacgcccgcgc	Protospacer
  *..  . ************  *********

1960. spacer 26.23|4599060|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP020440 (Paracoccus yeei strain FDAARGOS_252 plasmid unnamed2, complete sequence) position: , mismatch: 10, identity: 0.688

caggccctggaggacagccggtccgcccgcgc	CRISPR spacer
gtgatgaccgaggacagccggaacgcccgcgc	Protospacer
  *..  . ************  *********

1961. spacer 26.23|4599060|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP044082 (Paracoccus yeei strain FDAARGOS_643 plasmid unnamed4, complete sequence) position: , mismatch: 10, identity: 0.688

caggccctggaggacagccggtccgcccgcgc	CRISPR spacer
gtgatgaccgaggacagccggaacgcccgcgc	Protospacer
  *..  . ************  *********

1962. spacer 26.23|4599060|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP031080 (Paracoccus yeei strain CCUG 32053 plasmid pYEE2, complete sequence) position: , mismatch: 10, identity: 0.688

caggccctggaggacagccggtccgcccgcgc	CRISPR spacer
gtgatgaccgaggacagccggaacgcccgcgc	Protospacer
  *..  . ************  *********

1963. spacer 26.25|4599182|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP022220 (Bradyrhizobium guangxiense strain CCBAU 53363 plasmid p53363, complete sequence) position: , mismatch: 10, identity: 0.688

acggagctcgtcgagctcgacatcgcgggctc	CRISPR spacer
ggccgcctcgtcgtgctcgacgtcgcgggcct	Protospacer
.   . ******* *******.********..

1964. spacer 26.25|4599182|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP042167 (Burkholderia contaminans strain ZCC plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.688

acggagctcgtcgagctcgacatcgcgggctc	CRISPR spacer
gatctgctcgccgacctcgacatcgcgggaca	Protospacer
.    *****.*** ************** . 

1965. spacer 26.25|4599182|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP028810 (Burkholderia contaminans strain SK875 plasmid p875, complete sequence) position: , mismatch: 10, identity: 0.688

acggagctcgtcgagctcgacatcgcgggctc	CRISPR spacer
gatctgctcgccgacctcgacatcgcgggaca	Protospacer
.    *****.*** ************** . 

1966. spacer 26.25|4599182|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP046610 (Burkholderia contaminans strain XL73 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.688

acggagctcgtcgagctcgacatcgcgggctc	CRISPR spacer
gatctgctcgccgacctcgacatcgcgggaca	Protospacer
.    *****.*** ************** . 

1967. spacer 26.25|4599182|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP030052 (Bradyrhizobium guangdongense strain CCBAU 51649 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

acggagctcgtcgagctcgacatcgcgggctc	CRISPR spacer
ggccgcctcgtcgtgctcgacgtcgcgggcct	Protospacer
.   . ******* *******.********..

1968. spacer 26.25|4599182|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP030054 (Bradyrhizobium guangzhouense strain CCBAU 51670 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.688

acggagctcgtcgagctcgacatcgcgggctc	CRISPR spacer
ggccgcctcgtcgtgctcgacgtcgcgggcct	Protospacer
.   . ******* *******.********..

1969. spacer 26.25|4599182|32|NC_018524|CRISPRCasFinder,CRT matches to NC_022599 (Micrococcus sp. V7 plasmid pLMV7, complete sequence) position: , mismatch: 10, identity: 0.688

acggagctcgtcgagctcgacatcgcgggctc	CRISPR spacer
gcccttctcatcgcgctcgacatcgcgggtag	Protospacer
.*    ***.*** ***************.  

1970. spacer 26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_AP014579 (Burkholderia sp. RPE67 plasmid p1, complete sequence) position: , mismatch: 10, identity: 0.688

acctcgaactcgcggcgctcgcggccgtcacg	CRISPR spacer
accgcgaactcgcgacgctcgcgcgcagtgtc	Protospacer
*** **********.********  *. ... 

1971. spacer 26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT matches to MT522001 (Microbacterium phage Karate, complete genome) position: , mismatch: 10, identity: 0.688

acctcgaactcgcggcgctcgcggccgtcacg	CRISPR spacer
ggaccgaacacgcggcgctcgcggccgatgac	Protospacer
.  .***** ***************** ..  

1972. spacer 26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP049158 (Caballeronia sp. SBC1 plasmid pSBC1_2, complete sequence) position: , mismatch: 10, identity: 0.688

acctcgaactcgcggcgctcgcggccgtcacg	CRISPR spacer
gggtgttcctcgcgacgctcgcggccggcaca	Protospacer
.  *    ******.************ ***.

1973. spacer 26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP049318 (Caballeronia sp. SBC2 plasmid pSBC2-2, complete sequence) position: , mismatch: 10, identity: 0.688

acctcgaactcgcggcgctcgcggccgtcacg	CRISPR spacer
gggtgttcctcgcgacgctcgcggccggcaca	Protospacer
.  *    ******.************ ***.

1974. spacer 26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT matches to NC_016626 (Burkholderia sp. YI23 plasmid byi_1p, complete sequence) position: , mismatch: 10, identity: 0.688

acctcgaactcgcggcgctcgcggccgtcacg	CRISPR spacer
tcacgctgctcgcggcgcttgcggccgtgacc	Protospacer
 * .   .***********.******** ** 

1975. spacer 26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT matches to NC_016626 (Burkholderia sp. YI23 plasmid byi_1p, complete sequence) position: , mismatch: 10, identity: 0.688

acctcgaactcgcggcgctcgcggccgtcacg	CRISPR spacer
accgcgaactcgcgacgctcgcgcgcagtgtc	Protospacer
*** **********.********  *. ... 

1976. spacer 26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT matches to KM389229 (UNVERIFIED: Pseudomonas phage F_TK1718sp/PAK clone contig00001 genomic sequence) position: , mismatch: 10, identity: 0.688

acctcgaactcgcggcgctcgcggccgtcacg	CRISPR spacer
accttgacctcgcggcgctcgcgttgctggat	Protospacer
****.** *************** .  * .  

1977. spacer 26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT matches to NC_031091 (Pseudomonas phage MD8, complete genome) position: , mismatch: 10, identity: 0.688

acctcgaactcgcggcgctcgcggccgtcacg	CRISPR spacer
accttgacctcgcggcgctcgcgttgctggat	Protospacer
****.** *************** .  * .  

1978. spacer 30.2|4637791|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_017771 (Deinococcus gobiensis I-0 plasmid P3, complete sequence) position: , mismatch: 10, identity: 0.688

gagggcagtcgatgatgatctcgtcgaactct	CRISPR spacer
tgtagcggtcgatgatgatctcgtcgaggagg	Protospacer
 . .**.********************.    

1979. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_KR152226 (Micrococcus sp. MG-2010-D12 plasmid pJD12, complete sequence) position: , mismatch: 10, identity: 0.688

cctcggggccggcggtgatcgccccggcccgc	CRISPR spacer
aacaggggcgggcggtgatcgcccaggtgccg	Protospacer
  . ***** ************** **. *  

1980. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP029358 (Azospirillum sp. CFH 70021 plasmid unnamed3) position: , mismatch: 10, identity: 0.688

cctcggggccggcggtgatcgccccggcccgc	CRISPR spacer
cgcgcgggtcggcggtgatctccccggcggtg	Protospacer
* .  ***.*********** *******    

1981. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP021373 (Rhizobium sp. ACO-34A plasmid pRACO34Ac, complete sequence) position: , mismatch: 10, identity: 0.688

cctcggggccggcggtgatcgccccggcccgc	CRISPR spacer
ttcctctgccggcgctgatcgccctggccctt	Protospacer
...*   ******* *********.***** .

1982. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_024972 (Micrococcus sp. A1 plasmid pLMA1, complete sequence) position: , mismatch: 10, identity: 0.688

cctcggggccggcggtgatcgccccggcccgc	CRISPR spacer
aacaggggcgggcggtgatcgcccaggtgccg	Protospacer
  . ***** ************** **. *  

1983. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to KY555147 (Caulobacter phage Ccr34, complete genome) position: , mismatch: 10, identity: 0.688

cctcggggccggcggtgatcgccccggcccgc	CRISPR spacer
tgaggtagccggcggcgatcgcctcggccctg	Protospacer
.   * .********.*******.******  

1984. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to KY555145 (Caulobacter phage Ccr29, complete genome) position: , mismatch: 10, identity: 0.688

cctcggggccggcggtgatcgccccggcccgc	CRISPR spacer
tgaggtagccggcggcgatcgcctcggccctg	Protospacer
.   * .********.*******.******  

1985. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to KY555143 (Caulobacter phage Ccr2, complete genome) position: , mismatch: 10, identity: 0.688

cctcggggccggcggtgatcgccccggcccgc	CRISPR spacer
tgaggtagccggcggcgatcgcctcggccctg	Protospacer
.   * .********.*******.******  

1986. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_019410 (Caulobacter phage CcrKarma, complete genome) position: , mismatch: 10, identity: 0.688

cctcggggccggcggtgatcgccccggcccgc	CRISPR spacer
tgaggtagccggcggcgatcgcctcggccctg	Protospacer
.   * .********.*******.******  

1987. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to KY555146 (Caulobacter phage Ccr32, complete genome) position: , mismatch: 10, identity: 0.688

cctcggggccggcggtgatcgccccggcccgc	CRISPR spacer
tgaggtagccggcggcgatcgcctcggccctg	Protospacer
.   * .********.*******.******  

1988. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_019407 (Caulobacter phage CcrMagneto, complete genome) position: , mismatch: 10, identity: 0.688

cctcggggccggcggtgatcgccccggcccgc	CRISPR spacer
tgaggtagccggcggcgatcgcctcggccctg	Protospacer
.   * .********.*******.******  

1989. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to KY555144 (Caulobacter phage Ccr5, complete genome) position: , mismatch: 10, identity: 0.688

cctcggggccggcggtgatcgccccggcccgc	CRISPR spacer
tgaggtagccggcggcgatcgcctcggccctg	Protospacer
.   * .********.*******.******  

1990. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to JX163858 (Caulobacter phage phiCbK, complete genome) position: , mismatch: 10, identity: 0.688

cctcggggccggcggtgatcgccccggcccgc	CRISPR spacer
tgaggtagccggcggcgatcgcctcggccctg	Protospacer
.   * .********.*******.******  

1991. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to KY555142 (Caulobacter phage Ccr10, complete genome) position: , mismatch: 10, identity: 0.688

cctcggggccggcggtgatcgccccggcccgc	CRISPR spacer
tgaggtagccggcggcgatcgcctcggccctg	Protospacer
.   * .********.*******.******  

1992. spacer 30.3|4637852|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_019411 (Caulobacter phage CcrSwift, complete genome) position: , mismatch: 10, identity: 0.688

cctcggggccggcggtgatcgccccggcccgc	CRISPR spacer
tgaggtagccggcggcgatcgcctcggccctg	Protospacer
.   * .********.*******.******  

1993. spacer 30.5|4637974|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_LN997849 (Magnetospirillum sp. XM-1 isolate XM1 plasmid II, complete sequence) position: , mismatch: 10, identity: 0.688

tcgtggtacatcagctccccgctcacctccag	CRISPR spacer
cacgagtacatcagcaccacgctcacctggat	Protospacer
.   .********** ** *********  * 

1994. spacer 30.6|4638035|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP015006 (Aminobacter aminovorans strain KCTC 2477 plasmid pAA01, complete sequence) position: , mismatch: 10, identity: 0.688

caacgtgctgttgtagttcagctcggcgttga	CRISPR spacer
ggtcgtgctgttgtcgttcaactcgggcgagt	Protospacer
 . *********** *****.*****    * 

1995. spacer 31.3|4642035|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP019314 (Tateyamaria omphalii strain DOK1-4 plasmid pDOK1-4-2, complete sequence) position: , mismatch: 10, identity: 0.688

ccgtccccgcgtggcagaacggcgaactgatc	CRISPR spacer
acgaccccgcgtggcagcacggcgcccgcgcg	Protospacer
 ** ************* ******  *  .. 

1996. spacer 32.8|4652987|33|NC_018524|PILER-CR,CRT matches to NZ_CP023549 (Rhodobacter sp. CZR27 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.697

gcagatcatccacgccctggacgaggccccctc	CRISPR spacer
cttcatcacccacgacctggacgaggccatccg	Protospacer
 .  ****.***** ************* .*. 

1997. spacer 32.9|4653048|33|NC_018524|PILER-CR,CRT matches to MH153808 (Gordonia phage Petra, complete genome) position: , mismatch: 10, identity: 0.697

gaacacgaagaacccgccgctggtcgttgacca	CRISPR spacer
cgacacgaagaacccgccgcaggccgcgaagtt	Protospacer
 .****************** **.**. .* . 

1998. spacer 32.9|4653048|33|NC_018524|PILER-CR,CRT matches to NC_031237 (Gordonia phage Obliviate, complete genome) position: , mismatch: 10, identity: 0.697

gaacacgaagaacccgccgctggtcgttgacca	CRISPR spacer
cgacacgaagaacccgccgcaggccgcgaagtt	Protospacer
 .****************** **.**. .* . 

1999. spacer 32.15|4652562|32|NC_018524|CRISPRCasFinder matches to NZ_CP027023 (Streptomyces sp. WAC00288 plasmid p1, complete sequence) position: , mismatch: 10, identity: 0.688

tctggacgatcgaccaggtcaccgagttcctg	CRISPR spacer
cagacatcgtcgaccaggtcaccgagaccctg	Protospacer
.  . *. .***************** .****

2000. spacer 32.22|4652988|32|NC_018524|CRISPRCasFinder matches to NZ_LN832560 (Paracoccus aminovorans isolate JCM7685 plasmid II, complete sequence) position: , mismatch: 10, identity: 0.688

cagatcatccacgccctggacgaggccccctc	CRISPR spacer
ttcatcacccacgacctggacgaggccttgcg	Protospacer
.  ****.***** *************.. . 

2001. spacer 32.22|4652988|32|NC_018524|CRISPRCasFinder matches to NC_012811 (Methylorubrum extorquens AM1 megaplasmid, complete sequence) position: , mismatch: 10, identity: 0.688

cagatcatccacgccctggacgaggccccctc	CRISPR spacer
gcagccatccatgccctggacgcggcccgcat	Protospacer
  ...******.********** ***** * .

2002. spacer 32.22|4652988|32|NC_018524|CRISPRCasFinder matches to NZ_CP034813 (Paracoccus sp. Arc7-R13 plasmid unnamed2, complete sequence) position: , mismatch: 10, identity: 0.688

cagatcatccacgccctggacgaggccccctc	CRISPR spacer
ttcatcacccacgacctggacgaggcgctgaa	Protospacer
.  ****.***** ************ *.   

2003. spacer 32.22|4652988|32|NC_018524|CRISPRCasFinder matches to NZ_CP032347 (Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence) position: , mismatch: 10, identity: 0.688

cagatcatccacgccctggacgaggccccctc	CRISPR spacer
ttcatcagccacgacctggacgaggcgatccg	Protospacer
.  **** ***** ************  .*. 

2004. spacer 32.27|4653293|32|NC_018524|CRISPRCasFinder matches to NC_022536 (Rhizobium sp. IRBG74 plasmid IRBL74_p, complete sequence) position: , mismatch: 10, identity: 0.688

tttcggtgggtgacgtgcacggcctcgacgtt	CRISPR spacer
ccccaagaggtgacgagcacggcatcgacgtc	Protospacer
...*.. .******* ******* *******.

2005. spacer 32.27|4653293|32|NC_018524|CRISPRCasFinder matches to CP022268 (Xanthomonas citri pv. vignicola strain CFBP7112 plasmid plA, complete sequence) position: , mismatch: 10, identity: 0.688

tttcggtgggtgacgtgcacggcctcgacgtt	CRISPR spacer
gcctgcagggtgacgtgcacggcctagccgaa	Protospacer
 ...*  ****************** * **  

2006. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MH590593 (Mycobacterium phage Rabinovish, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2007. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to KX781992 (Mycobacterium phage Gabriel, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2008. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MK112554 (Mycobacterium phage TinyTim, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2009. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MK359337 (Mycobacterium phage Flabslab, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2010. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MN234193 (Mycobacterium phage Kboogie, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2011. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MK450432 (Mycobacterium phage ValleyTerrace, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2012. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MH051261 (Mycobacterium phage Tyke, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2013. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MK359311 (Mycobacterium phage SmallFry, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2014. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MK359364 (Mycobacterium phage ChickenPhender, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2015. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MK359303 (Mycobacterium phage Shnickers, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2016. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MH697586 (Mycobacterium phage InigoMontoya, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2017. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MK112549 (Mycobacterium phage Morizzled23, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2018. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MK359347 (Mycobacterium phage Ading, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2019. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NC_023714 (Mycobacterium phage LinStu, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2020. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MK359358 (Mycobacterium phage Essence, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2021. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MG812493 (Mycobacterium phage NuevoMundo, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2022. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MK359339 (Mycobacterium phage Naija, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2023. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MK359333 (Mycobacterium phage JustHall, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2024. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MN428065 (Mycobacterium phage Cactojaque, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2025. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MK359306 (Mycobacterium phage Norm, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2026. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MN735434 (Mycobacterium phage Mangeria, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2027. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to JN699625 (Mycobacterium phage Wally, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2028. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to EU826471 (Mycobacterium phage Cali, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2029. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MK359366 (Mycobacterium phage Basquiat, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2030. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MK359346 (Mycobacterium phage NoodleTree, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2031. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to JN699013 (Mycobacterium phage Pio, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2032. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MK359361 (Mycobacterium phage Darko, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2033. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NC_023725 (Mycobacterium phage Nappy, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2034. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MK359348 (Mycobacterium phage Rahel, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2035. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MH779498 (Mycobacterium phage Bread, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2036. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MK450427 (Mycobacterium phage Adlitam, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2037. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MG812494 (Mycobacterium phage Pier, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2038. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to GQ303262 (Mycobacterium phage LRRHood, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2039. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MT818423 (Mycobacterium phage Janiyra, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2040. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to AY129337 (Mycobacteriophage Bxz1, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2041. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MH051260 (Mycobacterium phage InterFolia, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2042. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to KX721256 (Mycobacterium phage Erdmann, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2043. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MK359328 (Mycobacterium phage EmmaElysia, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2044. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MK359335 (Mycobacterium phage Patter, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2045. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MT889395 (Mycobacterium phage Shifa, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2046. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to EU826467 (Mycobacterium phage Rizal, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2047. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MT723944 (Mycobacterium phage ChaylaJr, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2048. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to KR080196 (Mycobacterium phage Momo, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2049. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MH910040 (Mycobacterium phage Sauce, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2050. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MF919495 (Mycobacterium phage Bigswole, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2051. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MK359318 (Mycobacterium phage Specks, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2052. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to KF024734 (Mycobacterium phage Shrimp, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2053. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MK359308 (Mycobacterium phage Shaqnato, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2054. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MH825697 (Mycobacterium phage Bangla1971, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2055. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MK359338 (Mycobacterium phage Amataga, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2056. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MK359350 (Mycobacterium phage Nidhogg, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2057. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MT723945 (Mycobacterium phage Quasimodo, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2058. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MK359342 (Mycobacterium phage ShiaLabeouf, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2059. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MH316561 (Mycobacterium phage Derek, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2060. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MK450422 (Mycobacterium phage RoMag, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2061. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MH727543 (Mycobacterium phage CharlieB, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2062. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to JF704116 (Mycobacterium phage Drazdys, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2063. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MK359336 (Mycobacterium phage Chargie21, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2064. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MK359355 (Mycobacterium phage Sprinklers, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2065. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MK112534 (Mycobacterium phage Burrough, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2066. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NC_023696 (Mycobacterium phage Dandelion, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2067. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MN276192 (Mycobacterium phage Trinitium, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2068. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MK359324 (Mycobacterium phage Tortoise16, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2069. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MK359349 (Mycobacterium phage FoxtrotP1, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2070. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to JF704096 (Mycobacterium phage Ghost, complete sequence) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2071. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MN062707 (Mycobacterium phage Grungle, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2072. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MK359344 (Mycobacterium phage Napoleon13, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2073. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MH727558 (Mycobacterium phage Salacia, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2074. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MK359363 (Mycobacterium phage Fludd, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2075. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to KX831080 (Mycobacterium phage Lukilu, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2076. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MK359329 (Mycobacterium phage Kamryn, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2077. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NC_004687 (Mycobacterium phage Bxz1, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2078. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NC_011270 (Mycobacterium phage Spud, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2079. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MN183280 (Mycobacteriophage LolaVinca, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2080. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MK359345 (Mycobacterium phage QBert, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2081. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to GQ303260 (Mycobacterium phage ET08, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2082. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MK359321 (Mycobacterium phage Phusco, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2083. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MK359362 (Mycobacterium phage Atlantean, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2084. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to EU826469 (Mycobacterium phage ScottMcG, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2085. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MK310143 (Mycobacterium phage Dietrick, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2086. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NC_029044 (Mycobacterium phage Breeniome, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2087. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MK878897 (Mycobacterium phage Blackbrain, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2088. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MF919527 (Mycobacterium phage Phox, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2089. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MT818416 (Mycobacterium phage BackyardAgain, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2090. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MK359330 (Mycobacterium phage Iota, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2091. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to KT365398 (Mycobacterium phage DTDevon, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2092. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to KX369583 (Mycobacterium phage Littleton, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2093. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MF919494 (Mycobacterium phage BeanWater, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2094. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NC_028869 (Mycobacterium phage HyRo, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2095. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to KT365400 (Mycobacterium phage ErnieJ, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2096. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to KC691257 (Mycobacterium phage Astraea, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2097. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MG872839 (Mycobacterium phage LifeSavor, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2098. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to KC748968 (Mycobacterium phage Gizmo, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2099. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to KC748970 (Mycobacterium phage ArcherS7, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2100. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MK359353 (Mycobacterium phage BadAgartude, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2101. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MH697590 (Mycobacterium phage Phlegm, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2102. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MK359317 (Mycobacterium phage FrayBell, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2103. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MT553335 (Mycobacterium phage Ronan, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2104. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MN428066 (Mycobacterium phage JPickles, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2105. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MK359305 (Mycobacterium phage Teardrop, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2106. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to DQ398053 (Mycobacteriophage Catera, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2107. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MF919513 (Mycobacterium phage Koguma, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2108. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to JN699626 (Mycobacterium phage MoMoMixon, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2109. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NC_028986 (Mycobacterium phage Alice, complete sequence) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2110. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MK450424 (Mycobacterium phage Melpomini, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2111. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to JN204348 (Mycobacterium phage Sebata, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2112. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MN183285 (Mycobacterium phage YoungMoneyMata, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2113. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MK450423 (Mycobacterium phage Stubby, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2114. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MF919493 (Mycobacterium phage Audrick, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2115. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NC_008207 (Mycobacterium phage Catera, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2116. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to JN624850 (Mycobacterium phage Pleione, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2117. spacer 34.3|5116596|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to MK359326 (Mycobacterium phage Pivoine, complete genome) position: , mismatch: 10, identity: 0.688

aacaggaaggagtcctgatcgaccgaccccga	CRISPR spacer
gccaggaacgcgtcctgatcgaccgtgctgcc	Protospacer
. ****** * **************  *.   

2118. spacer 34.4|5116657|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP022565 (Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK01, complete sequence) position: , mismatch: 10, identity: 0.688

ccgggcgacgccgaggcggtgtggaacatccg	CRISPR spacer
gagagcgacgtcgagacggtgtggaacgcggt	Protospacer
  *.******.****.***********..   

2119. spacer 34.6|5116779|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP017076 (Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence) position: , mismatch: 10, identity: 0.688

ggaggcgctgctggaggccccggcagtctggg	CRISPR spacer
ggagtcgctgctggagaccccggtgacgctgt	Protospacer
**** ***********.******.... . * 

2120. spacer 34.6|5116779|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 10, identity: 0.688

ggaggcgctgctggaggccccggcagtctggg	CRISPR spacer
ccgcccgctgctggacgccccggctgtccccg	Protospacer
  .  ********** ******** ***.  *

2121. spacer 34.6|5116779|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 10, identity: 0.688

ggaggcgctgctggaggccccggcagtctggg	CRISPR spacer
ccgcccgctgctggacgccccggctgtccccg	Protospacer
  .  ********** ******** ***.  *

2122. spacer 35.2|5118353|33|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013739 (Streptomyces globisporus C-1027 plasmid SGLP1, complete sequence) position: , mismatch: 10, identity: 0.697

accccctggcaggccctggggctgctcccgatg	CRISPR spacer
ctccgctggcaggccctgtggctgctgggacag	Protospacer
 .** ************* *******   .  *

2123. spacer 35.2|5118353|33|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP029362 (Streptomyces globisporus strain TFH56 plasmid pTFSG1, complete sequence) position: , mismatch: 10, identity: 0.697

accccctggcaggccctggggctgctcccgatg	CRISPR spacer
ctccgctggcaggccctgtggctgctgggacag	Protospacer
 .** ************* *******   .  *

2124. spacer 35.7|5118659|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to KF626665 (Phage Sano, complete genome) position: , mismatch: 10, identity: 0.688

ggtgacggtctcgcggatgacctcccgcacgg	CRISPR spacer
caaggcggtctcgccgatgacctcgcgcggca	Protospacer
 . *.********* ********* ***.  .

2125. spacer 1.3|311748|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to CP047137 (Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.656

gtgccgctggccatctccatcgtcggctccta	CRISPR spacer
caaccgctggggatctccatcgtcggtgggct	Protospacer
  .*******  **************.   . 

2126. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 11, identity: 0.656

tcctccggcgcctcgtcggcgacgtcggcgac	CRISPR spacer
cgtgtgaacgcctcgccggcggcgtcggcgat	Protospacer
. . . ..*******.*****.*********.

2127. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013635 (Rhizobium sp. N324 plasmid pRspN324e, complete sequence) position: , mismatch: 11, identity: 0.656

tcctccggcgcctcgtcggcgacgtcggcgac	CRISPR spacer
agatccggcccctcgtcggcggcgtctatccg	Protospacer
   ****** ***********.**** ..   

2128. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to CP007644 (Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803c, complete sequence) position: , mismatch: 11, identity: 0.656

tcctccggcgcctcgtcggcgacgtcggcgac	CRISPR spacer
agatccggcccctcgtcggcggcgtctatccg	Protospacer
   ****** ***********.**** ..   

2129. spacer 3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to CP032840 (Aeromonas veronii strain FC951 plasmid unnamed) position: , mismatch: 11, identity: 0.656

atgaccgcccatttcgccgaccggctcgccgc	CRISPR spacer
gctcgcgcccatttcgccgtccgggtcgatat	Protospacer
..   ************** **** *** ...

2130. spacer 3.5|318761|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to CP032840 (Aeromonas veronii strain FC951 plasmid unnamed) position: , mismatch: 11, identity: 0.656

atgaccgcccatttcgccgaccggctcgccgc	CRISPR spacer
gctcgcgcccatttcgccgtccgggtcgatat	Protospacer
..   ************** **** *** ...

2131. spacer 3.8|318944|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP032687 (Rhizobium sp. CCGE531 plasmid pRCCGE531b, complete sequence) position: , mismatch: 11, identity: 0.656

ggctgtggagcgcgcggcggctgcgcggggtg	CRISPR spacer
tctggtggagcgcccgacggctgcgcgcaagt	Protospacer
  . ********* **.********** ..  

2132. spacer 3.8|318944|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NC_020061 (Rhizobium tropici CIAT 899 plasmid pRtrCIAT899b, complete sequence) position: , mismatch: 11, identity: 0.656

ggctgtggagcgcgcggcggctgcgcggggtg	CRISPR spacer
tctggtggagcgcccgacggctgcgcgcaagt	Protospacer
  . ********* **.********** ..  

2133. spacer 3.8|318944|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP034999 (Rhizobium acidisoli strain FH23 plasmid pRapFH23a, complete sequence) position: , mismatch: 11, identity: 0.656

ggctgtggagcgcgcggcggctgcgcggggtg	CRISPR spacer
tctggtggagcgcccgacggctgcgcgcaagt	Protospacer
  . ********* **.********** ..  

2134. spacer 3.12|319187|32|NC_018524|CRISPRCasFinder,CRT,PILER-CR matches to NZ_AP014863 (Pseudomonas furukawaii strain KF707 plasmid pKF707, complete sequence) position: , mismatch: 11, identity: 0.656

tggggtggccaccgggaccccctcctggccgt	CRISPR spacer
cacctgggccaccgccaccccctcctggcgtc	Protospacer
..    ********  *************  .

2135. spacer 9.1|1460065|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP032322 (Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence) position: , mismatch: 11, identity: 0.656

accgggtggcatcgcacggccgctcaggtcgt	CRISPR spacer
ggcgggtggcatcgcgcgcccgctcgatgtcc	Protospacer
. *************.** ******..  . .

2136. spacer 9.1|1460065|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP007794 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence) position: , mismatch: 11, identity: 0.656

accgggtggcatcgcacggccgctcaggtcgt	CRISPR spacer
gacgggtggcatcgcgcgcccgctcgatgtcc	Protospacer
. *************.** ******..  . .

2137. spacer 9.6|1460370|32|NC_018524|CRISPRCasFinder,CRT matches to KU160671 (Arthrobacter phage Vulture, complete genome) position: , mismatch: 11, identity: 0.656

ctcaccactcgcggtaagccggtccgggtgcc	CRISPR spacer
------tatcacggtaagcctgtccgggtgct	Protospacer
        **.********* **********.

2138. spacer 9.6|1460370|32|NC_018524|CRISPRCasFinder,CRT matches to KU160648 (Arthrobacter phage HunterDalle, complete genome) position: , mismatch: 11, identity: 0.656

ctcaccactcgcggtaagccggtccgggtgcc	CRISPR spacer
------tatcacggtaagcctgtccgggtgct	Protospacer
        **.********* **********.

2139. spacer 9.6|1460370|32|NC_018524|CRISPRCasFinder,CRT matches to MK279874 (Arthrobacter phage Riovina, complete genome) position: , mismatch: 11, identity: 0.656

ctcaccactcgcggtaagccggtccgggtgcc	CRISPR spacer
------tatcacggtaagcctgtccgggtgct	Protospacer
        **.********* **********.

2140. spacer 9.6|1460370|32|NC_018524|CRISPRCasFinder,CRT matches to MK279851 (Arthrobacter phage Eunoia, complete genome) position: , mismatch: 11, identity: 0.656

ctcaccactcgcggtaagccggtccgggtgcc	CRISPR spacer
------tatcacggtaagcctgtccgggtgct	Protospacer
        **.********* **********.

2141. spacer 9.6|1460370|32|NC_018524|CRISPRCasFinder,CRT matches to MK112526 (Arthrobacter phage Aledel, complete genome) position: , mismatch: 11, identity: 0.656

ctcaccactcgcggtaagccggtccgggtgcc	CRISPR spacer
------tatcacggtaagcctgtccgggtgct	Protospacer
        **.********* **********.

2142. spacer 9.6|1460370|32|NC_018524|CRISPRCasFinder,CRT matches to MK279868 (Arthrobacter phage OMalley, complete genome) position: , mismatch: 11, identity: 0.656

ctcaccactcgcggtaagccggtccgggtgcc	CRISPR spacer
------tatcacggtaagcctgtccgggtgct	Protospacer
        **.********* **********.

2143. spacer 9.6|1460370|32|NC_018524|CRISPRCasFinder,CRT matches to MK279884 (Arthrobacter phage Supakev, complete genome) position: , mismatch: 11, identity: 0.656

ctcaccactcgcggtaagccggtccgggtgcc	CRISPR spacer
------tatcacggtaagcctgtccgggtgct	Protospacer
        **.********* **********.

2144. spacer 9.9|1460554|32|NC_018524|CRISPRCasFinder,CRT matches to MN855603 (Bacteriophage sp. isolate 338, complete genome) position: , mismatch: 11, identity: 0.656

ctaccgcgggtgatcaaggacaagatcgtgga	CRISPR spacer
aggagacgggtgagcaaggtcaagatcgtcat	Protospacer
  .  .******* ***** ********* . 

2145. spacer 9.11|1460066|32|NC_018524|PILER-CR matches to NZ_CP032322 (Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence) position: , mismatch: 11, identity: 0.656

accgggtggcatcgcacggccgctcaggtcgt	CRISPR spacer
ggcgggtggcatcgcgcgcccgctcgatgtcc	Protospacer
. *************.** ******..  . .

2146. spacer 9.11|1460066|32|NC_018524|PILER-CR matches to NZ_CP007794 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence) position: , mismatch: 11, identity: 0.656

accgggtggcatcgcacggccgctcaggtcgt	CRISPR spacer
gacgggtggcatcgcgcgcccgctcgatgtcc	Protospacer
. *************.** ******..  . .

2147. spacer 9.16|1460371|32|NC_018524|PILER-CR matches to KU160671 (Arthrobacter phage Vulture, complete genome) position: , mismatch: 11, identity: 0.656

ctcaccactcgcggtaagccggtccgggtgcc	CRISPR spacer
------tatcacggtaagcctgtccgggtgct	Protospacer
        **.********* **********.

2148. spacer 9.16|1460371|32|NC_018524|PILER-CR matches to KU160648 (Arthrobacter phage HunterDalle, complete genome) position: , mismatch: 11, identity: 0.656

ctcaccactcgcggtaagccggtccgggtgcc	CRISPR spacer
------tatcacggtaagcctgtccgggtgct	Protospacer
        **.********* **********.

2149. spacer 9.16|1460371|32|NC_018524|PILER-CR matches to MK279874 (Arthrobacter phage Riovina, complete genome) position: , mismatch: 11, identity: 0.656

ctcaccactcgcggtaagccggtccgggtgcc	CRISPR spacer
------tatcacggtaagcctgtccgggtgct	Protospacer
        **.********* **********.

2150. spacer 9.16|1460371|32|NC_018524|PILER-CR matches to MK279851 (Arthrobacter phage Eunoia, complete genome) position: , mismatch: 11, identity: 0.656

ctcaccactcgcggtaagccggtccgggtgcc	CRISPR spacer
------tatcacggtaagcctgtccgggtgct	Protospacer
        **.********* **********.

2151. spacer 9.16|1460371|32|NC_018524|PILER-CR matches to MK112526 (Arthrobacter phage Aledel, complete genome) position: , mismatch: 11, identity: 0.656

ctcaccactcgcggtaagccggtccgggtgcc	CRISPR spacer
------tatcacggtaagcctgtccgggtgct	Protospacer
        **.********* **********.

2152. spacer 9.16|1460371|32|NC_018524|PILER-CR matches to MK279868 (Arthrobacter phage OMalley, complete genome) position: , mismatch: 11, identity: 0.656

ctcaccactcgcggtaagccggtccgggtgcc	CRISPR spacer
------tatcacggtaagcctgtccgggtgct	Protospacer
        **.********* **********.

2153. spacer 9.16|1460371|32|NC_018524|PILER-CR matches to MK279884 (Arthrobacter phage Supakev, complete genome) position: , mismatch: 11, identity: 0.656

ctcaccactcgcggtaagccggtccgggtgcc	CRISPR spacer
------tatcacggtaagcctgtccgggtgct	Protospacer
        **.********* **********.

2154. spacer 9.19|1460555|32|NC_018524|PILER-CR matches to MN855603 (Bacteriophage sp. isolate 338, complete genome) position: , mismatch: 11, identity: 0.656

ctaccgcgggtgatcaaggacaagatcgtgga	CRISPR spacer
aggagacgggtgagcaaggtcaagatcgtcat	Protospacer
  .  .******* ***** ********* . 

2155. spacer 11.1|2251024|32|NC_018524|PILER-CR,CRT matches to NC_016585 (Azospirillum lipoferum 4B plasmid AZO_p1, complete sequence) position: , mismatch: 11, identity: 0.656

aggttctccccgaccctccacaaccttcctct	CRISPR spacer
gccccctccccgaccctcccccaccttcggtg	Protospacer
.  ..************** * ******  . 

2156. spacer 19.5|4409022|32|NC_018524|CRT matches to NZ_LR134455 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 13, complete sequence) position: , mismatch: 11, identity: 0.656

ttccaccaccgcgccgagcgcgaacgggagcg	CRISPR spacer
gcacaccaccgcggcgagcgcgcacgcccaga	Protospacer
 . ********** ******** ***   . .

2157. spacer 19.5|4409022|32|NC_018524|CRT matches to NC_003037 (Sinorhizobium meliloti 1021 plasmid pSymA, complete sequence) position: , mismatch: 11, identity: 0.656

ttccaccaccgcgccgagcgcgaacgggagcg	CRISPR spacer
ccgtctttccgcgccgtacgcgaacgggagca	Protospacer
.. . .. ******** .*************.

2158. spacer 19.5|4409022|32|NC_018524|CRT matches to NZ_CP019585 (Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymA, complete sequence) position: , mismatch: 11, identity: 0.656

ttccaccaccgcgccgagcgcgaacgggagcg	CRISPR spacer
ccgtctttccgcgccgtacgcgaacgggagca	Protospacer
.. . .. ******** .*************.

2159. spacer 19.5|4409022|32|NC_018524|CRT matches to NZ_CP021798 (Sinorhizobium meliloti strain USDA1106 plasmid psymA, complete sequence) position: , mismatch: 11, identity: 0.656

ttccaccaccgcgccgagcgcgaacgggagcg	CRISPR spacer
ccgtctttccgcgccgtacgcgaacgggagca	Protospacer
.. . .. ******** .*************.

2160. spacer 19.5|4409022|32|NC_018524|CRT matches to NC_020527 (Sinorhizobium meliloti 2011 plasmid pSymA, complete sequence) position: , mismatch: 11, identity: 0.656

ttccaccaccgcgccgagcgcgaacgggagcg	CRISPR spacer
ccgtctttccgcgccgtacgcgaacgggagca	Protospacer
.. . .. ******** .*************.

2161. spacer 21.18|4582419|32|NC_018524|CRISPRCasFinder,CRT matches to CP047389 (Agrobacterium sp. CGMCC 11546 plasmid pA) position: , mismatch: 11, identity: 0.656

ctgtgggcttgaccagcaggcccttgaagatc	CRISPR spacer
gataggtcttgtccagcaggcccttgatcggt	Protospacer
    ** **** ***************  . .

2162. spacer 21.18|4582419|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP033036 (Agrobacterium fabrum strain 12D13 plasmid pAt12D13a, complete sequence) position: , mismatch: 11, identity: 0.656

ctgtgggcttgaccagcaggcccttgaagatc	CRISPR spacer
gataggtcttgtccagcaggcccttgatcggt	Protospacer
    ** **** ***************  . .

2163. spacer 21.18|4582419|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP033024 (Agrobacterium fabrum strain 1D132 plasmid pAt1D132a, complete sequence) position: , mismatch: 11, identity: 0.656

ctgtgggcttgaccagcaggcccttgaagatc	CRISPR spacer
gataggtcttgtccagcaggcccttgatcggt	Protospacer
    ** **** ***************  . .

2164. spacer 21.18|4582419|32|NC_018524|CRISPRCasFinder,CRT matches to MF417876 (Uncultured Caudovirales phage clone 3F_6, partial genome) position: , mismatch: 11, identity: 0.656

ctgtgggcttgaccagcaggcccttgaagatc	CRISPR spacer
ggccggccttggccagcaggcccttgaccgct	Protospacer
   .** ****.***************  ...

2165. spacer 21.18|4582419|32|NC_018524|CRISPRCasFinder,CRT matches to MF417995 (Uncultured Caudovirales phage clone 7F_19, partial genome) position: , mismatch: 11, identity: 0.656

ctgtgggcttgaccagcaggcccttgaagatc	CRISPR spacer
ggccggccttggccagcaggcccttgaccgct	Protospacer
   .** ****.***************  ...

2166. spacer 21.18|4582419|32|NC_018524|CRISPRCasFinder,CRT matches to MF417869 (Uncultured Caudovirales phage clone 3S_4, partial genome) position: , mismatch: 11, identity: 0.656

ctgtgggcttgaccagcaggcccttgaagatc	CRISPR spacer
ggccggccttggccagcaggcccttgaccgct	Protospacer
   .** ****.***************  ...

2167. spacer 21.18|4582419|32|NC_018524|CRISPRCasFinder,CRT matches to MF417877 (Uncultured Caudovirales phage clone 9F_7, partial genome) position: , mismatch: 11, identity: 0.656

ctgtgggcttgaccagcaggcccttgaagatc	CRISPR spacer
ggccggccttggccagcaggcccttgaccgct	Protospacer
   .** ****.***************  ...

2168. spacer 21.18|4582419|32|NC_018524|CRISPRCasFinder,CRT matches to MF417878 (Uncultured Caudovirales phage clone 8S_7, partial genome) position: , mismatch: 11, identity: 0.656

ctgtgggcttgaccagcaggcccttgaagatc	CRISPR spacer
ggccggccttggccagcaggcccttgaccgct	Protospacer
   .** ****.***************  ...

2169. spacer 21.22|4582663|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP010612 (Phaeobacter inhibens strain P92 plasmid pP92_b, complete sequence) position: , mismatch: 11, identity: 0.656

ggctcgtcgacacacgtcagcagggcagcacg	CRISPR spacer
aatgaatcgacacgcgacagcagggcagcgtc	Protospacer
...  .*******.** ************.. 

2170. spacer 21.22|4582663|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP010624 (Phaeobacter inhibens strain P51 plasmid pP51_a, complete sequence) position: , mismatch: 11, identity: 0.656

ggctcgtcgacacacgtcagcagggcagcacg	CRISPR spacer
aatgaatcgacacgcgacagcagggcagcgtc	Protospacer
...  .*******.** ************.. 

2171. spacer 21.22|4582663|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP010669 (Phaeobacter inhibens strain P57 plasmid pP57_a, complete sequence) position: , mismatch: 11, identity: 0.656

ggctcgtcgacacacgtcagcagggcagcacg	CRISPR spacer
aatgaatcgacacgcgacagcagggcagcgtc	Protospacer
...  .*******.** ************.. 

2172. spacer 21.22|4582663|32|NC_018524|CRISPRCasFinder,CRT matches to NC_018291 (Phaeobacter inhibens DSM 17395 plasmid pPGA1_262, complete sequence) position: , mismatch: 11, identity: 0.656

ggctcgtcgacacacgtcagcagggcagcacg	CRISPR spacer
aatgaatcgacacgcgacagcagggcagcgtc	Protospacer
...  .*******.** ************.. 

2173. spacer 21.22|4582663|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP010596 (Phaeobacter inhibens strain P10 plasmid pP10_a, complete sequence) position: , mismatch: 11, identity: 0.656

ggctcgtcgacacacgtcagcagggcagcacg	CRISPR spacer
aatgaatcgacacgcgacagcagggcagcgtc	Protospacer
...  .*******.** ************.. 

2174. spacer 21.22|4582663|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP010630 (Phaeobacter inhibens strain P78 plasmid pP78_a, complete sequence) position: , mismatch: 11, identity: 0.656

ggctcgtcgacacacgtcagcagggcagcacg	CRISPR spacer
aatgaatcgacacgcgacagcagggcagcgtc	Protospacer
...  .*******.** ************.. 

2175. spacer 21.22|4582663|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP010600 (Phaeobacter inhibens strain P83 plasmid pP83_a, complete sequence) position: , mismatch: 11, identity: 0.656

ggctcgtcgacacacgtcagcagggcagcacg	CRISPR spacer
aatgaatcgacacgcgacagcagggcagcgtc	Protospacer
...  .*******.** ************.. 

2176. spacer 21.22|4582663|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP031949 (Phaeobacter inhibens strain BS107 plasmid unnamed1, complete sequence) position: , mismatch: 11, identity: 0.656

ggctcgtcgacacacgtcagcagggcagcacg	CRISPR spacer
aatgaatcgacacgcgacagcagggcagcgtc	Protospacer
...  .*******.** ************.. 

2177. spacer 21.22|4582663|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP010742 (Phaeobacter inhibens strain P59 plasmid pP59_a, complete sequence) position: , mismatch: 11, identity: 0.656

ggctcgtcgacacacgtcagcagggcagcacg	CRISPR spacer
aatgaatcgacacgcgacagcagggcagcgtc	Protospacer
...  .*******.** ************.. 

2178. spacer 21.22|4582663|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP010618 (Phaeobacter inhibens strain P30 isolate M4-3.1A plasmid pP30_a, complete sequence) position: , mismatch: 11, identity: 0.656

ggctcgtcgacacacgtcagcagggcagcacg	CRISPR spacer
aatgaatcgacacgcgacagcagggcagcgtc	Protospacer
...  .*******.** ************.. 

2179. spacer 21.22|4582663|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP010726 (Phaeobacter inhibens strain P88 plasmid pP88_a, complete sequence) position: , mismatch: 11, identity: 0.656

ggctcgtcgacacacgtcagcagggcagcacg	CRISPR spacer
aatgaatcgacacgcgacagcagggcagcgtc	Protospacer
...  .*******.** ************.. 

2180. spacer 21.22|4582663|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP010651 (Phaeobacter inhibens strain P54 plasmid pP54_a, complete sequence) position: , mismatch: 11, identity: 0.656

ggctcgtcgacacacgtcagcagggcagcacg	CRISPR spacer
aatgaatcgacacgcgacagcagggcagcgtc	Protospacer
...  .*******.** ************.. 

2181. spacer 21.22|4582663|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP010706 (Phaeobacter inhibens strain P66 plasmid pP66_a, complete sequence) position: , mismatch: 11, identity: 0.656

ggctcgtcgacacacgtcagcagggcagcacg	CRISPR spacer
aatgaatcgacacgcgacagcagggcagcgtc	Protospacer
...  .*******.** ************.. 

2182. spacer 21.22|4582663|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP010697 (Phaeobacter inhibens strain P24 plasmid pP24_a, complete sequence) position: , mismatch: 11, identity: 0.656

ggctcgtcgacacacgtcagcagggcagcacg	CRISPR spacer
aatgaatcgacacgcgacagcagggcagcgtc	Protospacer
...  .*******.** ************.. 

2183. spacer 21.22|4582663|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP010746 (Phaeobacter inhibens strain P48 isolate M21-2.3 plasmid pP48_a, complete sequence) position: , mismatch: 11, identity: 0.656

ggctcgtcgacacacgtcagcagggcagcacg	CRISPR spacer
aatgaatcgacacgcgacagcagggcagcgtc	Protospacer
...  .*******.** ************.. 

2184. spacer 24.1|4593189|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP018172 (Mesorhizobium oceanicum strain B7 plasmid unnamed1, complete sequence) position: , mismatch: 11, identity: 0.656

gctatggccgccattctcgcggccgctgggat	CRISPR spacer
cgcgccgccgcgattctcgcggccgcaggccg	Protospacer
  ... ***** ************** **   

2185. spacer 25.7|4595504|32|NC_018524|CRISPRCasFinder matches to NC_021918 (Cycloclasticus zancles 78-ME plasmid p7ME01, complete sequence) position: , mismatch: 11, identity: 0.656

gctacgcggaacctcgcgcacatctgatgtgt	CRISPR spacer
catacgcagaacctcgcgcacttcttcaccag	Protospacer
  *****.************* ***    .. 

2186. spacer 26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 11, identity: 0.656

acctcgaactcgcggcgctcgcggccgtcacg	CRISPR spacer
ttgccgaacgcgcggcgctcgcgggcgatgaa	Protospacer
 . .***** ************** ** .. .

2187. spacer 26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 11, identity: 0.656

acctcgaactcgcggcgctcgcggccgtcacg	CRISPR spacer
ttgccgaacgcgcggcgctcgcgggcgatgaa	Protospacer
 . .***** ************** ** .. .

2188. spacer 26.26|4599243|32|NC_018524|CRISPRCasFinder,CRT matches to NC_011962 (Rhodobacter sphaeroides KD131 plasmid pRSKD131A, complete sequence) position: , mismatch: 11, identity: 0.656

acctcgaactcgcggcgctcgcggccgtcacg	CRISPR spacer
ggtcgctgctcgccgcgctctcggccgtcacc	Protospacer
. ..   .***** ****** ********** 

2189. spacer 30.2|4637791|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to AP013510 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G20, isolate: uvMED-CGR-C101A-MedDCM-OCT-S30-C6) position: , mismatch: 11, identity: 0.656

gagggcagtcgatgatgatctcgtcgaactct	CRISPR spacer
agaacttgtcgatgatgatgtcgtcgatctta	Protospacer
.... . ************ ******* **. 

2190. spacer 30.2|4637791|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to AP013876 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C101A-MedDCM-OCT-S39-C9, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 11, identity: 0.656

gagggcagtcgatgatgatctcgtcgaactct	CRISPR spacer
agaacttgtcgatgatgatgtcgtcgatctta	Protospacer
.... . ************ ******* **. 

2191. spacer 30.7|4638096|32|NC_018524|CRISPRCasFinder,CRT matches to NC_010510 (Methylobacterium radiotolerans JCM 2831 plasmid pMRAD01, complete sequence) position: , mismatch: 11, identity: 0.656

gtcacaccgatgttctctcggccggcctggta	CRISPR spacer
tcgacaccaatgtcctctcggccggcgccccg	Protospacer
 . *****.****.************ .  ..

2192. spacer 31.1|4641913|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_015184 (Agrobacterium sp. H13-3 plasmid pAspH13-3a, complete sequence) position: , mismatch: 11, identity: 0.656

ggctcgtccggatcgagagggggaccggcacc	CRISPR spacer
ttgtcgcccggatcgagagagggacctcttgt	Protospacer
   ***.************.******  .  .

2193. spacer 32.8|4652987|33|NC_018524|PILER-CR,CRT matches to NZ_LN832560 (Paracoccus aminovorans isolate JCM7685 plasmid II, complete sequence) position: , mismatch: 11, identity: 0.667

gcagatcatccacgccctggacgaggccccctc	CRISPR spacer
cttcatcacccacgacctggacgaggccttgcg	Protospacer
 .  ****.***** *************.. . 

2194. spacer 32.15|4652562|32|NC_018524|CRISPRCasFinder matches to NZ_CP045074 (Paracoccus kondratievae strain BJQ0001 plasmid unnamed1, complete sequence) position: , mismatch: 11, identity: 0.656

tctggacgatcgaccaggtcaccgagttcctg	CRISPR spacer
aagaagacatcgaccagctcaccgagatcctc	Protospacer
   ...  ********* ******** **** 

2195. spacer 32.22|4652988|32|NC_018524|CRISPRCasFinder matches to NZ_CP031166 (Euzebya sp. DY32-46 plasmid pEDY32-46I, complete sequence) position: , mismatch: 11, identity: 0.656

cagatcatccacgccctggacgaggccccctc	CRISPR spacer
gccctcatcgacgccctggtcgaggccgagat	Protospacer
    ***** ********* *******    .

2196. spacer 32.22|4652988|32|NC_018524|CRISPRCasFinder matches to NC_009959 (Dinoroseobacter shibae DFL 12 = DSM 16493 plasmid pDSHI05, complete sequence) position: , mismatch: 11, identity: 0.656

cagatcatccacgccctggacgaggccccctc	CRISPR spacer
ttcatcacccacgacctggacgaggcggtgct	Protospacer
.  ****.***** ************  . ..

2197. spacer 11.15|2251386|37|NC_018524|CRISPRCasFinder matches to KT287080 (Enterobacter phage phiEap-2, complete genome) position: , mismatch: 12, identity: 0.676

accgcttgagaagctcccgcgcgacctggagtccgag	CRISPR spacer
gaatctggagaagctcctgcgcgacctggaagacatc	Protospacer
.   ** **********.************.  *.  

2198. spacer 28.1|4608658|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NZ_AP014705 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence) position: , mismatch: 12, identity: 0.625

ccaccgcccgggaggccgcccaccgggccgca-	CRISPR spacer
-gcgcgcccggagggcggccgcccgggcctgcg	Protospacer
    *******..*** ***  *******    

2199. spacer 11.15|2251386|37|NC_018524|CRISPRCasFinder matches to MN855815 (Bacteriophage sp. isolate 146, partial genome) position: , mismatch: 13, identity: 0.649

accgcttgagaagctcccgcgcgacctggagtccgag	CRISPR spacer
gaatctggagaagctcctgcgcgacctggaagatatc	Protospacer
.   ** **********.************.  ..  

2200. spacer 1.13|312363|32|NC_018524|PILER-CR,CRISPRCasFinder,CRT matches to NC_013857 (Azospirillum sp. B510 plasmid pAB510c, complete sequence) position: , mismatch: 14, identity: 0.562

tcctccggcgcctcgtcggcgacgtcggcgac--------------	CRISPR spacer
--------------gtcggcgacgtcggcgacgaggctgaccgtcg	Protospacer
              ******************