CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NC_018518	Bordetella pertussis 18323, complete genome	4 crisprs	csa3,DEDDh,DinG,cas3	0	0	26	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_018518_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_018518_1

229293-229402

Orphan

Consensus_repeat	Method
TTGACTGCCAAGACGGTATCTGTCCCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_018518_1

>merge|NC_018518|1|229293-229402|CRISPRCasFinder
TTGACTGCCAAGACGGTATCTGTCCCCGCAGGGAGGGTGCCTGTCCCCGCCGGGACAGGCACACTGCTGTACGCCATCGACGCTTGACGGCCAAGACGGTATCTGTCCCC

>NC_018518|1|1|229293-229402|CRISPRCasFinder
TTGACTGCCAAGACGGTATCTGTCCCC	GCAGGGAGGGTGCCTGTCCCCGCCGGGACAGGCACACTGCTGTACGCCATCGACGC
TTGACGGCCAAGACGGTATCTGTCCCC

Protein	Signature genes	Signature genes Name	Protein_function
NC_018518.1\|WP_003814739.1\|227254_228040_+\|enoyl-ACP-reductase-FabI	unknown	unknown	gnl\|CDD\|180789
NC_018518.1\|WP_014905423.1\|235475_236837_+\|aromatic-ring-hydroxylating-dioxygenase-subunit-alpha	unknown	unknown	gnl\|CDD\|239561
NC_018518.1\|WP_041166119.1\|237530_238403_+\|branched-chain-amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|119324
NC_018518.1\|WP_003820674.1\|235014_235248_+\|hypothetical-protein	unknown	unknown	unknown
NC_018518.1\|WP_010929769.1\|217601_218276_-\|orotate-phosphoribosyltransferase	unknown	unknown	gnl\|CDD\|234771
NC_018518.1\|WP_010929766.1\|221004_221643_-\|trimeric-intracellular-cation-channel-family-protein	unknown	unknown	gnl\|CDD\|225415
NC_018518.1\|WP_010931354.1\|223638_224106_-\|ribonuclease-HI	unknown	unknown	gnl\|CDD\|178927
NC_018518.1\|WP_014905419.1\|219624_220968_+\|NADP-specific-glutamate-dehydrogenase	unknown	unknown	gnl\|CDD\|181834
NC_018518.1\|WP_003814748.1\|233741_234710_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226596
NC_018518.1\|WP_010931356.1\|225750_227160_+\|transglycosylase-SLT-domain-containing-protein	unknown	unknown	gnl\|CDD\|182727
NC_018518.1\|WP_005013747.1\|222691_223642_+\|IS481-like-element-IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
NC_018518.1\|WP_014905422.1\|231685_232636_-\|IS481-like-element-IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
NC_018518.1\|WP_010929768.1\|218413_219202_+\|exodeoxyribonuclease-III	unknown	unknown	gnl\|CDD\|197336
NC_018518.1\|WP_023994844.1\|230618_231590_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270296
NC_018518.1\|WP_014905420.1\|224148_224919_-\|methyltransferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|369777
NC_018518.1\|WP_003814756.1\|236895_237534_+\|hypothetical-protein	unknown	unknown	unknown
NC_018518.1\|WP_003814742.1\|229403_229796_-\|OsmC-family-protein	unknown	unknown	gnl\|CDD\|224679
NC_018518.1\|WP_161633092.1\|232734_233604_-\|carboxylating-nicotinate-nucleotide-diphosphorylase	unknown	unknown	gnl\|CDD\|180402
NC_018518.1\|WP_010927090.1\|224939_225740_+\|hydroxyacylglutathione-hydrolase	unknown	unknown	gnl\|CDD\|274569
NC_018518.1\|WP_003814743.1\|229933_230614_+\|tellurite-resistance-TerB-family-protein	unknown	unknown	gnl\|CDD\|377342

Protein	Function_ID	Function_description	E-value
NC_018518.1\|WP_003814739.1\|227254_228040_+\|enoyl-ACP-reductase-FabI	gnl\|CDD\|180789	PRK06997, PRK06997, enoyl-[acyl-carrier-protein] reductase FabI.	1.22848e-177
NC_018518.1\|WP_014905423.1\|235475_236837_+\|aromatic-ring-hydroxylating-dioxygenase-subunit-alpha	gnl\|CDD\|239561	cd03479, Rieske_RO_Alpha_PhDO_like, Rieske non-heme iron oxygenase (RO) family, Phthalate 4,5-dioxygenase (PhDO)-like subfamily, N-terminal Rieske domain of the oxygenase alpha subunit; composed of the oxygenase alpha subunits of PhDO and similar proteins including 3-chlorobenzoate 3,4-dioxygenase (CBDO), phenoxybenzoate dioxygenase (POB-dioxygenase) and 3-nitrobenzoate oxygenase (MnbA). ROs comprise a large class of aromatic ring-hydroxylating dioxygenases that enable microorganisms to tolerate and utilize aromatic compounds for growth. The oxygenase alpha subunit contains an N-terminal Rieske domain with an [2Fe-2S] cluster and a C-terminal catalytic domain with a mononuclear Fe(II) binding site. The Rieske [2Fe-2S] cluster accepts electrons from a reductase or ferredoxin component and transfers them to the mononuclear iron for catalysis. PhDO and CBDO are two-component RO systems, containing oxygenase and reductase components. PhDO catalyzes the dihydroxylation of phthalate to form the 4,5-dihydro-cis-dihydrodiol of phthalate (DHD). CBDO, together with CbaC dehydrogenase, converts the environmental pollutant 3CBA to protocatechuate (PCA) and 5-Cl-PCA, which are then metabolized by the chromosomal PCA meta (extradiol) ring fission pathway. POB-dioxygenase catalyzes the initial catabolic step in the angular dioxygenation of phenoxybenzoate, converting mono- and dichlorinated phenoxybenzoates to protocatechuate and chlorophenols. These phenoxybenzoates are metabolic products formed during the degradation of pyrethroid insecticides.	2.5666e-80
NC_018518.1\|WP_041166119.1\|237530_238403_+\|branched-chain-amino-acid-ABC-transporter-permease	gnl\|CDD\|119324	cd06582, TM_PBP1_LivH_like, Transmembrane subunit (TM) of Escherichia coli LivH and related proteins. LivH is one of two TMs of the E. coli LIV-1/LS transporter, a Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporter involved in the uptake of branched-chain amino acids (AAs). These types of transporters generally bind type 1 PBPs. PBP-dependent ABC transporters consist of a PBP, two TMs, and two cytoplasmic ABCs, and are mainly involved in importing solutes from the environment. The solute is captured by the PBP, which delivers it to a gated translocation pathway formed by the two TMs. The two ABCs bind and hydrolyze ATP and drive the transport reaction. E. coli LivH forms a heterodimer with another TM, LivM, to generate the transmembrane pore. LivM is not included in this subgroup. The LIV-1/LS transporter is comprised of two TMs (LivM and LivH), two ABCs (LivG and LivF), and one of two alternative PBPs, LivJ (LIV-BP) or LivK (LS-BP). In addition to transporting branched-chain AAs including leucine, isoleucine and valine, the E. coli LIV-1/LS transporter is involved in the uptake of the aromatic AA, phenylalanine.	1.05958e-68
NC_018518.1\|WP_010929769.1\|217601_218276_-\|orotate-phosphoribosyltransferase	gnl\|CDD\|234771	PRK00455, pyrE, orotate phosphoribosyltransferase; Validated.	1.93041e-80
NC_018518.1\|WP_010929766.1\|221004_221643_-\|trimeric-intracellular-cation-channel-family-protein	gnl\|CDD\|225415	COG2860, COG2860, Predicted membrane protein [Function unknown].	5.30548e-72
NC_018518.1\|WP_010931354.1\|223638_224106_-\|ribonuclease-HI	gnl\|CDD\|178927	PRK00203, rnhA, ribonuclease H; Reviewed.	4.07937e-102
NC_018518.1\|WP_014905419.1\|219624_220968_+\|NADP-specific-glutamate-dehydrogenase	gnl\|CDD\|181834	PRK09414, PRK09414, NADP-specific glutamate dehydrogenase.	0
NC_018518.1\|WP_003814748.1\|233741_234710_-\|hypothetical-protein	gnl\|CDD\|226596	COG4111, COG4111, Uncharacterized conserved protein [General function prediction only].	8.14847e-159
NC_018518.1\|WP_010931356.1\|225750_227160_+\|transglycosylase-SLT-domain-containing-protein	gnl\|CDD\|182727	PRK10783, mltD, membrane-bound lytic murein transglycosylase D; Provisional.	5.28635e-76
NC_018518.1\|WP_005013747.1\|222691_223642_+\|IS481-like-element-IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	9.05216e-23
NC_018518.1\|WP_014905422.1\|231685_232636_-\|IS481-like-element-IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	8.10991e-23
NC_018518.1\|WP_010929768.1\|218413_219202_+\|exodeoxyribonuclease-III	gnl\|CDD\|197336	cd10281, Nape_like_AP-endo, Neisseria meningitides Nape-like subfamily of the ExoIII family purinic/apyrimidinic (AP) endonucleases. This subfamily includes Neisseria meningitides Nape and related proteins. These are Escherichia coli exonuclease III (ExoIII)-like AP endonucleases and belong to the large EEP (exonuclease/endonuclease/phosphatase) superfamily that contains functionally diverse enzymes that share a common catalytic mechanism of cleaving phosphodiester bonds. AP endonucleases participate in the DNA base excision repair (BER) pathway. AP sites are one of the most common lesions in cellular DNA. During BER the damaged DNA is first recognized by DNA glycosylase. AP endonucleases then catalyze the hydrolytic cleavage of the phosphodiester bond 5' to the AP site, and this is followed by the coordinated actions of DNA polymerase, deoxyribose phosphatase, and DNA ligase. If left unrepaired, AP sites block DNA replication, and have both mutagenic and cytotoxic effects. AP endonucleases can carry out a variety of excision and incision reactions on DNA, including 3'-5' exonuclease, 3'-deoxyribose phosphodiesterase, 3'-phosphatase, and occasionally, nonspecific DNase activities. Different AP endonuclease enzymes catalyze the different reactions with different efficiences. Many organisms have two AP endonucleases, usually one is the dominant AP endonuclease, the other has weak AP endonuclease activity; for example, Neisseria meningitides Nape and NExo. Nape, found in this subfamily, is the dominant AP endonuclease. It exhibits strong AP endonuclease activity, and also exhibits 3'-5'exonuclease and 3'-deoxyribose phosphodiesterase activities.	5.56065e-140
NC_018518.1\|WP_023994844.1\|230618_231590_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270296	cd13578, PBP2_Bug27, Aromatic solutes transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. Bug27 binds non-carboxylated solute nicotinamide, in contrast to BugD (aspartic acid transporter) and BugE (glutamate transporter) which both bind aliphatic carboxylated ligands. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity.	2.71001e-129
NC_018518.1\|WP_014905420.1\|224148_224919_-\|methyltransferase-domain-containing-protein	gnl\|CDD\|369777	pfam08241, Methyltransf_11, Methyltransferase domain. Members of this family are SAM dependent methyltransferases.	9.83497e-10
NC_018518.1\|WP_003814742.1\|229403_229796_-\|OsmC-family-protein	gnl\|CDD\|224679	COG1765, COG1765, Predicted redox protein, regulator of disulfide bond formation [Posttranslational modification, protein turnover, chaperones].	4.86152e-16
NC_018518.1\|WP_161633092.1\|232734_233604_-\|carboxylating-nicotinate-nucleotide-diphosphorylase	gnl\|CDD\|180402	PRK06106, PRK06106, carboxylating nicotinate-nucleotide diphosphorylase.	5.21715e-174
NC_018518.1\|WP_010927090.1\|224939_225740_+\|hydroxyacylglutathione-hydrolase	gnl\|CDD\|274569	TIGR03413, GSH_gloB, hydroxyacylglutathione hydrolase. Members of this protein family are hydroxyacylglutathione hydrolase, a detoxification enzyme known as glyoxalase II. It follows lactoylglutathione lyase, or glyoxalase I, and acts to remove the toxic metabolite methylglyoxal and related compounds. This protein belongs to the broader metallo-beta-lactamase family (pfam00753). [Cellular processes, Detoxification].	2.85848e-146
NC_018518.1\|WP_003814743.1\|229933_230614_+\|tellurite-resistance-TerB-family-protein	gnl\|CDD\|377342	pfam04391, DUF533, Protein of unknown function (DUF533). Some family members may be secreted or integral membrane proteins.	6.37985e-62

>NC_018518.1|WP_003814739.1|227254_228040_+|enoyl-ACP-reductase-FabI
MGFLAGKRILMTGVLSNRSIAYGIARACRDQGADLAFTYVGDRFKERITEFAASFGSDIVLPCDVAEDSQIDAAFAELGKRWDGLDGLVHAIGFAPREAIAGDFLDGLSRENFRIAHDISAYSFPAMAKAALPLMEGRKGSVLTLSYLGSERVVANYNTMGLAKASLEASVRYLATALGPRGIRANAISAGPIKTLAASGIKDFSSILKFVEANAPLRRNVTIEDVGNVAAFMLSDLAAGITGEITHVDAGFSTVVPGMEN
>NC_018518.1|WP_010931356.1|225750_227160_+|transglycosylase-SLT-domain-containing-protein
MRFLRLLLPLFLAVLAGCAGTAKQNQAAGPSSNRYIAQDTSRTVDLTSPPSDAWDRIRRGFAIPNLNTDLAQEWTDYYASHPESVQRMAERAGKYLYFIVDEINRRGLPTELALLPFVESAYNPTALSRSQASGLWQFIPTTGQHFNLKQDWWRDERRDPIASTYAALDYLEKLFEMQGDWYLALASYNWGEGSVQRAMAKNEAAGLSTDYLSLNMPDETRNYVPKLQAIKNIIANPRKFAVVLPPVENTPYFVAVQKNRDIDIELAARLAEMPLDEFKALNPAFNRPLIRGEHAPTLLLPADRADRFNANLQNYKGDLSSWKVYHTRRGESYAAIAKRFGISEAKLRASNDIGSKRKVAADQALLIPGVPSGDGAANIQLASLSPPVGALDNVGEPRAAAAPRGKAPARVASARPNVRTHKVSSGDTLFGLARKYGTSVGALRALNNLKGNNLKLGSQLRIPGTGTRG
>NC_018518.1|WP_010927090.1|224939_225740_+|hydroxyacylglutathione-hydrolase
MQTAPPLSAVVPLPAFSDNYIWALAHEGQAAVVDPGDAAPVLRWLRATGATLRAILLTHHHPDHVGGVLELVQATGATVYGPAGETLPHCDVRLAEGDRVTLPELALALEVLDVPGHTAGHIAYTGRAAGVERVLFCGDTLFAGGCGRLFEGTPAQMLDSLEKLSALPADTQVCCAHEYTLANLRWALAVEPANRTLQQWYQRAQELRNEGTPTLPSTIGQERETNPFLRTPHAAVAHAAAVWSGRSLATPVEVFAALRQWKNNFK
>NC_018518.1|WP_014905420.1|224148_224919_-|methyltransferase-domain-containing-protein
MAEETPPIVELAEWFQTPPGQYVLAWEQAQFDEAVADIFGYYAWQVGLAEPNLLRANRMPFKAWVGAGVPPPELAQGWQACVAAAPEALPFESQSVDLLVLPHAFECAEAPHLVLREVERVLVPEGRVVISGFNLWSLWGARNLMPGMEAWLPLPLSAQVALPRLKDWFKLLSFEVERGRFGCYAPACRTDKWLRRWRFMERYGQRWWGLGGAVYVVTATKKVAAMRLIGPAWKTRRKRAQAASVVVNRQADDPGR
>NC_018518.1|WP_010931354.1|223638_224106_-|ribonuclease-HI
MQNLEGSGDGQQVEMWTDGACKGNPGPGGWGVLMRAGQHEKTMHGGERQTTNNRMELMAVIEGLRALKRPCRVTIHTDSQYVMKGMTEWLANWKRRGWRTADKKPVKNVELWQALDEQVGRHQVQWRWVRGHAGDPGNERADALANQGMEAARGR
>NC_018518.1|WP_005013747.1|222691_223642_+|IS481-like-element-IS481-family-transposase
MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHT
>NC_018518.1|WP_010929766.1|221004_221643_-|trimeric-intracellular-cation-channel-family-protein
MPPDPSVLLLYTLYLVAIVAEAMTAALAAGRRDMDWVGVCVIACVTALGGGSLRDVLLGHYPLSWVAHPEYLWMTAGAALLTALGARALRRLRSLFLLLDAIGLVAFTIIGCQVAQQMEMPLTIVLVSGMITGCAGGVLRDVLCNDIPLLFRSELYASVSAVTGGLYLAMYGQGVSASVSVPVALAVGLAFRLLALRFNWQMPKFVYRGDWH
>NC_018518.1|WP_014905419.1|219624_220968_+|NADP-specific-glutamate-dehydrogenase
MKLQSLDDFLRRVAARDPQQAEFMQAVQEVMLSLWPFIEKHPHYAEHALLERLVEPERVIQFRVCWTDDQGQAQVNRAFRIQHSSAIGPFKGGMRFHPTVNLSVLKFLAFEQTLKNALTTLPMGGGKGGSDFDPKGKSDAEVMRFCQALMLELHRHLGPDTDVPAGDIGVGAREVGFMAGMMKKLSNSAASVFTGKGLCFGGSLIRPEATGYGTVYFAQEMLQRAGLSFDGMRVSVSGSGNVAQYAIEKAMALGAKVVTISDSCGTVIDEAGFTHEKLLALMHIKNDLRGRLDTYASQFGLRYEAGVRPWHVPVDVALPCATQNELDENDARTLIRNGVKCVAEGANMPATLDAAKAFIAAEVLYAPGKASNAGGVAVSGLEMSQNSARLPWTREQVDARLHAIMRDIHENCVRHGHGAGNYVNYVDGANIAGFVKVADAMRQQGLY
>NC_018518.1|WP_010929768.1|218413_219202_+|exodeoxyribonuclease-III
MLRITSLNLNGIRSAFRKGLQPWMTAHNADVLCLQEIKVSHDDLTDELRHPPGYTGHFHHAEKKGYSGVGMYLRAGAERVVAGFDCEEFDAEGRILRADWKDLSVISAYLPSGSSGDERQQTKYRFLDQFGPWLDGLMAEHRKTGREFVICGDWNIAHKEIDLKNWKGNQKNSGFLPEERAWLTEVFDRRGFVDVFRKLDERADQYTWWSNRGQAWAKNVGWRIDYQIATPGIAERARATSIYKDERFSDHAPLTVDYDIAL
>NC_018518.1|WP_010929769.1|217601_218276_-|orotate-phosphoribosyltransferase
MSASASTAADFVRFALDEGVLRFGSFKVKSGRISPYFFNAGLFNSGRSVGTLAGFYAQALIDSGVAFDMLFGPAYKGIPLATATSVALAGHGAMAGRDVPFAFNRKEAKDHGEGGTLVGAPLTGKVVIIDDVITAGTSVRESVEIIRAAGAEPAAVLIALDRMERAGPDDALSPHSAVQDVARTYGIPVVSIASLADIMTLLQDDAQFAEHRAAVQAYRSKYGV
>NC_018518.1|WP_003814742.1|229403_229796_-|OsmC-family-protein
MTIQVRANTPGGLQYTATAEGHELPLAMPQPQGEGPDPHDYFDTALGGCKALTLMVYAQRKGLPLQAVDVDVVRDASEERKGIYRLTAKLKLHGDLDDAQIDELLKVADKCPLHKLMTATDIQVSTIVVE
>NC_018518.1|WP_003814743.1|229933_230614_+|tellurite-resistance-TerB-family-protein
MSARQLLDQLLQSGQSLMQGAGAQAQQATQGGKGTFLAGLGGGALGAGALGLLLGSKKARKIGGKVAMYGGMAALGALAYRAYDQYQRNQAGGAAAPAPQTLDRLPPAQAEQHSNAVLVAMIGAAKADGHIGPDERQLLETELAKLSGDAGDRAWLEAELARPLDPAVIAQQARTPEMGAEMYLASLLVADEQSFMERAYLDELARQLKLPAELKQQLEAQVPAAA
>NC_018518.1|WP_023994844.1|230618_231590_-|tripartite-tricarboxylate-transporter-substrate-binding-protein
MKSQVSILLAGCLLGAGAAAAQAPATYPDHAITIVVTFPPGGGTDLLARKLGAAMQQRLGQPVVVENRPGASGNIGARAVAEARPDGYTLLMVNSSFAVNPGVFRNLDFSPTRDFTAVINVAYVPSVIVTAEPAGDAGLPERLRQADTQSRTLAFASCGNGTPQHLAGEMLRQASGAWLQHVPYRGCGPALTDVLSRQVPLGIVTASSAAPFIHAGKLRALAVTSAQRSPLLPDVPTVAEQGAPGYELDQWHGLLAPAGTPPAVIQRLYEALSAIVAEPAMRRELESLGFNPVSEGPERFEALVQADIARFAALTARMGLRAD
>NC_018518.1|WP_014905422.1|231685_232636_-|IS481-like-element-IS481-family-transposase
MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVRS
>NC_018518.1|WP_161633092.1|232734_233604_-|carboxylating-nicotinate-nucleotide-diphosphorylase
MDAAPTLRTAPAPLPQVMLEPLVRAALLEDLGRAGDITTDAIVPAQARAQTRLVARQAGVLAGLDLARLAFRLVDPEIEFHALLPDGAQLQPGAEIALIRGPARGMLTAERTALNFLCHLSGVASATASIVAAIGAGHTKVTCTRKTMPGLRAVQKYAVRVGGGSNHRYGLDDAVLIKDNHVAIAGGIDAAVQRARAAIGHMVKIEVEVDTLEQLRVALRLGVDVVLLDNMDLDTLREAVALVDGRAVTEASGRITPETAPAVAATGVDLMAIGWLTHSARVLDIGLDS
>NC_018518.1|WP_003814748.1|233741_234710_-|hypothetical-protein
MAAPRLPYPIPIALTDALDRSVSAELVAVLVAVTQGEPRVLTTEDARALPAGPFELAHRSLQAGLRAWVETQTHHPLGYVEQLYTFADSDRSNEAGARVISVSYLGLTREAGATGVAQVGWQHWYRYFPWEDWRAGRPAIIADEIAPRLLAWAGAGADAAARAQRRQRVALTFGLDGAGWNEDMVLQRYELLFEAGLVPESRHPDASGLPVAGQSMRHDHRRILATGIARLRAKIKYRPVVFELMPPEFTLLQLQMAVEALAGRGLHKQNFRRLIEQQELVEETGGMASGAAGRPAKLFRFRRDVLLERAIAGSKLPLARQF
>NC_018518.1|WP_003820674.1|235014_235248_+|hypothetical-protein
MTKTARDSQPADPHAQSWPHRPVNARKGTDVMPMPEEAPQVAGMPRRGRAIAEPGDPGVITPEDDVLDTSHLSNPQR
>NC_018518.1|WP_014905423.1|235475_236837_+|aromatic-ring-hydroxylating-dioxygenase-subunit-alpha
MEKKIVLVKPYSAYERDKTPAENADLTRVEKGSPMGEYLRRFWQPVALSEELGELPTAVRMFGENLVLFRARNGKPGLLEKHCSHRGTSLEFGICEENGLRCCYHGWLFGVDGQILETPGDPPDSQLRFNVCHGAYPLHEYRGIIFGYFGPPADKPEFPVYDTYDIPGDRLVPYCITYPCNWLQVHENVMDPAHAVFLHTRISFTQFAEAWGELPEMDFVPTPTSMIYVTSRRWEDKVWVRSNDIVLPNLAQVGHIWEDGLTPKEFARVAITRWTTPIDDHTCRIIGWRHMHPDADPRGLADESLCGVETVDFFGQNGERPYADRQRMPGDYDAQISQRPIAVHAMENLTRCDRGVAMLRQLLRRESRKIANGEAPAISPLRANGATPTYAHDTVVSIPPADTDDAACVREIGKAITAIVVKGDHHEQADRPEQVRERIRAYAAEQASTATSE
>NC_018518.1|WP_003814756.1|236895_237534_+|hypothetical-protein
MSSPVHPGKVAWTGDNPGIYLKEQDDGPWTGLATYFHINYSPYGMGRGVLLLEQPDIAATLPQACNVCITDNEPLARYLMKEFFARFNSFRVSAGTEAISYLPLTEARSAGDTRSRYQEILRSRDIEVVLTWDGLTEPYAVDMPPEKGPTGRHEMYSLFIDATDASITLNGKPLRGRVTTRNFDGGKKSSAFLAFSESWMETPSDGTDKRTT
>NC_018518.1|WP_041166119.1|237530_238403_+|branched-chain-amino-acid-ABC-transporter-permease
MMTEFLQYLVSGLVVGCIYGLVAIGFTAVYNVTNIVNFAQGEVSMLGALATASMLAAGVPLPLAVVACVLLVGALGVVLERFALRPVGSHAIRGIIITIGISVVLQGLAVVTWGTDAQSLPAFSGSTPISVYGVSMQPQAFWVLGTSVVLMAVLYVFLTRTYLGRSFRACAMNPQAAALMGIPSSVMRGLGFFLSGAVGAIAGIIIAPIALMQYDSGAALGIKGFVACIMGGFGNPVGAAAGGLLLGLLEAFSAGYISSGFKNAIAFVLLLAFLLVRPGGLFGEFDKVKR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_018518_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_018518_2

1433395-1433489

Orphan

Consensus_repeat	Method
TAAAAGGGCACCCGCAAGGGTGTCCTTTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_018518_2

>merge|NC_018518|2|1433395-1433489|CRISPRCasFinder
TAAAAGGGCACCCGCAAGGGTGTCCTTTTATTGCGAAAAGATATCTGGAAGAAAGCCTTTTCAGAGTAAAAGGGCACCCGCAAGGGTGCCTTTTT

>NC_018518|2|2|1433395-1433489|CRISPRCasFinder
TAAAAGGGCACCCGCAAGGGTGTCCTTTT	ATTGCGAAAAGATATCTGGAAGAAAGCCTTTTCAGAG
TAAAAGGGCACCCGCAAGGGTGCCTTTTT

Protein	Signature genes	Signature genes Name	Protein_function
NC_018518.1\|WP_010930124.1\|1447254_1447869_-\|SCO-family-protein	unknown	unknown	gnl\|CDD\|239266
NC_018518.1\|WP_023852693.1\|1429951_1431226_+\|PA0069-family-radical-SAM-protein	unknown	unknown	gnl\|CDD\|275263
NC_018518.1\|WP_014486063.1\|1445403_1446786_+\|efflux-transporter-outer-membrane-subunit	unknown	unknown	gnl\|CDD\|273830
NC_018518.1\|WP_029443805.1\|1440500_1441418_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
NC_018518.1\|WP_003821532.1\|1425693_1426758_+\|sulfate-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213263
NC_018518.1\|WP_014905650.1\|1421991_1422633_+\|peroxiredoxin	unknown	unknown	gnl\|CDD\|239314
NC_018518.1\|WP_003813314.1\|1433538_1434264_+\|CoA-pyrophosphatase	unknown	unknown	gnl\|CDD\|239518
NC_018518.1\|WP_010930111.1\|1418909_1419839_+\|electron-transfer-flavoprotein-subunit-alpha	unknown	unknown	gnl\|CDD\|224936
NC_018518.1\|WP_003821527.1\|1420082_1421909_+\|acyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|173842
NC_018518.1\|WP_014905652.1\|1431767_1432640_-\|EamA-family-transporter	unknown	unknown	gnl\|CDD\|274527
NC_018518.1\|WP_003813315.1\|1432947_1433328_+\|50S-ribosomal-protein-L19	unknown	unknown	gnl\|CDD\|235418
NC_018518.1\|WP_023852686.1\|1431379_1431760_+\|hypothetical-protein	unknown	unknown	unknown
NC_018518.1\|WP_010930048.1\|1434359_1435310_-\|IS481-like-element-IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
NC_018518.1\|WP_080019424.1\|1426754_1428464_+\|sulfate-adenylyltransferase-subunit-CysD	unknown	unknown	gnl\|CDD\|235375
NC_018518.1\|WP_010930119.1\|1439717_1440449_+\|rRNA-pseudouridine-synthase	unknown	unknown	gnl\|CDD\|224108
NC_018518.1\|WP_010926548.1\|1439085_1439658_-\|chorismate-lyase	unknown	unknown	gnl\|CDD\|225703
NC_018518.1\|WP_010930123.1\|1446855_1447107_-\|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein	unknown	unknown	gnl\|CDD\|225170
NC_018518.1\|WP_010930525.1\|1436560_1437577_-\|IS110-like-element-IS1663-family-transposase	unknown	unknown	gnl\|CDD\|376773
NC_018518.1\|WP_010930118.1\|1435414_1436464_+\|NADP(H)-dependent-aldo-keto-reductase	unknown	unknown	gnl\|CDD\|381320
NC_018518.1\|WP_003821528.1\|1422822_1423857_+\|sulfate-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|224529

Protein	Function_ID	Function_description	E-value
NC_018518.1\|WP_010930124.1\|1447254_1447869_-\|SCO-family-protein	gnl\|CDD\|239266	cd02968, SCO, SCO (an acronym for Synthesis of Cytochrome c Oxidase) family; composed of proteins similar to Sco1, a membrane-anchored protein possessing a soluble domain with a TRX fold. Members of this family are required for the proper assembly of cytochrome c oxidase (COX). They contain a metal binding motif, typically CXXXC, which is located in a flexible loop. COX, the terminal enzyme in the respiratory chain, is imbedded in the inner mitochondrial membrane of all eukaryotes and in the plasma membrane of some prokaryotes. It is composed of two subunits, COX I and COX II. It has been proposed that Sco1 specifically delivers copper to the CuA site, a dinuclear copper center, of the COX II subunit. Mutations in human Sco1 and Sco2 cause fatal infantile hepatoencephalomyopathy and cardioencephalomyopathy, respectively. Both disorders are associated with severe COX deficiency in affected tissues. More recently, it has been argued that the redox sensitivity of the copper binding properties of Sco1 implies that it participates in signaling events rather than functioning as a chaperone that transfers copper to COX II.	2.62796e-54
NC_018518.1\|WP_023852693.1\|1429951_1431226_+\|PA0069-family-radical-SAM-protein	gnl\|CDD\|275263	TIGR04470, hypothetical_protein_ALIPUT_00462, radical SAM mobile pair protein B. Members of this family are the downstream member (B) of a pair of tandem-encoded radical SAM enzymes. Most of these radical SAM gene pairs have an additional upstream regulatory gene in the MarR family. Examples of high sequence identity (over 96 percent) from cassettes in several Treponema species of the oral cavity to those in multiple Firmicutes in the gut microbiome suggest recent lateral gene transfer, as might be expected for antibiotic resistance genes. The function is unknown.	4.71758e-24
NC_018518.1\|WP_014486063.1\|1445403_1446786_+\|efflux-transporter-outer-membrane-subunit	gnl\|CDD\|273830	TIGR01845, Outer_membrane_protein_OprM, efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family. Members of this model comprise a subfamily of the Outer Membrane Factor (TCDB 1.B.17) porins. OMF proteins operate in conjunction with a primary transporter of the RND, MFS, ABC, or PET systems, and a MFP (membrane fusion protein) to tranport substrates across membranes. The complex thus formed allows transport (export) of various solutes (heavy metal cations; drugs, oligosaccharides, proteins, etc.) across the two envelopes of the Gram-negative bacterial cell envelope in a single energy-coupled step. Current data suggest that the OMF (and not the MFP) is largely responsible for the formation of both the trans-outer membrane and trans-periplasmic channels. The roles played by the MFP have yet to be determined. [Cellular processes, Detoxification, Transport and binding proteins, Porins].	9.9815e-102
NC_018518.1\|WP_029443805.1\|1440500_1441418_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	4.56316e-67
NC_018518.1\|WP_003821532.1\|1425693_1426758_+\|sulfate-ABC-transporter-ATP-binding-protein	gnl\|CDD\|213263	cd03296, ABC_CysA_sulfate_importer, ATP-binding cassette domain of the sulfate transporter. Part of the ABC transporter complex cysAWTP involved in sulfate import. Responsible for energy coupling to the transport system. The complex is composed of two ATP-binding proteins (cysA), two transmembrane proteins (cysT and cysW), and a solute-binding protein (cysP). ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.	5.12136e-166
NC_018518.1\|WP_014905650.1\|1421991_1422633_+\|peroxiredoxin	gnl\|CDD\|239314	cd03016, PRX_1cys, Peroxiredoxin (PRX) family, 1-cys PRX subfamily; composed of PRXs containing only one conserved cysteine, which serves as the peroxidatic cysteine. They are homodimeric thiol-specific antioxidant (TSA) proteins that confer a protective role in cells by reducing and detoxifying hydrogen peroxide, peroxynitrite, and organic hydroperoxides. As with all other PRXs, a cysteine sulfenic acid intermediate is formed upon reaction of 1-cys PRX with its substrates. Having no resolving cysteine, the oxidized enzyme is resolved by an external small-molecule or protein reductant such as thioredoxin or glutaredoxin. Similar to typical 2-cys PRX, 1-cys PRX forms a functional dimeric unit with a B-type interface, as well as a decameric structure which is stabilized in the reduced form of the enzyme. Other oligomeric forms, tetramers and hexamers, have also been reported. Mammalian 1-cys PRX is localized cellularly in the cytosol and is expressed at high levels in brain, eye, testes and lung. The seed-specific plant 1-cys PRXs protect tissues from reactive oxygen species during desiccation and are also called rehydrins.	2.41753e-131
NC_018518.1\|WP_003813314.1\|1433538_1434264_+\|CoA-pyrophosphatase	gnl\|CDD\|239518	cd03426, CoAse, Coenzyme A pyrophosphatase (CoAse), a member of the Nudix hydrolase superfamily, functions to catalyze the elimination of oxidized inactive CoA, which can inhibit CoA-utilizing enzymes. The need of CoAses mainly arises under conditions of oxidative stress. CoAse has a conserved Nudix fold and requires a single divalent cation for catalysis. In addition to a signature Nudix motif G[X5]E[X7]REUXEEXGU, where U is Ile, Leu, or Val, CoAse contains an additional motif upstream called the NuCoA motif (LLTXT(SA)X3RX3GX3FPGG) which is postulated to be involved in CoA recognition. CoA plays a central role in lipid metabolism. It is involved in the initial steps of fatty acid sythesis in the cytosol, in the oxidation of fatty acids and the citric acid cycle in the mitochondria, and in the oxidation of long-chain fatty acids in peroxisomes. CoA has the important role of activating fatty acids for further modification into key biological signalling molecules.	5.50907e-72
NC_018518.1\|WP_010930111.1\|1418909_1419839_+\|electron-transfer-flavoprotein-subunit-alpha	gnl\|CDD\|224936	COG2025, FixB, Electron transfer flavoprotein, alpha subunit [Energy production and conversion].	1.05379e-120
NC_018518.1\|WP_003821527.1\|1420082_1421909_+\|acyl-CoA-dehydrogenase	gnl\|CDD\|173842	cd01153, ACAD_fadE5, Putative acyl-CoA dehydrogenases similar to fadE5. Putative acyl-CoA dehydrogenase (ACAD). Mitochondrial acyl-CoA dehydrogenases (ACAD) catalyze the alpha,beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of ACAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. The ACD family includes the eukaryotic beta-oxidation, as well as amino acid catabolism enzymes. These enzymes share high sequence similarity, but differ in their substrate specificities. The mitochondrial ACD's are generally homotetramers and have an active site glutamate at a conserved position.	6.94362e-153
NC_018518.1\|WP_014905652.1\|1431767_1432640_-\|EamA-family-transporter	gnl\|CDD\|274527	TIGR03340, phn_DUF6, phosphonate utilization associated putative membrane protein. This family of hydrophobic proteins has some homology to families of integral membrane proteins such as (pfam00892) and may be a permease. It occurs in the vicinity of various types of operons for the catabolism of phosphonates in Vibrio, Pseudomonas, Polaromonas and Thiomicrospira.	3.74356e-26
NC_018518.1\|WP_003813315.1\|1432947_1433328_+\|50S-ribosomal-protein-L19	gnl\|CDD\|235418	PRK05338, rplS, 50S ribosomal protein L19; Provisional.	1.34063e-62
NC_018518.1\|WP_010930048.1\|1434359_1435310_-\|IS481-like-element-IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	9.05216e-23
NC_018518.1\|WP_080019424.1\|1426754_1428464_+\|sulfate-adenylyltransferase-subunit-CysD	gnl\|CDD\|235375	PRK05253, PRK05253, sulfate adenylyltransferase subunit CysD.	0
NC_018518.1\|WP_010930119.1\|1439717_1440449_+\|rRNA-pseudouridine-synthase	gnl\|CDD\|224108	COG1187, RsuA, 16S rRNA uridine-516 pseudouridylate synthase and related pseudouridylate synthases [Translation, ribosomal structure and biogenesis].	7.73356e-72
NC_018518.1\|WP_010926548.1\|1439085_1439658_-\|chorismate-lyase	gnl\|CDD\|225703	COG3161, UbiC, 4-hydroxybenzoate synthetase (chorismate lyase) [Coenzyme metabolism].	1.05194e-17
NC_018518.1\|WP_010930123.1\|1446855_1447107_-\|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein	gnl\|CDD\|225170	COG2261, COG2261, Predicted membrane protein [Function unknown].	2.42408e-12
NC_018518.1\|WP_010930525.1\|1436560_1437577_-\|IS110-like-element-IS1663-family-transposase	gnl\|CDD\|376773	pfam02371, Transposase_20, Transposase IS116/IS110/IS902 family. Transposases are needed for efficient transposition of the insertion sequence or transposon DNA. This family includes transposases for IS116, IS110 and IS902. This region is often found with pfam01548. The exact function of this region is uncertain. This family contains a HHH motif suggesting a DNA-binding function.	3.99585e-23
NC_018518.1\|WP_010930118.1\|1435414_1436464_+\|NADP(H)-dependent-aldo-keto-reductase	gnl\|CDD\|381320	cd19094, AKR_Tas-like, Escherichia coli Tas protein and similar proteins. Escherichia coli Tas protein is the prototype of this family. It is an NADP(H)-dependent aldo-keto reductase that catalyzes the reversible reduction of ketones to the respective alcohols using NADP(H) as a hydride donor.	0
NC_018518.1\|WP_003821528.1\|1422822_1423857_+\|sulfate-ABC-transporter-substrate-binding-protein	gnl\|CDD\|224529	COG1613, Sbp, ABC-type sulfate transport system, periplasmic component [Inorganic ion transport and metabolism].	0

>NC_018518.1|WP_003813315.1|1432947_1433328_+|50S-ribosomal-protein-L19
MNLIAILEQEEIARLTGGNAVTEFAPGDTVVVSVNVVEGTRKRVQAFEGVVIAKRNRGLNSSFIVRKISSGEAVERTFQLYSPQIAGIEVKRRGDVRRAKLYYLRSRSGKSARIKEKLVLKKAKSA
>NC_018518.1|WP_014905652.1|1431767_1432640_-|EamA-family-transporter
MSYTSLILVVLAAMAHAAWNLLAKRAAMVGPMFVFAYGLAATILYAPWVIWVLAHDGMVWSWPVVLCILASSMLHLGYSLCLQRGYQVADLSVVYPIARGTGPLLSTMGAFTLLSEPATTTGIAGMLCVVGGVLLIATQGRLGMFRQAQAWIGVRWGVVIGLFIAAYTVVDAYGVKILLIMPVLFDWFTCATRTLMMTPHVLRRRAQYWPAMRGYWHLAIAVGVLSPLGYILVLYALRNGAPLSLVAPAREMSMMLGTLAGMFLLREKVGIGRLAGCLAILAGVVLLGSS
>NC_018518.1|WP_023852686.1|1431379_1431760_+|hypothetical-protein
MTIATTLDAATSLPTAVPGRTLGALRRLARAWAGAAVPQRKWPFPPTPPGQAQPCTPCTDSQPRSVQAVQPAQARALHAQAELSGAATQAATQVLSTKAKIIDVLLVAVWGAMIPALMWLGAAGGF
>NC_018518.1|WP_023852693.1|1429951_1431226_+|PA0069-family-radical-SAM-protein
MASTEHSFSAGFGSPAAAPAALRGRGAVTNVPHRFQQADRVRVDDGWANPDYTAGSDAAALPSVAEALGQGGRRAIPIAVEGADASPNTCAQAPAPRTIVQAEEARKMLSRNDSPDIPFDVAANPYRGCEHGCVYCYARPTHAYLGYSPGLDFETRLVAKANAVAALRAELARPGYRASPINIGSATDAYQPIERTWRLTRGMLELLLQTRHPLTVVTKNALVERDLDLLQDLARQKLVTVFVSITTLDAAMARTLEPRASAPYRRLQTVRTLAQAGVPVGVLVAPVIPFINDESLEHILQEASAAGACYASYTVLRLPWEVKEVFETWLQAHFPDRAQRVLHRIEDLRNGRRNDTAFGSRMRGTGIWADLLRQRFALATRKLDLNRHRPELDTHRFVPPLEPGLPPARGRREARAQPGQLALF
>NC_018518.1|WP_080019424.1|1426754_1428464_+|sulfate-adenylyltransferase-subunit-CysD
MMAARPLAAIAGLTAAAAARWHDLQSLLAIIARQYPDAALASSLAAEDMVLTHAIYAGGLDLEVFTLDTGRLHTETLGVLDAVATRYGRAITVYRPDAAAVQAHVDAHGMHAFYESVALRKACCEIRKVEPLRRALAGRGAWITGQRRAQSATRGELPDEERDPVFGLYKFNPLAAWNEADVWSVIRALGIPYNPLHDQGYPSIGCEPCTRAVRPGEDVRAGRWWWESSDSKECGLHAGNRVIQIEARLPEARIATDIDNADRKETPMSAVMTRSHLDWLESEAIFILREVAAECARPALLFSGGKDSVVLLRLAEKAFRPGRFPFPLLHIDTGHNYDEVISFRDARAAELGETLLVRSVEDSIARGSVALRRETDSRNAAQAVTLLEAIEELGLDACIGGARRDEEKARAKERIFSFRDEFGQWDPKAQRPELWNLFNTRVHRGENMWVFPISNWTELDVWQYIQRERLALPSIYYSHTREVVRRKGLLVPVTRLTPPAKGETVEQLAVRFRTVGDISCTCPVASDAADPAAIIAETAVTDITERGATRMDDQTSEASMERRKREGYF
>NC_018518.1|WP_003821532.1|1425693_1426758_+|sulfate-ABC-transporter-ATP-binding-protein
MSIEVRGLSKRFGAFRALDEVSLHIETGELVALLGPSGCGKTTLLRIIAGLESADAGSVLFAGEDATEVDVRQRQVGFVFQHYALFKHMTVFENVAFGLRVRHRSQRPSEARIRAKVLDLLGLVQLDWLADRYPAQLSGGQRQRIALARALAVEPRVLLLDEPFGALDAKVRKELRRWLRRLHDELHVASVFVTHDQEEALEVADRVVLMNAGRIEQVGSPREVWERPATPFVYGFLGDVNQLHGHATRGVWRLGEVALPAPDLPEADNQRAIAYVRPHDIDLARAGTAAPGIPVRLNHVYLAGPSAYLELARQDDQAIIEAQVPEPLFRSLGLKEGEALLAQPRRARVFAVQP
>NC_018518.1|WP_003821528.1|1422822_1423857_+|sulfate-ABC-transporter-substrate-binding-protein
MPRNTAGIRGAIVALATVFSLGLPWAVQAQDKQTLLNVSYDPTRELYRAVDEAFIKEYQARAGVDLTVRQSHGGSGRQARSVIDGLDADVVTLALAYDIDAIADRGLLPQDWQKRLPRNSSPYTSTIVFLVRKGNPRQIHDWDDLVKDGVQVITPNPKTSGGARWNYLAAWAYALARNEGSEAKAREFVGQLLSHVPVLDTGARGSTTTFVERGVGDVLLAWENEAFLAREELGPDKFDIVVPSLSILAEPPVAVVDKVVDRKGTRAAAQAYLEYLYTPAAQEIIARNFYRPTDAGVAAKYASRFPKLKLVTIDDPIFGGWRKAQKDHFSDGGTFDQVYQPQRK
>NC_018518.1|WP_014905650.1|1421991_1422633_+|peroxiredoxin
MGQLRLGDTAPDFEQKSSIGPLRLYDYLGDSWGVLFSHPADFTPVCTTELGYTAKLVGEFAKRNVKVLALSVDPVDSHTKWIDDINDTQSTTVNFPILADDDRKVSELYDMIHPNANATLTVRSVFVIDPAKKVRLTITYPASTGRNFDEILRVIDSLQLTDSHSVATPVNWKDGEDVIIVPSLKDEAVIKEKFPKGYKALRPYLRITPQPNK
>NC_018518.1|WP_003821527.1|1420082_1421909_+|acyl-CoA-dehydrogenase
MTYATPLQDFRFALNELAGLEEILKLPGFEEVTPDLVDAILEENARFVQQAIAPLNVAGDTKPPVWNDGQVTTTPGFSQGFADYTAGGWQGLQHPQKWGGQGLPKVVAAPAGENIQAASLAFSLCPMLTDGVIEALLTVGSEAQRQTYVPKLIGGQWTGTMNLTEPQAGSDLAQVATRAVRQDDGSYRLSGQKIFITYGEHDLAENIIHLVLARTPDAPAGVKGISLFIVPKYLVNEDGSRGKRNDVWCASLEHKLGIHGSPTAVLLYGAGKGEVGEGAVGYLVGEANRGLEYMFIMMNAARYSVGQQGIGVSERAYQHAQAYARERVQGRAIEGSAAPVTIAHHPDVQRMLLTMRALTEAARAVSYVAAAAHDKGTHHPDAEVRARNRAFYEYLVPIVKGFSTESAVEVASLGIQVHGGMGFIEETGAAQHYRDARILPIYEGTTAIQANDLVGRKTLRDGGATAHASIAAMRDTLKAVAAEAQRADTADHTALRVLRDNFDQAIQSYEGAVEFILAHAASNVRAVYSSSVPYLMLAGVVHGGWQMARAALACRRHLAAGSGDAFHRHKLGTALFYGAHILPRALALAAAVRAGDVADSCGSMADIA
>NC_018518.1|WP_010930111.1|1418909_1419839_+|electron-transfer-flavoprotein-subunit-alpha
MTTLVIAEHDNAQLKGATLNTIAAASRLGGEVHVLVAGSGAQAVAEQAAQAARVSKVLLADAPQLAEGLAENLAAQVLAVAGGYSHILFAATASGKNVAPRVAAKLDVAQISDIIGVESADTFQRPIYAGNAIATVQSGDAVKVITVRTTGFDAVAAQGGSAAVEALDAVADSGLSRFVGREVAKSDRPELAGARVVVSGGRGLGSAENFKILDPLADKLGAALGASRAAVDAGYAPNDWQVGQTGKIVAPQLYVAVGISGAIQHLAGMKDSKVIVAINKDPEAPIFGVADYGLVGDLFQVVPELTGAL
>NC_018518.1|WP_003813314.1|1433538_1434264_+|CoA-pyrophosphatase
MSDSAPSRPRRTPVRPLFDPMAQPWETANQGLARVDERLLTPPELRSSLRPADHWRLDPLCAAEPRAPGREGSLVAAAVLIPLVMRADGVRVMLTQRAAHLHDHAGQVSFPGGRIEVSDATPVAAALREAQEETGLPVQQVEVLGSMPQYFTATGFAITPVVSLVQPDFELAPDAFEVAEVFEVPLSFLMDPANHRLYRAALPDGYVRQYYAMPWQRYFIWGATAGMLRNLYQTVREALPG
>NC_018518.1|WP_010930048.1|1434359_1435310_-|IS481-like-element-IS481-family-transposase
MNTHKHARLTFLRRLEMVQQLIAHQVCVSEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHS
>NC_018518.1|WP_010930118.1|1435414_1436464_+|NADP(H)-dependent-aldo-keto-reductase
MKYRKLGHTDLDVSLIGLGTMTWGEQNTEAQAHEQLDYALAHGINLVDAAEMYPVPPKPETQGRTESCIGSWLARTGRRHEVVLASKAAGPVRDAKRPSHIRDGKTFLDRKNLTQALDASLKRLQTDYLDLYQLHWPDRTTNTFGKLAYPWVDDAHTVPIEETLEVLQDFVRAGKVRHVGLSNETPWGVARFLQAAEKHGLPKVATIQNPYNLLNRIFEIGLAEFSHREGVGLLAYSPLAMGILSGKYLDGARPEGSRLALFTRFTRYSNPQAEAAARDYVMLARDHGLAPAQMALAWVNQRPFVSSNLMGATTLAQLKENIESVEVTLSDEVLQGIEAIHARQPNPAP
>NC_018518.1|WP_010930525.1|1436560_1437577_-|IS110-like-element-IS1663-family-transposase
MADSSLLSAGGQVHVFIGIDVSKAKLDCTLLTAEADKRKTKVVVNTAAGVQALLAWCAKHGAQPAQLHAILEPTGLYHEQAATALPQVRVSLVNPAQARDFAKALALRSKNDALDSYVLARYGQTLSPALWHPAPLHARQLRALLTRREALSKDLLRELNRKEKSQFSPSAPLVDGSIDKAIAFLREQIKQIERAIDQHIDNHPDLKQDCELLNSIPAIGPQAGNAILAVMHNRHIDSAQSLAAYLGVVPVQRQSGSSLNSCARLSKAGPSQVRATLYMAALVGTRHNPHIRALYQRLLKAGKSKKAALGAAMRKLVHLCFGVLKNRIPYQPNYAMNG
>NC_018518.1|WP_010926548.1|1439085_1439658_-|chorismate-lyase
MTTPIPLARGWLPAAPSTLDPLRKYWLFRPGALTAGLRQLGHVRLRVLAEYPTGAPRDEADGMRIAAQSPVWVREVLMSIDGVDSVVARSLTPLRASHGVWQGMRRLLTRPLADMLYHDPGIHRSVFVCRRLAAGVPFHATAIARAPAGGPEPALWARRSAFWRAGQPLLVAECFLPAFWSLARAPVAPR
>NC_018518.1|WP_010930119.1|1439717_1440449_+|rRNA-pseudouridine-synthase
MEKVRISKLMSERGLCSRREADSYIERGWVRVDGVVVSELGARALPDQVITLERAAAARQTARVTILLHKPVGYVSGQAEKGYTPAVALIDARSRYAGDRAPQRFERGQLQGLAVAGRLDIDSQGLLVLTQDGRIAKKLIGEDSEVDKEYLVRVQGRLSEAGLALLNHGLSLDGKPLRPAQVRWQNADQLRFVLREGKKRQIRRMCELVGLRVVGLKRVRIGRVSLGDLPAGQWRYLRADERF
>NC_018518.1|WP_029443805.1|1440500_1441418_-|LysR-family-transcriptional-regulator
MELFVEVARTLSFGRAAENLAIPKSTLSRQVAELERSVGLRLLSRTTRRVELTEAGQLYFERCQRIVAEARIAHEELQNLVETPSGPLRVNMPADFGTDFLSEAFTEFSRRYPEVTFYLDLASPEHAERVFQTCDVSIEIGDLPDSTHIARLLGVLPAHLYASPDYLARHGEPQHPDDLPRHECIQFRAGTGRVTRWPLNSGERHVEITPGNRFSVNSVSMVRNLATLGAGIAILAPMGNVREDIESGRLKRILPDWLAGPFPVYAVTDTRMLPAKTRIFVEFLMERLSNKTLAGQNNPAFLNLR
>NC_018518.1|WP_014486063.1|1445403_1446786_+|efflux-transporter-outer-membrane-subunit
MKPVVMRTLLSLAVATALAGCSLAPTYERPQAPVDAAYPSGPAYGAPGQAAAGAPAAADVGWRDFFGDPLLQELLALSLANNRDLRVAALNVEAARLNPSGQAGISRSYQVGASLSTWELDLFGRIRSLSEQALQLYLAQDETRLATQLTLVAETANAYLTLRADQELLALTRQTLAAQQESYKLTRQSYDLGVATELDLSQAEISLRTAERNLSQYTRMAAQDRNALVLLVGQPLPAGIGAQLDQAVALPDGVVLADLPAGLPSDLLARRPDIRAAEHQLQAANASIGAARAAFFPRISLTGSAGTASASLGGLFDAGSGAWSFAPQISVPIFAGGALRASLDLAKIQKDIGIARYEQAIQSGFREVSDALAGRGTLQEQIRSQELLVQANQRAYDLSQQRYQQGIDNYLSVLDSQRSLYTAQQTLVETRLARLSNLIQLYKALGGGWSERTVAAAQAG
>NC_018518.1|WP_010930123.1|1446855_1447107_-|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein
MNIIIMIIVGFVVGLITRAIMPGDQNMGYIMTTILGIIGSVVAGFLGQQLGWYAPGEPAGWIGSVVGAIIVLFVVGLVAKKRA
>NC_018518.1|WP_010930124.1|1447254_1447869_-|SCO-family-protein
MYSPLSGRAWRGLLLAMLMLLAACSERSADWSLYNVKGHLPDLKFSLPGAHGKTVSSDDLKGKTVLLFFGYASCPDVCPTTMAQLTAVLQQLGEQARDVRILFVSVDPHRDTPDILQAYVNEFNSNAIGVTGNEKQIADLARRYRVAYQIEKPKPGDDADIYDVTHSRGVYIFDNQGKARLLASDTDTIDTMVKDLRQLIAQTQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_018518_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_018518_3

1817101-1817228

Orphan

Consensus_repeat	Method
AAAAAGCCCCCTCGGGGGGCAGCAAGCCCGCATAGCGGGCGCAGCG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_018518_3

>merge|NC_018518|3|1817101-1817228|CRISPRCasFinder
AAAAAGCCCCCTCGGGGGGCAGCAAGCCCGCATAGCGGGCGCAGCGTGGGGGCACTACTTTGCCGCTGGGCCGCCCCAAGGCAAAAAGCCCCCTCGGGGGGCAGCAAGCCCGCGTAGCGGGCGCAGCG

>NC_018518|3|3|1817101-1817228|CRISPRCasFinder
AAAAAGCCCCCTCGGGGGGCAGCAAGCCCGCATAGCGGGCGCAGCG	TGGGGGCACTACTTTGCCGCTGGGCCGCCCCAAGGC
AAAAAGCCCCCTCGGGGGGCAGCAAGCCCGCGTAGCGGGCGCAGCG

Protein	Signature genes	Signature genes Name	Protein_function
NC_018518.1\|WP_010930569.1\|1821599_1822091_+\|low-molecular-weight-phosphotyrosine-protein-phosphatase	unknown	unknown	gnl\|CDD\|319971
NC_018518.1\|WP_019248063.1\|1812168_1812900_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|270296
NC_018518.1\|WP_003812462.1\|1822836_1824048_+\|IscS-subfamily-cysteine-desulfurase	unknown	unknown	gnl\|CDD\|184450
NC_018518.1\|WP_003812491.1\|1806235_1806667_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|224462
NC_018518.1\|WP_014905733.1\|1825461_1827324_+\|Fe-S-protein-assembly-chaperone-HscA	unknown	unknown	gnl\|CDD\|235360
NC_018518.1\|WP_014905731.1\|1815633_1816584_-\|IS481-like-element-IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
NC_018518.1\|WP_014905728.1\|1805441_1806239_+\|enoyl-CoA-hydratase/isomerase-family-protein	unknown	unknown	gnl\|CDD\|223955
NC_018518.1\|WP_010930566.1\|1817251_1817902_-\|transcriptional-repressor-LexA	unknown	unknown	gnl\|CDD\|234688
NC_018518.1\|WP_003812456.1\|1824819_1825332_+\|Fe-S-protein-assembly-co-chaperone-HscB	unknown	unknown	gnl\|CDD\|235133
NC_018518.1\|WP_019247934.1\|1812917_1813130_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|270296
NC_018518.1\|WP_003812458.1\|1824493_1824817_+\|iron-sulfur-cluster-assembly-protein-IscA	unknown	unknown	gnl\|CDD\|213674
NC_018518.1\|WP_014905730.1\|1810831_1811500_+\|3-oxoacid-CoA-transferase-subunit-A	unknown	unknown	gnl\|CDD\|131482
NC_018518.1\|WP_010930179.1\|1813694_1814645_+\|IS481-like-element-IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
NC_018518.1\|WP_010930567.1\|1818030_1819233_-\|aspartate/tyrosine/aromatic-aminotransferase	unknown	unknown	gnl\|CDD\|181731
NC_018518.1\|WP_003812460.1\|1824081_1824492_+\|Fe-S-cluster-assembly-scaffold-IscU	unknown	unknown	gnl\|CDD\|183087
NC_018518.1\|WP_010930563.1\|1806663_1807821_+\|thiolase	unknown	unknown	gnl\|CDD\|180434
NC_018518.1\|WP_014905732.1\|1819310_1821347_+\|excinuclease-ABC-subunit-UvrB	unknown	unknown	gnl\|CDD\|235395
NC_018518.1\|WP_014905729.1\|1807842_1808619_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|235546
NC_018518.1\|WP_003812463.1\|1822306_1822819_+\|Fe-S-cluster-assembly-transcriptional-regulator-IscR	unknown	unknown	gnl\|CDD\|273927
NC_018518.1\|WP_003812478.1\|1811492_1812134_+\|CoA-transferase-subunit-B	unknown	unknown	gnl\|CDD\|188219

Protein	Function_ID	Function_description	E-value
NC_018518.1\|WP_010930569.1\|1821599_1822091_+\|low-molecular-weight-phosphotyrosine-protein-phosphatase	gnl\|CDD\|319971	cd16343, LMWPTP, Low molecular weight protein tyrosine phosphatase. Low molecular weight protein tyrosine phosphatases (LMW-PTP) are a family of small soluble single-domain enzymes that are characterized by a highly conserved active site motif (V/I)CXGNXCRS and share no sequence similarity with other types of protein tyrosine phosphatases (PTPs). LMW-PTPs play important roles in many biological processes and are widely distributed in prokaryotes and eukaryotes.	1.04407e-74
NC_018518.1\|WP_019248063.1\|1812168_1812900_+\|hypothetical-protein	gnl\|CDD\|270296	cd13578, PBP2_Bug27, Aromatic solutes transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. Bug27 binds non-carboxylated solute nicotinamide, in contrast to BugD (aspartic acid transporter) and BugE (glutamate transporter) which both bind aliphatic carboxylated ligands. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity.	6.98498e-108
NC_018518.1\|WP_003812462.1\|1822836_1824048_+\|IscS-subfamily-cysteine-desulfurase	gnl\|CDD\|184450	PRK14012, PRK14012, IscS subfamily cysteine desulfurase.	0
NC_018518.1\|WP_003812491.1\|1806235_1806667_+\|hypothetical-protein	gnl\|CDD\|224462	COG1545, COG1545, Predicted nucleic-acid-binding protein containing a Zn-ribbon [General function prediction only].	1.42164e-21
NC_018518.1\|WP_014905733.1\|1825461_1827324_+\|Fe-S-protein-assembly-chaperone-HscA	gnl\|CDD\|235360	PRK05183, hscA, chaperone protein HscA; Provisional.	0
NC_018518.1\|WP_014905731.1\|1815633_1816584_-\|IS481-like-element-IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	3.58426e-23
NC_018518.1\|WP_014905728.1\|1805441_1806239_+\|enoyl-CoA-hydratase/isomerase-family-protein	gnl\|CDD\|223955	COG1024, CaiD, Enoyl-CoA hydratase/carnithine racemase [Lipid metabolism].	1.61875e-62
NC_018518.1\|WP_010930566.1\|1817251_1817902_-\|transcriptional-repressor-LexA	gnl\|CDD\|234688	PRK00215, PRK00215, transcriptional repressor LexA.	1.25833e-105
NC_018518.1\|WP_003812456.1\|1824819_1825332_+\|Fe-S-protein-assembly-co-chaperone-HscB	gnl\|CDD\|235133	PRK03578, hscB, Fe-S protein assembly co-chaperone HscB.	2.55481e-79
NC_018518.1\|WP_019247934.1\|1812917_1813130_+\|hypothetical-protein	gnl\|CDD\|270296	cd13578, PBP2_Bug27, Aromatic solutes transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. Bug27 binds non-carboxylated solute nicotinamide, in contrast to BugD (aspartic acid transporter) and BugE (glutamate transporter) which both bind aliphatic carboxylated ligands. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity.	1.69368e-19
NC_018518.1\|WP_003812458.1\|1824493_1824817_+\|iron-sulfur-cluster-assembly-protein-IscA	gnl\|CDD\|213674	TIGR02011, Protein_yfhF., iron-sulfur cluster assembly protein IscA. This model represents the IscA component of the ISC system for iron-sulfur cluster assembly. The ISC system consists of IscRASU, HscAB and an Isc-specific ferredoxin. IscA previously was believed to act as a scaffold and now is seen as an iron donor protein. This clade is limited to the proteobacteria. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other].	4.04388e-54
NC_018518.1\|WP_014905730.1\|1810831_1811500_+\|3-oxoacid-CoA-transferase-subunit-A	gnl\|CDD\|131482	TIGR02429, 3-oxoadipate_CoA-transferase_subunit_A, 3-oxoacid CoA-transferase, A subunit. Various members of this family are characterized as the A subunits of succinyl-CoA:3-ketoacid-CoA transferase (EC 2.8.3.5), beta-ketoadipate:succinyl-CoA transferase (EC 2.8.3.6), acetyl-CoA:acetoacetate CoA transferase (EC 2.8.3.8), and butyrate-acetoacetate CoA-transferase (EC 2.8.3.9). This represents a very distinct clade with strong sequence conservation within the larger family defined by pfam01144. The B subunit represents a different clade in pfam01144, described by TIGR02428. The two are found in general as tandem genes and occasionally as a fusion.	5.84782e-141
NC_018518.1\|WP_010930179.1\|1813694_1814645_+\|IS481-like-element-IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	7.3142e-23
NC_018518.1\|WP_010930567.1\|1818030_1819233_-\|aspartate/tyrosine/aromatic-aminotransferase	gnl\|CDD\|181731	PRK09257, PRK09257, aromatic amino acid transaminase.	0
NC_018518.1\|WP_003812460.1\|1824081_1824492_+\|Fe-S-cluster-assembly-scaffold-IscU	gnl\|CDD\|183087	PRK11325, PRK11325, scaffold protein; Provisional.	5.84746e-99
NC_018518.1\|WP_010930563.1\|1806663_1807821_+\|thiolase	gnl\|CDD\|180434	PRK06158, PRK06158, thiolase; Provisional.	0
NC_018518.1\|WP_014905732.1\|1819310_1821347_+\|excinuclease-ABC-subunit-UvrB	gnl\|CDD\|235395	PRK05298, PRK05298, excinuclease ABC subunit UvrB.	0
NC_018518.1\|WP_014905729.1\|1807842_1808619_+\|SDR-family-oxidoreductase	gnl\|CDD\|235546	PRK05653, fabG, 3-oxoacyl-ACP reductase FabG.	3.2149e-79
NC_018518.1\|WP_003812463.1\|1822306_1822819_+\|Fe-S-cluster-assembly-transcriptional-regulator-IscR	gnl\|CDD\|273927	TIGR02010, Putative_HTH-type_transcriptional_regulator, iron-sulfur cluster assembly transcription factor IscR. This model describes IscR, an iron-sulfur binding transcription factor of the ISC iron-sulfur cluster assembly system. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other, Regulatory functions, DNA interactions].	1.00126e-77
NC_018518.1\|WP_003812478.1\|1811492_1812134_+\|CoA-transferase-subunit-B	gnl\|CDD\|188219	TIGR02428, 3-oxoadipate_CoA-transferase_subunit_B, 3-oxoacid CoA-transferase, B subunit. Various members of this family are characterized as the B subunits of succinyl-CoA:3-ketoacid-CoA transferase (EC 2.8.3.5), beta-ketoadipate:succinyl-CoA transferase (EC 2.8.3.6), acetyl-CoA:acetoacetate CoA transferase (EC 2.8.3.8), and butyrate-acetoacetate CoA-transferase (EC 2.8.3.9). This represents a very distinct clade with strong sequence conservation within the larger family defined by pfam01144. The A subunit represents a different clade in pfam01144.	3.32577e-117

>NC_018518.1|WP_014905731.1|1815633_1816584_-|IS481-like-element-IS481-family-transposase
MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARLAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHM
>NC_018518.1|WP_010930179.1|1813694_1814645_+|IS481-like-element-IS481-family-transposase
MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWQRPHQGIGRAVPISRLNLDEYNLLTVHS
>NC_018518.1|WP_019247934.1|1812917_1813130_+|hypothetical-protein
MGPAGIPADITAAWAKEIARVAALPDVSEKLATLGVESVSSTPQQFSAFVESEIRKWEKVVQDAHIPPVQ
>NC_018518.1|WP_019248063.1|1812168_1812900_+|hypothetical-protein
MKTKIKIVTLALCAFSSAVFASSFPSKPINLIVPYPPGGAVDPIARLYAEKISQSWGVPVIVLNRPGAGTTIGLNQAARAEPDGYTVVLGTASITSNAPLYRSLPYDTLKDFTYLSMAGMIPLAITANPRTAVNSMDELVGQLKKKPGSLTYSSSGNGTIIHLGGELFKSLAGVDMVHVPYKGSGPSVMAGVAGEVDLTFDSVFLMDPQVKAGKLKYIAVASEKRLKSLPEVPAIGESILVIS
>NC_018518.1|WP_003812478.1|1811492_1812134_+|CoA-transferase-subunit-B
MSKGWSNDEIAARIAVDLPEHAIVNLGIGLPILVANHIPEGKTIFFHSENGIIGLGPVPAPGQEDPDIVNAAKKHATLIAGASIVHHADSFSLIRGGRLDYSVLGGLQVSSGGDIANWKVPGQKGGGGVGGAMDLAVGARNVLVMMRHQDKTGASKLVKSCTFPLTAVSAVTRVYTELGIFECAGDAFIVRESAPGIGKDELLRKTEAALTFP
>NC_018518.1|WP_014905730.1|1810831_1811500_+|3-oxoacid-CoA-transferase-subunit-A
MLNKTCESADEAVSVVESGATILISGFGDIGLPFELLHALARTSVKDLTIVSNNAGTGELGLSRLFRNRQVSRLIASFPSQPESHHYFAAYQEGLVDLELVPQGTLAERIRAAGAGLAGFFTPTGYGTELAQGKECRMFKGKGYVFEEALPGDFAFIKAHVADAYGNLRYRRASRTFNPIMAMAARTTIAEAKQMVPVGSIDPDDVHTPGVFVDRIVEVRDE
>NC_018518.1|WP_014905729.1|1807842_1808619_+|SDR-family-oxidoreductase
MQDKLLTLENRQVIVTGAGQGIGRALASAIAGLGGRVVAVDLNADALAALREALGHERCVTVAGNVADPSLAQQAVDAGVTAFGGVNGLVNNAGVTRTAMIDKMSISDWQQVIDVHLSGSFYFLQALGRHLLGRAKAGGDGAGAIVNISSDAGRRGTIGQINYGAAKAGVLGLTMCAAREWARYGIRTNTVGFGVVETPMTETIRGEKFRDTYLSQIPLGRWGEADEVVRPVCFLLSDAASYVTGQHLSVNGGYTIGL
>NC_018518.1|WP_010930563.1|1806663_1807821_+|thiolase
MIQERFPRGKTAIVACATYGIGESPGLSSLDLAVRASVQALDSVGLTPADVDGLFIGLPDDFVSGLSFTEYLGISPRLTDNNRTGGSSFLTHAIHAALALEAGLCDVALIAYGSNQRSGAGKLVSSMRPSPYEGAYKLARPVGAYALAASRYAAQYGLQKEQLGAVALAARQWAQKNPEAYMRAPLTMDECLASRLVCDPFSVRDCCLVTDGAAAVVMVRADRARDLAARPAYLLGGAAAAWHKDITNMPDLTVTAASLSGPRAMAQAGVTPADIDVLELYDAFTLNTILFLEDLGFCAKGEGGAFVEDGRIAPGGALPVNTNGGGLSCVHPGMYGLFTMVEAAQQLAGAAGERQVAQARLALAHGNGGELSSQATLILGTEETI
>NC_018518.1|WP_003812491.1|1806235_1806667_+|hypothetical-protein
MTEHPQAASALLPQQEYFAHLADGRFMIQRSRSSGEYVFYPRVAAPRTGAQDLEWVAASGRGTVYATTVMRVRPPAAPYNVCLVELEEGPRMMSRVEGIGPEDVQVGMAVRARIIRDDAGEPLVVFEPAGPSDAGIGQGRAAQ
>NC_018518.1|WP_014905728.1|1805441_1806239_+|enoyl-CoA-hydratase/isomerase-family-protein
MSVLEISRVGACAVLTLNRPAARNALDMDLRNALAKALPEIRDDVTVCAVVLTGAGGHFCAGGDIRAIAAGQGNADVFEGRNRILSMQRWFDGLVDLEKPVIAAVDGVAFGAGLSLALAADFVLASPRATFCAVFARLGYVPDLGGMYLLPRAVGLARAKALAFSARVVGAPEALEMGIAHQLVDDRPVLDAALELAGRFEQAPAGALGIVKSVMNHAFESDRRTVYMQEALAQALCRESAFHQEAARRFLDKQAPLYQWPQEQQ
>NC_018518.1|WP_010930566.1|1817251_1817902_-|transcriptional-repressor-LexA
MATKLTERQQEILDLIRQTVARTGFPPTRAEIAQALGFRSPNAAEDHLKALARKGAIELTAGASRGIRLKVPDSATPSAQLTHPLLAQLVLPLVGRVAAGSPILASEHVEREVGVDPGLFAQTPDYLLKVRGMSMRDAGILEGDLLAVKRAAEARNGQIVVARLGDEVTVKRLQRQNGRIELLPENPDFAPIVVANTDEFALEGIAVGLIRTQPLH
>NC_018518.1|WP_010930567.1|1818030_1819233_-|aspartate/tyrosine/aromatic-aminotransferase
MSTLFASVELAPRDPILGLNEQYNADTRPGKVNLGVGVYYDDEGRIPLLQAVRKAEVARIEAAAARGYLPIEGIAGYNKGAQALLLGADSPLAAEGRVLTAQALGGTGALKIGADFLRQLLPQSKVLISDPSWENHRALFERAGFPVETYAYYDAATHGLNFEAMLAALQAAPEQTIVVLHACCHNPTGVDPTPQQWEQIAAVVKARNLVPFLDIAYQGFGEGLEQDAAVVRMFAALDLTMFISSSFSKSFSLYGERVGALTVVAGSKDEAARVLSQLKRVIRTNYSNPPTHGGTVVSTVLNTPELFALWENELAGMRDRIRLMRKELVEKIKTQGVAQDFSFVLAQRGMFSYSGLTAAQVDRLREEHGIYAVSSGRICVAALNSRNIDAVAAGIAAVLK
>NC_018518.1|WP_014905732.1|1819310_1821347_+|excinuclease-ABC-subunit-UvrB
MTAPGFVEFPDSPFHLYQPYPPAGDQPGAIDALTEGVSDGLMFQTLLGVTGSGKTYTMANMIARLGRPALVLAPNKTLAAQLYAEMREFFPRNAVEYFVSYYDYYQPEAYVPTRDLFIEKDSSINEHIEQMRLSATKSLLERRDTVIVGTVSCIYGIGNPGDYHAMVLILRTGDRISRREVLARLVAMQYTRNDADFTRGVFRVRCETIDIFPAESPELALRLTLFDDEIESLELFDPLTGRVRQKLPRFTVYPGSHYVTPRETVLRAIETIKEELRERLAQLIADGKLVEAQRLEQRTRFDLEMLQELGFCKGIENYSRHLSGAAPGEPPPTLIDYLPADALMFIDESHVTIGQLGGMYRGDRSRKETLVQYGFRLPSALDNRPLRLEEFEARMRQCVFVSATPAAYEQEHADNVVEQVVRPTGLVDPIVEVRPAHTQVDDLLGEIHKRAALQERVLVTTLTKRMAEDLTDFLSEHGVRVRYLHSDIDTVERVEIIRDLRLGVFDVLVGINLLREGLDIPEVSLVAILDADKEGFLRSERSLIQTIGRAARNLNGRAILYADRITDSMRRAIDETERRRAKQIQHNTDHGITARGVSKAVRELIDGVMAPAGHDALESAVPAEVLTDEKAMAREIRRLEKLMMDHARNLEFEQAAAARDALNALKSRLLLDGVGWSG
>NC_018518.1|WP_010930569.1|1821599_1822091_+|low-molecular-weight-phosphotyrosine-protein-phosphatase
MMTKVLFVCMGNICRSPSAEGVFRYLVNDAGMGDVVRVDSAGTHAFHIGEAPDARAQAAARKRGYDLTHCAARQVTADDFREFDLILAMDWDNLAALQQQCPKAYQHKLMLLMRFANEFEEATVPDPYYGGPEGFGKVLDYLEDACQGVLELVRKRATQYQAA
>NC_018518.1|WP_003812463.1|1822306_1822819_+|Fe-S-cluster-assembly-transcriptional-regulator-IscR
MRLTTKGRFAVTAMIDLAMRQHSGPVTLAAISQRQNISLSYLEQLFGKLRRHELVDSVRGPGGGYSLARLARNVTVADIIFAVDEPLDATSCGGKRDCTSGNDGKPGKCMTHELWTTLNRKMVDYLDSVSLQDLVDQQRVRQLQEAANQAQGCSAVRVNRSTPVAANATA
>NC_018518.1|WP_003812462.1|1822836_1824048_+|IscS-subfamily-cysteine-desulfurase
MSNRPIYLDYSATTPVDPRVVEKMIPWLYESFGNPASRSHAFGWEAEDAVEKAREEVAKLVNADPREIVWTSGATESDNLAIKGAANFYAERGKHIITVKTEHKAVLDTCRELERQGFEVTYLDVQDDGLLSLDAFKAALRPDTILVSVMMVNNEIGVIQDIAALGEICREKGIIFHVDAAQATGKVEIDLQKLKVDLMSFSAHKTYGPKGIGALYVRRKPRVRIEAQMHGGGHERGFRSGTLATHQIVGMGEAFRLAREEMGTENERVRMLRDRLLAGLTQIEEVYVNGSMEHRVPHNLNISFNYVEGESLIMAIKELAVSSGSACTSASLEPSYVLRALGRNDELAHSSIRFTLGRFTTEQEIDFTIELIKSRVGKLRDMSPLWEMAQEGIDLNSVQWAAH
>NC_018518.1|WP_003812460.1|1824081_1824492_+|Fe-S-cluster-assembly-scaffold-IscU
MAYSSKVLDHYENPRNVGSFDKGDDSVGTGMVGAPACGDVMKLQIKVNEAGVIEDARFKTYGCGSAIASSSLVTEWVKGKTLDEAMNIRNTQIAEELALPPVKIHCSILAEDAIKAAVQDYKTKHGAETPEAVAAN
>NC_018518.1|WP_003812458.1|1824493_1824817_+|iron-sulfur-cluster-assembly-protein-IscA
MAVTLTQSAANHVGRYLQKRGKGIGLRLGVRTTGCSGMAYKLEYVDEQAADDVVFDSFGVKVFIDPKSLAYLDGTELDYAREGLNEGFRFSNPNEKATCGCGESFTV
>NC_018518.1|WP_003812456.1|1824819_1825332_+|Fe-S-protein-assembly-co-chaperone-HscB
MAADDHFSLFGLPTRFALDPVQLEQAWRAVAARVHPDRYATASAAERRVAMQWAARANEAYRQLRDPMLRARYLCEQAGVDLQTESNTAMDPAFLMQQMEWREMLDDARRDPAAFAALRAELEQARLRMQQTLSELIDERGDYQQAGTKVREWMFVEKLAQELSAAQPMQ
>NC_018518.1|WP_014905733.1|1825461_1827324_+|Fe-S-protein-assembly-chaperone-HscA
MALLQISEPGDSPAPHQRKLAVGIDLGTTNSLVAAVRSSVPEVLADAQGQVLLPSAVRYLDGGAVRIGREALLEQARDPLNTIVSVKRFMGRSAADAVASGAPYEFVDAPGMVRLRTVQGDLSPVEVSAQILAVLRQRAEDVLGDDLVGAVITVPAYFDDAQRQATRDAARLAGLNVLRLLNEPTAAAIAYGLDQAAEGIYAVYDLGGGTFDISILRLTQGVFEVIATGGDTALGGDDFDSAIVAHACAGEDVAALPVADRRALLVAARAAREALTDQAQAPFEVTLRDGRAIQATLTRAQFEQLAEPLVGRTLDSARRALRDAGLAVGDVRGVVMVGGATRMPVVRQQVGALFGTEPLTNLDPDQVVALGAALQANLLAGNRALGEDWLLLDVIPLSLGLETMGGLVERIIPRNSTIPVARAQEFTTFKDGQTAMSVHVVQGERDLVSDCRSLARFELRGIPPMVAGAARIRVTFQVDADGLLSVTAREQSTGVEAAVAVKPSYGLSDDEIARMLADSVTQADSDARARMLREQQVEARQLVESVGAALAADGDLLDPAERATVDQRLQAAAQAQSLDDVEAVRAAVQALSDATEEFAARRMDRSIRSALAGRKLDELA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_018518_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_018518_4

3721135-3721228

Orphan

Consensus_repeat	Method
GTGCCTGTCCCCGCCGGGACAGGCAC	CRISPRCasFinder

1 spacers

DEDDh

The CRISPR arrays of NC_018518_4

>merge|NC_018518|4|3721135-3721228|CRISPRCasFinder
GTGCCTGTCCCCGCCGGGACAGGCACCCGGGCCCAGGAAAACCCCCACGCTGCGCCCGCTGTGCGGGCGTGCCTGTCCCCGCCGGGACAGGCAC

>NC_018518|4|4|3721135-3721228|CRISPRCasFinder
GTGCCTGTCCCCGCCGGGACAGGCAC	CCGGGCCCAGGAAAACCCCCACGCTGCGCCCGCTGTGCGGGC
GTGCCTGTCCCCGCCGGGACAGGCAC

Protein	Signature genes	Signature genes Name	Protein_function
NC_018518.1\|WP_041166230.1\|3731248_3732421_+\|acyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|173841
NC_018518.1\|WP_003814730.1\|3716244_3716979_-\|DNA-polymerase-III-subunit-epsilon	DEDDh	cd06127_DEDDh_CAS-I	gnl\|CDD\|235574
NC_018518.1\|WP_003814691.1\|3727086_3728319_+\|CoA-transferase	unknown	unknown	gnl\|CDD\|367110
NC_018518.1\|WP_010929791.1\|3728311_3729097_+\|crotonase/enoyl-CoA-hydratase-family-protein	unknown	unknown	gnl\|CDD\|181723
NC_018518.1\|WP_005012067.1\|3719423_3720374_+\|IS481-like-element-IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
NC_018518.1\|WP_010930048.1\|3706860_3707811_-\|IS481-like-element-IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
NC_018518.1\|WP_003814726.1\|3714151_3715465_-\|short-chain-fatty-acid-transporter	unknown	unknown	gnl\|CDD\|224942
NC_018518.1\|WP_003814694.1\|3726135_3726891_+\|TerC-family-protein	unknown	unknown	gnl\|CDD\|223930
NC_018518.1\|WP_010929786.1\|3712624_3714136_+\|TAXI-family-TRAP-transporter-solute-binding-subunit	unknown	unknown	gnl\|CDD\|270238
NC_018518.1\|WP_010929785.1\|3711422_3712628_+\|sodium/glutamate-symporter	unknown	unknown	gnl\|CDD\|129314
NC_018518.1\|WP_010929789.1\|3725506_3726025_-\|MgtC/SapB-family-protein	unknown	unknown	gnl\|CDD\|224204
NC_018518.1\|WP_003814728.1\|3715655_3715835_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377342
NC_018518.1\|WP_019247421.1\|3720505_3720904_-\|GTP-binding-protein	unknown	unknown	gnl\|CDD\|234569
NC_018518.1\|WP_014906085.1\|3722317_3723718_-\|PLP-dependent-aminotransferase-family-protein	unknown	unknown	gnl\|CDD\|224089
NC_018518.1\|WP_003814681.1\|3730145_3731123_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176106
NC_018518.1\|WP_003814720.1\|3709523_3710582_-\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|133030
NC_018518.1\|WP_003814701.1\|3721314_3721785_-\|universal-stress-protein	unknown	unknown	gnl\|CDD\|366180
NC_018518.1\|WP_014906086.1\|3729163_3730135_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270234
NC_018518.1\|WP_014906084.1\|3710711_3711227_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NC_018518.1\|WP_003820700.1\|3721873_3722218_-\|TIGR01244-family-phosphatase	unknown	unknown	gnl\|CDD\|225984

Protein	Function_ID	Function_description	E-value
NC_018518.1\|WP_041166230.1\|3731248_3732421_+\|acyl-CoA-dehydrogenase	gnl\|CDD\|173841	cd01152, ACAD_fadE6_17_26, Putative acyl-CoA dehydrogenases similar to fadE6, fadE17, and fadE26. Putative acyl-CoA dehydrogenases (ACAD). Mitochondrial acyl-CoA dehydrogenases (ACAD) catalyze the alpha, beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of ACAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. The ACD family includes the eukaryotic beta-oxidation, as well as amino acid catabolism enzymes. These enzymes share high sequence similarity, but differ in their substrate specificities. The mitochondrial ACD's are generally homotetramers and have an active site glutamate at a conserved position.	1.92051e-82
NC_018518.1\|WP_003814730.1\|3716244_3716979_-\|DNA-polymerase-III-subunit-epsilon	gnl\|CDD\|235574	PRK05711, PRK05711, DNA polymerase III subunit epsilon; Provisional.	2.40573e-142
NC_018518.1\|WP_003814691.1\|3727086_3728319_+\|CoA-transferase	gnl\|CDD\|367110	pfam02515, CoA_transf_3, CoA-transferase family III. CoA-transferases are found in organisms from all lines of descent. Most of these enzymes belong to two well-known enzyme families, but recent work on unusual biochemical pathways of anaerobic bacteria has revealed the existence of a third family of CoA-transferases. The members of this enzyme family differ in sequence and reaction mechanism from CoA-transferases of the other families. Currently known enzymes of the new family are a formyl-CoA: oxalate CoA-transferase, a succinyl-CoA: (R)-benzylsuccinate CoA-transferase, an (E)-cinnamoyl-CoA: (R)-phenyllactate CoA-transferase, and a butyrobetainyl-CoA: (R)-carnitine CoA-transferase. In addition, a large number of proteins of unknown or differently annotated function from Bacteria, Archaea and Eukarya apparently belong to this enzyme family. Properties and reaction mechanisms of the CoA-transferases of family III are described and compared to those of the previously known CoA-transferases.	8.36236e-118
NC_018518.1\|WP_010929791.1\|3728311_3729097_+\|crotonase/enoyl-CoA-hydratase-family-protein	gnl\|CDD\|181723	PRK09245, PRK09245, crotonase/enoyl-CoA hydratase family protein.	5.15941e-155
NC_018518.1\|WP_005012067.1\|3719423_3720374_+\|IS481-like-element-IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	8.66858e-23
NC_018518.1\|WP_010930048.1\|3706860_3707811_-\|IS481-like-element-IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	9.05216e-23
NC_018518.1\|WP_003814726.1\|3714151_3715465_-\|short-chain-fatty-acid-transporter	gnl\|CDD\|224942	COG2031, AtoE, Short chain fatty acids transporter [Lipid metabolism].	6.57351e-166
NC_018518.1\|WP_003814694.1\|3726135_3726891_+\|TerC-family-protein	gnl\|CDD\|223930	COG0861, TerC, Membrane protein TerC, possibly involved in tellurium resistance [Inorganic ion transport and metabolism].	1.14565e-78
NC_018518.1\|WP_010929786.1\|3712624_3714136_+\|TAXI-family-TRAP-transporter-solute-binding-subunit	gnl\|CDD\|270238	cd13520, PBP2_TAXI_TRAP, Substrate binding domain of TAXI proteins of the tripartite ATP-independent periplasmic transporters; the type 2 periplasmic binding protein fold. This group includes Thermus thermophilus GluBP (TtGluBP) of TAXI-TRAP family and closely related proteins. TRAP transporters are ubiquitous in prokaryotes, but absent from eukaryotes. They are comprised of an SBP (substrate-binding protein) of the DctP or TAXI families and two unequally sized integral membrane components. Although TtGluBP is predicted to be an L-glutamate and/or an L-glutamine-binding protein, the substrate spectrum of TAXI proteins remains to be defined. A sequence-homology search also shows that TtGluBP shares low sequence homology with putative immunogenic proteins of uncharacterized function. The substrate-binding domain of TAXI proteins belongs to the type 2 periplasmic-binding fold protein (PBP2) superfamily, whose members are involved in chemotaxis and uptake of nutrients and other small molecules from the extracellular space as a primary receptor. PBP2 typically comprises of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and tworeceptor cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	9.13066e-82
NC_018518.1\|WP_010929785.1\|3711422_3712628_+\|sodium/glutamate-symporter	gnl\|CDD\|129314	TIGR00210, Sodium/glutamate_symport_carrier_protein, sodium--glutamate symport carrier (gltS). [Transport and binding proteins, Amino acids, peptides and amines].	1.2444e-106
NC_018518.1\|WP_010929789.1\|3725506_3726025_-\|MgtC/SapB-family-protein	gnl\|CDD\|224204	COG1285, SapB, Uncharacterized membrane protein [Function unknown].	1.12064e-44
NC_018518.1\|WP_003814728.1\|3715655_3715835_-\|hypothetical-protein	gnl\|CDD\|377342	pfam04391, DUF533, Protein of unknown function (DUF533). Some family members may be secreted or integral membrane proteins.	0.00323203
NC_018518.1\|WP_019247421.1\|3720505_3720904_-\|GTP-binding-protein	gnl\|CDD\|234569	PRK00007, PRK00007, elongation factor G; Reviewed.	1.37761e-90
NC_018518.1\|WP_014906085.1\|3722317_3723718_-\|PLP-dependent-aminotransferase-family-protein	gnl\|CDD\|224089	COG1167, ARO8, Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism].	1.10917e-110
NC_018518.1\|WP_003814681.1\|3730145_3731123_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176106	cd08414, PBP2_LTTR_aromatics_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators involved in the catabolism of aromatic compounds and that of other related regulators, contains type 2 periplasmic binding fold. This CD includes the C-terminal substrate binding domain of LTTRs involved in degradation of aromatic compounds, such as CbnR, BenM, CatM, ClcR and TfdR, as well as that of other transcriptional regulators clustered together in phylogenetic trees, including XapR, HcaR, MprR, IlvR, BudR, AlsR, LysR, and OccR. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the substrate-binding domains from ionotropic glutamate receptors, LysR-like transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	2.33368e-60
NC_018518.1\|WP_003814720.1\|3709523_3710582_-\|glycosyltransferase-family-2-protein	gnl\|CDD\|133030	cd04187, DPM1_like_bac, Bacterial DPM1_like enzymes are related to eukaryotic DPM1. A family of bacterial enzymes related to eukaryotic DPM1; Although the mechanism of eukaryotic enzyme is well studied, the mechanism of the bacterial enzymes is not well understood. The eukaryotic DPM1 is the catalytic subunit of eukaryotic Dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. The enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. This protein family belongs to Glycosyltransferase 2 superfamily.	4.18053e-89
NC_018518.1\|WP_003814701.1\|3721314_3721785_-\|universal-stress-protein	gnl\|CDD\|366180	pfam00582, Usp, Universal stress protein family. The universal stress protein UspA is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. UspA enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae UspA reveals an alpha/beta fold similar to that of the Methanococcus jannaschii MJ0577 protein, which binds ATP, though UspA lacks ATP-binding activity.	9.38587e-30
NC_018518.1\|WP_014906086.1\|3729163_3730135_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270234	cd07012, PBP2_Bug_TTT, Bug (Bordetella uptake gene) protein family of periplasmic solute-binding receptors; contains the type 2 periplasmic binding fold. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) proteins present in a number of bacterial species, but mainly in proteobacteria. In eubacteria, at least three families of periplasmic binding-protein dependent transporters are known: the ATP-binding cassette (ABC) transporters, the tripartite ATP-independent periplasmic transporters, and the tripartite tricarboxylate transporters (TTT). Bug proteins are the PBP components of the TTT. Their expansive expansion in proteobacteria indicates a large functional diversity. The best studied examples are Bordetella pertussis BugD, which is an aspartic acid transporter, and BugE, which is glutamate transporter.	2.00341e-117
NC_018518.1\|WP_014906084.1\|3710711_3711227_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	1.78118e-07
NC_018518.1\|WP_003820700.1\|3721873_3722218_-\|TIGR01244-family-phosphatase	gnl\|CDD\|225984	COG3453, COG3453, Uncharacterized protein conserved in bacteria [Function unknown].	3.40043e-35

>NC_018518.1|WP_019247421.1|3720505_3720904_-|GTP-binding-protein
MTRRTSIERYRNIGISAHIDAGKATTTERILFYTGITHKLGEVHEGAATMDWMEQEQGRGITITSAATTAFWRGMAGNYPEHRINIIDTPGHVDFTIEVERSMRVLDGACMVYDSVGGVQEVATVMVVLPGQ
>NC_018518.1|WP_005012067.1|3719423_3720374_+|IS481-like-element-IS481-family-transposase
MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHS
>NC_018518.1|WP_003814730.1|3716244_3716979_-|DNA-polymerase-III-subunit-epsilon
MRQIIFDTETTGLDPAQGHRIVEIGCVEIVNRMVTGNNLHLYLNPDRDSDPEALAVHGLTTEFLADKPRFAEVAEQFLAFIADAELIAHNAAFDVKFFNAELQRIGRDPLNTHCENIVDSLLHARSLHPGKRNSLDALCDRYGISNAHRTLHGALLDSQLLAEVWLAMTRGQDALLIDVDDQGANANGALVLGKFDASVLTVLAASEAELAEHAAYLQALDKAVGGACAWRAIEPLPAESGQPG
>NC_018518.1|WP_003814728.1|3715655_3715835_-|hypothetical-protein
MHPDTNTMLIIIAAAVALMIVGFGLRDRNLGLGLLGIGLIAALATIAYKAYITFNSFYY
>NC_018518.1|WP_003814726.1|3714151_3715465_-|short-chain-fatty-acid-transporter
MFKLMSRSAVKMVERYLPDPYVFVVLLTLVAAGAAMIIEGQTPMAVVRWWGNGFWGLLTFAMQMLLVLVTGYMLASTPLVKRMLARLASLATSAGGAIILVSVVSLAASWINWGFGLVVGALFAKQIARQVRVDYRLLVASAYSGFIIWHGGLAGSIPLTIATEGHFSADKIGIIPTGDTIFAVFNLVIVVAMFILVPLVNRLMLPDEKESVYVDPARLEEASVPASDDDKRPAARLENSRLLAWLIAAGGLAYMFDYYVVRGAGLNLNVINFSFLILAILLHGTPRRLLASLDEAIKGGAGIVIQFPFYAGIMAIMMDSGLAATLSEWFVSIASAATLPFWTFISAGIVNIFIPSGGGQWAVQSPIVISAAQALGADMPRVAMAVAWGDAWTNMLQPFWALPVLAIAGLKAKDIMGYCIIQLLVTGVIISVGLSFF
>NC_018518.1|WP_010929786.1|3712624_3714136_+|TAXI-family-TRAP-transporter-solute-binding-subunit
MTMFIRWLILSACLLLAACSRAPDTEILQRDVGQTLAATYGPDLFDIVALRRMGSATDSTAPPGQTRRVVYYDVVLGLKKDLTLGAWDQPGAAALVSLLGAGPRSISGVKSSGNAAGDQIVAHASAIYQRDAEQWVHVAPASFTATEAPSLDTGAPPPVTRQLLQTLEQITRSVPYSASSTAQHVVQQELERSVARINGRLARLQKGYPLATGPDKGEYLAFGQALAAIGRNEQVRVIPLITGGSADNMAMLRSGAAVAALSQADIAQLAYEGKGPFESQGPFSGLRALGSLYPELVHIVVRQGDGIATVGALRGKKIALGPSGSAVRTTLETVLAAHGLQPGRDYAVIDTPAAAALPQLSEGRVDAVAQVIGTPAAPLRAALTQARLALLPLDRAAIDKLVQADPTLMALDIPANTYPSQAAAIPTVGMAALLVTTADLTRDEAAHMVDVVYRAGQDLLAAGSAQGAQVSAANAGRGLSIPLHDGAVEAFEKLGAPPLPEGR
>NC_018518.1|WP_010929785.1|3711422_3712628_+|sodium/glutamate-symporter
MISLTPVQSLLACCLVLVAGRILTTRIGVLSRYSIPDPIVGGLLFAVLATALDTWGGIQISLETNIKPTLLLIFFGCIGLTADLKLLARGGPRLIAFLLALIPFLVLQNAVGLGLAWLLDMHPLMGLIGGTITLVGGHGTGAAYAARFADINNIQDVMALAMTAATIGLVLGGIIGGPVAEWLIRRHKLDPRMAGKDANQVLPEVETTAEAPTATSFITSLTAVFVTVVVGTYLAGLVEDAPISLPNFLWCLATGAIIRNFGGYVGIRLDDRVSEIIGSISLSLFLGLTMMTLDLSSVVRLAGPLALMLVAQALVCALYAGWAVFRMLKRDYEAAVMAAAFCGFAMGATATAIANMQALTRRHGPAPESFIVVPVTGAFLVDILNVIVLTSLIALPFVGGM
>NC_018518.1|WP_014906084.1|3710711_3711227_+|GNAT-family-N-acetyltransferase
MPQSYIVRTMRPADVEAVLRVQAAVYPASLLESAALFQNRIEIAPATCQVALDGQDLIGYLIAYPWDAGLPPALDRSLERLPGAADTWFVHDCAVLPAAQGGGVAAALLAGGRAQARRLGLRRASLVALAQAVGYWLRHGYQPLADSDALRAKLAGYGDGARYMVRADLAG
>NC_018518.1|WP_003814720.1|3709523_3710582_-|glycosyltransferase-family-2-protein
MFMYTEFRSQLLAGAGTSAAGQSARMAVLAGDGATGVQVSCVVPGLNEAANLRVLVPALRACLEQWCASWEIIVVDDGSTDDTAELMAQWSAVEGIRYVQLSRNFGKEAALTAGLEAADGDAVICLDADMQHPPELIGDMLAAWRNGADMVYAVRRQRDDEPWFKRVGARAFYRLLSTARGVEVPPHAGDFRLMDRRVVEALVALPERTRFMKGLYAWVGFKSQAVPYTPQARRHGASHFSAWKLFRLACDGLTAFTTWPLRLVSLIGVLFALLSLSYGGYLVADYLISGNAVSGWTTIVTALLFFAGINLISLGVVGEYVARIFDEVKGRPLFIARQRRGRAKRAAKARSQ
>NC_018518.1|WP_010930048.1|3706860_3707811_-|IS481-like-element-IS481-family-transposase
MNTHKHARLTFLRRLEMVQQLIAHQVCVSEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHS
>NC_018518.1|WP_003814701.1|3721314_3721785_-|universal-stress-protein
MFKKILIPTDGSPLSAQAANAGICFARSTGAEVVALHVTQPFAATIGFDGMAAAYAITDEDYEKASAEQAEKYLKLILDRAETAGVKAESRAVSNFNVADGIVQAAGEAGCDLIFIGSHGRSGLSRLLLGSVTAKVLSLAHTAVLVYRVKEDKDKK
>NC_018518.1|WP_003820700.1|3721873_3722218_-|TIGR01244-family-phosphatase
MSAAIKPLTENFAVAPQLGPADMADVAAAGYKSVIINRPDFEGGPDQPTAADVSQAAQALGLQVEYQPVVGSAMTAADVARFAELLRTMPGPVLAYCRTGTRCTNLFAAAQQLG
>NC_018518.1|WP_014906085.1|3722317_3723718_-|PLP-dependent-aminotransferase-family-protein
MRQADATLVTQLADDLARRIDEHGLRPGTRLPSIRRMAEQSGVSRFTVVEAYDRLVARGLVQSRHGAGFFVRARSASLTALASARVPQAAPETPVRVDVSWLLRNMFRETAAGMPGGAGLLPPEWLDPDMVAAAVRAVGRTVRGNLVSYGSPQGYAPLRQQLASMLQADGVPAHPERNLLTTNGVTHGLDIVARHLIKPGDTVLVEDPAWFVIFGRLAAFGARPVGVPRGPDGPDLAMLDRLAAEHKPRLYIINGAVHNPTGHTLSAGAAYDILRLAERHDFMVVEDDTYADLHPGGAMKLAALDRLERVILVGGFSKMLAASLRVGYIAAGAETLQRLTDLKMLAGLTSPELGERVVHRVLVEGQYQRHIERVRARVNEARLRSIQALQQLGLSVPHEPHAGMFVWADCGRDSEPVARNAAERGMLLAPGTLFSPSGAPSTMLRFSVAMVDTPGIWQSIAAVMAQ
>NC_018518.1|WP_010929789.1|3725506_3726025_-|MgtC/SapB-family-protein
MDTVWMEIWTTVRNEFADIPDVAEATRIVLRLGMAVALGGLLGYERERSGKAAGLRTHMLVALGAALFVLVPLQGGMEVGDLSRVLQGVIAGIGFLGAGVIIKLGNEGEIRGLTTSAGIWLTAAIGVAAGMGREATALASTLIALFVLAALRRLEKRIAARDDKRVVAQPPP
>NC_018518.1|WP_003814694.1|3726135_3726891_+|TerC-family-protein
MDYLVSLAQQPAAWAALATLIAMEVVLGIDNLIFISILTNKLPPQHQTKARRIGIGMALILRLALLGTVAFIVQLTQPVFELFGHGFSWRDVILVAGGLFLVWKATKEIHHHVDPNPGDDMFGGKAATLGFAAAVAQILMLDLVFSIDSIITAVGMTEHIPIMFVAVIVAVAVMLLAAEPLARFIERNPTVVMLALAFLMMIGMTLIAEGFGAHVPKGYIYAAMAFSALVEGLNMMARRAREGRGAGAAGG
>NC_018518.1|WP_003814691.1|3727086_3728319_+|CoA-transferase
MSGPLEGVRILDVTTVLMGPYATQILGDLGADVIKVEPPAGDNVRGIGPGRHADMGGIFLHANRSKRSIALDLKNPAGREALLKVAATCDVLVYNVRPQAMARLGLSYAEVAQANPSILYVGMYGYDQRGPYAARAAYDDLIQGAVGIPSLSVEAGSDIPRYAPSAMVDRIVGISAANAVTAGLYHRARTGQGQAIDVPMFETMAHLILGDHMMGQTFEPPLGPPGYPRILNADRRPYATRNGHICVLLYADKHWKAFFELIGQPGRDAADPRFRDIGTRTQHIHAIYRLVSDAIASRTTEEWLAAFEAADIPAMPVHTMASLLRDPHLEAIGFFGMVDHPSEGAVRMMAVPSRWSGTPPQPRGHAPRLGEHSVDVLKEAGYDDEAIAALVRNGAAIAAARQLPEGTDHD
>NC_018518.1|WP_010929791.1|3728311_3729097_+|crotonase/enoyl-CoA-hydratase-family-protein
MTDFLRHERHGGVLLLTMDRERTRNALSDADAVEALVQACARIGADLSVRAVVLTGSHGVFSSGGNLKTLSDTVGAGLGEPVHSLQAYRSGIQRIPLALYNLEVPTIAAVNGPAIGAGCDLACMCDIRLAARQASFAESFVKLGLTPGDGGAWLLPRIVGMSRACELAFTGRSIDAARARELGLVSEVFDADALLPAALALAQEIAQHSGHALRLTKRLLREGQHTRLDTLLELSAGFQALAHHTQEHAGALDAHLSRKRG
>NC_018518.1|WP_014906086.1|3729163_3730135_+|tripartite-tricarboxylate-transporter-substrate-binding-protein
MHSRTLALALLFVAALAQGGSARAASDYPAHPVKIIVSLPPGSGADTTARFLSKHLAERFKQPFVVENRPGGNSFIAAQAVATAPPDGYTLFVASNSPMTTNAAVFKNLPYDAVKDFAPVAPIARFPMALVVPANSPYRSVADLVAAARAAPGQLNFASGTATYQVVLELFHEQNGIKATHVPYKGTSAALADVAGGVVQYSVADVSAALPLIRGGKLRPLAVTSTRRIKDLPDVPTMQESGNKGFEAYAWTAAFFPAKVDPAIVARVSDAVQALVRSQEGKAFMEQLGGEPFVGGPDTLAAFQRDELASMRRIAKLANIQQE
>NC_018518.1|WP_003814681.1|3730145_3731123_-|LysR-family-transcriptional-regulator
MWTGQYIVHIASPAHHWRRAVELRQLKQLLVLSETLNFHRAAERLHMAQPPLSTAIKKLEQELGVQLFERLPAGLQPTPAAEVVLRYARATLFYADEIQRAAQEGASGKQGMLKVGFVGSSIYSLMPQLLSAFRKDYPRVDLVIEESTTVDLLRRLDAHTLDVALVRFPVLEPSTARITLLQADHLMLAVPAGSRYAQRDDVALDELADEPFIGYSRTHVPGMHALIMYAFQQYGVVPHIAQEAIQVQTILSLVESGLGLAIVPKVACRQAGSGVRLVNVPQLAETIKVGIALAVHPDNATPTTANFVDMACRLMQTEPAAGQAR
>NC_018518.1|WP_041166230.1|3731248_3732421_+|acyl-CoA-dehydrogenase
MGAILGTIIEALQLAAIPAHDEALRPAVRAFLDEALREMPADRRARSWMGHDAEFSRALARQGWLGLTLPVEYGGAGRSNFARFVLSEELLAVGAPVSAHWIADRQTAPLILRFGSPAQRAFYLPRIIRGEAFFAIGMSEPDTGSDLASVRTRATPVADGWLLNGRKIWTTNAHRSHYMCALVRTSGAPEDRHRGLSQMIFDLALPGIEIRPIRDIAGDAHFCEVLFDNVLLPHDALVGEEGSGWRQVMAELALERSGPERIYSSMVLLDGWLAHLRCDAAPQRAQVCLAGRLAARLAVLRSMSLAVSQRLEQGADASLAAVLVKDLGTEFEQAVPELIGQALHASPQPAPDDVLMRTLAYLTLINPTFSLRGGTRHILRGIIARELGLR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

27238 : 78099

Planktothrix_phage(40.0%)

tRNA,transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010929577.1\|27238_28189_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_023998031.1\|28206_28371_+	hypothetical protein	NA	NA	NA	NA
WP_003815086.1\|28371_29145_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_003815084.1\|29234_30044_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_033446142.1\|30054_31122_-	A/G-specific adenine glycosylase	NA	NA	NA	NA
WP_014905383.1\|31279_34888_+	indolepyruvate ferredoxin oxidoreductase family protein	NA	NA	NA	NA
WP_014905384.1\|34978_35659_-	chemoreceptor glutamine deamidase CheD	NA	NA	NA	NA
WP_010927126.1\|35870_36779_-	FtsX-like permease family protein	NA	NA	NA	NA
WP_003815073.1\|36775_37447_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	9.5e-29	38.2
WP_003815070.1\|37765_38782_+	amino acid ABC transporter substrate-binding protein	A0A1B1IT51	uncultured_Mediterranean_phage	1.0e-71	42.1
WP_014905385.1\|38901_40092_+	amino acid ABC transporter permease	NA	NA	NA	NA
WP_014905386.1\|40093_41194_+	amino acid ABC transporter permease	NA	NA	NA	NA
WP_003815064.1\|41248_41989_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.4e-35	39.7
WP_010931671.1\|42109_43132_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_003815061.1\|43131_43599_+	membrane protein	NA	NA	NA	NA
WP_010931670.1\|43617_45144_-	glycerol kinase GlpK	NA	NA	NA	NA
WP_010931669.1\|45130_46588_-	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
WP_003815055.1\|46685_46874_+	DUF3460 family protein	NA	NA	NA	NA
WP_003815053.1\|46900_47788_+	segregation/condensation protein A	NA	NA	NA	NA
WP_003815051.1\|47832_48675_+	pantoate--beta-alanine ligase	NA	NA	NA	NA
WP_003815049.1\|48772_49120_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_003815047.1\|49202_49946_-	hypothetical protein	NA	NA	NA	NA
WP_003820519.1\|50186_51026_+	prepilin peptidase	NA	NA	NA	NA
WP_010931667.1\|51034_51679_+	dephospho-CoA kinase	NA	NA	NA	NA
WP_023853184.1\|51720_52473_+	cell division protein ZapD	NA	NA	NA	NA
WP_010931666.1\|52653_53904_+	MdtA/MuxA family multidrug efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_010931665.1\|53900_56969_+	MdtB/MuxB family multidrug efflux RND transporter permease subunit	NA	NA	NA	NA
WP_003815032.1\|56965_60073_+	multidrug efflux RND transporter permease subunit	NA	NA	NA	NA
WP_041166113.1\|60069_61572_+	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_005012067.1\|61670_62621_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_014486105.1\|62617_63568_-\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_003815027.1\|63668_64631_-	Nudix family hydrolase	A0A221LFJ1	Barns_Ness_breadcrumb_sponge_sobemo-like_virus	1.9e-06	53.4
WP_003815026.1\|64623_65490_-	ATP-binding protein	NA	NA	NA	NA
WP_010931662.1\|65689_66916_-	bifunctional glutamate N-acetyltransferase/amino-acid acetyltransferase ArgJ	NA	NA	NA	NA
WP_014905388.1\|67085_68036_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010929585.1\|69450_70362_+\|tRNA	glycine--tRNA ligase subunit alpha	NA	NA	NA	NA
WP_010929586.1\|70363_72502_+\|tRNA	glycine--tRNA ligase subunit beta	NA	NA	NA	NA
WP_003814404.1\|72498_73038_+	D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase	NA	NA	NA	NA
WP_003814405.1\|73041_73770_+	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_010929587.1\|73756_74650_+	M48 family metallopeptidase	NA	NA	NA	NA
WP_003814410.1\|74720_75116_+	lactoylglutathione lyase	NA	NA	NA	NA
WP_003814412.1\|75125_75656_+	peptide deformylase	E3SLL2	Synechococcus_phage	3.7e-12	35.4
WP_041166115.1\|75784_76036_-	hypothetical protein	NA	NA	NA	NA
WP_005013747.1\|76099_77050_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010930048.1\|77148_78099_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_2

83099 : 143991

Pseudomonas_phage(25.0%)

terminase,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005012067.1\|83099_84050_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003814462.1\|84207_85473_-	saccharopine dehydrogenase family protein	NA	NA	NA	NA
WP_003814461.1\|85506_86604_-	carboxynorspermidine decarboxylase	NA	NA	NA	NA
WP_014905391.1\|87258_88209_+\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_003814459.1\|88209_88779_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_014905392.1\|88846_89662_-	IclR family transcriptional regulator	NA	NA	NA	NA
WP_014905393.1\|89828_91448_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_010929978.1\|91526_92468_+	ABC transporter permease	NA	NA	NA	NA
WP_010929977.1\|92467_93352_+	ABC transporter permease	NA	NA	NA	NA
WP_010927038.1\|93355_95008_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.0e-16	30.8
WP_010929976.1\|95047_96445_+	amidase family protein	NA	NA	NA	NA
WP_010929975.1\|96486_97866_+	aminotransferase class III-fold pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_003814443.1\|97905_98124_-	DUF1059 domain-containing protein	NA	NA	NA	NA
WP_003814441.1\|98464_99337_+	oxaloacetate decarboxylase	NA	NA	NA	NA
WP_010927036.1\|99450_100098_+	OmpA family protein	NA	NA	NA	NA
WP_003814437.1\|100121_100499_+	4a-hydroxytetrahydrobiopterin dehydratase	NA	NA	NA	NA
WP_003814436.1\|100483_101185_-	membrane protein	NA	NA	NA	NA
WP_010931409.1\|101328_102021_-	nucleotidyltransferase family protein	NA	NA	NA	NA
WP_023852735.1\|102020_103061_-	phosphotransferase	NA	NA	NA	NA
WP_033446130.1\|103239_105606_+	LPS-assembly protein LptD	NA	NA	NA	NA
WP_010931412.1\|105602_107162_+	chaperone SurA	NA	NA	NA	NA
WP_010931413.1\|107186_107984_+	16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA	NA	NA	NA	NA
WP_010931414.1\|108015_109161_-	glycerate kinase	W6LM47	Streptococcus_phage	1.7e-41	42.2
WP_003814419.1\|109265_110708_+	pyruvate kinase	NA	NA	NA	NA
WP_014905394.1\|110710_111940_-	spore maturation protein	NA	NA	NA	NA
WP_005012808.1\|114077_115028_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010929759.1\|115139_115862_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_003815420.1\|115960_116704_-	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
WP_003815418.1\|118563_119295_+	iron-containing redox enzyme family protein	NA	NA	NA	NA
WP_010929761.1\|119341_120802_+	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_003815416.1\|120826_121306_+	heme-binding protein	NA	NA	NA	NA
WP_003817846.1\|121324_122335_+	2Fe-2S iron-sulfur cluster binding domain-containing protein	NA	NA	NA	NA
WP_014905395.1\|122549_123290_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_014905396.1\|123496_124471_+	beta-propeller fold lactonase family protein	NA	NA	NA	NA
WP_005012067.1\|124467_125418_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003818344.1\|127376_128255_-	fatty acid desaturase	NA	NA	NA	NA
WP_041166240.1\|129181_132160_-	hypothetical protein	NA	NA	NA	NA
WP_005012808.1\|132509_133460_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010931443.1\|133888_134491_-	hypothetical protein	R9TF81	Synechococcus_phage	7.9e-27	43.6
WP_014905397.1\|134613_134856_-	hypothetical protein	A0A0H5AUE5	Pseudomonas_phage	1.5e-16	54.5
WP_010931445.1\|134861_135917_-	hypothetical protein	A0A0H5BBX3	Pseudomonas_phage	2.6e-97	50.6
WP_010931446.1\|135945_137364_-	DUF4055 domain-containing protein	R9TF43	Synechococcus_phage	2.2e-99	42.1
WP_010931447.1\|137366_138644_-\|terminase	terminase	A0A1B1P9C9	Acinetobacter_phage	2.4e-150	64.7
WP_019247942.1\|138630_139116_-\|transposase	transposase	C7U0W1	Enterobacteria_phage	7.3e-39	61.5
WP_014905398.1\|139666_140107_-	hypothetical protein	NA	NA	NA	NA
WP_015063596.1\|140306_141125_-	hypothetical protein	K4ICN3	Acidithiobacillus_phage	1.2e-22	43.8
WP_014905401.1\|141244_141721_-	phage protein	NA	NA	NA	NA
WP_014905402.1\|141717_142473_-	hypothetical protein	U6C6D0	Ralstonia_phage	1.0e-26	38.0
WP_033470402.1\|142472_143285_-	helix-turn-helix domain-containing protein	A0A1B0YZZ0	Pseudomonas_phage	9.4e-15	45.4
WP_033452948.1\|143327_143543_+	hypothetical protein	NA	NA	NA	NA
WP_014905404.1\|143544_143991_-	DUF1364 family protein	Q8W6N7	Burkholderia_virus	5.9e-19	51.1

DBSCAN-SWA_3

148249 : 198089

Escherichia_phage(22.22%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005012067.1\|148249_149200_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_019248926.1\|149298_150372_-	hypothetical protein	NA	NA	NA	NA
WP_014905406.1\|150539_151334_+	MetQ/NlpA family ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_010925795.1\|151373_151898_-	DUF934 domain-containing protein	NA	NA	NA	NA
WP_010931474.1\|151890_153633_-	nitrite/sulfite reductase	NA	NA	NA	NA
WP_010931473.1\|153842_154601_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	4.4e-14	24.4
WP_010931472.1\|154603_155311_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	8.2e-07	25.4
WP_014905407.1\|155327_156209_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_014905408.1\|156219_157206_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_014905409.1\|157307_158225_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_014905410.1\|158346_159579_+	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_014905411.1\|159648_161067_+	amidase	NA	NA	NA	NA
WP_003819076.1\|161088_161739_-	carbonic anhydrase	NA	NA	NA	NA
WP_033446132.1\|161872_162208_-	ASCH domain-containing protein	NA	NA	NA	NA
WP_005012067.1\|162296_163247_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_014905412.1\|163243_165118_-	polysaccharide biosynthesis protein	A0A2P1ELS8	Moumouvirus	8.8e-24	26.9
WP_005012067.1\|166567_167518_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003807102.1\|167514_168219_-	DUF2837 family protein	NA	NA	NA	NA
WP_003807104.1\|168215_169322_-	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_010929610.1\|169583_170177_-	sugar transferase	NA	NA	NA	NA
WP_023853419.1\|170173_171361_-	DegT/DnrJ/EryC1/StrS family aminotransferase	NA	NA	NA	NA
WP_014905413.1\|171423_172683_-	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_010929613.1\|172706_173795_-	UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing)	A0A0N9R0B2	Chrysochromulina_ericina_virus	4.8e-46	36.3
WP_010929614.1\|173802_174903_-	DegT/DnrJ/EryC1/StrS family aminotransferase	A0A2K9L0G1	Tupanvirus	3.3e-31	29.7
WP_003807114.1\|174906_175482_-	N-acetyltransferase	NA	NA	NA	NA
WP_003807115.1\|175485_176538_-	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_014905414.1\|176668_177676_+	lipopolysaccharide heptosyltransferase I	NA	NA	NA	NA
WP_010929616.1\|177677_178964_+	3-deoxy-D-manno-octulosonic acid transferase	NA	NA	NA	NA
WP_003807124.1\|178980_179136_-	hypothetical protein	NA	NA	NA	NA
WP_010929617.1\|179160_179964_-	type III pantothenate kinase	NA	NA	NA	NA
WP_010929618.1\|179960_180827_-	biotin--[acetyl-CoA-carboxylase] ligase	NA	NA	NA	NA
WP_010929619.1\|180901_182032_+	ABC transporter permease	NA	NA	NA	NA
WP_003807131.1\|182031_182871_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	9.1e-21	32.4
WP_010929620.1\|183803_184406_+	hypothetical protein	NA	NA	NA	NA
WP_010929621.1\|184435_185089_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_005012808.1\|185316_186267_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_014905415.1\|186270_187527_+	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	6.2e-66	40.5
WP_023853421.1\|187607_188474_+	D-amino acid aminotransferase	NA	NA	NA	NA
WP_003818417.1\|188549_188825_+	YbeD family protein	NA	NA	NA	NA
WP_003818418.1\|188832_189495_+	lipoyl(octanoyl) transferase LipB	NA	NA	NA	NA
WP_003807146.1\|189556_190558_+	lipoyl synthase	NA	NA	NA	NA
WP_003807148.1\|190572_191121_-	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A291LA62	Escherichia_phage	3.7e-47	53.4
WP_010929624.1\|191178_192075_-	dTDP-4-dehydrorhamnose reductase	NA	NA	NA	NA
WP_010929625.1\|192071_193133_-	dTDP-glucose 4,6-dehydratase	A0A1D7XFE8	Escherichia_phage	1.6e-78	44.8
WP_005012808.1\|193168_194119_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_014905416.1\|194220_194649_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_003807447.1\|194721_196917_+	DUF1156 domain-containing protein	NA	NA	NA	NA
WP_005012067.1\|197138_198089_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_4

260740 : 319266

Acinetobacter_phage(30.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005012808.1\|260740_261691_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_014905431.1\|261840_262824_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_014905432.1\|265000_265735_+	crotonase	NA	NA	NA	NA
WP_014486055.1\|265810_266791_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_003807865.1\|267251_267851_+	hypothetical protein	NA	NA	NA	NA
WP_003807867.1\|267919_268912_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_014486054.1\|268961_270551_+	sulfurtransferase	NA	NA	NA	NA
WP_014486053.1\|270591_271488_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_014905433.1\|271484_273191_+	thiamine pyrophosphate-requiring protein	NA	NA	NA	NA
WP_019247259.1\|273358_274537_+	CoA transferase	NA	NA	NA	NA
WP_014486050.1\|275350_276052_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_014486049.1\|275978_276962_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010929840.1\|277419_278343_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_003814626.1\|278351_278750_-	hypothetical protein	NA	NA	NA	NA
WP_014905434.1\|278991_280971_+	DUF3220 domain-containing protein	NA	NA	NA	NA
WP_010926403.1\|283443_283644_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_010929845.1\|283756_284098_-	hypothetical protein	A0A0H5ARN8	Pseudomonas_phage	1.0e-10	45.3
WP_041166122.1\|284108_285293_-	hypothetical protein	A0A291L9X3	Bordetella_phage	1.5e-24	37.8
WP_010929847.1\|285329_285857_-	hypothetical protein	NA	NA	NA	NA
WP_010929848.1\|285914_286562_-	YqaJ viral recombinase family protein	A0A0U2BXF3	Paracoccus_phage	2.0e-31	41.4
WP_014905436.1\|286558_287545_-	DNA recombinase	H9C0R8	Aeromonas_phage	2.0e-67	57.3
WP_010926410.1\|287548_287731_-	hypothetical protein	NA	NA	NA	NA
WP_010926411.1\|287727_288105_-	hypothetical protein	NA	NA	NA	NA
WP_014905437.1\|288338_288818_-	hypothetical protein	Q3HQX1	Burkholderia_phage	1.7e-43	71.3
WP_010929577.1\|288955_289906_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_014905438.1\|289951_293338_-	molybdopterin-dependent oxidoreductase	NA	NA	NA	NA
WP_010929801.1\|293479_293884_-	RidA family protein	NA	NA	NA	NA
WP_010929802.1\|294027_295014_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_019247316.1\|295000_295282_-	hypothetical protein	NA	NA	NA	NA
WP_010929803.1\|296027_297260_-	dehydratase	NA	NA	NA	NA
WP_010929804.1\|297259_297754_-	MaoC family dehydratase	NA	NA	NA	NA
WP_014905439.1\|297885_298848_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_010929806.1\|298825_300079_-	CoA transferase	NA	NA	NA	NA
WP_005012067.1\|300200_301151_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010931380.1\|301163_302099_-	D-2-hydroxyacid dehydrogenase family protein	A0A1J0F959	Only_Syngen_Nebraska_virus	6.4e-15	27.7
WP_010931379.1\|302158_302998_-	thiol:disulfide interchange protein DsbC	NA	NA	NA	NA
WP_010931378.1\|302994_304164_-	UbiH/UbiF family hydroxylase	NA	NA	NA	NA
WP_003815379.1\|304160_305450_-	murein transglycosylase A	NA	NA	NA	NA
WP_003815381.1\|305492_305867_-	Co2+/Mg2+ efflux protein ApaG	NA	NA	NA	NA
WP_023852620.1\|305981_306710_+	ribulose-phosphate 3-epimerase	NA	NA	NA	NA
WP_010931377.1\|306717_307422_+	phosphoglycolate phosphatase	NA	NA	NA	NA
WP_014905440.1\|307685_309206_+	anthranilate synthase component I	S4VNU7	Pandoravirus	1.8e-43	32.0
WP_003815390.1\|309261_309825_+	aminodeoxychorismate/anthranilate synthase component II	A0A0P0IKJ1	Acinetobacter_phage	1.1e-65	62.1
WP_003817833.1\|309843_310875_+	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	7.4e-73	42.7
WP_010931375.1\|310871_311660_+	indole-3-glycerol phosphate synthase TrpC	A0A0P0IR83	Acinetobacter_phage	5.1e-66	53.0
WP_019247413.1\|311680_311839_-	hypothetical protein	NA	NA	NA	NA
WP_014905441.1\|311835_312825_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_014905442.1\|312917_313649_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_003815398.1\|313685_314315_-	2-hydroxychromene-2-carboxylate isomerase	NA	NA	NA	NA
WP_014905443.1\|314311_314578_-	DUF2917 domain-containing protein	NA	NA	NA	NA
WP_014905444.1\|314706_315621_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_014905445.1\|315662_316649_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_005013747.1\|318315_319266_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_5

406980 : 480675

Acanthamoeba_polyphaga_mimivirus(16.67%)

tRNA,transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_041166123.1\|406980_409776_-\|protease	serine protease autotransporter SphB1	NA	NA	NA	NA
WP_010929689.1\|413373_414093_+	7-cyano-7-deazaguanine synthase QueC	A0A0A0RPC6	Escherichia_phage	8.0e-50	43.9
WP_010929688.1\|414131_414680_-	N-acetyltransferase	A0A2H4J136	uncultured_Caudovirales_phage	1.2e-21	41.7
WP_010929687.1\|414834_415734_+	virginiamycin B lyase	NA	NA	NA	NA
WP_005012808.1\|415758_416709_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003807705.1\|416807_417434_-	FMN-binding negative transcriptional regulator	NA	NA	NA	NA
WP_014905464.1\|417456_418383_-	glyoxylate/hydroxypyruvate reductase A	NA	NA	NA	NA
WP_003819100.1\|418391_419978_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_010929723.1\|419974_420979_-	alpha/beta hydrolase	A0A2L2DMU8	Acanthamoeba_polyphaga_mimivirus	7.5e-30	31.5
WP_003807710.1\|421178_422039_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_010929724.1\|422070_423072_-	2-isopropylmalate synthase	NA	NA	NA	NA
WP_003819104.1\|423142_423952_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_003819105.1\|424029_425889_+	dihydroxy-acid dehydratase	NA	NA	NA	NA
WP_010929725.1\|425998_427201_-	MFS transporter	NA	NA	NA	NA
WP_004566082.1\|427314_428196_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_014905465.1\|428229_429567_-	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_004566083.1\|429696_430257_-	5'-3'-deoxyribonucleotidase	A0A1E1EUN3	Acanthamoeba_castellanii_mimivirus	3.2e-14	30.8
WP_014905466.1\|430316_431294_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_014905467.1\|432268_434128_+	bifunctional isocitrate dehydrogenase kinase/phosphatase	NA	NA	NA	NA
WP_010929808.1\|434175_435345_+	acetyl-CoA C-acyltransferase	NA	NA	NA	NA
WP_003815953.1\|435445_437053_+	methylcrotonoyl-CoA carboxylase	A0A1B2ITV7	Pike_perch_iridovirus	5.4e-22	57.3
WP_014905468.1\|437099_439121_+	acetyl/propionyl/methylcrotonyl-CoA carboxylase subunit alpha	NA	NA	NA	NA
WP_003815955.1\|439149_439395_-	DUF1653 domain-containing protein	NA	NA	NA	NA
WP_004565905.1\|439408_440599_-	acetylornithine transaminase	A0A1V0SKB7	Klosneuvirus	4.4e-21	26.7
WP_010929811.1\|440794_441760_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_014905469.1\|441782_442934_-	DSD1 family PLP-dependent enzyme	NA	NA	NA	NA
WP_014905470.1\|443145_444108_+	TAXI family TRAP transporter solute-binding subunit	NA	NA	NA	NA
WP_010929814.1\|444231_446256_+	TRAP transporter permease	NA	NA	NA	NA
WP_014905471.1\|446452_448696_+	TonB-dependent hemoglobin/transferrin/lactoferrin family receptor	NA	NA	NA	NA
WP_003815964.1\|448974_449433_+	DUF494 domain-containing protein	NA	NA	NA	NA
WP_014905472.1\|449449_450409_+\|tRNA	tRNA glutamyl-Q(34) synthetase GluQRS	NA	NA	NA	NA
WP_014905473.1\|450395_453017_-	DUF4401 domain-containing protein	NA	NA	NA	NA
WP_010929817.1\|453080_455708_+	DNA topoisomerase III	A0A0G2YA05	Acanthamoeba_polyphaga_mimivirus	6.1e-23	25.4
WP_014905474.1\|455859_456924_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_041166124.1\|456923_457694_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	8.1e-24	33.9
WP_014905476.1\|457702_458536_+	ABC transporter permease	NA	NA	NA	NA
WP_014905477.1\|458548_459328_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_010929820.1\|459401_460835_+	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_003818228.1\|460862_461621_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_023853380.1\|461676_463518_-	biosynthetic-type acetolactate synthase large subunit	E4WLQ6	Ostreococcus_tauri_virus	2.2e-59	30.4
WP_010929823.1\|463620_464097_+	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_023853391.1\|464113_465034_-	bestrophin	NA	NA	NA	NA
WP_003818232.1\|465140_465641_+	SET domain-containing protein	NA	NA	NA	NA
WP_010929826.1\|466014_466707_+	3,4-dihydroxy-2-butanone-4-phosphate synthase	A0A2H4PQS2	Staphylococcus_phage	6.3e-36	41.6
WP_023853374.1\|466720_466861_-	hypothetical protein	NA	NA	NA	NA
WP_162471241.1\|466821_466998_-	hypothetical protein	NA	NA	NA	NA
WP_014905478.1\|467015_468014_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_033446233.1\|467976_468411_+	carbon monoxide dehydrogenase	NA	NA	NA	NA
WP_010929974.1\|469927_470812_+	DMT family transporter	NA	NA	NA	NA
WP_041166125.1\|470808_471036_-	hypothetical protein	NA	NA	NA	NA
WP_005015810.1\|471053_472004_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_080019410.1\|471983_473063_-	cardiolipin synthase ClsB	NA	NA	NA	NA
WP_010929972.1\|473059_473920_-	endonuclease	NA	NA	NA	NA
WP_003807038.1\|474032_475823_-\|tRNA	aspartate--tRNA ligase	A0A1V0SAC0	Catovirus	6.5e-08	25.5
WP_023852857.1\|475863_476514_-	DUF502 domain-containing protein	A0A2I7S9X1	Vibrio_phage	8.6e-11	28.4
WP_010929971.1\|476529_476838_-	FmdB family transcriptional regulator	NA	NA	NA	NA
WP_010929970.1\|477003_478290_-	membrane protein	NA	NA	NA	NA
WP_014905388.1\|479724_480675_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_6

530436 : 601265

Bacillus_phage(44.44%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010930525.1\|530436_531453_+\|transposase	IS110-like element IS1663 family transposase	NA	NA	NA	NA
WP_003807735.1\|531644_532748_+	AI-2E family transporter	NA	NA	NA	NA
WP_010931562.1\|532834_533599_+	phytanoyl-CoA dioxygenase	NA	NA	NA	NA
WP_010931563.1\|533720_534911_+	voltage-gated potassium channel protein	NA	NA	NA	NA
WP_005012067.1\|534907_535858_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_014905488.1\|535956_536862_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	9.8e-21	31.7
WP_003815918.1\|536858_537692_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_010929637.1\|538537_539548_-	extracellular solute-binding protein	NA	NA	NA	NA
WP_019247800.1\|539544_539934_-	substrate-binding domain-containing protein	NA	NA	NA	NA
WP_033446324.1\|540815_542081_+	amidase	NA	NA	NA	NA
WP_010929639.1\|542171_543872_-	2-isopropylmalate synthase	NA	NA	NA	NA
WP_010929640.1\|544298_544946_-	hypothetical protein	NA	NA	NA	NA
WP_049805778.1\|544944_546384_+	RNA polymerase factor sigma-54	NA	NA	NA	NA
WP_023853394.1\|546494_546779_+	(2Fe-2S)-binding protein	NA	NA	NA	NA
WP_010929512.1\|546806_547685_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_005013747.1\|548951_549902_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_049805779.1\|549994_550561_-	RNA 2',3'-cyclic phosphodiesterase	NA	NA	NA	NA
WP_014905490.1\|550650_551532_-	ferritin	NA	NA	NA	NA
WP_041166246.1\|551706_553260_-	ubiquinone biosynthesis regulatory protein kinase UbiB	A0A2N9QVT9	Dishui_lake_phycodnavirus	1.3e-33	28.7
WP_023853232.1\|553265_553901_-	SCP-2 sterol transfer family protein	NA	NA	NA	NA
WP_010929656.1\|554129_555152_-	Tim44 domain-containing protein	NA	NA	NA	NA
WP_003815111.1\|555317_556094_-	bifunctional demethylmenaquinone methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol methylase UbiE	NA	NA	NA	NA
WP_003815113.1\|556257_556956_+	phosphate regulon transcriptional regulator PhoB	W8CYM9	Bacillus_phage	8.6e-33	37.1
WP_010929655.1\|556967_558278_+	phosphate regulon sensor histidine kinase PhoR	A0A1V0SGX0	Hokovirus	6.2e-16	25.5
WP_010929654.1\|558333_559011_+	heavy metal response regulator transcription factor	W8CYM9	Bacillus_phage	1.5e-29	35.2
WP_014905492.1\|559007_560405_+	heavy metal sensor histidine kinase	NA	NA	NA	NA
WP_010929652.1\|560510_560972_+	DUF411 domain-containing protein	NA	NA	NA	NA
WP_023853237.1\|561078_562278_+	phosphoglycerate dehydrogenase	A0A1V0SBV6	Catovirus	3.1e-91	42.6
WP_010929650.1\|562328_563204_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_003815126.1\|563305_563737_+	VOC family protein	NA	NA	NA	NA
WP_010929649.1\|563761_564490_+	5-oxoprolinase subunit PxpB	NA	NA	NA	NA
WP_010929648.1\|564486_565467_+	biotin-dependent carboxyltransferase	NA	NA	NA	NA
WP_014905493.1\|565463_566222_+	LamB/YcsF family protein	NA	NA	NA	NA
WP_010929647.1\|567189_568161_+	hypothetical protein	NA	NA	NA	NA
WP_019247545.1\|568229_568988_+	hypothetical protein	NA	NA	NA	NA
WP_019247546.1\|569006_569450_+	hypothetical protein	NA	NA	NA	NA
WP_003817676.1\|569470_570283_+	enoyl-CoA hydratase	NA	NA	NA	NA
WP_010929646.1\|570288_571221_+	alpha/beta hydrolase fold domain-containing protein	NA	NA	NA	NA
WP_010929645.1\|571204_572428_+	CoA transferase	NA	NA	NA	NA
WP_010929644.1\|572515_573298_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_041166130.1\|573350_577313_-	FAD/FMN-binding oxidoreductase	NA	NA	NA	NA
WP_003815155.1\|578050_579559_+	threonine ammonia-lyase, biosynthetic	NA	NA	NA	NA
WP_077082470.1\|579607_579961_-	porin	NA	NA	NA	NA
WP_005012067.1\|579978_580929_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010929717.1\|581972_582251_-	DUF4148 domain-containing protein	NA	NA	NA	NA
WP_010929716.1\|583393_583942_-	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	1.3e-28	43.1
WP_014905495.1\|584004_585684_-	thiol reductant ABC exporter subunit CydC	W8CYL7	Bacillus_phage	3.6e-16	27.6
WP_014905496.1\|585680_587432_-	thiol reductant ABC exporter subunit CydD	W8CYL7	Bacillus_phage	3.4e-09	23.8
WP_003817696.1\|587428_587554_-	cytochrome bd-I oxidase subunit CydX	NA	NA	NA	NA
WP_004567834.1\|587567_588722_-	cytochrome d ubiquinol oxidase subunit II	NA	NA	NA	NA
WP_023852659.1\|588737_590315_-	cytochrome d ubiquinol oxidase subunit I	NA	NA	NA	NA
WP_010929712.1\|590440_590986_-	GbsR/MarR family transcriptional regulator	NA	NA	NA	NA
WP_005012067.1\|591545_592496_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003818947.1\|592710_593406_+	FadR family transcriptional regulator	NA	NA	NA	NA
WP_014905497.1\|593422_594835_+	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_010929684.1\|594947_596378_+	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_010929683.1\|596419_598333_-	phosphomethylpyrimidine synthase ThiC	NA	NA	NA	NA
WP_010929682.1\|598651_599218_+	preprotein translocase subunit SecD	NA	NA	NA	NA
WP_014905498.1\|599309_600311_+	HindIII family type II restriction endonuclease	NA	NA	NA	NA
WP_041166247.1\|600323_601265_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_7

631417 : 691206

Staphylococcus_phage(16.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010929956.1\|631417_632368_+\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_014905505.1\|632772_633417_-	urease accessory protein UreG	NA	NA	NA	NA
WP_019247677.1\|633441_634026_-	urease accessory protein UreF	NA	NA	NA	NA
WP_014905506.1\|634126_634744_-	urease accessory protein UreE	NA	NA	NA	NA
WP_014905507.1\|634746_636462_-	urease subunit alpha	NA	NA	NA	NA
WP_010931338.1\|636458_636767_-	urease subunit beta	NA	NA	NA	NA
WP_003814828.1\|636783_637401_-	HupE/UreJ family protein	NA	NA	NA	NA
WP_010931340.1\|637445_637748_-	urease subunit gamma	NA	NA	NA	NA
WP_003814832.1\|637848_638703_-	urease accessory protein UreD	NA	NA	NA	NA
WP_124740609.1\|638890_639115_-	hypothetical protein	NA	NA	NA	NA
WP_010929281.1\|639284_639557_+	MerR family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_010929282.1\|639974_640382_-	GFA family protein	NA	NA	NA	NA
WP_010931341.1\|640751_641546_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_005013747.1\|641589_642540_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_014905508.1\|643696_644743_+	TRAP transporter substrate-binding protein	NA	NA	NA	NA
WP_005013747.1\|644841_645792_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_014905509.1\|646022_647744_-	membrane protein insertase YidC	NA	NA	NA	NA
WP_003816027.1\|647792_648065_-	membrane protein insertion efficiency factor YidD	A0A2H4PQM5	Staphylococcus_phage	7.0e-15	52.2
WP_003816026.1\|648061_648433_-	ribonuclease P protein component	NA	NA	NA	NA
WP_003816025.1\|648528_648663_-	50S ribosomal protein L34	NA	NA	NA	NA
WP_010929554.1\|649068_650478_+	chromosomal replication initiator protein DnaA	NA	NA	NA	NA
WP_010929839.1\|650480_651590_+	DNA polymerase III subunit beta	B4UTW9	Rhizobium_phage	1.2e-41	32.6
WP_010929838.1\|651684_654138_+	DNA topoisomerase (ATP-hydrolyzing) subunit B	G3M9Z3	Bacillus_virus	2.3e-112	34.8
WP_015040793.1\|654256_655048_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_010929836.1\|655167_656595_+	amidase	NA	NA	NA	NA
WP_010929835.1\|656633_657605_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_010929834.1\|658023_659187_+	alpha-hydroxy-acid oxidizing protein	NA	NA	NA	NA
WP_014905511.1\|659274_660120_+	AraC family transcriptional regulator	NA	NA	NA	NA
WP_041166131.1\|660213_661953_+	peptidase M14	NA	NA	NA	NA
WP_003816007.1\|661973_662411_+	acetyltransferase	NA	NA	NA	NA
WP_005012067.1\|662509_663460_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010931139.1\|663456_664608_-	aromatic ring-hydroxylating dioxygenase subunit alpha	NA	NA	NA	NA
WP_014905513.1\|664755_665766_-	acyltransferase family protein	A0A0F6TJ51	Escherichia_coli_O157_typing_phage	6.2e-16	25.1
WP_010931138.1\|665936_666902_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_033446289.1\|667076_667907_+	IclR family transcriptional regulator	NA	NA	NA	NA
WP_003813109.1\|667993_668260_+	exodeoxyribonuclease VII small subunit	NA	NA	NA	NA
WP_014905514.1\|668264_669176_+	polyprenyl synthetase family protein	NA	NA	NA	NA
WP_010931136.1\|669225_671088_+	1-deoxy-D-xylulose-5-phosphate synthase	NA	NA	NA	NA
WP_003813103.1\|671244_672042_+	GTP cyclohydrolase I FolE2	NA	NA	NA	NA
WP_010926331.1\|672261_672642_+	30S ribosomal protein S6	NA	NA	NA	NA
WP_003813095.1\|672689_673013_+	primosomal replication protein N	NA	NA	NA	NA
WP_003813094.1\|673105_673378_+	30S ribosomal protein S18	NA	NA	NA	NA
WP_010931135.1\|673393_673849_+	50S ribosomal protein L9	NA	NA	NA	NA
WP_003813091.1\|673965_674802_+	hypothetical protein	NA	NA	NA	NA
WP_003813089.1\|674798_676172_+	replicative DNA helicase	C7BGG1	Burkholderia_phage	4.0e-135	58.2
WP_014905515.1\|676192_677161_-	bile acid:sodium symporter	NA	NA	NA	NA
WP_003813085.1\|677240_678218_-	4-hydroxythreonine-4-phosphate dehydrogenase PdxA	NA	NA	NA	NA
WP_003813082.1\|678322_680002_-	PhoH family protein	A0A2I7SAD7	Vibrio_phage	1.5e-70	36.9
WP_003813079.1\|680081_680546_-	peroxiredoxin	NA	NA	NA	NA
WP_003813077.1\|680548_681001_-	Xcc1710-like domain-containing protein	NA	NA	NA	NA
WP_010931132.1\|681217_682405_+	alanine transaminase	NA	NA	NA	NA
WP_003813074.1\|682401_683706_+	homoserine dehydrogenase	NA	NA	NA	NA
WP_010931131.1\|683702_685109_+	threonine synthase	NA	NA	NA	NA
WP_003813070.1\|685322_685544_+	YgdI/YgdR family lipoprotein	NA	NA	NA	NA
WP_005012808.1\|685752_686703_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_162835094.1\|686774_687872_+	Ldh family oxidoreductase	NA	NA	NA	NA
WP_005012067.1\|690255_691206_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_8

700852 : 768120

uncultured_Mediterranean_phage(25.0%)

holin,transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005012067.1\|700852_701803_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_014905517.1\|701970_703362_+	exodeoxyribonuclease VII large subunit	A0A1V0SD82	Indivirus	1.4e-29	32.0
WP_010931119.1\|703434_704013_+	superoxide dismutase [Fe]	NA	NA	NA	NA
WP_041166132.1\|704129_705527_+	chloride channel protein	NA	NA	NA	NA
WP_014905519.1\|705642_706848_+	3-oxoadipyl-CoA thiolase	NA	NA	NA	NA
WP_003820399.1\|706947_707466_-	hypothetical protein	A0A1B1IUW8	uncultured_Mediterranean_phage	5.1e-14	42.2
WP_003812875.1\|707560_707806_-	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	1.3e-20	76.6
WP_003820400.1\|708033_708348_+\|protease	ATP-dependent Clp protease adapter ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	1.2e-10	43.8
WP_162471245.1\|708446_713627_+	alpha-2-macroglobulin family protein	NA	NA	NA	NA
WP_010931115.1\|713623_715792_+	penicillin-binding protein 1C	NA	NA	NA	NA
WP_014905521.1\|715847_718163_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	3.1e-164	41.9
WP_003820402.1\|718167_719487_+	PqiA/YebS family transporter subunit	NA	NA	NA	NA
WP_014905522.1\|719505_721179_+	MCE family protein	NA	NA	NA	NA
WP_010931111.1\|721183_721852_+	membrane integrity-associated transporter subunit PqiC	NA	NA	NA	NA
WP_010931110.1\|722008_725830_+	trifunctional transcriptional regulator/proline dehydrogenase/L-glutamate gamma-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_158322896.1\|725984_726143_-	hypothetical protein	NA	NA	NA	NA
WP_005015810.1\|726160_727111_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003812857.1\|727132_728278_+	branched-chain amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_014905523.1\|728426_729356_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_003812851.1\|729352_730441_+	ABC transporter ATP-binding protein	NA	NA	NA	NA
WP_010931109.1\|730437_731241_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	7.9e-14	23.5
WP_003812846.1\|731237_731969_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.4e-12	31.0
WP_010931108.1\|732026_733316_-	MFS transporter	NA	NA	NA	NA
WP_010931107.1\|733412_734015_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_003812839.1\|738566_738905_-	P-II family nitrogen regulator	NA	NA	NA	NA
WP_010931105.1\|739612_739879_+	accessory factor UbiK family protein	NA	NA	NA	NA
WP_014905524.1\|742531_743869_-	MFS transporter	NA	NA	NA	NA
WP_014905525.1\|745129_747130_+	cytochrome o ubiquinol oxidase subunit I	NA	NA	NA	NA
WP_014905526.1\|747122_747764_+	cytochrome o ubiquinol oxidase subunit III	NA	NA	NA	NA
WP_003809276.1\|747760_748168_+	cytochrome o ubiquinol oxidase subunit IV	NA	NA	NA	NA
WP_010931101.1\|748164_748965_+	SURF1 family protein	NA	NA	NA	NA
WP_014905527.1\|749039_749744_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_010931099.1\|749775_750570_+	N-formylglutamate deformylase	NA	NA	NA	NA
WP_005013747.1\|750566_751517_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003813999.1\|751657_752875_+	threonine ammonia-lyase	NA	NA	NA	NA
WP_010930016.1\|752868_753480_-	PIN domain-containing protein	K4HZX4	Acidithiobacillus_phage	3.3e-12	32.5
WP_003813997.1\|754113_755091_+	NAD(P)H-quinone oxidoreductase	NA	NA	NA	NA
WP_003813996.1\|755234_755981_+	triose-phosphate isomerase	NA	NA	NA	NA
WP_010930017.1\|756002_756449_+	preprotein translocase subunit SecG	NA	NA	NA	NA
WP_014905528.1\|757236_759468_+\|holin	choline BCCT transporter BetT	NA	NA	NA	NA
WP_003813993.1\|759490_760291_-	IclR family transcriptional regulator	NA	NA	NA	NA
WP_003813992.1\|760572_761805_+	methylaspartate ammonia-lyase	NA	NA	NA	NA
WP_003813991.1\|761915_762905_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_010930019.1\|762935_764324_+	MmgE/PrpD family protein	NA	NA	NA	NA
WP_014905529.1\|764371_765865_+	argininosuccinate lyase	NA	NA	NA	NA
WP_003813988.1\|765923_766907_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_014905421.1\|767103_768120_+\|transposase	IS110-like element IS1663 family transposase	NA	NA	NA	NA

DBSCAN-SWA_9

791110 : 852694

Vibrio_phage(12.5%)

holin,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005013747.1\|791110_792061_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003813960.1\|792143_794102_+\|holin	choline BCCT transporter BetT	A0A2I7QNT1	Vibrio_phage	8.0e-28	30.3
WP_010930033.1\|794129_794831_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_014905538.1\|794835_795795_+	hypothetical protein	NA	NA	NA	NA
WP_003813954.1\|795791_796607_+	DNA repair exonuclease	NA	NA	NA	NA
WP_003813952.1\|796623_797427_+	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_003813951.1\|797410_797845_-	hypothetical protein	NA	NA	NA	NA
WP_003813949.1\|797841_798276_-	PaaI family thioesterase	NA	NA	NA	NA
WP_041166249.1\|798277_798877_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_010929577.1\|798849_799800_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_135186269.1\|799817_800144_+	hypothetical protein	NA	NA	NA	NA
WP_033446280.1\|800202_800910_+	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_019247284.1\|800884_802039_+	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_014905539.1\|802163_802436_-	YkgJ family cysteine cluster protein	NA	NA	NA	NA
WP_010930871.1\|802440_803205_-	YdcF family protein	NA	NA	NA	NA
WP_010926806.1\|803217_804183_-	heptosyltransferase II	NA	NA	NA	NA
WP_003813209.1\|804294_806070_+	lipid A export permease/ATP-binding protein MsbA	W8CYL7	Bacillus_phage	4.0e-50	29.5
WP_010930869.1\|806042_807542_-	MFS transporter	NA	NA	NA	NA
WP_003813206.1\|807625_808171_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_014905540.1\|808167_809070_+	PDT and ACT domain-containing protein	NA	NA	NA	NA
WP_010930867.1\|809103_810567_-	ribonuclease G	NA	NA	NA	NA
WP_005012808.1\|810610_811561_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_014905541.1\|818039_820787_+	autotransporter Vag8	NA	NA	NA	NA
WP_010930865.1\|820807_821431_-	septum formation inhibitor Maf	NA	NA	NA	NA
WP_003813199.1\|821442_821913_-	23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH	NA	NA	NA	NA
WP_003813196.1\|821924_822311_-	ribosome silencing factor	NA	NA	NA	NA
WP_003820260.1\|822372_822960_-	nicotinate (nicotinamide) nucleotide adenylyltransferase	NA	NA	NA	NA
WP_010930863.1\|822956_823868_-	oxygen-dependent coproporphyrinogen oxidase	NA	NA	NA	NA
WP_023853662.1\|823883_825194_-	phosphoribosylamine--glycine ligase	NA	NA	NA	NA
WP_010930861.1\|825291_826023_-	YebC/PmpR family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_023853666.1\|826177_827698_+	DUF853 domain-containing protein	A0A248XCZ8	Klebsiella_phage	1.7e-78	44.9
WP_023853659.1\|827770_829114_+	sodium:alanine symporter family protein	NA	NA	NA	NA
WP_076879554.1\|829148_830474_-	aspartate aminotransferase family protein	A0A1C9EHH3	Mycobacterium_phage	1.8e-07	22.5
WP_010930857.1\|830655_831588_+	glyoxylate/hydroxypyruvate reductase A	NA	NA	NA	NA
WP_010930856.1\|831598_833092_-	aldehyde dehydrogenase	NA	NA	NA	NA
WP_010930855.1\|833088_834012_-	DMT family transporter	NA	NA	NA	NA
WP_010930854.1\|834014_835277_-	Zn-dependent hydrolase	NA	NA	NA	NA
WP_047122810.1\|835296_836310_-	histone deacetylase family protein	A0A2K9L4C2	Tupanvirus	1.7e-42	35.2
WP_010930852.1\|836382_836673_-	cupin domain-containing protein	NA	NA	NA	NA
WP_014905542.1\|836702_837977_-	4-aminobutyrate--2-oxoglutarate transaminase	A0A1V0SKB7	Klosneuvirus	1.2e-24	27.9
WP_162268683.1\|837958_838102_-	hypothetical protein	NA	NA	NA	NA
WP_014905543.1\|838119_839070_+\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_014905544.1\|839066_840704_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.6e-21	30.6
WP_003813165.1\|840708_841548_-	ABC transporter permease	NA	NA	NA	NA
WP_161780341.1\|841544_842552_-	ABC transporter permease	NA	NA	NA	NA
WP_010930848.1\|842668_844243_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_010930847.1\|844662_846207_+	PLP-dependent aminotransferase family protein	A0A1X9I5H2	Streptococcus_phage	3.1e-14	25.4
WP_010930846.1\|846311_847379_+	tartrate dehydrogenase	NA	NA	NA	NA
WP_003813155.1\|847397_848984_-	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
WP_010930844.1\|848980_850171_-	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_005012067.1\|851743_852694_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_10

1345965 : 1414957

Klosneuvirus(10.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005013747.1\|1345965_1346916_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_014905635.1\|1347014_1349615_-	TRAP transporter fused permease subunit	NA	NA	NA	NA
WP_003818658.1\|1349721_1350726_-	TAXI family TRAP transporter solute-binding subunit	NA	NA	NA	NA
WP_003818660.1\|1350834_1352175_-	aspartate aminotransferase family protein	A0A1V0SKB7	Klosneuvirus	8.8e-18	22.8
WP_003818661.1\|1352215_1353244_-	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_010930802.1\|1353439_1353985_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_010930801.1\|1353981_1354542_+	diaminobutyrate acetyltransferase	NA	NA	NA	NA
WP_005012067.1\|1354640_1355591_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010930797.1\|1358331_1359621_-	D-amino acid dehydrogenase	NA	NA	NA	NA
WP_010930798.1\|1359739_1360177_-	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_010930799.1\|1360220_1361429_-	NO-inducible flavohemoprotein	NA	NA	NA	NA
WP_003810867.1\|1361575_1362040_+	GatB/YqeY domain-containing protein	A0A0K2FLI9	Brevibacillus_phage	3.9e-05	32.4
WP_005015810.1\|1362063_1363014_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010930595.1\|1363112_1364129_-	folate-binding protein YgfZ	NA	NA	NA	NA
WP_014905636.1\|1364307_1365342_+	endolytic transglycosylase MltG	NA	NA	NA	NA
WP_003811733.1\|1365338_1365965_+	dTMP kinase	A0A1L2BX49	Bacteriophage	1.6e-22	35.1
WP_014905637.1\|1365961_1367020_+	DNA polymerase III subunit delta'	NA	NA	NA	NA
WP_010930598.1\|1367069_1367840_+	TatD family hydrolase	NA	NA	NA	NA
WP_014905638.1\|1367890_1368727_+	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_010930600.1\|1368923_1369664_+	IclR family transcriptional regulator	NA	NA	NA	NA
WP_014905639.1\|1369738_1370482_+	glutamine ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_020699606.1\|1371158_1371917_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.7e-31	37.9
WP_014905640.1\|1373054_1374344_+	Glu/Leu/Phe/Val dehydrogenase	NA	NA	NA	NA
WP_010930602.1\|1375954_1377202_-	Zn-dependent hydrolase	NA	NA	NA	NA
WP_010930603.1\|1377211_1378921_-	thiamine pyrophosphate-binding protein	A0A0P0YLY7	Yellowstone_lake_phycodnavirus	5.9e-35	27.3
WP_003811709.1\|1378917_1379856_-	citrate lyase subunit beta	NA	NA	NA	NA
WP_003811706.1\|1379852_1381136_-	TRAP transporter large permease	NA	NA	NA	NA
WP_010930604.1\|1381139_1381622_-	TRAP transporter small permease	NA	NA	NA	NA
WP_014905641.1\|1381622_1382609_-	DctP family TRAP transporter solute-binding subunit	NA	NA	NA	NA
WP_003811701.1\|1382781_1383501_-	FadR family transcriptional regulator	NA	NA	NA	NA
WP_005013747.1\|1383617_1384568_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003811518.1\|1385238_1386228_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_014905642.1\|1387169_1388375_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003811524.1\|1388570_1389056_+	glyoxalase	NA	NA	NA	NA
WP_041166153.1\|1389039_1390257_+	monooxygenase	NA	NA	NA	NA
WP_014905644.1\|1390433_1391360_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_014905645.1\|1393597_1394548_+\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_010930090.1\|1394577_1394760_-	type II toxin-antitoxin system HicA family toxin	A0A1L2JY37	Aeribacillus_phage	3.7e-12	56.1
WP_014905646.1\|1395532_1396714_-	MFS transporter	NA	NA	NA	NA
WP_010930092.1\|1396929_1397607_-	HAD-IA family hydrolase	NA	NA	NA	NA
WP_010930093.1\|1397603_1398329_-	bifunctional 3-demethylubiquinone 3-O-methyltransferase/2-octaprenyl-6-hydroxy phenol methylase	NA	NA	NA	NA
WP_010930094.1\|1398454_1399036_-	OmpA family protein	NA	NA	NA	NA
WP_014905647.1\|1399406_1402124_+	DNA gyrase subunit A	G3M9Z5	Bacillus_virus	3.3e-104	33.5
WP_023852687.1\|1402126_1403257_+	3-phosphoserine/phosphohydroxythreonine transaminase	M1Q1P2	Streptococcus_phage	4.9e-78	44.0
WP_010930097.1\|1403249_1404335_+	prephenate dehydratase	NA	NA	NA	NA
WP_010930098.1\|1404421_1405321_+	prephenate dehydrogenase/arogenate dehydrogenase family protein	NA	NA	NA	NA
WP_010930099.1\|1405317_1406646_+	3-phosphoshikimate 1-carboxyvinyltransferase	NA	NA	NA	NA
WP_014905648.1\|1406660_1407332_+	(d)CMP kinase	NA	NA	NA	NA
WP_010930101.1\|1407519_1409235_+	30S ribosomal protein S1	NA	NA	NA	NA
WP_010930102.1\|1409236_1409596_+	integration host factor subunit beta	NA	NA	NA	NA
WP_010930103.1\|1409787_1410102_+	DUF1049 domain-containing protein	NA	NA	NA	NA
WP_010930104.1\|1410144_1411365_+	lipopolysaccharide assembly protein LapB	NA	NA	NA	NA
WP_010930105.1\|1411361_1412303_+	D-glycero-beta-D-manno-heptose-7-phosphate kinase	A0A2H4N7X4	Lake_Baikal_phage	1.5e-16	28.1
WP_014905649.1\|1412299_1413289_+	ADP-glyceromanno-heptose 6-epimerase	E3SJ87	Synechococcus_phage	2.2e-26	34.4
WP_033446303.1\|1413323_1413908_+	helix-hairpin-helix domain-containing protein	NA	NA	NA	NA
WP_005012067.1\|1414006_1414957_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_11

1434359 : 1567380

108

Erysipelothrix_phage(25.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010930048.1\|1434359_1435310_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010930118.1\|1435414_1436464_+	NADP(H)-dependent aldo-keto reductase	NA	NA	NA	NA
WP_010930525.1\|1436560_1437577_-\|transposase	IS110-like element IS1663 family transposase	NA	NA	NA	NA
WP_010926548.1\|1439085_1439658_-	chorismate lyase	NA	NA	NA	NA
WP_010930119.1\|1439717_1440449_+	rRNA pseudouridine synthase	NA	NA	NA	NA
WP_029443805.1\|1440500_1441418_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_014486063.1\|1445403_1446786_+	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_010930123.1\|1446855_1447107_-	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
WP_010930124.1\|1447254_1447869_-	SCO family protein	NA	NA	NA	NA
WP_010930125.1\|1448055_1450116_-	M3 family metallopeptidase	NA	NA	NA	NA
WP_003811948.1\|1450245_1451097_-	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD	A0A249XZQ2	Enterococcus_phage	2.1e-33	39.8
WP_010930126.1\|1451093_1451720_-	response regulator transcription factor	NA	NA	NA	NA
WP_003817147.1\|1451716_1453471_-	PAS domain S-box protein	NA	NA	NA	NA
WP_014905653.1\|1453763_1456469_+	pyruvate dehydrogenase (acetyl-transferring), homodimeric type	NA	NA	NA	NA
WP_014905654.1\|1456481_1458128_+	dihydrolipoyllysine-residue acetyltransferase	NA	NA	NA	NA
WP_014905655.1\|1458140_1459916_+	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	2.4e-39	25.2
WP_003817151.1\|1460137_1461313_-	FliC/FljB family flagellin	NA	NA	NA	NA
WP_005012808.1\|1461355_1462306_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010930130.1\|1462404_1463145_-	16S rRNA (uracil(1498)-N(3))-methyltransferase	NA	NA	NA	NA
WP_010930131.1\|1463339_1465376_+	transketolase	NA	NA	NA	NA
WP_010930132.1\|1465393_1466404_+	type I glyceraldehyde-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_010930133.1\|1466521_1467715_+	phosphoglycerate kinase	NA	NA	NA	NA
WP_014905656.1\|1467744_1468518_-	enoyl-ACP reductase FabI	NA	NA	NA	NA
WP_014905657.1\|1468514_1469705_-	acetate kinase	NA	NA	NA	NA
WP_003809454.1\|1469730_1470669_-	phosphate acetyltransferase	NA	NA	NA	NA
WP_014905658.1\|1470665_1473014_-	DUF3141 domain-containing protein	NA	NA	NA	NA
WP_010930137.1\|1473168_1473810_-	glutathione transferase	NA	NA	NA	NA
WP_077085735.1\|1473913_1475047_-\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_023994624.1\|1475139_1475292_-	hypothetical protein	NA	NA	NA	NA
WP_014905659.1\|1475323_1475872_-	diguanylate cyclase	NA	NA	NA	NA
WP_003819814.1\|1475890_1476376_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_010930139.1\|1476553_1477492_+	DnaJ domain-containing protein	A0A0P0YMJ9	Yellowstone_lake_phycodnavirus	5.6e-11	24.1
WP_003809467.1\|1477494_1477812_+	MerR family transcriptional regulator	NA	NA	NA	NA
WP_019247197.1\|1477857_1478802_+	AzlC family ABC transporter permease	NA	NA	NA	NA
WP_010930140.1\|1478822_1480298_-	inorganic phosphate transporter	NA	NA	NA	NA
WP_010930141.1\|1480482_1481133_+	molybdopterin adenylyltransferase	NA	NA	NA	NA
WP_003809479.1\|1481186_1481522_+	hypothetical protein	NA	NA	NA	NA
WP_014905660.1\|1481518_1482379_+	M23 family metallopeptidase	A0A292GJG6	Xanthomonas_phage	4.5e-15	35.4
WP_003819817.1\|1482395_1482677_-	hypothetical protein	NA	NA	NA	NA
WP_003809486.1\|1482750_1483014_-	translation initiation factor IF-1	NA	NA	NA	NA
WP_005012067.1\|1483257_1484208_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010930768.1\|1484204_1486070_-	sigma-54-dependent Fis family transcriptional regulator	NA	NA	NA	NA
WP_014905661.1\|1486327_1487857_+	aldehyde dehydrogenase	NA	NA	NA	NA
WP_003816959.1\|1487968_1488619_-	flavodoxin family protein	NA	NA	NA	NA
WP_010930766.1\|1489671_1490967_+	DUF445 domain-containing protein	NA	NA	NA	NA
WP_010930765.1\|1490988_1491873_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_014905662.1\|1491971_1492847_+	PhzF family phenazine biosynthesis protein	NA	NA	NA	NA
WP_003816964.1\|1492836_1493193_-	DUF1428 domain-containing protein	NA	NA	NA	NA
WP_010930763.1\|1493323_1494298_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_003812228.1\|1494427_1494607_-	DUF3008 family protein	NA	NA	NA	NA
WP_029443822.1\|1494704_1495229_+	DUF302 domain-containing protein	NA	NA	NA	NA
WP_003816971.1\|1496188_1496560_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_010930760.1\|1496556_1497108_+	SRPBCC family protein	NA	NA	NA	NA
WP_003816977.1\|1498831_1499512_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_014905663.1\|1499759_1500224_-	hypothetical protein	NA	NA	NA	NA
WP_010930758.1\|1500393_1501323_+	ZIP family metal transporter	NA	NA	NA	NA
WP_019247659.1\|1501335_1501983_-	hypothetical protein	NA	NA	NA	NA
WP_023997035.1\|1502056_1503874_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.3e-37	27.4
WP_005012067.1\|1503957_1504908_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_005013747.1\|1505560_1506511_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003812199.1\|1506529_1506877_-	GFA family protein	NA	NA	NA	NA
WP_014905664.1\|1506905_1508345_-	DHA2 family efflux MFS transporter permease subunit	A0A0M3UL24	Mycobacterium_phage	8.8e-56	37.6
WP_014905665.1\|1508363_1508759_-	VOC family protein	NA	NA	NA	NA
WP_003812191.1\|1508933_1509542_+	peptidase S16	NA	NA	NA	NA
WP_010930753.1\|1509554_1510373_+	hypothetical protein	A0A1B1INV8	uncultured_Mediterranean_phage	2.3e-16	28.8
WP_010930752.1\|1510324_1511299_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_014905666.1\|1511327_1512395_-	XdhC family protein	NA	NA	NA	NA
WP_014905667.1\|1512391_1514608_-	xanthine dehydrogenase family protein molybdopterin-binding subunit	NA	NA	NA	NA
WP_010930750.1\|1514621_1515080_-	(2Fe-2S)-binding protein	NA	NA	NA	NA
WP_003812179.1\|1515237_1515582_-	exported protein	NA	NA	NA	NA
WP_010930749.1\|1515738_1516644_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_010930748.1\|1516730_1517744_+	pyridoxamine 5'-phosphate oxidase	NA	NA	NA	NA
WP_014905421.1\|1519738_1520755_+\|transposase	IS110-like element IS1663 family transposase	NA	NA	NA	NA
WP_010930747.1\|1520897_1522250_-	glutathione-disulfide reductase	A0A2K5B2C5	Erysipelothrix_phage	8.5e-45	27.4
WP_003812172.1\|1522424_1522721_+	hypothetical protein	NA	NA	NA	NA
WP_014905668.1\|1522819_1523770_+\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_019247855.1\|1524255_1524432_-	winged helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_003812044.1\|1525116_1526088_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_014905669.1\|1526091_1526946_+	polysaccharide deacetylase	NA	NA	NA	NA
WP_003812040.1\|1526964_1527783_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_080019425.1\|1527802_1529263_+	amidase	NA	NA	NA	NA
WP_019247851.1\|1529220_1530054_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_014905672.1\|1530339_1531845_-	M81 family metallopeptidase	NA	NA	NA	NA
WP_003812032.1\|1531886_1532669_-	exodeoxyribonuclease III	NA	NA	NA	NA
WP_003812030.1\|1532738_1533185_-	membrane protein	NA	NA	NA	NA
WP_010930743.1\|1533181_1534408_-	NnrS family protein	NA	NA	NA	NA
WP_003812026.1\|1534400_1534805_-	group III truncated hemoglobin	NA	NA	NA	NA
WP_003812024.1\|1534964_1535267_+	SelT/SelW/SelH family protein	NA	NA	NA	NA
WP_005013747.1\|1535263_1536214_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_023999972.1\|1536231_1536471_+	hypothetical protein	NA	NA	NA	NA
WP_019247530.1\|1536952_1537384_-	BcpO-related WXXGXW repeat protein	NA	NA	NA	NA
WP_003811318.1\|1537565_1537970_-	DoxX family protein	NA	NA	NA	NA
WP_003811319.1\|1538174_1539212_+	M4 family metallopeptidase	NA	NA	NA	NA
WP_010930301.1\|1539208_1539532_+	hypothetical protein	NA	NA	NA	NA
WP_010926674.1\|1539534_1540422_-	aldo/keto reductase	NA	NA	NA	NA
WP_003811322.1\|1540454_1540880_-	universal stress protein	NA	NA	NA	NA
WP_019247534.1\|1540951_1541305_-	hypothetical protein	NA	NA	NA	NA
WP_003811324.1\|1541544_1542051_-	hypothetical protein	NA	NA	NA	NA
WP_014905673.1\|1542089_1543421_-	transcriptional regulator PtsJ	NA	NA	NA	NA
WP_003811326.1\|1543480_1544296_+	YggS family pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_010930303.1\|1544292_1545147_+	pyridoxine/pyridoxal/pyridoxamine kinase	NA	NA	NA	NA
WP_010930304.1\|1548209_1550753_-	malto-oligosyltrehalose synthase	NA	NA	NA	NA
WP_014905674.1\|1552298_1553249_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_014905675.1\|1553228_1554923_-	malto-oligosyltrehalose trehalohydrolase	NA	NA	NA	NA
WP_010930306.1\|1554919_1557040_-	glycogen debranching protein GlgX	NA	NA	NA	NA
WP_010930307.1\|1557044_1559240_-	1,4-alpha-glucan branching protein GlgB	NA	NA	NA	NA
WP_005013747.1\|1560345_1561296_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_005012808.1\|1566429_1567380_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_12

1579546 : 1641321

Streptococcus_phage(16.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014905678.1\|1579546_1580563_-\|transposase	IS110-like element IS1663 family transposase	NA	NA	NA	NA
WP_010931098.1\|1580754_1583091_-	heavy metal translocating P-type ATPase	E4ZFI9	Streptococcus_phage	3.2e-124	42.8
WP_003812014.1\|1583173_1583608_+	Cd(II)/Pb(II)-responsive transcriptional regulator	NA	NA	NA	NA
WP_005012067.1\|1583706_1584657_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010930051.1\|1584653_1586486_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.3e-27	26.4
WP_010930052.1\|1586884_1587544_+	thiopurine S-methyltransferase	NA	NA	NA	NA
WP_023852837.1\|1587637_1587784_+	hypothetical protein	NA	NA	NA	NA
WP_003809770.1\|1587892_1588060_+	hypothetical protein	NA	NA	NA	NA
WP_010930054.1\|1588071_1588752_-	DUF3313 domain-containing protein	NA	NA	NA	NA
WP_010930055.1\|1589033_1589750_+	flagellar brake protein	NA	NA	NA	NA
WP_010930056.1\|1589764_1591066_-	phospholipase	NA	NA	NA	NA
WP_010930057.1\|1596330_1597683_+	MmgE/PrpD family protein	NA	NA	NA	NA
WP_004568140.1\|1597711_1598233_+	acetyl-CoA carboxylase biotin carboxyl carrier protein	NA	NA	NA	NA
WP_003819989.1\|1598229_1599684_+	carboxylase	NA	NA	NA	NA
WP_023852826.1\|1599718_1599967_+	hypothetical protein	NA	NA	NA	NA
WP_019247557.1\|1600072_1600948_+	amidohydrolase	NA	NA	NA	NA
WP_014905679.1\|1600973_1602029_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_010930061.1\|1602041_1602833_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_014905680.1\|1602865_1604236_+	acetyl-CoA carboxylase biotin carboxylase subunit	NA	NA	NA	NA
WP_005012067.1\|1605412_1606363_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003819994.1\|1606881_1607103_+	biotin/lipoyl-binding carrier protein	NA	NA	NA	NA
WP_014905681.1\|1607099_1607825_+	acetate--CoA ligase family protein	NA	NA	NA	NA
WP_014905682.1\|1607832_1609329_+	acyl-CoA synthetase	NA	NA	NA	NA
WP_014905683.1\|1609367_1610375_+	TRAP transporter substrate-binding protein	NA	NA	NA	NA
WP_014905684.1\|1610477_1611035_+	TRAP transporter small permease	NA	NA	NA	NA
WP_003809811.1\|1611052_1612339_+	TRAP transporter large permease	NA	NA	NA	NA
WP_041166162.1\|1612351_1613479_+	MFS transporter	NA	NA	NA	NA
WP_014905685.1\|1613579_1614812_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_014905686.1\|1614910_1615321_+	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_041166261.1\|1615353_1616157_+	2-oxo-hepta-3-ene-1,7-dioic acid hydratase	NA	NA	NA	NA
WP_005015810.1\|1616213_1617164_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003809618.1\|1617315_1617918_-	YhbY family RNA-binding protein	NA	NA	NA	NA
WP_010930175.1\|1617936_1618569_+	RlmE family RNA methyltransferase	NA	NA	NA	NA
WP_162096758.1\|1618613_1618865_-	hypothetical protein	NA	NA	NA	NA
WP_003809623.1\|1618806_1620693_+	ATP-dependent metallopeptidase FtsH/Yme1/Tma family protein	M4QMW8	Micromonas_pusilla_virus	1.4e-109	41.5
WP_014905688.1\|1620711_1621554_+	dihydropteroate synthase	A0A0B5J4J5	Pandoravirus	2.7e-25	32.2
WP_003819875.1\|1621550_1622909_+	phosphoglucosamine mutase	NA	NA	NA	NA
WP_003809629.1\|1623129_1623924_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_010930172.1\|1624154_1625648_-	exopolyphosphatase	NA	NA	NA	NA
WP_010930171.1\|1625883_1627965_+	polyphosphate kinase 1	NA	NA	NA	NA
WP_014486066.1\|1628159_1629200_+	phosphate ABC transporter substrate-binding protein PstS	M4QHS4	Cyanophage	2.1e-51	40.2
WP_014905689.1\|1629334_1630351_+	phosphate ABC transporter permease subunit PstC	NA	NA	NA	NA
WP_003809638.1\|1630372_1631230_+	phosphate ABC transporter permease PstA	NA	NA	NA	NA
WP_010930167.1\|1631274_1632051_+	phosphate ABC transporter ATP-binding protein PstB	G9BWD6	Planktothrix_phage	4.3e-17	28.7
WP_158322903.1\|1632263_1632401_-	hypothetical protein	NA	NA	NA	NA
WP_005013747.1\|1632418_1633369_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_014905690.1\|1633900_1634869_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_014905691.1\|1635190_1636198_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_041166163.1\|1636257_1637052_+	enoyl-CoA hydratase	NA	NA	NA	NA
WP_014905693.1\|1637204_1638092_+	CoA ester lyase	NA	NA	NA	NA
WP_014905694.1\|1638121_1638577_+	MaoC family dehydratase	NA	NA	NA	NA
WP_014905695.1\|1638655_1639888_+	CoA transferase	NA	NA	NA	NA
WP_014905696.1\|1640370_1641321_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_13

1680386 : 1726340

Paramecium_bursaria_Chlorella_virus(50.0%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005012067.1\|1680386_1681337_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003814052.1\|1681447_1682143_-	two-component system response regulator KdpE	NA	NA	NA	NA
WP_003814050.1\|1684964_1685564_-	potassium-transporting ATPase subunit KdpC	NA	NA	NA	NA
WP_010930950.1\|1685574_1687740_-	potassium-transporting ATPase subunit KdpB	M1HBF8	Paramecium_bursaria_Chlorella_virus	1.2e-24	27.1
WP_014905703.1\|1687763_1689542_-	potassium-transporting ATPase subunit KdpA	NA	NA	NA	NA
WP_017685545.1\|1689541_1689631_-	K(+)-transporting ATPase subunit F	NA	NA	NA	NA
WP_003814042.1\|1690325_1690598_+	DUF4212 domain-containing protein	NA	NA	NA	NA
WP_003814040.1\|1690597_1692664_+	cation acetate symporter	NA	NA	NA	NA
WP_005012067.1\|1692660_1693611_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010930199.1\|1693709_1694342_-	fimbrial protein	NA	NA	NA	NA
WP_014905704.1\|1694511_1696794_-	NADP-dependent malic enzyme	NA	NA	NA	NA
WP_014905705.1\|1696948_1699645_-	alpha-ketoglutarate dehydrogenase	NA	NA	NA	NA
WP_010930202.1\|1699767_1700256_+	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_014905706.1\|1702440_1703391_+\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_003813631.1\|1703715_1706586_+	2-oxoglutarate dehydrogenase E1 component	NA	NA	NA	NA
WP_010930204.1\|1706631_1707846_+	2-oxoglutarate dehydrogenase complex dihydrolipoyllysine-residue succinyltransferase	NA	NA	NA	NA
WP_003813626.1\|1708075_1709503_+	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	2.1e-41	28.1
WP_023853245.1\|1709600_1710692_+	cell division protein ZapE	NA	NA	NA	NA
WP_010930206.1\|1710704_1711463_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_003813621.1\|1711550_1712453_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_014905707.1\|1712449_1713400_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010930207.1\|1713529_1714513_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_003813618.1\|1714567_1715290_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_010926922.1\|1716380_1716914_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_003813612.1\|1716906_1717869_+	DUF4880 domain-containing protein	NA	NA	NA	NA
WP_003813609.1\|1717962_1720440_+	TonB-dependent siderophore receptor	NA	NA	NA	NA
WP_033447956.1\|1720583_1720865_+	DUF3649 domain-containing protein	NA	NA	NA	NA
WP_162835035.1\|1722503_1722827_+	DUF3325 family protein	NA	NA	NA	NA
WP_005013747.1\|1722975_1723926_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010930211.1\|1723935_1725291_+\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_010930742.1\|1725389_1726340_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_14

1741326 : 1794133

Yersinia_phage(10.0%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005015810.1\|1741326_1742277_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_014486105.1\|1742273_1743224_-\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_005013747.1\|1743310_1744261_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_004568536.1\|1744703_1745111_+	M15 family metallopeptidase	A9DET4	Yersinia_phage	1.8e-30	51.5
WP_004568533.1\|1745265_1745664_-	RidA family protein	NA	NA	NA	NA
WP_014905712.1\|1745813_1747043_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_003810741.1\|1747018_1747621_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_003810743.1\|1747860_1748562_-	ABC transporter ATP-binding protein	NA	NA	NA	NA
WP_003816696.1\|1748555_1749338_-	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	2.0e-09	25.8
WP_005012808.1\|1749522_1750473_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_014905713.1\|1750571_1751309_-	TerC family protein	A0A0S4KZH7	Pseudomonas_phage	4.1e-41	46.6
WP_010926609.1\|1751498_1752257_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_014905714.1\|1752303_1753293_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_014905715.1\|1753470_1754439_-	transporter	NA	NA	NA	NA
WP_014905716.1\|1755979_1756948_+	AAA family ATPase	NA	NA	NA	NA
WP_010930479.1\|1756956_1757898_+	DUF58 domain-containing protein	NA	NA	NA	NA
WP_010930478.1\|1758371_1759382_+	VWA domain-containing protein	NA	NA	NA	NA
WP_010930477.1\|1759372_1760887_+	VWA domain-containing protein	NA	NA	NA	NA
WP_010930476.1\|1760883_1762230_+	hypothetical protein	NA	NA	NA	NA
WP_010930475.1\|1762232_1763267_+	haloacid dehalogenase-like hydrolase	NA	NA	NA	NA
WP_041166167.1\|1763316_1764942_+	arylsulfatase	A0A2P0VMN7	Tetraselmis_virus	4.8e-151	52.6
WP_014905499.1\|1765596_1766547_+\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_010930538.1\|1766543_1767017_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_033446178.1\|1767178_1768117_+	membrane protein	NA	NA	NA	NA
WP_010930540.1\|1768118_1769327_-	bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC	Q9HH70	Methanothermobacter_phage	3.8e-36	30.0
WP_014905718.1\|1769431_1769938_-	lipoprotein signal peptidase	NA	NA	NA	NA
WP_014905719.1\|1769940_1772802_-\|tRNA	isoleucine--tRNA ligase	A0A1V0SJ93	Klosneuvirus	2.7e-72	25.5
WP_010930543.1\|1772791_1773757_-	bifunctional riboflavin kinase/FAD synthetase	NA	NA	NA	NA
WP_049805781.1\|1773807_1774494_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	4.4e-21	32.6
WP_005012067.1\|1774592_1775543_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010930545.1\|1775539_1775914_-	hypothetical protein	NA	NA	NA	NA
WP_003812548.1\|1776175_1777384_+	aminotransferase	NA	NA	NA	NA
WP_003812546.1\|1777380_1779681_+	UvrD-helicase domain-containing protein	A7KV33	Bacillus_phage	9.9e-110	35.9
WP_010926400.1\|1779733_1782346_-	TonB-dependent receptor	NA	NA	NA	NA
WP_033449632.1\|1782705_1784613_-	ATP-binding cassette domain-containing protein	A0A2K9L0W2	Tupanvirus	6.6e-67	31.8
WP_010930547.1\|1784627_1785524_-	50S ribosomal protein L3 N(5)-glutamine methyltransferase	NA	NA	NA	NA
WP_010930548.1\|1785530_1786670_-	succinyl-diaminopimelate desuccinylase	NA	NA	NA	NA
WP_014905721.1\|1786669_1787491_-	2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase	NA	NA	NA	NA
WP_014905722.1\|1787516_1788713_-	succinyldiaminopimelate transaminase	NA	NA	NA	NA
WP_010930549.1\|1789063_1789393_-	DUF4148 domain-containing protein	NA	NA	NA	NA
WP_010930550.1\|1789775_1791032_+	autotransporter Phg	NA	NA	NA	NA
WP_003812526.1\|1791106_1791388_+	membrane protein	NA	NA	NA	NA
WP_003812524.1\|1791429_1791750_+	hypothetical protein	NA	NA	NA	NA
WP_010930551.1\|1792056_1792260_+	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	1.6e-16	62.1
WP_003812519.1\|1792343_1792910_+	DUF924 family protein	NA	NA	NA	NA
WP_005012067.1\|1793182_1794133_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_15

1797444 : 1921418

107

Klosneuvirus(13.33%)

tRNA,transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010930556.1\|1797444_1798749_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	3.2e-129	53.8
WP_010930557.1\|1798937_1801391_+	endopeptidase La	A0A0R6PGP8	Moraxella_phage	1.5e-220	52.0
WP_041166169.1\|1801514_1802465_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_014905725.1\|1802692_1803916_+	CoA transferase	NA	NA	NA	NA
WP_014905726.1\|1803981_1804953_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_003812496.1\|1804957_1805422_+	MaoC family dehydratase	NA	NA	NA	NA
WP_014905728.1\|1805441_1806239_+	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_003812491.1\|1806235_1806667_+	hypothetical protein	NA	NA	NA	NA
WP_010930563.1\|1806663_1807821_+	thiolase	NA	NA	NA	NA
WP_014905729.1\|1807842_1808619_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_014905730.1\|1810831_1811500_+	3-oxoacid CoA-transferase subunit A	NA	NA	NA	NA
WP_003812478.1\|1811492_1812134_+	CoA transferase subunit B	NA	NA	NA	NA
WP_019248063.1\|1812168_1812900_+	hypothetical protein	NA	NA	NA	NA
WP_019247934.1\|1812917_1813130_+	hypothetical protein	NA	NA	NA	NA
WP_010930179.1\|1813694_1814645_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_014905731.1\|1815633_1816584_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010930566.1\|1817251_1817902_-	transcriptional repressor LexA	A0A2H4JG58	uncultured_Caudovirales_phage	3.3e-10	50.7
WP_010930567.1\|1818030_1819233_-	aspartate/tyrosine/aromatic aminotransferase	NA	NA	NA	NA
WP_014905732.1\|1819310_1821347_+	excinuclease ABC subunit UvrB	NA	NA	NA	NA
WP_010930569.1\|1821599_1822091_+	low molecular weight phosphotyrosine protein phosphatase	NA	NA	NA	NA
WP_003812463.1\|1822306_1822819_+	Fe-S cluster assembly transcriptional regulator IscR	NA	NA	NA	NA
WP_003812462.1\|1822836_1824048_+	IscS subfamily cysteine desulfurase	NA	NA	NA	NA
WP_003812460.1\|1824081_1824492_+	Fe-S cluster assembly scaffold IscU	A0A218MKD1	uncultured_virus	7.5e-53	79.0
WP_003812458.1\|1824493_1824817_+	iron-sulfur cluster assembly protein IscA	A0A2H4N7N5	Lake_Baikal_phage	6.8e-25	52.8
WP_003812456.1\|1824819_1825332_+	Fe-S protein assembly co-chaperone HscB	NA	NA	NA	NA
WP_014905733.1\|1825461_1827324_+	Fe-S protein assembly chaperone HscA	A0A0N9QXN8	Chrysochromulina_ericina_virus	5.2e-101	42.4
WP_003812453.1\|1827333_1827675_+	ISC system 2Fe-2S type ferredoxin	NA	NA	NA	NA
WP_003812452.1\|1827674_1827869_+	Fe-S cluster assembly protein IscX	NA	NA	NA	NA
WP_010930572.1\|1827993_1828887_+	methylglyoxal synthase	NA	NA	NA	NA
WP_010930573.1\|1828909_1829719_-	enoyl-CoA hydratase	NA	NA	NA	NA
WP_005012067.1\|1829919_1830870_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_014905734.1\|1832142_1833360_+	four-carbon acid sugar kinase family protein	NA	NA	NA	NA
WP_003818670.1\|1834416_1835319_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_014905736.1\|1835395_1836268_+	MOSC domain-containing protein	NA	NA	NA	NA
WP_003818672.1\|1836398_1836767_+	aspartate 1-decarboxylase	NA	NA	NA	NA
WP_010930577.1\|1836824_1837871_+	CDP-6-deoxy-delta-3,4-glucoseen reductase	NA	NA	NA	NA
WP_010930578.1\|1838066_1839323_+	D-amino acid dehydrogenase	NA	NA	NA	NA
WP_003810623.1\|1839327_1840665_+	extracellular solute-binding protein	NA	NA	NA	NA
WP_003818676.1\|1840814_1841771_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_014905737.1\|1841867_1843244_+	DUF1446 domain-containing protein	NA	NA	NA	NA
WP_033446181.1\|1843230_1843596_+	hypothetical protein	NA	NA	NA	NA
WP_014905738.1\|1843643_1845218_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003810637.1\|1845270_1846215_+	ABC transporter permease	NA	NA	NA	NA
WP_010930582.1\|1846232_1847063_+	ABC transporter permease	NA	NA	NA	NA
WP_014905739.1\|1847055_1848690_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	8.2e-18	32.7
WP_014905740.1\|1848686_1850042_+	amidase	NA	NA	NA	NA
WP_014905741.1\|1850948_1852526_+	hypothetical protein	NA	NA	NA	NA
WP_010930586.1\|1852529_1853804_+	type 4b pilus protein PilO2	NA	NA	NA	NA
WP_005013747.1\|1853902_1854853_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010930587.1\|1854950_1855325_+	hypothetical protein	NA	NA	NA	NA
WP_014905742.1\|1855321_1857037_+	Flp pilus assembly complex ATPase component TadA	NA	NA	NA	NA
WP_014905743.1\|1857029_1858163_+	hypothetical protein	NA	NA	NA	NA
WP_003810661.1\|1858200_1858806_+	prepilin-type N-terminal cleavage/methylation domain-containing protein	NA	NA	NA	NA
WP_010930589.1\|1858802_1859621_+	hypothetical protein	NA	NA	NA	NA
WP_014905744.1\|1859692_1862317_+\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	1.7e-81	39.4
WP_004568544.1\|1862303_1862558_+	sulfurtransferase TusA family protein	NA	NA	NA	NA
WP_014486105.1\|1862714_1863665_+\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_005012067.1\|1863661_1864612_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003816666.1\|1865883_1866849_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_014905746.1\|1866986_1867898_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_014905747.1\|1870493_1871981_+	hydroxymethylglutaryl-CoA synthase family protein	NA	NA	NA	NA
WP_014486081.1\|1871991_1873188_+	acetyl-CoA acetyltransferase	NA	NA	NA	NA
WP_003816680.1\|1873260_1874580_+	AMP-binding protein	NA	NA	NA	NA
WP_014905748.1\|1874576_1875452_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_014905749.1\|1875482_1876631_-	CoA transferase	NA	NA	NA	NA
WP_010930735.1\|1876648_1876963_-	2Fe-2S iron-sulfur cluster binding domain-containing protein	NA	NA	NA	NA
WP_003816687.1\|1876984_1877707_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_003816690.1\|1877706_1878525_-	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_003816691.1\|1878529_1879057_-	aromatic-ring-hydroxylating dioxygenase subunit beta	NA	NA	NA	NA
WP_010930733.1\|1879062_1880319_-	Rieske 2Fe-2S domain-containing protein	NA	NA	NA	NA
WP_010930732.1\|1880677_1881817_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_010930731.1\|1881894_1882767_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_005013747.1\|1883637_1884588_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_047122784.1\|1884547_1884961_-	transcriptional regulator	A0A222YXG1	Escherichia_phage	3.8e-36	59.0
WP_014905750.1\|1885245_1885545_+	hypothetical protein	NA	NA	NA	NA
WP_010930783.1\|1885954_1888237_-	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	3.2e-36	30.1
WP_124740709.1\|1888702_1888897_+	hypothetical protein	NA	NA	NA	NA
WP_014905751.1\|1888922_1890974_-	DNA primase	A0A0K1LMQ9	Caulobacter_phage	1.0e-65	41.9
WP_006218592.1\|1890993_1891206_-	30S ribosomal protein S21	NA	NA	NA	NA
WP_003810720.1\|1891483_1892023_-	phosphoribosyltransferase	NA	NA	NA	NA
WP_023852902.1\|1892136_1893432_-	adenylosuccinate synthase	A0A160ER07	Powai_lake_megavirus	3.0e-63	33.5
WP_010930786.1\|1893508_1894666_-	ATP phosphoribosyltransferase regulatory subunit	NA	NA	NA	NA
WP_010930787.1\|1894849_1895749_-\|protease	protease modulator HflC	NA	NA	NA	NA
WP_014905752.1\|1895767_1897072_-\|protease	FtsH protease activity modulator HflK	NA	NA	NA	NA
WP_010930789.1\|1897037_1898144_-	GTPase HflX	NA	NA	NA	NA
WP_003810707.1\|1898231_1898468_-	RNA chaperone Hfq	NA	NA	NA	NA
WP_010930790.1\|1898606_1899677_-	histidinol-phosphate transaminase	A0A1X6WGT4	Pacmanvirus	2.5e-15	25.7
WP_003810703.1\|1899680_1901036_-	ribosome biogenesis GTPase Der	NA	NA	NA	NA
WP_023852925.1\|1901062_1902220_-	outer membrane protein assembly factor BamB	NA	NA	NA	NA
WP_010930791.1\|1902225_1902864_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_033450041.1\|1902865_1904161_-\|tRNA	histidine--tRNA ligase	NA	NA	NA	NA
WP_041166172.1\|1904210_1905497_-	flavodoxin-dependent (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase	NA	NA	NA	NA
WP_003810693.1\|1905512_1906019_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_014905755.1\|1906015_1907164_-	23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN	NA	NA	NA	NA
WP_003810689.1\|1907191_1907617_-	nucleoside-diphosphate kinase	D2E8E1	Anguillid_herpesvirus	2.1e-21	43.2
WP_010930794.1\|1907939_1910822_+\|tRNA	valine--tRNA ligase	A0A1V0SK04	Klosneuvirus	3.7e-138	37.1
WP_023852900.1\|1910914_1911670_-	MipA/OmpV family protein	NA	NA	NA	NA
WP_014905756.1\|1912435_1913785_+	two-component sensor histidine kinase	NA	NA	NA	NA
WP_014905674.1\|1913883_1914834_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010930594.1\|1914907_1915381_+	RidA family protein	NA	NA	NA	NA
WP_010930593.1\|1915406_1916615_+	aminotransferase class V-fold PLP-dependent enzyme	NA	NA	NA	NA
WP_003816734.1\|1916611_1917385_-\|tRNA	tRNA (guanosine(37)-N1)-methyltransferase TrmD	NA	NA	NA	NA
WP_014905757.1\|1917384_1918008_-	ribosome maturation factor RimM	NA	NA	NA	NA
WP_010926757.1\|1918173_1918434_-	30S ribosomal protein S16	NA	NA	NA	NA
WP_014905758.1\|1918737_1919319_+	hypothetical protein	NA	NA	NA	NA
WP_005012067.1\|1919418_1920369_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_005013747.1\|1920467_1921418_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_16

2286082 : 2403204

102

uncultured_Caudovirales_phage(15.0%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005012067.1\|2286082_2287033_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003810865.1\|2287131_2288217_-	DNA polymerase IV	NA	NA	NA	NA
WP_010930072.1\|2288314_2288725_+	PaaI family thioesterase	NA	NA	NA	NA
WP_014905821.1\|2289338_2291252_+	S9 family peptidase	NA	NA	NA	NA
WP_014905822.1\|2291387_2294000_+	PBP1A family penicillin-binding protein	NA	NA	NA	NA
WP_080019436.1\|2294098_2295751_+\|transposase	IS481 family transposase	A0A2H4PQR8	Staphylococcus_phage	1.5e-59	47.1
WP_003810847.1\|2295796_2296777_+	aldo/keto reductase	NA	NA	NA	NA
WP_003810850.1\|2296773_2296986_-	hypothetical protein	NA	NA	NA	NA
WP_003810851.1\|2296982_2298164_-	PepSY domain-containing protein	NA	NA	NA	NA
WP_014905823.1\|2298327_2299062_+	serine/threonine protein phosphatase	A0A2H4J0P0	uncultured_Caudovirales_phage	1.3e-63	50.0
WP_005015810.1\|2299063_2300014_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_004566334.1\|2300124_2300565_-	DUF937 domain-containing protein	NA	NA	NA	NA
WP_010930537.1\|2300693_2301923_-	lytic murein transglycosylase	NA	NA	NA	NA
WP_004566336.1\|2301961_2302783_-	ferritin-like domain-containing protein	NA	NA	NA	NA
WP_029443743.1\|2302836_2303988_+	N-acetyltransferase	NA	NA	NA	NA
WP_023852690.1\|2304079_2304550_-	DUF1854 domain-containing protein	NA	NA	NA	NA
WP_041166180.1\|2307118_2309668_+	cyanophycin synthetase	NA	NA	NA	NA
WP_010930533.1\|2309738_2312312_+	cyanophycin synthetase	NA	NA	NA	NA
WP_003813568.1\|2312577_2312778_+	CsbD family protein	NA	NA	NA	NA
WP_003813570.1\|2312809_2312971_+	DUF1328 domain-containing protein	NA	NA	NA	NA
WP_003813572.1\|2313028_2313367_+	BON domain-containing protein	NA	NA	NA	NA
WP_010930179.1\|2313515_2314466_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_014905825.1\|2314564_2315470_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_014905826.1\|2315573_2316536_+	DMT family transporter	NA	NA	NA	NA
WP_010928863.1\|2316539_2317211_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.2e-33	40.8
WP_041166181.1\|2317209_2317878_+	arylesterase	NA	NA	NA	NA
WP_010930531.1\|2317859_2319815_-	peptidyl-prolyl cis-trans isomerase	NA	NA	NA	NA
WP_004568486.1\|2320057_2320807_+	glycerophosphodiester phosphodiesterase	A0A2H4PGQ5	Escherichia_phage	1.5e-14	27.8
WP_003816518.1\|2320819_2321683_+	23S rRNA (adenine(2030)-N(6))-methyltransferase RlmJ	NA	NA	NA	NA
WP_003816520.1\|2321686_2323102_-	dihydrolipoyl dehydrogenase	NA	NA	NA	NA
WP_010930530.1\|2323235_2323964_-	redoxin family protein	A0A1D8KSL1	Synechococcus_phage	9.6e-43	56.8
WP_003811035.1\|2324102_2324303_-	heavy-metal-associated domain-containing protein	NA	NA	NA	NA
WP_003816523.1\|2324478_2324877_+	Cu(I)-responsive transcriptional regulator	NA	NA	NA	NA
WP_003816525.1\|2324900_2326301_-	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	7.3e-31	26.5
WP_010930529.1\|2326419_2327172_-	hypothetical protein	NA	NA	NA	NA
WP_003816527.1\|2327460_2328138_-	hypothetical protein	NA	NA	NA	NA
WP_004568488.1\|2328164_2328944_-	3'-5' exonuclease	NA	NA	NA	NA
WP_003811022.1\|2328940_2329825_-	peptidoglycan DD-metalloendopeptidase family protein	A0A292GJG6	Xanthomonas_phage	4.6e-15	49.5
WP_019247478.1\|2329842_2330622_-	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	4.8e-32	46.9
WP_014905828.1\|2330606_2331365_-	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	5.2e-68	50.8
WP_023852762.1\|2331502_2332138_+	glycerol-3-phosphate 1-O-acyltransferase PlsY	NA	NA	NA	NA
WP_014905678.1\|2332405_2333422_+\|transposase	IS110-like element IS1663 family transposase	NA	NA	NA	NA
WP_010930208.1\|2333519_2334470_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003811013.1\|2334568_2335609_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	9.3e-92	51.6
WP_014905829.1\|2335743_2337036_+	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	2.9e-66	36.0
WP_003811007.1\|2338395_2338779_+	thioredoxin family protein	V9SJ74	Achromobacter_phage	8.1e-09	25.8
WP_010930523.1\|2338796_2339384_-	YigZ family protein	A0A1X9I5T8	Streptococcus_phage	4.7e-16	35.8
WP_005012067.1\|2339421_2340372_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_014905830.1\|2340470_2341319_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_010930521.1\|2341355_2342129_-	ABC transporter permease	NA	NA	NA	NA
WP_010930519.1\|2343209_2343986_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.2e-30	34.2
WP_014905831.1\|2344140_2345745_-	ABC-F family ATPase	A0A1V0SKJ1	Klosneuvirus	2.7e-53	28.8
WP_003816541.1\|2346125_2347250_+	TRAP transporter substrate-binding protein	NA	NA	NA	NA
WP_003810992.1\|2347376_2348000_+	TRAP transporter small permease subunit	NA	NA	NA	NA
WP_010930517.1\|2347996_2349898_+	TRAP transporter large permease subunit	NA	NA	NA	NA
WP_010930516.1\|2349946_2350741_+	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_010930515.1\|2350753_2351755_-	muramoyltetrapeptide carboxypeptidase	NA	NA	NA	NA
WP_010930514.1\|2351751_2352201_-\|tRNA	tRNA adenosine(34) deaminase TadA	S4VYT2	Pandoravirus	2.0e-06	38.2
WP_010930513.1\|2352250_2353099_-	hydrolase	NA	NA	NA	NA
WP_005012808.1\|2353262_2354213_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_041166182.1\|2354245_2354815_-	hypothetical protein	NA	NA	NA	NA
WP_005013747.1\|2354858_2355809_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_014905833.1\|2355964_2356291_-	cation:proton antiporter	NA	NA	NA	NA
WP_033446177.1\|2356287_2356569_-	K+/H+ antiporter subunit F	NA	NA	NA	NA
WP_023852885.1\|2356568_2357045_-	Na+/H+ antiporter subunit E	NA	NA	NA	NA
WP_004568496.1\|2357044_2358673_-	monovalent cation/H+ antiporter subunit D	NA	NA	NA	NA
WP_003810969.1\|2358669_2359014_-	Na+/H+ antiporter subunit C	NA	NA	NA	NA
WP_003816550.1\|2359013_2361947_-	monovalent cation/H+ antiporter subunit A	NA	NA	NA	NA
WP_010930208.1\|2363105_2364056_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003811452.1\|2364154_2364451_-	hypothetical protein	NA	NA	NA	NA
WP_014905834.1\|2364557_2365475_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_010930507.1\|2365479_2366193_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_010930506.1\|2366206_2367178_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_010930505.1\|2368927_2369278_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_014905835.1\|2369281_2370469_+	MFS transporter	NA	NA	NA	NA
WP_010930503.1\|2370907_2371630_+	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	1.3e-87	68.2
WP_010929956.1\|2371923_2372874_+\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_014905836.1\|2373735_2374731_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_014905837.1\|2374770_2375976_+	NAD(P)-binding protein	NA	NA	NA	NA
WP_003811478.1\|2376319_2377531_+	D-amino acid dehydrogenase	NA	NA	NA	NA
WP_014905838.1\|2377561_2378029_-	acyl-CoA thioesterase	NA	NA	NA	NA
WP_014905839.1\|2378025_2379180_-	iron-containing alcohol dehydrogenase	NA	NA	NA	NA
WP_014905840.1\|2379176_2380361_-	acetyl-CoA C-acyltransferase	NA	NA	NA	NA
WP_014905841.1\|2380357_2382442_-	crotonase	NA	NA	NA	NA
WP_014905842.1\|2382452_2383427_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_014905843.1\|2383457_2384270_-	crotonase/enoyl-CoA hydratase family protein	NA	NA	NA	NA
WP_014905844.1\|2385676_2386648_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_041166281.1\|2386809_2387610_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_033446742.1\|2387826_2388639_+	SDR family oxidoreductase	W8CYX9	Bacillus_phage	1.1e-07	36.8
WP_014905846.1\|2388783_2389800_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_014905847.1\|2389879_2390299_+	OB-fold domain-containing protein	NA	NA	NA	NA
WP_005012067.1\|2390804_2391755_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_041166183.1\|2391758_2392925_+	CoA transferase	NA	NA	NA	NA
WP_003811509.1\|2393076_2393904_+	IclR family transcriptional regulator	NA	NA	NA	NA
WP_003811511.1\|2393917_2394508_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_014905848.1\|2394664_2395369_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	8.4e-12	23.9
WP_005012067.1\|2395547_2396498_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_041166283.1\|2398061_2399213_+	multidrug effflux MFS transporter	NA	NA	NA	NA
WP_003810297.1\|2399581_2399818_+	50S ribosomal protein L28	NA	NA	NA	NA
WP_010930711.1\|2399881_2400049_+	50S ribosomal protein L33	NA	NA	NA	NA
WP_014905850.1\|2400162_2401956_-	STAS domain-containing protein	A0A2H4J153	uncultured_Caudovirales_phage	4.8e-19	27.5
WP_010930208.1\|2402253_2403204_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_17

2444113 : 2518892

Catovirus(22.22%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014905866.1\|2444113_2445064_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_041166184.1\|2445140_2446757_+	phosphoethanolamine transferase	NA	NA	NA	NA
WP_003813224.1\|2446735_2447848_-	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_003813226.1\|2447844_2448597_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_010930875.1\|2448593_2449445_-	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_010930876.1\|2449437_2450541_-	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_010930877.1\|2450540_2454032_-	DNA polymerase III subunit alpha	A0A0K1Y9G6	Streptomyces_phage	1.7e-185	37.6
WP_041166285.1\|2454169_2455069_+	lipid A hydroxylase LpxO	S4VR59	Pandoravirus	2.4e-35	36.8
WP_010930878.1\|2455200_2459085_-	ATP-dependent RNA helicase HrpA	A0A1V0SBU4	Catovirus	4.5e-46	28.7
WP_041166185.1\|2459265_2460621_+	amino-acid N-acetyltransferase	NA	NA	NA	NA
WP_003813239.1\|2460694_2460967_+	oxidative damage protection protein	NA	NA	NA	NA
WP_010930880.1\|2461020_2462901_+	DUF756 domain-containing protein	NA	NA	NA	NA
WP_003813242.1\|2462914_2463694_-	phosphate signaling complex protein PhoU	NA	NA	NA	NA
WP_010930882.1\|2463848_2464529_-	ribose-5-phosphate isomerase RpiA	NA	NA	NA	NA
WP_014905870.1\|2464582_2466241_-	isovaleryl-CoA dehydrogenase	NA	NA	NA	NA
WP_003813247.1\|2466320_2467736_-	DNA recombination protein RmuC	NA	NA	NA	NA
WP_010930885.1\|2467861_2468521_+	hypothetical protein	NA	NA	NA	NA
WP_003813251.1\|2468528_2469245_-	DNA-3-methyladenine glycosylase	NA	NA	NA	NA
WP_003813253.1\|2469249_2469606_-	arsenate reductase	NA	NA	NA	NA
WP_003813256.1\|2469602_2470412_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_003813258.1\|2470408_2471323_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_003813260.1\|2471319_2472447_-	polyamine ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	3.9e-27	38.0
WP_014905871.1\|2472453_2473557_-	polyamine ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_010930888.1\|2473688_2474423_-	3-deoxy-D-manno-octulosonic acid kinase	NA	NA	NA	NA
WP_003813267.1\|2474412_2474838_-	group II truncated hemoglobin	NA	NA	NA	NA
WP_049803247.1\|2474837_2477297_-	FtsX-like permease family protein	NA	NA	NA	NA
WP_010930890.1\|2477483_2478458_+	TRAP transporter substrate-binding protein DctP	NA	NA	NA	NA
WP_014905872.1\|2478543_2479044_+	TRAP transporter small permease	NA	NA	NA	NA
WP_010930048.1\|2479569_2480520_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003812405.1\|2480566_2481121_-	transcription elongation factor GreB	NA	NA	NA	NA
WP_003816844.1\|2481188_2482034_-	PHP domain-containing protein	NA	NA	NA	NA
WP_019248398.1\|2482103_2483072_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_041166187.1\|2483071_2485546_-	DNA internalization-related competence protein ComEC/Rec2	NA	NA	NA	NA
WP_041166188.1\|2485718_2488565_-	inverse autotransporter beta-barrel domain-containing protein	NA	NA	NA	NA
WP_014905874.1\|2489217_2492448_-	autotransporter SphB3	NA	NA	NA	NA
WP_010928340.1\|2492729_2493557_-	TatD family hydrolase	NA	NA	NA	NA
WP_003812422.1\|2493590_2494286_-	lipoprotein-releasing ABC transporter ATP-binding protein LolD	G9BWD6	Planktothrix_phage	7.0e-35	38.6
WP_019247537.1\|2494278_2495559_-	lipoprotein-releasing ABC transporter permease subunit	NA	NA	NA	NA
WP_023853218.1\|2495604_2496546_+	hypothetical protein	NA	NA	NA	NA
WP_010930191.1\|2496527_2498228_+	single-stranded-DNA-specific exonuclease RecJ	A7KV88	Bacillus_phage	1.3e-50	28.3
WP_010926448.1\|2498330_2499434_+	peptide chain release factor 2	NA	NA	NA	NA
WP_010926447.1\|2499464_2500220_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_010930190.1\|2500226_2501747_+\|tRNA	lysine--tRNA ligase	A0A1V0SAC0	Catovirus	1.2e-82	36.0
WP_014905875.1\|2501789_2502092_+	hypothetical protein	NA	NA	NA	NA
WP_014905645.1\|2502088_2503039_-\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_014905876.1\|2503251_2506104_+	EAL domain-containing protein	NA	NA	NA	NA
WP_010930182.1\|2506085_2506814_-	response regulator transcription factor	NA	NA	NA	NA
WP_014905877.1\|2506954_2508442_-	YdiU family protein	A0A075BSJ0	Microcystis_phage	2.4e-48	34.0
WP_010930180.1\|2508438_2508810_-	DUF2069 domain-containing protein	NA	NA	NA	NA
WP_003812701.1\|2508827_2510141_+	YihY family inner membrane protein	NA	NA	NA	NA
WP_003812703.1\|2510177_2510636_+	CBS domain-containing protein	NA	NA	NA	NA
WP_155120815.1\|2510590_2510731_-	hypothetical protein	NA	NA	NA	NA
WP_010930179.1\|2510748_2511699_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010930178.1\|2511695_2512709_-\|tRNA	tRNA dihydrouridine(20/20a) synthase DusA	NA	NA	NA	NA
WP_003812707.1\|2512848_2513835_+	homoserine kinase	NA	NA	NA	NA
WP_161633091.1\|2514193_2514901_-	DUF192 domain-containing protein	NA	NA	NA	NA
WP_005012067.1\|2515481_2516432_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_014905878.1\|2516606_2517281_+	hypothetical protein	A0A0U4J8W4	Pseudomonas_phage	9.5e-37	41.8
WP_080019440.1\|2517741_2517924_-	hypothetical protein	NA	NA	NA	NA
WP_005015810.1\|2517941_2518892_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_18

2695426 : 2755140

uncultured_Mediterranean_phage(60.0%)

tRNA,holin,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003810909.1\|2695426_2695843_-\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA
WP_010931061.1\|2695953_2696586_+	7-carboxy-7-deazaguanine synthase	NA	NA	NA	NA
WP_010931062.1\|2696614_2697058_+	6-carboxytetrahydropterin synthase QueD	NA	NA	NA	NA
WP_003810897.1\|2697079_2698171_-	TRAP transporter substrate-binding protein DctP	NA	NA	NA	NA
WP_162832304.1\|2698225_2699017_-	aldolase	NA	NA	NA	NA
WP_010931064.1\|2699161_2699782_+	XRE family transcriptional regulator	NA	NA	NA	NA
WP_010931065.1\|2700030_2700504_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_005013747.1\|2701643_2702594_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003809441.1\|2702620_2703085_-	barstar family protein	NA	NA	NA	NA
WP_014905912.1\|2704277_2706566_-	NADP-dependent malic enzyme	NA	NA	NA	NA
WP_010930165.1\|2706682_2707555_-	hypothetical protein	NA	NA	NA	NA
WP_014905913.1\|2707597_2708752_+	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
WP_010930163.1\|2708786_2709617_-	lytic transglycosylase domain-containing protein	NA	NA	NA	NA
WP_023853525.1\|2709700_2711245_+	4-hydroxy-3-polyprenylbenzoate decarboxylase	NA	NA	NA	NA
WP_010930161.1\|2711287_2711647_-	hypothetical protein	NA	NA	NA	NA
WP_003819794.1\|2711648_2712062_-\|holin	phage holin family protein	NA	NA	NA	NA
WP_003809432.1\|2712102_2712420_-	DUF883 domain-containing protein	NA	NA	NA	NA
WP_003809431.1\|2712504_2713221_-	hypothetical protein	NA	NA	NA	NA
WP_014905914.1\|2713484_2714906_+	uroporphyrinogen-III C-methyltransferase	NA	NA	NA	NA
WP_014905915.1\|2714972_2717696_-	pertactin autotransporter	NA	NA	NA	NA
WP_010930525.1\|2718028_2719045_-\|transposase	IS110-like element IS1663 family transposase	NA	NA	NA	NA
WP_010930157.1\|2719379_2720021_-	uracil phosphoribosyltransferase	NA	NA	NA	NA
WP_003809423.1\|2720111_2721548_-	D-alanyl-D-alanine carboxypeptidase/D-alanyl-D-alanine-endopeptidase	NA	NA	NA	NA
WP_023853534.1\|2721705_2722779_+\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
WP_014905916.1\|2722775_2723912_+\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	1.7e-86	44.7
WP_003809416.1\|2724056_2724401_+	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	1.0e-10	40.4
WP_010930154.1\|2724467_2726348_+	protein translocase subunit SecD	NA	NA	NA	NA
WP_003809411.1\|2726397_2727333_+	protein translocase subunit SecF	A0A1B1IVP7	uncultured_Mediterranean_phage	3.0e-41	35.5
WP_010930525.1\|2727664_2728681_+\|transposase	IS110-like element IS1663 family transposase	NA	NA	NA	NA
WP_015041211.1\|2729602_2731030_+\|tRNA	tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB	NA	NA	NA	NA
WP_010930151.1\|2731026_2732049_+	PhoH family protein	A0A0S0MVD6	Pseudomonas_phage	8.7e-50	45.4
WP_041166194.1\|2732038_2732512_+	rRNA maturation RNase YbeY	NA	NA	NA	NA
WP_010930149.1\|2732652_2733540_+	CBS domain-containing protein	NA	NA	NA	NA
WP_014905918.1\|2733536_2735180_+	apolipoprotein N-acyltransferase	NA	NA	NA	NA
WP_003819773.1\|2735176_2736184_-	aldo/keto reductase	NA	NA	NA	NA
WP_010930525.1\|2737014_2738031_+\|transposase	IS110-like element IS1663 family transposase	NA	NA	NA	NA
WP_003819753.1\|2738178_2738769_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_010931097.1\|2738859_2739165_-	DUF4148 domain-containing protein	NA	NA	NA	NA
WP_023853546.1\|2739632_2740640_+	biotin synthase BioB	NA	NA	NA	NA
WP_010931095.1\|2740636_2741512_+	membrane protein	NA	NA	NA	NA
WP_010931094.1\|2741586_2742987_-	MFS transporter	NA	NA	NA	NA
WP_003809348.1\|2743064_2743568_-	peroxiredoxin	M1I839	Pelagibacter_phage	1.8e-24	44.1
WP_010931092.1\|2743814_2744246_+	lipoprotein	NA	NA	NA	NA
WP_010931091.1\|2744255_2745140_-	dienelactone hydrolase family protein	NA	NA	NA	NA
WP_014905919.1\|2745157_2748625_-	DUF748 domain-containing protein	NA	NA	NA	NA
WP_003819741.1\|2748760_2749246_+	cyclic pyranopterin monophosphate synthase MoaC	NA	NA	NA	NA
WP_014905920.1\|2749226_2749478_+	MoaD/ThiS family protein	NA	NA	NA	NA
WP_023853551.1\|2749483_2749966_+	molybdenum cofactor biosynthesis protein MoaE	NA	NA	NA	NA
WP_010931088.1\|2749962_2750484_+	molybdenum cofactor biosynthesis protein B	NA	NA	NA	NA
WP_014905921.1\|2750490_2751696_+	molybdopterin molybdotransferase MoeA	NA	NA	NA	NA
WP_010931086.1\|2751840_2752938_-	GTP 3',8-cyclase MoaA	NA	NA	NA	NA
WP_010931085.1\|2752948_2754055_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_005013747.1\|2754189_2755140_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_19

2847506 : 2906655

Staphylococcus_phage(11.11%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005015810.1\|2847506_2848457_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_033446301.1\|2849231_2850089_-	EamA family transporter	NA	NA	NA	NA
WP_014905934.1\|2850267_2852247_-	acetate--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	5.5e-85	44.2
WP_010930730.1\|2852458_2853409_-\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_014905935.1\|2853507_2854848_-	MFS transporter	NA	NA	NA	NA
WP_003821377.1\|2854844_2855252_-	hypothetical protein	NA	NA	NA	NA
WP_014905936.1\|2857372_2858032_+	C40 family peptidase	A0A0A8WF62	Clostridium_phage	7.4e-18	37.6
WP_010930920.1\|2858136_2858478_-	DUF2325 domain-containing protein	NA	NA	NA	NA
WP_005013747.1\|2858786_2859737_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_014486084.1\|2859733_2860687_-	CysB family HTH-type transcriptional regulator	NA	NA	NA	NA
WP_010930923.1\|2860786_2862253_-	CoA-acylating methylmalonate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_003821372.1\|2862365_2863583_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003821371.1\|2863722_2864643_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_003813765.1\|2864639_2865752_-	LPS export ABC transporter permease LptF	NA	NA	NA	NA
WP_003821370.1\|2865805_2867305_+	leucyl aminopeptidase	Q6GYZ8	Mycoplasma_phage	1.0e-51	39.3
WP_003813769.1\|2867322_2867778_+	DNA polymerase III subunit chi	NA	NA	NA	NA
WP_003821368.1\|2867808_2868135_+	hypothetical protein	NA	NA	NA	NA
WP_014905937.1\|2868233_2868944_+	Bax inhibitor-1/YccA family protein	NA	NA	NA	NA
WP_014905938.1\|2869125_2870079_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_010930926.1\|2870175_2871045_+	succinylglutamate desuccinylase	NA	NA	NA	NA
WP_014905939.1\|2871048_2872245_+	PLP-dependent lyase/thiolase	NA	NA	NA	NA
WP_004566380.1\|2872241_2873162_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_003813782.1\|2873181_2873769_-	DNA repair protein RecO	NA	NA	NA	NA
WP_014905940.1\|2873761_2874652_-	GTPase Era	NA	NA	NA	NA
WP_023853248.1\|2874648_2875410_-	ribonuclease III	M4QNJ2	Ostreococcus_lucimarinus_virus	3.1e-20	33.0
WP_003821360.1\|2875415_2876300_-	signal peptidase I	NA	NA	NA	NA
WP_010930930.1\|2876322_2878116_-	elongation factor 4	E4ZFJ7	Streptococcus_phage	8.4e-24	23.5
WP_014905941.1\|2878246_2879734_-\|protease	DegQ family serine endoprotease	W5SAB9	Pithovirus	1.2e-07	31.5
WP_010930931.1\|2879771_2880830_-	siderophore-interacting protein	NA	NA	NA	NA
WP_041166199.1\|2880829_2881330_-	sigma-E factor negative regulatory protein	NA	NA	NA	NA
WP_003813797.1\|2881342_2881942_-	RNA polymerase sigma factor RpoE	A0A0F6TH34	Sinorhizobium_phage	2.2e-05	26.1
WP_010930933.1\|2881938_2882439_-	membrane protein	NA	NA	NA	NA
WP_003813802.1\|2882440_2883670_-	beta-ketoacyl-ACP synthase II	NA	NA	NA	NA
WP_003813816.1\|2883859_2884099_-	acyl carrier protein	B2ZXV3	Ralstonia_phage	5.4e-11	46.6
WP_003813819.1\|2884281_2885034_-	3-oxoacyl-ACP reductase FabG	Q06VL0	Trichoplusia_ni_ascovirus	6.9e-12	31.3
WP_010930934.1\|2885035_2885971_-	ACP S-malonyltransferase	NA	NA	NA	NA
WP_010930935.1\|2886052_2887039_-	ketoacyl-ACP synthase III	NA	NA	NA	NA
WP_003821347.1\|2887038_2888097_-	phosphate acyltransferase PlsX	NA	NA	NA	NA
WP_003813827.1\|2888153_2888336_-	50S ribosomal protein L32	NA	NA	NA	NA
WP_010930936.1\|2888387_2888981_-	DUF177 domain-containing protein	NA	NA	NA	NA
WP_003821345.1\|2889089_2889689_+	septum formation protein Maf	NA	NA	NA	NA
WP_010930937.1\|2889685_2890396_+	SAM-dependent methyltransferase	NA	NA	NA	NA
WP_010930938.1\|2890397_2891225_+	N-acetylmuramoyl-L-alanine amidase	NA	NA	NA	NA
WP_005013747.1\|2891323_2892274_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003821340.1\|2892270_2892933_-	protein-methionine-sulfoxide reductase heme-binding subunit MsrQ	NA	NA	NA	NA
WP_010929831.1\|2892940_2893900_-	protein-methionine-sulfoxide reductase catalytic subunit MsrP	NA	NA	NA	NA
WP_010929830.1\|2894056_2894728_-	HAD family hydrolase	NA	NA	NA	NA
WP_033446197.1\|2894730_2895636_-	RluA family pseudouridine synthase	NA	NA	NA	NA
WP_014905943.1\|2896203_2899326_+	Rne/Rng family ribonuclease	NA	NA	NA	NA
WP_014905944.1\|2899401_2900469_-	linear amide C-N hydrolase	NA	NA	NA	NA
WP_003813843.1\|2902529_2903408_-	acetyl-CoA carboxylase carboxyltransferase subunit beta	NA	NA	NA	NA
WP_003821334.1\|2903444_2904302_-	tryptophan synthase subunit alpha	NA	NA	NA	NA
WP_010931555.1\|2904305_2905505_-	tryptophan synthase subunit beta	NA	NA	NA	NA
WP_014486105.1\|2905704_2906655_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_20

2949900 : 3013056

Paramecium_bursaria_Chlorella_virus(15.38%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014905922.1\|2949900_2950851_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_033446154.1\|2950949_2951654_-	FadR family transcriptional regulator	NA	NA	NA	NA
WP_003812921.1\|2951782_2952700_-	dihydrodipicolinate synthase family protein	NA	NA	NA	NA
WP_003812923.1\|2952907_2953099_+	hypothetical protein	NA	NA	NA	NA
WP_003812927.1\|2953179_2954151_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_014905951.1\|2954253_2955207_+	2-hydroxyacid dehydrogenase	Q89388	Paramecium_bursaria_Chlorella_virus	5.9e-16	26.6
WP_010931528.1\|2955353_2956079_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_003820369.1\|2956190_2957099_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_003812933.1\|2957103_2957394_-	DUF3579 domain-containing protein	NA	NA	NA	NA
WP_010931526.1\|2957603_2958785_+	aspartate aminotransferase family protein	A0A1V0SKB7	Klosneuvirus	3.4e-21	28.1
WP_003812938.1\|2958836_2959778_+	ornithine carbamoyltransferase	M1HWF9	Paramecium_bursaria_Chlorella_virus	1.1e-17	26.4
WP_003820367.1\|2959928_2961266_+	argininosuccinate synthase	A0A140XAJ5	Dickeya_phage	1.4e-55	81.7
WP_003820366.1\|2961350_2963261_-	potassium transporter Kup	A7K9V6	Acanthocystis_turfacea_chlorella_virus	5.4e-69	32.4
WP_014905952.1\|2963257_2964376_-	two-component sensor histidine kinase	W8CYF6	Bacillus_phage	2.0e-15	26.2
WP_003812947.1\|2964434_2965106_-	response regulator transcription factor	NA	NA	NA	NA
WP_014905953.1\|2965188_2965656_-	biopolymer transporter ExbD	NA	NA	NA	NA
WP_010931525.1\|2965655_2966633_-	MotA/TolQ/ExbB proton channel family protein	NA	NA	NA	NA
WP_010931524.1\|2966634_2967435_-	energy transducer TonB	NA	NA	NA	NA
WP_003812968.1\|2967931_2968204_-	HU family DNA-binding protein	B5TA87	Burkholderia_phage	1.1e-20	57.8
WP_003812970.1\|2968524_2969205_-	Fe2+-dependent dioxygenase	Q5GQB0	Synechococcus_phage	4.9e-17	29.1
WP_010931523.1\|2969245_2970490_-	cystathionine gamma-synthase family protein	NA	NA	NA	NA
WP_003812973.1\|2970543_2971281_-	23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB	NA	NA	NA	NA
WP_024000927.1\|2971405_2973835_-	ribonuclease R	Q0GXV6	Lactococcus_phage	3.0e-64	31.6
WP_014905954.1\|2974387_2974969_-	DTW domain-containing protein	NA	NA	NA	NA
WP_010931520.1\|2975308_2975752_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_014905955.1\|2975876_2976824_+	AEC family transporter	NA	NA	NA	NA
WP_041166202.1\|2976965_2978192_+	YeeE/YedE family protein	NA	NA	NA	NA
WP_010931517.1\|2978267_2979929_+	FMN-binding glutamate synthase family protein	NA	NA	NA	NA
WP_005013747.1\|2980027_2980978_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_005013747.1\|2981076_2982027_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010928587.1\|2982036_2983467_-	cardiolipin synthase B	NA	NA	NA	NA
WP_010931516.1\|2983454_2984054_-	membrane protein	NA	NA	NA	NA
WP_010931515.1\|2984385_2985360_+	L-histidine N(alpha)-methyltransferase	NA	NA	NA	NA
WP_003812993.1\|2986973_2987231_-	hypothetical protein	NA	NA	NA	NA
WP_003812995.1\|2987247_2987484_-	hypothetical protein	NA	NA	NA	NA
WP_003812997.1\|2987813_2988080_+	hypothetical protein	NA	NA	NA	NA
WP_014486106.1\|2988101_2988425_-	hypothetical protein	NA	NA	NA	NA
WP_003813001.1\|2988460_2989066_+	HD domain-containing protein	NA	NA	NA	NA
WP_010931513.1\|2989231_2990659_+	diguanylate cyclase	A0A127AWB9	Bacillus_phage	6.5e-19	40.0
WP_003813004.1\|2990673_2991321_-	isochorismatase family protein	NA	NA	NA	NA
WP_005013747.1\|2991402_2992353_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_041166203.1\|2992451_2993570_-	DUF1513 domain-containing protein	NA	NA	NA	NA
WP_041166204.1\|2993559_2994561_-	imelysin family protein	NA	NA	NA	NA
WP_019247498.1\|2994666_2996178_-	c-type cytochrome	NA	NA	NA	NA
WP_023853587.1\|2996174_2997479_-	imelysin	NA	NA	NA	NA
WP_041166294.1\|2997590_2998148_-	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
WP_010930432.1\|2998418_2998973_+	NAD(P)H-dependent oxidoreductase	A0A2P0ZL82	Lactobacillus_phage	1.7e-15	32.0
WP_010930433.1\|2999428_2999644_-	dodecin domain-containing protein	NA	NA	NA	NA
WP_041166295.1\|2999898_3002496_+	DNA mismatch repair protein MutS	A0A1V0SDQ0	Indivirus	2.0e-21	22.6
WP_014905960.1\|3002492_3003680_+	cupin	NA	NA	NA	NA
WP_010930436.1\|3004343_3004958_+	serotype 3 fimbrial subunit	NA	NA	NA	NA
WP_033447671.1\|3005046_3006168_-	outer membrane protein assembly factor BamC	NA	NA	NA	NA
WP_003809954.1\|3006185_3007091_-	4-hydroxy-tetrahydrodipicolinate synthase	NA	NA	NA	NA
WP_005012067.1\|3007983_3008934_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010928449.1\|3008930_3009557_-	threonylcarbamoyl-AMP synthase	NA	NA	NA	NA
WP_010930427.1\|3009618_3010470_+	membrane protein	A0A1I9SA48	Rhodococcus_phage	7.0e-37	35.3
WP_010930425.1\|3011169_3011934_+	hypothetical protein	NA	NA	NA	NA
WP_005012067.1\|3012105_3013056_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_21

3187124 : 3252743

Klebsiella_phage(16.67%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005013747.1\|3187124_3188075_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003813056.1\|3191083_3192157_-	3-deoxy-7-phosphoheptulonate synthase AroG	A0A2I6UFP9	Klebsiella_phage	3.9e-77	46.4
WP_010931196.1\|3192413_3193874_-\|protease	metalloprotease TldD	NA	NA	NA	NA
WP_010931197.1\|3193884_3194715_-	carbon-nitrogen hydrolase family protein	NA	NA	NA	NA
WP_010931198.1\|3194839_3195211_+	H-NS histone family protein	NA	NA	NA	NA
WP_005012067.1\|3195309_3196260_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_014905989.1\|3196884_3197865_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_003807759.1\|3197918_3198254_-	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_010929865.1\|3198298_3199063_-	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_010929864.1\|3199086_3199827_-	IclR family transcriptional regulator	NA	NA	NA	NA
WP_010929863.1\|3199834_3201388_-	acyl--CoA ligase	A0A2K9L3I8	Tupanvirus	1.5e-13	22.6
WP_010929862.1\|3201422_3202400_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_041166209.1\|3202672_3203254_-	ureidoglycolate hydrolase	NA	NA	NA	NA
WP_094145972.1\|3203305_3210208_-	autotransporter BatB	NA	NA	NA	NA
WP_003807750.1\|3210654_3210786_-	entericidin A/B family lipoprotein	NA	NA	NA	NA
WP_010929858.1\|3211051_3211258_-	DUF3596 domain-containing protein	NA	NA	NA	NA
WP_014905991.1\|3212262_3212922_+	HAD-IA family hydrolase	NA	NA	NA	NA
WP_010929856.1\|3212949_3214095_+	DSD1 family PLP-dependent enzyme	NA	NA	NA	NA
WP_003807743.1\|3214235_3214571_+	YegP family protein	NA	NA	NA	NA
WP_010929855.1\|3214645_3215506_-	hypothetical protein	A0A2C9D0H9	Yersinia_phage	1.7e-51	53.6
WP_010929854.1\|3215769_3216471_-	glutathione S-transferase	NA	NA	NA	NA
WP_003807740.1\|3216640_3217036_+	RidA family protein	NA	NA	NA	NA
WP_005012067.1\|3217145_3218096_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_023852861.1\|3219409_3220237_-	4-hydroxy-tetrahydrodipicolinate synthase	NA	NA	NA	NA
WP_010931591.1\|3220524_3221019_-	GAF domain-containing protein	NA	NA	NA	NA
WP_010931590.1\|3221157_3222357_+	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
WP_010931589.1\|3222443_3223370_+	4-hydroxybenzoate octaprenyltransferase	NA	NA	NA	NA
WP_010931588.1\|3223635_3223809_+	DUF4148 domain-containing protein	NA	NA	NA	NA
WP_003818337.1\|3224034_3225162_+	NAD(P)-binding domain-containing protein	NA	NA	NA	NA
WP_010931587.1\|3226167_3228345_+	malate synthase G	NA	NA	NA	NA
WP_003818333.1\|3228380_3229025_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_010931585.1\|3229346_3230663_-	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_003818330.1\|3230690_3231482_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.6e-33	33.8
WP_014905992.1\|3231469_3232240_-	ABC transporter permease	NA	NA	NA	NA
WP_041166212.1\|3232303_3233305_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_014905994.1\|3233330_3234302_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_010931581.1\|3234460_3235279_-	hypothetical protein	NA	NA	NA	NA
WP_003806967.1\|3236581_3237568_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_010931580.1\|3237606_3239097_-	amidohydrolase family protein	NA	NA	NA	NA
WP_010931579.1\|3239376_3240210_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_126967223.1\|3240314_3240794_-	UTRA domain-containing protein	NA	NA	NA	NA
WP_010930742.1\|3240811_3241762_+\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_014905995.1\|3242211_3243228_-	hypothetical protein	NA	NA	NA	NA
WP_076879594.1\|3243256_3243613_-	hypothetical protein	NA	NA	NA	NA
WP_019247383.1\|3243597_3243945_-	hypothetical protein	NA	NA	NA	NA
WP_023852866.1\|3243963_3244467_-	hypothetical protein	NA	NA	NA	NA
WP_049805776.1\|3244497_3246627_-	TonB-dependent receptor	NA	NA	NA	NA
WP_003806953.1\|3246859_3247360_-	single-stranded DNA-binding protein	F8TUL2	EBPR_podovirus	3.4e-39	65.2
WP_014905997.1\|3247592_3248777_-	MFS transporter	NA	NA	NA	NA
WP_014905998.1\|3248932_3251791_+	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	1.9e-296	54.0
WP_005013747.1\|3251792_3252743_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_22

3294362 : 3333146

Acinetobacter_phage(25.0%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005012067.1\|3294362_3295313_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_080019449.1\|3295417_3296194_-	SRPBCC family protein	NA	NA	NA	NA
WP_010929962.1\|3296180_3298562_-	xanthine dehydrogenase family protein molybdopterin-binding subunit	NA	NA	NA	NA
WP_014906004.1\|3298554_3299064_-	(2Fe-2S)-binding protein	A0A0P0IVM8	Acinetobacter_phage	8.8e-19	37.3
WP_005013747.1\|3299282_3300233_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010929960.1\|3300995_3301991_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003819054.1\|3302009_3303002_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_003807624.1\|3303242_3303803_-	UbiX family flavin prenyltransferase	NA	NA	NA	NA
WP_010929959.1\|3303807_3304134_-	Grx4 family monothiol glutaredoxin	NA	NA	NA	NA
WP_014906005.1\|3304170_3304983_-	peptide chain release factor N(5)-glutamine methyltransferase	NA	NA	NA	NA
WP_003807618.1\|3304993_3306076_-	peptide chain release factor 1	A0A0S4KWG0	Pseudomonas_phage	3.3e-07	40.7
WP_010929957.1\|3306162_3307437_-\|tRNA	glutamyl-tRNA reductase	NA	NA	NA	NA
WP_005013747.1\|3308159_3309110_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003814555.1\|3309305_3310778_-	magnesium transporter	NA	NA	NA	NA
WP_003814554.1\|3310788_3311199_-	acyl-CoA thioesterase	NA	NA	NA	NA
WP_014906006.1\|3311262_3312309_-	YeiH family putative sulfate export transporter	NA	NA	NA	NA
WP_003814552.1\|3312415_3313294_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_014906007.1\|3313307_3314489_-	amidohydrolase	NA	NA	NA	NA
WP_010931141.1\|3314550_3316242_+	AMP-binding protein	A0A2H4PQU7	Staphylococcus_phage	9.4e-33	28.1
WP_010930048.1\|3316238_3317189_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_014486105.1\|3317287_3318238_-\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_023852715.1\|3318346_3319243_-	inositol monophosphatase	NA	NA	NA	NA
WP_003814547.1\|3321520_3323746_+	glycoside hydrolase family 31 protein	NA	NA	NA	NA
WP_003814544.1\|3323910_3324999_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	8.7e-32	36.4
WP_019247918.1\|3324955_3325609_+	ABC transporter permease	NA	NA	NA	NA
WP_010931144.1\|3325656_3326454_+	MetQ/NlpA family ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_041166214.1\|3326967_3328116_+	iron-containing alcohol dehydrogenase	NA	NA	NA	NA
WP_003814535.1\|3328172_3328478_-	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
WP_003820797.1\|3328506_3328941_-	DUF126 domain-containing protein	NA	NA	NA	NA
WP_003820799.1\|3330184_3330895_-	FadR family transcriptional regulator	NA	NA	NA	NA
WP_033446288.1\|3330909_3331821_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_005013747.1\|3332195_3333146_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_23

3349452 : 3390135

Bacillus_virus(16.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005012067.1\|3349452_3350403_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_041166215.1\|3351438_3351981_-	hypothetical protein	NA	NA	NA	NA
WP_162471243.1\|3352178_3352349_-	hypothetical protein	NA	NA	NA	NA
WP_005013747.1\|3352366_3353317_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003809019.1\|3353313_3354102_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.1e-33	40.0
WP_003809022.1\|3355227_3355662_-	PaaI family thioesterase	NA	NA	NA	NA
WP_010931167.1\|3355658_3356669_-	zinc-binding dehydrogenase	NA	NA	NA	NA
WP_041166216.1\|3356712_3357639_-	VOC family protein	NA	NA	NA	NA
WP_003809026.1\|3357923_3358292_+	DUF861 domain-containing protein	NA	NA	NA	NA
WP_154698394.1\|3358344_3358491_-	hypothetical protein	NA	NA	NA	NA
WP_014905668.1\|3358508_3359459_+\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_014906012.1\|3359503_3361930_+	copper-translocating P-type ATPase	A0A218MNH6	uncultured_virus	3.1e-85	33.6
WP_010931164.1\|3361978_3362671_+	HD domain-containing protein	A0A1D6Y7U0	Golden_Marseillevirus	4.7e-07	29.9
WP_010931163.1\|3362743_3363943_+	aspartate/tyrosine/aromatic aminotransferase	NA	NA	NA	NA
WP_014906013.1\|3364062_3365013_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_014906014.1\|3365009_3365939_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_003815281.1\|3366065_3366902_+	3-methyl-2-oxobutanoate hydroxymethyltransferase	A0A0P0BXC9	Ostreococcus_lucimarinus_virus	1.6e-33	33.3
WP_010931158.1\|3367414_3368524_+	porin	NA	NA	NA	NA
WP_005012067.1\|3368585_3369536_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003819553.1\|3369698_3370511_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_019247888.1\|3370524_3371289_-	SDR family oxidoreductase	A0A0M4JSW6	Mollivirus	3.1e-12	26.5
WP_010931161.1\|3371301_3372648_-	MFS transporter	NA	NA	NA	NA
WP_014906015.1\|3372673_3373603_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_003819549.1\|3373718_3374624_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_010929956.1\|3374620_3375571_-\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_010931170.1\|3375682_3376465_+	ABC transporter permease	NA	NA	NA	NA
WP_010931171.1\|3376468_3377560_-	DUF2817 domain-containing protein	NA	NA	NA	NA
WP_010931172.1\|3377665_3379141_+	acyl--CoA ligase	Q75ZG1	Hepacivirus	3.0e-35	25.6
WP_010931173.1\|3379282_3379831_+	hypothetical protein	NA	NA	NA	NA
WP_003809010.1\|3379846_3380308_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_014906016.1\|3380408_3381398_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_010931175.1\|3381696_3382398_+	riboflavin synthase	NA	NA	NA	NA
WP_010931176.1\|3382436_3383810_-	amidase	NA	NA	NA	NA
WP_041166218.1\|3383848_3384820_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_003808997.1\|3384972_3385875_+	transcriptional regulator GcvA	NA	NA	NA	NA
WP_010931178.1\|3385822_3387043_-	MFS transporter	NA	NA	NA	NA
WP_010931179.1\|3387039_3387549_-	nucleoside deaminase	NA	NA	NA	NA
WP_010926062.1\|3387538_3388234_-	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_010931181.1\|3388304_3389174_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_005013747.1\|3389184_3390135_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_24

3457282 : 3542389

Planktothrix_phage(15.38%)

tRNA,holin,transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005012808.1\|3457282_3458233_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003814611.1\|3458677_3458989_-	cell division protein ZapA	NA	NA	NA	NA
WP_003820745.1\|3458988_3459519_-	hypothetical protein	NA	NA	NA	NA
WP_162268687.1\|3459475_3459664_-	hypothetical protein	NA	NA	NA	NA
WP_010929577.1\|3459681_3460632_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003820744.1\|3460921_3461386_+	tripartite tricarboxylate transporter TctB family protein	NA	NA	NA	NA
WP_010931270.1\|3461400_3462906_+	tripartite tricarboxylate transporter permease	NA	NA	NA	NA
WP_010931271.1\|3463159_3464767_+	gamma-glutamyltransferase family protein	NA	NA	NA	NA
WP_003814620.1\|3464822_3465728_+	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_005013747.1\|3466168_3467119_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003818450.1\|3467257_3468010_+	uracil-DNA glycosylase	A0A1Y0B680	Bovine_alphaherpesvirus	2.5e-46	47.5
WP_023853440.1\|3468284_3469973_+	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	1.6e-48	32.9
WP_023995245.1\|3470061_3471252_+	hypothetical protein	NA	NA	NA	NA
WP_014906030.1\|3471266_3472361_-\|tRNA	CCA tRNA nucleotidyltransferase	A0A0F6YPT7	Sinorhizobium_phage	7.1e-50	50.0
WP_014906031.1\|3472357_3474421_-	lytic transglycosylase domain-containing protein	A0A0S2SXL7	Bacillus_phage	5.3e-14	36.6
WP_010931276.1\|3474496_3475177_+	5-formyltetrahydrofolate cyclo-ligase	NA	NA	NA	NA
WP_014906032.1\|3475454_3476828_+	MHS family MFS transporter	NA	NA	NA	NA
WP_003818444.1\|3476829_3477849_+	histone deacetylase family protein	A0A2K9L473	Tupanvirus	3.4e-22	31.7
WP_003818443.1\|3477912_3478884_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_014905391.1\|3478948_3479899_-\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_003807159.1\|3479997_3480558_-	cob(I)yrinic acid a,c-diamide adenosyltransferase	NA	NA	NA	NA
WP_003807161.1\|3480982_3481288_+	copper-binding protein	NA	NA	NA	NA
WP_003807162.1\|3481301_3482636_-\|protease	ATP-dependent protease ATPase subunit HslU	A0A191ZC11	Erwinia_phage	3.5e-43	29.6
WP_005013747.1\|3482767_3483718_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_041166222.1\|3483697_3484246_-\|protease	ATP-dependent protease subunit HslV	NA	NA	NA	NA
WP_003807164.1\|3484393_3484858_-	RNA polymerase-binding protein DksA	NA	NA	NA	NA
WP_003818423.1\|3485000_3486110_-	GTP-binding protein	NA	NA	NA	NA
WP_003807166.1\|3486386_3486890_-	transcriptional repressor	NA	NA	NA	NA
WP_019248127.1\|3487063_3487228_+	hypothetical protein	NA	NA	NA	NA
WP_010931288.1\|3487218_3487941_+	metal ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	1.1e-11	30.0
WP_010931287.1\|3487937_3488834_+	metal ABC transporter permease	NA	NA	NA	NA
WP_010931286.1\|3488830_3489766_+	metal ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_019247300.1\|3489726_3490395_+	DUF1007 family protein	NA	NA	NA	NA
WP_003818434.1\|3490385_3491354_+	putative membrane protein	NA	NA	NA	NA
WP_014906033.1\|3491402_3493544_+	TonB-dependent receptor	NA	NA	NA	NA
WP_010931282.1\|3493556_3494537_-	tyrosine recombinase XerC	A0A166YH27	Gordonia_phage	3.3e-14	30.5
WP_010931281.1\|3494551_3495244_-	DUF484 family protein	NA	NA	NA	NA
WP_003807183.1\|3495270_3496182_-	diaminopimelate epimerase	NA	NA	NA	NA
WP_014906034.1\|3496224_3497115_-	lysophospholipid acyltransferase family protein	NA	NA	NA	NA
WP_014906035.1\|3497111_3497966_-	lysophospholipid acyltransferase family protein	NA	NA	NA	NA
WP_010925730.1\|3498249_3499413_+	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	5.0e-126	60.8
WP_003818441.1\|3499523_3499775_+	DUF1289 domain-containing protein	NA	NA	NA	NA
WP_003807194.1\|3499854_3500895_+	glycosyltransferase family 1 protein	NA	NA	NA	NA
WP_010931278.1\|3501174_3502593_+	adenosylhomocysteinase	S4VPF6	Pandoravirus	8.7e-40	29.4
WP_010931277.1\|3502663_3502999_+\|holin	phage holin family protein	NA	NA	NA	NA
WP_003807199.1\|3502998_3503841_+	methylenetetrahydrofolate reductase [NAD(P)H]	NA	NA	NA	NA
WP_005012808.1\|3503939_3504890_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010929594.1\|3504983_3505883_+	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_023852650.1\|3505962_3506724_+	amino acid ABC transporter permease	NA	NA	NA	NA
WP_003817737.1\|3506720_3507410_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_019247224.1\|3507434_3508025_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.2e-20	33.6
WP_010929592.1\|3508030_3508765_+	aspartate/glutamate racemase family protein	NA	NA	NA	NA
WP_014906036.1\|3508822_3509887_-	porin	NA	NA	NA	NA
WP_029443813.1\|3509998_3511255_-	muropeptide transporter	NA	NA	NA	NA
WP_010930048.1\|3511297_3512248_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003817748.1\|3512383_3512998_-	methionine biosynthesis protein MetW	NA	NA	NA	NA
WP_010929590.1\|3512994_3514242_-	homoserine O-acetyltransferase	NA	NA	NA	NA
WP_014906037.1\|3516107_3516344_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_010929589.1\|3516315_3516864_-	hypothetical protein	NA	NA	NA	NA
WP_014906038.1\|3518537_3519455_+	reductase	NA	NA	NA	NA
WP_003815842.1\|3519451_3519700_+	glutaredoxin family protein	NA	NA	NA	NA
WP_003815840.1\|3519696_3520902_+	CoA transferase	NA	NA	NA	NA
WP_014486045.1\|3520974_3521970_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_014906039.1\|3521992_3523213_-	CoA transferase	NA	NA	NA	NA
WP_014486047.1\|3523209_3523854_-	hypothetical protein	NA	NA	NA	NA
WP_010929483.1\|3525584_3526394_-	IclR family transcriptional regulator	NA	NA	NA	NA
WP_014486048.1\|3526698_3527652_+	thioredoxin-disulfide reductase	A0A2I2L5E1	Orpheovirus	5.6e-59	42.5
WP_005012067.1\|3527750_3528701_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003815921.1\|3528801_3529623_+	phosphodiesterase	NA	NA	NA	NA
WP_010929634.1\|3529728_3530769_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.0e-22	33.7
WP_003815926.1\|3530811_3532104_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003815927.1\|3532114_3532990_+	sugar ABC transporter permease	NA	NA	NA	NA
WP_003815929.1\|3532986_3533787_+	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_014905678.1\|3533862_3534879_-\|transposase	IS110-like element IS1663 family transposase	NA	NA	NA	NA
WP_003815930.1\|3535157_3535475_-	hypothetical protein	NA	NA	NA	NA
WP_003815933.1\|3535565_3535913_-	DUF1840 domain-containing protein	NA	NA	NA	NA
WP_023853376.1\|3536200_3537883_+\|tRNA	arginine--tRNA ligase	NA	NA	NA	NA
WP_010927242.1\|3537892_3538576_+	SPOR domain-containing protein	NA	NA	NA	NA
WP_010929628.1\|3538637_3539267_+	thiol:disulfide interchange protein DsbA/DsbL	NA	NA	NA	NA
WP_010929627.1\|3539348_3540542_-	cystathionine beta-lyase	NA	NA	NA	NA
WP_014906041.1\|3541438_3542389_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_25

3605188 : 3659551

Flavobacterium_phage(16.67%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005013747.1\|3605188_3606139_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_014906058.1\|3606237_3606693_-	PaaI family thioesterase	NA	NA	NA	NA
WP_003815479.1\|3607881_3608589_-	haloacid dehalogenase type II	NA	NA	NA	NA
WP_014906059.1\|3608817_3609762_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_014906060.1\|3609777_3610746_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_014906061.1\|3611108_3612704_+	cytochrome c oxidase subunit I	R9VX24	Flavobacterium_phage	6.8e-09	38.3
WP_003815472.1\|3612731_3613277_+	DUF2244 domain-containing protein	NA	NA	NA	NA
WP_014906062.1\|3613308_3614019_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_014906063.1\|3614217_3615414_+	aminotransferase class V-fold PLP-dependent enzyme	NA	NA	NA	NA
WP_004567894.1\|3616269_3616962_+	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_005013747.1\|3617060_3618011_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_014906064.1\|3618007_3618382_-	hypothetical protein	NA	NA	NA	NA
WP_014906065.1\|3618378_3620058_-	ATP-dependent acyl-CoA ligase	A0A2H4PQM9	Staphylococcus_phage	1.8e-20	24.4
WP_010929742.1\|3620067_3621084_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_010929743.1\|3621096_3621510_-	Zn-ribbon domain-containing OB-fold protein	NA	NA	NA	NA
WP_010929744.1\|3621506_3622703_-	thiolase domain-containing protein	NA	NA	NA	NA
WP_010929745.1\|3622789_3623674_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_014906066.1\|3623686_3624664_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_014906067.1\|3625832_3627152_+	DUF3300 domain-containing protein	NA	NA	NA	NA
WP_010929747.1\|3627148_3627979_+	DUF2950 family protein	NA	NA	NA	NA
WP_010929749.1\|3629221_3629809_-	methylated-DNA--[protein]-cysteine S-methyltransferase	M1PFU9	Streptococcus_phage	1.4e-20	39.5
WP_003815451.1\|3629829_3630480_-	DNA oxidative demethylase AlkB	NA	NA	NA	NA
WP_010929750.1\|3630491_3631214_-	2OG-Fe(II) oxygenase	NA	NA	NA	NA
WP_003817864.1\|3631358_3631859_+	DUF523 domain-containing protein	NA	NA	NA	NA
WP_014906068.1\|3631862_3632651_-	heme ABC transporter ATP-binding protein	NA	NA	NA	NA
WP_041166308.1\|3632665_3633610_-	iron ABC transporter permease	NA	NA	NA	NA
WP_041166226.1\|3633653_3634511_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_010929754.1\|3634519_3635566_-	hemin-degrading factor	NA	NA	NA	NA
WP_029443809.1\|3635601_3638214_-	TonB-dependent receptor	NA	NA	NA	NA
WP_019247195.1\|3638346_3639321_-	DUF4880 domain-containing protein	NA	NA	NA	NA
WP_003815434.1\|3639299_3639809_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_023852637.1\|3639982_3640174_-	hypothetical protein	NA	NA	NA	NA
WP_003815429.1\|3640487_3640805_+	(2Fe-2S)-binding protein	NA	NA	NA	NA
WP_004567880.1\|3640806_3641106_+	hypothetical protein	NA	NA	NA	NA
WP_003815425.1\|3641124_3641430_+	(2Fe-2S)-binding protein	NA	NA	NA	NA
WP_010929758.1\|3641440_3642373_+	ornithine cyclodeaminase family protein	NA	NA	NA	NA
WP_010930179.1\|3642369_3643320_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_039251062.1\|3643394_3644339_+\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_080019464.1\|3644552_3645734_-	Rieske 2Fe-2S domain-containing protein	S4S2K9	Puniceispirillum_phage	1.9e-56	33.7
WP_010930048.1\|3645706_3646657_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_014906071.1\|3648488_3649316_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_010931596.1\|3649363_3650311_-	hydroxymethylglutaryl-CoA lyase	NA	NA	NA	NA
WP_010931595.1\|3651618_3652518_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_010931594.1\|3652611_3653376_+\|tRNA	tRNA (guanosine(46)-N7)-methyltransferase TrmB	NA	NA	NA	NA
WP_014906072.1\|3653376_3654294_+	prolyl aminopeptidase	NA	NA	NA	NA
WP_003807812.1\|3654304_3654505_+	sulfur carrier protein ThiS	NA	NA	NA	NA
WP_041166227.1\|3654646_3655096_+	peptidoglycan-binding protein LysM	G3MBQ1	Bacillus_virus	2.0e-06	46.9
WP_014906074.1\|3655221_3656631_-	signal recognition particle protein	NA	NA	NA	NA
WP_010929606.1\|3656736_3657579_+	cytochrome c biogenesis protein CcsA	NA	NA	NA	NA
WP_003807805.1\|3657580_3657832_+	hypothetical protein	NA	NA	NA	NA
WP_003807804.1\|3657920_3658502_+	1,6-anhydro-N-acetylmuramyl-L-alanine amidase AmpD	A0A1W6DX33	Sphingobium_phage	1.7e-05	54.3
WP_005015810.1\|3658600_3659551_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_26

3663872 : 3720374

Diachasmimorpha_longicaudata_entomopoxvirus(14.29%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005012808.1\|3663872_3664823_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_014906075.1\|3666266_3667175_-	YgcG family protein	NA	NA	NA	NA
WP_003815889.1\|3667152_3667782_-	LemA family protein	NA	NA	NA	NA
WP_010929660.1\|3668064_3669495_+	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	5.8e-44	29.8
WP_010929661.1\|3669528_3670158_+	LysE family transporter	NA	NA	NA	NA
WP_041166228.1\|3670206_3671793_+	peptide chain release factor 3	A0A2K9L6L3	Tupanvirus	7.0e-14	37.8
WP_003815897.1\|3671817_3672501_+	hypothetical protein	NA	NA	NA	NA
WP_003815898.1\|3672582_3673059_-	bacterioferritin	NA	NA	NA	NA
WP_005012067.1\|3673265_3674216_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010931297.1\|3674306_3674735_+	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_023853362.1\|3674731_3676168_+	TonB-dependent receptor	NA	NA	NA	NA
WP_010931296.1\|3676887_3677367_+	membrane protein	NA	NA	NA	NA
WP_004566249.1\|3677518_3677818_+	DUF4148 domain-containing protein	NA	NA	NA	NA
WP_010931294.1\|3678078_3678660_-	CGNR zinc finger domain-containing protein	NA	NA	NA	NA
WP_010925959.1\|3678747_3679632_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_003808340.1\|3679767_3680523_+	molybdate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003808339.1\|3680544_3681225_+	molybdate ABC transporter permease subunit	NA	NA	NA	NA
WP_010931293.1\|3681236_3682346_+	molybdenum ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	7.5e-23	34.5
WP_041166309.1\|3682352_3683831_-	phospholipase D family protein	NA	NA	NA	NA
WP_005012808.1\|3684143_3685094_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010929595.1\|3685895_3687122_-	type II toxin-antitoxin system HipA family toxin	NA	NA	NA	NA
WP_047122776.1\|3687121_3687535_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_010929597.1\|3687724_3688666_-	hypothetical protein	NA	NA	NA	NA
WP_050849198.1\|3689089_3690064_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_010929599.1\|3690120_3690702_-	DJ-1/PfpI family protein	NA	NA	NA	NA
WP_014906079.1\|3690714_3691017_-	Rieske 2Fe-2S domain-containing protein	NA	NA	NA	NA
WP_029443770.1\|3691135_3692194_-	2Fe-2S iron-sulfur cluster binding domain-containing protein	NA	NA	NA	NA
WP_019247832.1\|3692228_3693500_-	TRAP transporter large permease	NA	NA	NA	NA
WP_010929603.1\|3694129_3695311_-	TRAP transporter substrate-binding protein	NA	NA	NA	NA
WP_080019455.1\|3695331_3695715_-	hypothetical protein	NA	NA	NA	NA
WP_014906080.1\|3695732_3696683_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010929673.1\|3696785_3697421_+	superoxide dismutase	Q56AR7	Bacillus_thuringiensis_phage	2.8e-83	73.8
WP_010929674.1\|3697417_3698311_+	ZIP family metal transporter	NA	NA	NA	NA
WP_014906081.1\|3698705_3699806_+	glycine cleavage system aminomethyltransferase GcvT	NA	NA	NA	NA
WP_010929676.1\|3699887_3700262_+	glycine cleavage system protein GcvH	NA	NA	NA	NA
WP_014906082.1\|3700321_3703186_+	aminomethyl-transferring glycine dehydrogenase	E3SN07	Prochlorococcus_phage	4.0e-262	51.5
WP_014906083.1\|3703330_3704071_-	FadR family transcriptional regulator	NA	NA	NA	NA
WP_010929679.1\|3704140_3705352_+	CoA transferase	NA	NA	NA	NA
WP_010929680.1\|3705380_3706349_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_010930048.1\|3706860_3707811_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003814720.1\|3709523_3710582_-	glycosyltransferase family 2 protein	I1TED8	Salmonella_phage	2.8e-59	40.5
WP_014906084.1\|3710711_3711227_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_010929785.1\|3711422_3712628_+	sodium/glutamate symporter	NA	NA	NA	NA
WP_010929786.1\|3712624_3714136_+	TAXI family TRAP transporter solute-binding subunit	NA	NA	NA	NA
WP_003814726.1\|3714151_3715465_-	short-chain fatty acid transporter	NA	NA	NA	NA
WP_003814728.1\|3715655_3715835_-	hypothetical protein	NA	NA	NA	NA
WP_003814730.1\|3716244_3716979_-	DNA polymerase III subunit epsilon	A0A1X9SH08	Bradyrhizobium_phage	1.4e-41	43.8
WP_005012067.1\|3719423_3720374_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_018518

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection