CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number
NC_019793	Deinococcus peraridilitoris DSM 19664, complete sequence	1 crisprs	cas3,DEDDh,csa3,WYL	2	4	4
NC_019790	Deinococcus peraridilitoris DSM 19664 plasmid pDEIPE02, complete sequence	0 crisprs	NA	0	0	1
NC_019789	Deinococcus peraridilitoris DSM 19664 plasmid pDEIPE01, complete sequence	1 crisprs	c2c10_CAS-V-U3,csa3	0	1	5

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_019789_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_019789_1

398440-398539

Orphan

Consensus_repeat	Method
CCCTGAAGGACGCCTGCCCGCGTC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_019789_1

>merge|NC_019789|1|398440-398539|CRISPRCasFinder
CCCTGAAGGACGCCTGCCCGCGTCTTGGCCAGAACGGACTCGCATGAGCAAGCCTGGCCGCTTGGGCAGAACGGCGCCCTGAAGGACGCCTGCCCGCGTC

>NC_019789|1|1|398440-398539|CRISPRCasFinder
CCCTGAAGGACGCCTGCCCGCGTC	TTGGCCAGAACGGACTCGCATGAGCAAGCCTGGCCGCTTGGGCAGAACGGCG
CCCTGAAGGACGCCTGCCCGCGTC

Protein	Signature genes	Signature genes Name	Protein_function
NC_019789.1\|WP_015231489.1\|399156_400365_-\|multidrug-effflux-MFS-transporter	unknown	unknown	gnl\|CDD\|340878
NC_019789.1\|WP_015231487.1\|395676_396165_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225837
NC_019789.1\|WP_015231486.1\|395109_395688_+\|hypothetical-protein	unknown	unknown	unknown
NC_019789.1\|WP_041231827.1\|406886_407171_+\|winged-helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|379282
NC_019789.1\|WP_083865921.1\|406636_406831_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|239243
NC_019789.1\|WP_015231494.1\|405971_406415_-\|DMT-family-transporter	unknown	unknown	gnl\|CDD\|377396
NC_019789.1\|WP_015231485.1\|391876_394543_-\|EAL-domain-containing-protein	unknown	unknown	gnl\|CDD\|183097
NC_019789.1\|WP_041231956.1\|409613_409976_+\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	unknown	unknown	gnl\|CDD\|227028
NC_019789.1\|WP_041231824.1\|390307_390805_+\|GHKL-domain-containing-protein	unknown	unknown	gnl\|CDD\|340398
NC_019789.1\|WP_041231823.1\|385661_385898_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|272971
NC_019789.1\|WP_015231481.1\|388339_389413_-\|S8-family-serine-peptidase	unknown	unknown	gnl\|CDD\|173810
NC_019789.1\|WP_015231490.1\|400376_400958_-\|hypothetical-protein	unknown	unknown	unknown
NC_019789.1\|WP_015231488.1\|396284_398174_-\|tetratricopeptide-repeat-protein	unknown	unknown	gnl\|CDD\|226702
NC_019789.1\|WP_015231480.1\|385894_388288_-\|EAL-domain-containing-protein	unknown	unknown	gnl\|CDD\|236645
NC_019789.1\|WP_015231482.1\|389421_389952_-\|hypothetical-protein	unknown	unknown	unknown
NC_019789.1\|WP_015231495.1\|407264_407672_+\|RidA-family-protein	unknown	unknown	gnl\|CDD\|129116
NC_019789.1\|WP_015231496.1\|407677_408676_+\|threonine/serine-dehydratase	unknown	unknown	gnl\|CDD\|107205
NC_019789.1\|WP_015231491.1\|401300_404915_-\|PAS-domain-S-box-protein	unknown	unknown	gnl\|CDD\|226702
NC_019789.1\|WP_015231484.1\|390947_391841_-\|diguanylate-cyclase	unknown	unknown	gnl\|CDD\|143635
NC_019789.1\|WP_041231826.1\|405549_405729_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NC_019789.1\|WP_015231489.1\|399156_400365_-\|multidrug-effflux-MFS-transporter	gnl\|CDD\|340878	cd17320, MFS_MdfA_MDR_like, Multidrug transporter MdfA and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This family is composed of bacterial multidrug resistance (MDR) transporters including several proteins from Escherichia coli such as MdfA (also called chloramphenicol resistance pump Cmr), EmrD, MdtM, MdtL, bicyclomycin resistance protein (also called sulfonamide resistance protein), and the uncharacterized inner membrane transport protein YdhC. EmrD is a proton-dependent secondary transporter, first identified as an efflux pump for uncouplers of oxidative phosphorylation. It expels a range of drug molecules and amphipathic compounds across the inner membrane of E. coli. Similarly, MdfA is a secondary multidrug transporter that exports a broad spectrum of structurally and electrically dissimilar toxic compounds. These MDR transporters are drug/H+ antiporters (DHA) belonging to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	5.68158e-86
NC_019789.1\|WP_015231487.1\|395676_396165_-\|hypothetical-protein	gnl\|CDD\|225837	COG3300, COG3300, MHYT domain (predicted integral membrane sensor domain) [Signal transduction mechanisms].	1.57288e-15
NC_019789.1\|WP_083865921.1\|406636_406831_+\|hypothetical-protein	gnl\|CDD\|239243	cd02933, OYE_like_FMN, Old yellow enzyme (OYE)-like FMN binding domain. OYE was the first flavin-dependent enzyme identified, however its true physiological role remains elusive to this day. Each monomer of OYE contains FMN as a non-covalently bound cofactor, uses NADPH as a reducing agent with oxygens, quinones, and alpha,beta-unsaturated aldehydes and ketones, and can act as electron acceptors in the catalytic reaction. Members of OYE family include 12-oxophytodienoate reductase, pentaerythritol tetranitrate reductase, morphinone reductase, and related enzymes.	3.1504e-11
NC_019789.1\|WP_015231494.1\|405971_406415_-\|DMT-family-transporter	gnl\|CDD\|377396	pfam04657, DMT_YdcZ, Putative inner membrane exporter, YdcZ. DMT_YdcZ is a family of putative inner membrane exporters from both Gram-positive and Gram-negative bacteria.	6.32223e-28
NC_019789.1\|WP_015231485.1\|391876_394543_-\|EAL-domain-containing-protein	gnl\|CDD\|183097	PRK11359, PRK11359, cyclic-di-GMP phosphodiesterase; Provisional.	2.34947e-107
NC_019789.1\|WP_041231956.1\|409613_409976_+\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	gnl\|CDD\|227028	COG4683, COG4683, Uncharacterized protein conserved in bacteria [Function unknown].	3.83367e-33
NC_019789.1\|WP_041231824.1\|390307_390805_+\|GHKL-domain-containing-protein	gnl\|CDD\|340398	cd16921, HATPase_FilI-like, Histidine kinase-like ATPase domain of two-component sensor histidine kinases similar to Methanosaeta harundinacea FilI and some hybrid sensor histidine kinases. This family includes FilI, the histidine kinase (HK) component of FilI-FilRs, a two-component signal transduction system (TCS) of the methanogenic archaeon, Methanosaeta harundinacea, which is involved in regulating methanogenesis. The cytoplasmic HK core consists of a C-terminal HK-like ATPase domain (represented here) and a histidine kinase dimerization and phosphoacceptor domain (HisKA) domain, which, in FilI, are coupled to CHASE, HAMP, PAS, and GAF sensor domains. FilI-FilRs catalyzes the phosphotransfer between FilI (HK) and FilRs (FilR1 and FilR2, response regulators) of the TCS. TCSs are predicted to be of bacterial origin, and acquired by archaea by horizontal gene transfer. This model also includes related HATPase domains such as that of Synechocystis sp. PCC6803 phytochrome-like protein Cph1. Proteins having this HATPase domain and HisKA domain also have accessory sensor domains such as CHASE, GAF, HAMP and PAS; some are hybrid sensor histidine kinases as they also contain a REC signal receiver domain.	9.87843e-41
NC_019789.1\|WP_041231823.1\|385661_385898_-\|hypothetical-protein	gnl\|CDD\|272971	TIGR00229, Sensor_protein_FixL, PAS domain S-box. The PAS domain was previously described. This sensory box, or S-box domain occupies the central portion of the PAS domain but is more widely distributed. It is often tandemly repeated. Known prosthetic groups bound in the S-box domain include heme in the oxygen sensor FixL, FAD in the redox potential sensor NifL, and a 4-hydroxycinnamyl chromophore in photoactive yellow protein. Proteins containing the domain often contain other regulatory domains such as response regulator or sensor histidine kinase domains. Other S-box proteins include phytochromes and the aryl hydrocarbon receptor nuclear translocator. [Regulatory functions, Small molecule interactions].	0.000542819
NC_019789.1\|WP_015231481.1\|388339_389413_-\|S8-family-serine-peptidase	gnl\|CDD\|173810	cd07484, Peptidases_S8_Thermitase_like, Peptidase S8 family domain in Thermitase-like proteins. Thermitase is a non-specific, trypsin-related serine protease with a very high specific activity. It contains a subtilisin like domain. The tertiary structure of thermitase is similar to that of subtilisin BPN'. It contains a Asp/His/Ser catalytic triad. Members of the peptidases S8 (subtilisin and kexin) and S53 (sedolisin) clan include endopeptidases and exopeptidases. The S8 family has an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. Serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base. The S53 family contains a catalytic triad Glu/Asp/Ser with an additional acidic residue Asp in the oxyanion hole, similar to that of subtilisin. The serine residue here is the nucleophilic equivalent of the serine residue in the S8 family, while glutamic acid has the same role here as the histidine base. However, the aspartic acid residue that acts as an electrophile is quite different. In S53 the it follows glutamic acid, while in S8 it precedes histidine. The stability of these enzymes may be enhanced by calcium, some members have been shown to bind up to 4 ions via binding sites with different affinity. There is a great diversity in the characteristics of their members: some contain disulfide bonds, some are intracellular while others are extracellular, some function at extreme temperatures, and others at high or low pH values.	2.06263e-47
NC_019789.1\|WP_015231488.1\|396284_398174_-\|tetratricopeptide-repeat-protein	gnl\|CDD\|226702	COG4251, COG4251, Bacteriophytochrome (light-regulated signal transduction histidine kinase) [Signal transduction mechanisms].	1.49278e-53
NC_019789.1\|WP_015231480.1\|385894_388288_-\|EAL-domain-containing-protein	gnl\|CDD\|236645	PRK10060, PRK10060, cyclic di-GMP phosphodiesterase.	6.76616e-93
NC_019789.1\|WP_015231495.1\|407264_407672_+\|RidA-family-protein	gnl\|CDD\|129116	TIGR00004, RutC_family_protein, reactive intermediate/imine deaminase. This protein was described initially as an inhibitor of protein synthesis intiation, then as an endoribonuclease active on single-stranded mRNA, endoribonuclease L-PSP. Members of this family, conserved in all domains of life and often with several members per bacterial genome, appear to catalyze a reaction that minimizes toxic by-products from reactions catalyzed by pyridoxal phosphate-dependent enzymes. [Cellular processes, Other].	1.46658e-28
NC_019789.1\|WP_015231496.1\|407677_408676_+\|threonine/serine-dehydratase	gnl\|CDD\|107205	cd01562, Thr-dehyd, Threonine dehydratase: The first step in amino acid degradation is the removal of nitrogen. Although the nitrogen atoms of most amino acids are transferred to alpha-ketoglutarate before removal, the alpha-amino group of threonine can be directly converted into NH4+. The direct deamination is catalyzed by threonine dehydratase, in which pyridoxal phosphate (PLP) is the prosthetic group. Threonine dehydratase is widely distributed in all three major phylogenetic divisions.	6.44241e-118
NC_019789.1\|WP_015231491.1\|401300_404915_-\|PAS-domain-S-box-protein	gnl\|CDD\|226702	COG4251, COG4251, Bacteriophytochrome (light-regulated signal transduction histidine kinase) [Signal transduction mechanisms].	1.28587e-67
NC_019789.1\|WP_015231484.1\|390947_391841_-\|diguanylate-cyclase	gnl\|CDD\|143635	cd01949, GGDEF, Diguanylate-cyclase (DGC) or GGDEF domain. Diguanylate-cyclase (DGC) or GGDEF domain: Originally named after a conserved residue pattern, and initially described as a domain of unknown function 1 (DUF1). This domain is widely present in bacteria, linked to a wide range of non-homologous domains in a variety of cell signaling proteins. The domain shows homology to the adenylyl cyclase catalytic domain. This correlates with the functional information available on two GGDEF-containing proteins, namely diguanylate cyclase and phosphodiesterase A of Acetobacter xylinum, both of which regulate the turnover of cyclic diguanosine monophosphate. Together with the EAL domain, GGDEF might be involved in regulating cell surface adhesion in bacteria.	3.44703e-53
NC_019789.1\|WP_041231827.1\|406886_407171_+\|winged-helix-turn-helix-domain-containing-protein	gnl\|CDD\|379282	pfam13592, HTH_33, Winged helix-turn helix. This helix-turn-helix domain is often found in transferases and is likely to be DNA-binding.	0.000121772

>NC_019789.1|WP_015231488.1|396284_398174_-|tetratricopeptide-repeat-protein
MSEPHHHTDQPPTGDAAQVDALLALSEKLALNEREQAALLAHQALTLADQLLDEPRGAQAALRLATLEWRLSRHDSAMQHASDALTRFRRLGDAEHEAWSLRLLGNIHGVQSQYVPATEYLQAAAALSRETNNRACLASCLNNLGIIADELGDYATALEHLFEALQMYDEHDRDVPITLNNISSQYRQLGQFDRAMHFHQQTLELARSGQEHPLIATFVHNMAETLRRHRRGEQAQPLLQEALMLARQASDRQTEMLALDSLGLIQQEQGEEELARGVFEQGLSIASTVNHPLAEVKLLMHHAATLGPGGAVEQLERALALAVRAGLKAEELEVHDLLVSAHHQPGNLAAAFDHLKRARTLERELFNEEQDRRVQALHIQYDLRSARELAEAQRVLNEQLLRANEELDAFTSTVSHDLRAPLRHIISFSAVLRRVLGEDLPERALKPLGVIESSAARMNVLTDALLSFARTSRQPLQVQDVNLHVLLDDAREDLHLGVTAQRVQWRVESLPVVRGDPVLLRQVLVNLLSNAVKYSAERDTPVVSVTAEEAPGEVVLTVQDNGVGFDPRHADKLFGMFSRLHQASTFEGTGIGLATAKRIVERHGGRIWAESTPGHGAVFHLSLPKGTQA
>NC_019789.1|WP_015231487.1|395676_396165_-|hypothetical-protein
MHPVTGQDDPQLVLLSILIACLASCATLSVAARVQPNLLRLLVPHLLFSPIVMAVGIWSMHFTGMLALKLPTPVAYDPLTVVLSALAGMIGAVLALRPVVPLAPWIFDPSAPGWRLPVTTGEAAPRVPSCSGAGRSLQHDAQRSFQFIMTAWTRFAEPSSSP
>NC_019789.1|WP_015231486.1|395109_395688_+|hypothetical-protein
MHTRADVMDAARQALALEVLVCHQAVVTIKGSAADVPVMFDEAYEAVGALVRFVQQPPDTEPLAVTRSGIDSLIMDGESWCEILAVRDARRRVSAALRYAAHWAWHRNDAAASLNAFTPEELADIKQRAVDFAARTQGGRQDVGHDHDRRCGLHLTFRFLREGGGVPLRPLKVKPGPSARIQKRRPCLHSWG
>NC_019789.1|WP_015231485.1|391876_394543_-|EAL-domain-containing-protein
MNALTPLQEQARLAELRRYAILDTLPEDAFDRLAKQAAAHYHAPIALISLIDQDRQWFKACVGLDDREASRDVSFCAHALHADTPLIIPDATQDERFSQNPFVTGEAHIRFYAGAPIITPRGHRLGTLCVVDTQPRAFSFEDAEFLQQLAASVTSELELRNALHRLKYEKIVLQSIDDALVVLNQNWRVAMLNQAAQTLYGVTEEILGRPASELFTARWPSPEAEREVQETLARNASWTGQVTHRLRDGSERHVALTITNILAPDARQQGQLFTIRDLTEQRRRETLEQDRRVILEMAIATAPLPGVLHAVLQMIENQLPGKTAAIMRLRDGRLFNGAPSSLPAAYLAAIEGIEAGPNVGSCGAAASSKKLTITPDIMTDPKWLPYRDGARTCGLMACWSMPVLDQTGAVLGTFAVYAPAACTPTPAEVEVLQDAAQLTSLLIERDEAQKATRRQALHDPLTGLPNRTMIHELLGHALRTAVRTGEFVAVGLLDVDQFKRVNEALGQAGGDEVLRQISARLQTALPVNCTVGRVSADEFVLLAPQLSGDGALASLAQTAREVFHTPFVVEGEELFVTASAGWALFPGDSLNPEALLSLANAAMQRAKRDNLGWTRFTTGPSLPDRRTLSLRNALHRALERQELSVHFQPIVHAGDARPYSVEALLRWQHPRYGSVSPATFIPLAEESGLIMSIGEWVLHETCRELKALQVSTPGLRGQVNLSARQFSSPHLLGSIRAALEAAGLDPSLLELEITESSIMSAEDAALTMQGLRKLGVRLAVDDFGTGHSNLAYFKRFPVQTLKIDRSFVQDVGENPTGTDAMIVRTMVGLARALNLQVVAEGVETEKQASFLRDAGVDYLQGWLYARAMTGEALLHWLTERHEQVLSRP
>NC_019789.1|WP_015231484.1|390947_391841_-|diguanylate-cyclase
MHTPTDFSQILTRAVHAATNGLIVTQADGDFPILYCNPAFETLTGYPASEILGRNCRFLQGPGTDAYTRTQMREALCAGLSLDVVILNYRRDGTPFWNALNLAPIHDEQGRVTHFVGVQTDVTDRVRLQRALEKKIQTDDLTGLGSRASFLEALQLAIQHSASSPFAVGFADLDDFKRVNDSLGHEAGDELLRHVAIRLRESVRKGDLVARLAGDEFVLLLRELEDCSVVEAVAKRALQALERPFSLKGLQVRVGASLGFVVPSKGVSAVEVLSSADRAMYDAKHQGKNRFVIQDCR
>NC_019789.1|WP_041231824.1|390307_390805_+|GHKL-domain-containing-protein
MRGASKLEARKGKRRRTWTVDVDEAVVLAVLRSEVSVAQAARRRGVSERLPVVKGDPLLWCQSFENLLSNAVKYTSKREIACIGIQAEVKGESVVFSVTDNGAGFDPRFQKRLFDVFQRLHRKDQFRGAGVGLATVRRMVERHHGRIWAEGRLGERATFYLQLPR
>NC_019789.1|WP_015231482.1|389421_389952_-|hypothetical-protein
MQRITRTDNDQGIPLTVTIERTGALTTSSISIESDEEKWQFEDHNTLTQTLDWIMHDARSKAEHISTQYRNAALGGWAVTFIMPVGHNGELSIYDRWLFRKLMSCCPAFQTTWNTIEHSGSMTRILRQDDHFRVQIAPEGSPAHARTFSFKADNFTSILEHIATYTSTAAVKHAAD
>NC_019789.1|WP_015231481.1|388339_389413_-|S8-family-serine-peptidase
MRNRAVLIPLFLSLAACGQYAGFPAGSPSTPIQIQSVALGDTRVFIADGSRWWADGSRWWADGSRWWADGTRWWADGSRWWADGTFQPAPENSAAFKLIGLDRIQDLASKMGQGVIVAVIDTGVDFEHPMLKGALLPGHDYINNRQGAREEGGDHDLAYGHGSAVAGLIRQVAPAATILPMRVLSPDGSGLDKAVAQAIRDAAAQGARVINLSLGTSTSTGGVRDAIVSATEQGVIVLGASGNAGESKPQSPAWHMGNPDAAGRMSLSVGAVDQAGNAVSWSNAGSEVVAPGVNMTTAYPGQRLVNASGTSFSTPLVSGAVALALAEGANASRLSETLKSSSQQGRLDVANLMAQPK
>NC_019789.1|WP_015231480.1|385894_388288_-|EAL-domain-containing-protein
MSNRLPTPYAGHTILEEALSQCGLDDQRAMLLFEQAASIARDTRDRALLAKALNGMARIEHAHGDSHAALFHLREALELRRETHDLNGEAAILCNLGALYTDLGQYNFALDYLLKALGIIDEQSDRKRASMLAANLARVYDALEQTGSAEEHYQTALRLARESQQRIGEVILCANYGDFRRRQGHYDHAEQLLRHALECAGGEGVFPAIALHPLGLLHRDRHDRASALDAFAQAMRFAREHNDTDTLLEIILSQAETHLQCDTPELARQVLEEGVQLAEESGRNRTLGRILHLLTDALERLDQPSLALAVSRRANQVDSDVLTAEAYRQTRQLTTQYELERAKAELEAQHQKYDAQRLAKEELEREATARLRELERQALYDPLTGLPNRLLLADRFRVALELAVQQGTQLALGVIDLNKFKQINDTFGHHIGDQLLVEVARRLEVVMNGQDTVARMGGDEFVLLIRDADRPQTVLSVARRVLRAFEPVFALSGHELHVRPSVGFAVYPDDALTYEALFEQADKAMYDAKVRGSGFEIHNHQSERRAPATLESALHQALALGQFKLVYQPQTTAGGQVRGAETFLRWQHPHFGNVPPAEFLPLAEATGLSLPIGAWVLAQACQEATTWHGRMVAVNLSARQFAHPNLSRSIHEALECSGLPPHLLELEVNEEMLARHPHRARSTLQDLKALGVRVVIDDFGSGFTSFAALKHDPVDGVKIDRALVNDLQARERPGRDEALVTAVVHMAHALNLDVIAEGVENEYQQCFLASLGVTAVQGFLLAPPQPSEVFRLWMESH
>NC_019789.1|WP_041231823.1|385661_385898_-|hypothetical-protein
MSDVVRCGPDAPGPFGARDVLHPNDQLSSKKLVLRDLPAGSTVTRSPRRVRTALGSWRWVEGKVLPPTCGNDRRAANP
>NC_019789.1|WP_015231489.1|399156_400365_-|multidrug-effflux-MFS-transporter
MSLTTRTALPLSSALLTLILGALQALMPLSIDLYLPGLPTIARDLNVTSGAAQATLAVFMLGVALGQIVYGPVTDKYGRKPPLLLGLAVYVLSSVLCALAPSMTVLLAGRFLQALGASAAAVITATIVRDLWSGKALADRLSILMLIMGAAPILAPSLGGLLLTQIGWHGLFWLLAIFGVLITIIVTRLPETSSAQERAQTRLRDAATNYLSLLRNTPFLLYILTGACTAGMLFAYLTGSSFMYIDTLDVTPGVFAVLFGVNAAGLIIASQINRVLLRHFSLFAIARSAILAAVVLAGLLLAVVLSGAASVPTLTLLLFLLLATFGFIFPNIAALAFSNVKERMGSAAALQGTLQSTVGGLAGALVGVLAGSALLPVAGIITAFAVLATIFLLAAHRARPTA
>NC_019789.1|WP_015231490.1|400376_400958_-|hypothetical-protein
MTRYTQIHALTIEQPPETPTPAWPDVTEDSQGDLADANDDVMGLLPLDDLEDATFSPELEQALVAFQDSVGELRASDLSRMDGCILEPYALATARFIAFVALSDVCGMMNPAGAPFLHTSSVRRLPPHQLAFAHASPECQFECWTLQASSSPRADASEPLNACSMGKRARWSMVCNTLRNLALSRNCPYHSHP
>NC_019789.1|WP_015231491.1|401300_404915_-|PAS-domain-S-box-protein
MPDQPTAQPSFLLLDALPLPAYVSDANGAALFVNRALTLHSGVSTEELLGYGFAELIHPDDREHALTLWAREWHDGKPTQHELRLRTKNGTYHWHCVQSQPTFDRERLAYIVGTLHDIHALKDAEARVTLLHLVTARLSHAQDVPDVLKVLPDCARALHAPCATITLLKDDGLHLVGAFGYPEACLGVFRVLPHDADVPAADVLLTGQPLILPFEAFAARYPHLVSPQPPPARTLVLIPLRADGHVRGVLTVGYLEQHDVSEAERTFLLTLADVLAGTLHRVQLDVTSLETEVEHYRAVFEQAAVGVARVAFEGARFLEVNDALCRITGYLRDELLTTPWTEITHPDDVDLDLVPFRRMAAGELETYTVEKRFMHKHGHTVWTRLTLSLVRDARGRPNYEICVVEDISESKATEAQLRASEALLSAMLDALPVGVTIADATGRLLRDNTAHRELWGVPPETTRWEQYGDWVGWNPDTGDRLSAADWAMTRALLHGEIVRSELVEFQPFGDTRPPGERATLHERRYYLNNAAPIRDAEGTIIGGVVAEQDVTKQIRAERTVQENAERVQLALSAGAILGTWFWDLPSDRFTVDEGFAVNFGLDSALGREGLSLEQVIATVHPDDRPELIAAIDAAITRGGPYAHQYRVRRHDGRYYWIEANGRVDKAADGSPLSFPGVLLDAEERRAALAALRESEQRYRLAVHATNDTIWDWDLSCGHILWNEAVQFRFGYSSHEVGSSGAWWKANIHPDDRERVVAGIQAVIGGAGETWSDEYRFRRADGSYAEVHDRGAVLRDAQDRAVRMIGAMQDLTERQAAESALRESEDRLRIATEAAAIGTWDYDLLRDVLRWDTRTKALFGLSPEAEVTFETAFLAGLHPEDRSRVEAAVATALEVGGPGEYDIEYRTIGLEDGVERWIAAKGRVFFEDDRALRFIGTVIDITERKRTEARLREVTEALEWRVQERTADLMRTNAELERSNTELERFAYITSHDLIEPIRTVSSFTGLLKQRYGATLDERGQLFLDMTLKGTERMKALVDDLLTYSRISGDRVPLRSVDVRAPLSEALARLERRLTETQAHVTWGELGVVLGDGPQLAQLFQNLLGNAVKFSRAGVTPEVRVNAVRDGEWWQFSVSDNGIGIDEQYLDQIFELFRRLHTREKFEGTGLGLGICQKIVERHGGRLWATSKVGVGSTFHFTLRAAGDA
>NC_019789.1|WP_041231826.1|405549_405729_-|hypothetical-protein
MQFEAGRVSFQLDLVGYQFPHLTSQEWDSDWLRVRVRLQHAARVWKLTDPALTTFEVQG
>NC_019789.1|WP_015231494.1|405971_406415_-|DMT-family-transporter
MIWLAVLFALLAGVVVPLQAAANARLGSAAGHPAWGALISVIVTLLVLGTYVLLFRPGNVSSLIATPVPWWAWLGGLFGATYLLGLTALAPRLGTATLLGLIVLGQLLIASLLEHFGLMGMRTHPLSPGRLLGLALLIVGVVLVRRY
>NC_019789.1|WP_083865921.1|406636_406831_+|hypothetical-protein
MTTDTDAIPARRTAATQNKRHYTPQSGGTHELLEPVQLGTLTLPNRIAMAPMTRSHAFDTIPTP
>NC_019789.1|WP_041231827.1|406886_407171_+|winged-helix-turn-helix-domain-containing-protein
MLYAVLGDLKLPVGDHVYKLLIKLGFSVQKPGKKPVERDKPAIHTWSRTKGVEISKKSRGGPDACLSGRKRLQRLKVALIILAYNLKFRDLASP
>NC_019789.1|WP_015231495.1|407264_407672_+|RidA-family-protein
MNTEPQKSDIDPLTRPEVALRRPYALTRQAAGLLFISGQVGLDPETQQLVPGGFPAEFGQMMTNLQRILTEHQLTLRDLVSVNVYLTAPDDYTRLNELYLAAFDDALPTRTTVVVRALPLGATVEIQSVAALTGA
>NC_019789.1|WP_015231496.1|407677_408676_+|threonine/serine-dehydratase
MTFSELSLSALREAHARLAGGVLLTPVWHWQTGVIAEQLVPETEVWLKLELWQKTGTFKLRGALNSIEALDEAARARGVTAVSAGNHAIAVAYAAREAGVSAKVVMLQHSNPARVQACQALGAEVHLAPDVHQAFERVHTIQVHEGRTLIHPFEGPLTSQGTAGVGLEFMDQVPDLDAVIVPVGGGGLISGVAAAVKHLRPQCQVFGVEPLGADSLFQSLNAGEPVRLERVATIADSLGAPFALPYSFEVCRTFVDEVVRVSDDDLCRAMFYLFRDMKLVTEPATAAGTAALLGPLKERLNGKRVGIVACGANIDAASFDTHLERGQALVGL
>NC_019789.1|WP_041231956.1|409613_409976_+|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin
MLCVTWTIILLDEVTAWFDSLDDETTQLVTSAIDMLEERGPSLGRPMVDTLEGTNLPNLKELCPGSSGRSEIRILFVAPGILLTAGDKTGHWKRWYKEHIPIAEAHCHEGLKDDRDQEEL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_019789_1	1.1\|398464\|52\|NC_019789\|CRISPRCasFinder	398464-398515	52	NC_019789	Deinococcus peraridilitoris DSM 19664 plasmid pDEIPE01, complete sequence	398464-398515	0	1.0

1. spacer 1.1|398464|52|NC_019789|CRISPRCasFinder matches to NC_019789 (Deinococcus peraridilitoris DSM 19664 plasmid pDEIPE01, complete sequence) position: , mismatch: 0, identity: 1.0

ttggccagaacggactcgcatgagcaagcctggccgcttgggcagaacggcg	CRISPR spacer
ttggccagaacggactcgcatgagcaagcctggccgcttgggcagaacggcg	Protospacer
****************************************************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

86354 : 108408

Rhodococcus_phage(50.0%)

transposase,integrase

attL 89191:89205|attR 112041:112055

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_157449092.1\|86354_86744_-\|transposase	transposase	NA	NA	NA	NA
WP_083865900.1\|86841_87180_-\|transposase	transposase family protein	NA	NA	NA	NA
WP_015231234.1\|87440_88505_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_052326828.1\|88885_89947_-	aminopeptidase P family N-terminal domain-containing protein	NA	NA	NA	NA
89191:89205	attL	NA	NA	NA	NA
WP_015231236.1\|89943_91368_-	NAD-dependent succinate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_015231237.1\|91364_92048_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_015231238.1\|92179_93421_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_041231774.1\|93478_94375_+	sugar ABC transporter permease	NA	NA	NA	NA
WP_015231240.1\|94371_95289_+	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_015231241.1\|95285_96590_+	L-fucose isomerase	NA	NA	NA	NA
WP_157449093.1\|96586_97465_+	sugar kinase	NA	NA	NA	NA
WP_015231243.1\|97436_98468_+	tagatose 1,6-diphosphate aldolase	NA	NA	NA	NA
WP_015231244.1\|98481_100668_+	alpha-xylosidase	NA	NA	NA	NA
WP_015231245.1\|100686_101607_+	AEC family transporter	NA	NA	NA	NA
WP_015231246.1\|101755_102550_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_015231247.1\|102982_103243_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
WP_015231248.1\|103239_103647_+	PIN domain-containing protein	NA	NA	NA	NA
WP_157449139.1\|104190_104835_+\|integrase	tyrosine-type recombinase/integrase	D4P765	Rhodococcus_phage	1.4e-08	32.7
WP_015231250.1\|104930_105215_-	hypothetical protein	NA	NA	NA	NA
WP_052326829.1\|105388_106012_-	AAA family ATPase	A0A2P1A2G0	Mycobacterium_phage	4.1e-10	32.6
WP_041231778.1\|106308_106713_-	hypothetical protein	NA	NA	NA	NA
WP_015231253.1\|107307_108408_-\|transposase	IS4 family transposase	NA	NA	NA	NA
112041:112055	attR	NA	NA	NA	NA

DBSCAN-SWA_2

114926 : 177126

Mycobacterium_phage(14.29%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_157449095.1\|114926_115247_-\|transposase	transposase	NA	NA	NA	NA
WP_015231259.1\|116313_116976_+	hypothetical protein	NA	NA	NA	NA
WP_015231260.1\|117206_118190_+\|transposase	IS110 family transposase	A0A1S7J231	Thermus_phage	9.6e-22	33.2
WP_015231261.1\|118363_119140_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_041231780.1\|119160_119358_+	hypothetical protein	NA	NA	NA	NA
WP_015231262.1\|119377_120034_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	4.2e-05	36.4
WP_015231265.1\|122226_123129_-	proline iminopeptidase-family hydrolase	NA	NA	NA	NA
WP_157449140.1\|123342_124107_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_015231267.1\|124160_125666_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_015231268.1\|125675_126599_+	ABC transporter permease	NA	NA	NA	NA
WP_015231269.1\|126600_127461_+	ABC transporter permease	NA	NA	NA	NA
WP_015231270.1\|127460_129410_+	zinc carboxypeptidase	NA	NA	NA	NA
WP_157449096.1\|129630_130278_+	5-oxoprolinase subunit PxpB	NA	NA	NA	NA
WP_015231272.1\|130271_131294_+	biotin-dependent carboxyltransferase	NA	NA	NA	NA
WP_015231273.1\|131290_132058_+	LamB/YcsF family protein	NA	NA	NA	NA
WP_041231895.1\|132338_133763_+	DEAD/DEAH box helicase family protein	A0A2I5ARD8	Synechococcus_phage	5.1e-16	26.2
WP_015231275.1\|133762_135001_+	DUF790 family protein	NA	NA	NA	NA
WP_015231277.1\|135424_137473_+	type I DNA topoisomerase	A0A2K9L5F8	Tupanvirus	1.1e-83	35.9
WP_015231278.1\|137703_139095_-	serine hydrolase	G1DB24	Mycobacterium_phage	7.2e-15	28.8
WP_015231279.1\|140188_140587_-	hypothetical protein	NA	NA	NA	NA
WP_015231280.1\|140573_140966_-	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_041231898.1\|141088_141901_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_015231282.1\|141956_142211_+	DUF3006 domain-containing protein	NA	NA	NA	NA
WP_015231283.1\|142207_143200_+	excalibur calcium-binding domain-containing protein	Q0H255	Geobacillus_phage	8.2e-29	32.7
WP_041231899.1\|144003_144798_+	nucleotidyltransferase domain-containing protein	NA	NA	NA	NA
WP_015231286.1\|144921_145059_-	hypothetical protein	NA	NA	NA	NA
WP_015231287.1\|145036_145543_-	hypothetical protein	NA	NA	NA	NA
WP_015231288.1\|145539_146037_-	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_015231289.1\|146233_146989_-	hypothetical protein	A0A1X9SGN6	Bradyrhizobium_phage	3.3e-22	42.6
WP_015231290.1\|147218_147437_+	hypothetical protein	NA	NA	NA	NA
WP_169316626.1\|147505_151411_-	UvrD-helicase domain-containing protein	Q9DSV4	Diadromus_pulchellus_ascovirus	1.9e-20	31.3
WP_169316627.1\|151422_151875_-	hypothetical protein	NA	NA	NA	NA
WP_052326834.1\|152807_153089_-\|transposase	transposase	U5P429	Shigella_phage	7.5e-12	42.0
WP_052326835.1\|153987_154620_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	4.7e-30	37.6
WP_015231291.1\|154597_154912_-\|transposase	transposase	A9YX41	Burkholderia_phage	3.4e-05	38.5
WP_157449097.1\|155261_155696_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_041231787.1\|155873_156353_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_015231293.1\|157529_157847_+	hypothetical protein	NA	NA	NA	NA
WP_015231294.1\|157908_159534_+\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_015231295.1\|159522_160158_-	plasmid pRiA4b ORF-3 family protein	A0A2H4PDG5	Mycobacterium_phage	4.7e-30	39.3
WP_157449142.1\|160111_160699_+	hypothetical protein	NA	NA	NA	NA
WP_083865905.1\|161067_161838_-\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	1.4e-20	44.0
WP_015231298.1\|161981_162362_-	hypothetical protein	NA	NA	NA	NA
WP_015231299.1\|162404_163700_-\|transposase	IS701 family transposase	NA	NA	NA	NA
WP_015231300.1\|164354_165221_-	serine hydrolase	NA	NA	NA	NA
WP_015231301.1\|165270_166086_-	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_015231302.1\|166239_167289_-	dipeptide epimerase	NA	NA	NA	NA
WP_015231303.1\|167285_168188_-	C40 family peptidase	A0A2P0ZLG0	Lactobacillus_phage	1.0e-06	29.6
WP_015231304.1\|168184_169294_-	M20/M25/M40 family metallo-hydrolase	NA	NA	NA	NA
WP_015231305.1\|169300_170170_-	ABC transporter permease	NA	NA	NA	NA
WP_015231306.1\|170166_171084_-	ABC transporter permease	NA	NA	NA	NA
WP_015231307.1\|171080_172670_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_157449098.1\|172845_173052_+\|transposase	transposase	NA	NA	NA	NA
WP_041231789.1\|173048_174233_+\|transposase	IS701 family transposase	NA	NA	NA	NA
WP_015231308.1\|174444_175014_+	helix-turn-helix domain containing protein	NA	NA	NA	NA
WP_083865778.1\|175010_175577_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_015231310.1\|176025_177126_+\|transposase	IS4 family transposase	NA	NA	NA	NA

DBSCAN-SWA_3

189600 : 242565

Leptospira_phage(20.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_083865908.1\|189600_189984_-\|transposase	transposase	NA	NA	NA	NA
WP_157449101.1\|191178_191316_-	hypothetical protein	NA	NA	NA	NA
WP_041231796.1\|191933_192842_+	radical SAM protein	NA	NA	NA	NA
WP_015231331.1\|192838_193270_+	hypothetical protein	NA	NA	NA	NA
WP_157449143.1\|193239_194190_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	3.2e-30	32.3
WP_015231333.1\|194087_194357_-\|transposase	transposase	NA	NA	NA	NA
WP_052326841.1\|194460_195135_+	Fic family protein	NA	NA	NA	NA
WP_157449144.1\|195114_195297_-	hypothetical protein	NA	NA	NA	NA
WP_015231335.1\|195948_197793_-	discoidin domain-containing protein	NA	NA	NA	NA
WP_015231336.1\|198400_199573_-	diaminopropionate ammonia-lyase	NA	NA	NA	NA
WP_015231337.1\|199590_200727_-	ArgE/DapE family deacylase	NA	NA	NA	NA
WP_041230670.1\|201056_201575_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_157448751.1\|201610_202018_-	winged helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_015231339.1\|202564_203950_-	class I SAM-dependent methyltransferase	A0A2K9L0U7	Tupanvirus	2.1e-38	34.1
WP_052326878.1\|204639_205842_-	membrane dipeptidase	NA	NA	NA	NA
WP_015231342.1\|206033_206882_-	ABC transporter permease	NA	NA	NA	NA
WP_157449145.1\|206883_207843_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_015231344.1\|207843_209382_-	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_015231345.1\|209416_211165_-	M28 family peptidase	NA	NA	NA	NA
WP_015231346.1\|211236_212016_+	IclR family transcriptional regulator	NA	NA	NA	NA
WP_015231347.1\|212694_213432_+	DUF1028 domain-containing protein	NA	NA	NA	NA
WP_015231348.1\|213494_215012_+	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_015231349.1\|215024_215969_+	ABC transporter permease	NA	NA	NA	NA
WP_015231350.1\|215965_216829_+	ABC transporter permease	NA	NA	NA	NA
WP_015231351.1\|216877_218911_+	S9 family peptidase	NA	NA	NA	NA
WP_015231352.1\|219469_220735_-	FAD-binding protein	NA	NA	NA	NA
WP_015231353.1\|220904_222059_-	MFS transporter	NA	NA	NA	NA
WP_083865911.1\|222433_222703_-	HNH endonuclease	A0A2I7QIM4	Bacillus_phage	1.3e-08	60.5
WP_157449102.1\|222749_222878_+\|transposase	Tn3 family transposase	NA	NA	NA	NA
WP_041231798.1\|222908_223118_+\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	2.0e-09	54.2
WP_015231354.1\|223241_224225_+	aldo/keto reductase	NA	NA	NA	NA
WP_015231355.1\|224661_225615_-	secreted hydrolase	NA	NA	NA	NA
WP_015231356.1\|225792_227808_+	DUF4158 domain-containing protein	Q1MVP5	Enterobacteria_phage	2.0e-98	35.2
WP_041231799.1\|230956_231928_+	hypothetical protein	NA	NA	NA	NA
WP_015231357.1\|232337_232823_-	hypothetical protein	NA	NA	NA	NA
WP_041231800.1\|233005_233338_+	hypothetical protein	NA	NA	NA	NA
WP_015231360.1\|237539_238640_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_083865935.1\|238650_238986_-\|transposase	transposase	NA	NA	NA	NA
WP_041231925.1\|239000_239411_-\|transposase	transposase family protein	NA	NA	NA	NA
WP_015231361.1\|239887_240274_-	hypothetical protein	NA	NA	NA	NA
WP_041231803.1\|240286_241879_-	hypothetical protein	NA	NA	NA	NA
WP_041231804.1\|242097_242565_+\|transposase	IS1182 family transposase	NA	NA	NA	NA

DBSCAN-SWA_4

272231 : 301432

Salmonella_phage(16.67%)

integrase,transposase

attL 283544:283559|attR 310042:310057

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_041231808.1\|272231_272561_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_157449106.1\|272679_273615_-\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	1.6e-34	34.2
WP_157449107.1\|274315_275350_-	DUF4158 domain-containing protein	NA	NA	NA	NA
WP_052326853.1\|275369_275669_-	DUF4158 domain-containing protein	NA	NA	NA	NA
WP_015231386.1\|276725_280064_+	GAF domain-containing protein	NA	NA	NA	NA
WP_015231388.1\|280146_280524_+	response regulator	NA	NA	NA	NA
WP_157449108.1\|280604_280925_-\|transposase	transposase	NA	NA	NA	NA
283544:283559	attL	NA	NA	NA	NA
WP_015231390.1\|284580_285522_+\|integrase	site-specific integrase	W8EHC2	Mycobacterium_phage	2.7e-05	26.4
WP_052326854.1\|285740_285938_+	hypothetical protein	NA	NA	NA	NA
WP_083865918.1\|285915_286266_+	RtcB family protein	NA	NA	NA	NA
WP_015231392.1\|286724_287519_-\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	7.5e-25	44.2
WP_015231393.1\|287894_288206_+	hypothetical protein	NA	NA	NA	NA
WP_157449147.1\|288307_289387_+	ABC transporter permease	NA	NA	NA	NA
WP_015231395.1\|289579_289972_-	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
WP_015231396.1\|289968_290220_-	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
WP_157449148.1\|290535_291534_+\|integrase	tyrosine-type recombinase/integrase	S5M9V8	Brevibacillus_phage	2.3e-07	25.3
WP_015231399.1\|292162_292537_-	hypothetical protein	NA	NA	NA	NA
WP_052326856.1\|292948_295207_+	bifunctional diguanylate cyclase/phosphodiesterase	NA	NA	NA	NA
WP_015231401.1\|295887_298026_+	cadmium-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	7.5e-128	40.0
WP_041231810.1\|298069_298450_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_015231403.1\|298689_299781_-\|transposase	transposase	NA	NA	NA	NA
WP_015231405.1\|300268_301432_+\|integrase	site-specific integrase	A0A1B0T6A8	Bacillus_phage	8.1e-36	28.0
310042:310057	attR	NA	NA	NA	NA

DBSCAN-SWA_5

410455 : 453282

Bacillus_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015231499.1\|410455_411310_-\|transposase	IS256 family transposase	A0A218MND5	uncultured_virus	7.1e-05	56.5
WP_015231500.1\|411402_411876_+	hypothetical protein	NA	NA	NA	NA
WP_015231501.1\|412711_412993_+	HNH endonuclease	A0A2I7QIM4	Bacillus_phage	1.7e-08	62.8
WP_015231502.1\|413027_414653_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_157449120.1\|414686_414830_+	hypothetical protein	NA	NA	NA	NA
WP_041231832.1\|415109_415523_-	hypothetical protein	NA	NA	NA	NA
WP_157449121.1\|416141_418175_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_015231506.1\|419730_422550_-	PAS domain S-box protein	W8CYF6	Bacillus_phage	1.9e-14	27.0
WP_015231507.1\|423429_424143_+\|transposase	IS1 transposase	NA	NA	NA	NA
WP_083865923.1\|424135_424624_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	1.2e-12	36.3
WP_015231508.1\|424660_425110_-	response regulator	NA	NA	NA	NA
WP_157449122.1\|425514_425679_+	hypothetical protein	NA	NA	NA	NA
WP_052326866.1\|425890_426403_-	ATP-binding protein	Q8QKW6	Ectocarpus_siliculosus_virus	2.9e-06	34.2
WP_157449123.1\|426399_426672_-	hypothetical protein	NA	NA	NA	NA
WP_169316629.1\|426656_426932_-	hypothetical protein	NA	NA	NA	NA
WP_041231835.1\|426928_427561_-	PAS domain-containing protein	NA	NA	NA	NA
WP_083865924.1\|427781_428567_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_015231509.1\|429359_430286_+	hypothetical protein	NA	NA	NA	NA
WP_015231510.1\|430708_433459_+	GAF domain-containing protein	NA	NA	NA	NA
WP_015231511.1\|433455_433911_+	response regulator	NA	NA	NA	NA
WP_157449124.1\|433907_434270_+	response regulator	NA	NA	NA	NA
WP_015231513.1\|434411_434714_+	hypothetical protein	NA	NA	NA	NA
WP_015231514.1\|434830_436471_-	PAS domain-containing protein	NA	NA	NA	NA
WP_157449125.1\|436996_437494_+	hypothetical protein	NA	NA	NA	NA
WP_015231260.1\|438765_439749_+\|transposase	IS110 family transposase	A0A1S7J231	Thermus_phage	9.6e-22	33.2
WP_015231519.1\|440307_442212_-	hypothetical protein	NA	NA	NA	NA
WP_041231837.1\|443991_444333_-	hypothetical protein	NA	NA	NA	NA
WP_157449126.1\|450531_451323_-	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_157449127.1\|451640_452171_-\|transposase	transposase	NA	NA	NA	NA
WP_083865925.1\|452508_453282_-\|transposase	ISL3 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NC_019790

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

17626 : 58872

Bacillus_virus(12.5%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_083865941.1\|17626_18622_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_015231471.1\|19049_19697_+	HAD hydrolase-like protein	NA	NA	NA	NA
WP_157449174.1\|19806_20022_-\|transposase	transposase	NA	NA	NA	NA
WP_157449184.1\|20535_20877_-	hypothetical protein	NA	NA	NA	NA
WP_015231645.1\|21723_23229_+	diguanylate cyclase	G3MA91	Bacillus_virus	8.7e-14	41.0
WP_157449175.1\|23385_23757_-\|transposase	transposase	NA	NA	NA	NA
WP_083865938.1\|24290_25097_-\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_041232012.1\|25366_25948_+	SMI1/KNR4 family protein	NA	NA	NA	NA
WP_015231647.1\|26320_26890_-	dihydrofolate reductase	NA	NA	NA	NA
WP_041231996.1\|26951_27533_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_015231649.1\|27638_28535_+	phosphotransferase	NA	NA	NA	NA
WP_041232014.1\|28765_29575_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_015231651.1\|30124_33286_+	GAF domain-containing protein	W8CYF6	Bacillus_phage	5.3e-13	27.8
WP_015231652.1\|33282_33765_+	response regulator	NA	NA	NA	NA
WP_083865939.1\|33756_34008_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_015231653.1\|34013_36578_-	PAS domain-containing protein	A0A1V0SGX0	Hokovirus	2.6e-10	25.8
WP_015231654.1\|36574_37192_-	recombinase family protein	W6CWV1	Ralstonia_phage	2.3e-37	45.0
WP_157449176.1\|37446_38274_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	8.1e-30	32.0
WP_015231656.1\|38294_38564_-\|transposase	transposase	NA	NA	NA	NA
WP_041231997.1\|39299_40436_-	Fic family protein	NA	NA	NA	NA
WP_157449177.1\|40728_41433_-	recombinase family protein	A0A1B1IWV2	uncultured_Mediterranean_phage	1.3e-31	42.6
WP_015231660.1\|41736_41997_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
WP_015231661.1\|41993_42401_+	PIN domain-containing protein	NA	NA	NA	NA
WP_015231662.1\|42593_43226_+	ParA family protein	NA	NA	NA	NA
WP_157449178.1\|43326_43485_+	hypothetical protein	NA	NA	NA	NA
WP_157449179.1\|44381_45116_+	hypothetical protein	NA	NA	NA	NA
WP_015231308.1\|45272_45842_+	helix-turn-helix domain containing protein	NA	NA	NA	NA
WP_083865778.1\|45838_46405_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_015231665.1\|46552_48325_+	ParB N-terminal domain-containing protein	NA	NA	NA	NA
WP_157449185.1\|48387_48747_+	hypothetical protein	NA	NA	NA	NA
WP_015231667.1\|48854_49889_+	bifunctional DNA primase/polymerase	A0A173H0P8	Pseudoalteromonas_phage	1.7e-05	32.1
WP_015231668.1\|49986_50214_+	hypothetical protein	NA	NA	NA	NA
WP_157449180.1\|50455_50857_+	hypothetical protein	NA	NA	NA	NA
WP_157449181.1\|51080_51335_+	hypothetical protein	NA	NA	NA	NA
WP_015231672.1\|52181_52643_+	hypothetical protein	NA	NA	NA	NA
WP_015231673.1\|53364_53853_+	DnaJ domain-containing protein	I6WMN0	Aeromonas_phage	9.0e-05	45.0
WP_015231675.1\|54040_54214_+	hypothetical protein	NA	NA	NA	NA
WP_015231676.1\|54210_54726_+	hypothetical protein	NA	NA	NA	NA
WP_015231678.1\|55896_56325_+	TIR domain-containing protein	NA	NA	NA	NA
WP_015231360.1\|56269_57370_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_015231679.1\|57397_57667_-	HD domain-containing protein	NA	NA	NA	NA
WP_015231680.1\|57855_58872_+\|transposase	IS4 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NC_019793

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_019793_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_019793_1

2503904-2504262

Orphan

Consensus_repeat	Method
GGTGGTTTCCGNCCCCGTGAAGACCG	CRT

7 spacers

The CRISPR arrays of NC_019793_1

>merge|NC_019793|1|2503904-2504262|CRT
GGTGGTTTCCGTACCCGCGAAGACCGCAACGACCGAGGCAGTGACCGTGGTGGTTTCCGTCCCCGTGAAGATCGCGGCGCCGCGCCGCGTGAAGGTGGTTTCCGTCCCCGTGAAGACCGTGGCGGCGACCGAGGCAATGACCGTGGTGGTTTCCGCCCGCGTGAAGACCGTGGTGGCGCTCCGCGTGAAGGTGGGTTTCGCCCCCGCGAAGACCGCAACGACCGAGGCAGTGACCGTGGTGGTTTCCGTCCCCGTGAAGACCGCGGCGCCGCGCCGCGTGAAGGTGGTTTCCGTCCCCGTGAAGACCGTGGTGGCGACCGAGGCAATGACCGTGGTGGTTTCCGCCCGCGTGAAGACCG

>NC_019793|1|1|2503904-2504262|CRT
GGTGGTTTCCGTACCCGCGAAGACCG	CAACGACCGAGGCAGTGACCGT
GGTGGTTTCCGTCCCCGTGAAGATCG	CGGCGCCGCGCCGCGTGAA
GGTGGTTTCCGTCCCCGTGAAGACCG	TGGCGGCGACCGAGGCAATGACCGT
GGTGGTTTCCGCCCGCGTGAAGACCG	TGGTGGCGCTCCGCGTGAA
GGTGGGTTTCGCCCCCGCGAAGACCG	CAACGACCGAGGCAGTGACCGT
GGTGGTTTCCGTCCCCGTGAAGACCG	CGGCGCCGCGCCGCGTGAA
GGTGGTTTCCGTCCCCGTGAAGACCG	TGGTGGCGACCGAGGCAATGACCGT
GGTGGTTTCCGCCCGCGTGAAGACCG

Protein	Signature genes	Signature genes Name	Protein_function
NC_019793.1\|WP_015236268.1\|2506541_2506775_+\|50S-ribosomal-protein-L28	unknown	unknown	gnl\|CDD\|272851
NC_019793.1\|WP_015236270.1\|2509136_2509466_-\|hypothetical-protein	unknown	unknown	unknown
NC_019793.1\|WP_052326789.1\|2493970_2494681_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|223498
NC_019793.1\|WP_015236259.1\|2494836_2495595_+\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|224423
NC_019793.1\|WP_015236271.1\|2509570_2510260_+\|LexA-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|119397
NC_019793.1\|WP_015236273.1\|2510615_2511671_-\|DNA-topoisomerase-IB	unknown	unknown	gnl\|CDD\|226099
NC_019793.1\|WP_157448852.1\|2505277_2505478_+\|hypothetical-protein	unknown	unknown	unknown
NC_019793.1\|WP_015236262.1\|2496785_2497433_+\|rhomboid-family-intramembrane-serine-protease	unknown	unknown	gnl\|CDD\|223777
NC_019793.1\|WP_041231483.1\|2497726_2498002_+\|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein	unknown	unknown	gnl\|CDD\|225170
NC_019793.1\|WP_015236276.1\|2512481_2513147_-\|phosphatase-PAP2-family-protein	unknown	unknown	gnl\|CDD\|239486
NC_019793.1\|WP_041231484.1\|2498710_2499178_+\|S-ribosylhomocysteine-lyase	unknown	unknown	gnl\|CDD\|179399
NC_019793.1\|WP_015236274.1\|2511907_2512264_+\|(2Fe-2S)-binding-protein	unknown	unknown	gnl\|CDD\|223706
NC_019793.1\|WP_015236257.1\|2493440_2493713_-\|hypothetical-protein	unknown	unknown	unknown
NC_019793.1\|WP_015236266.1\|2502695_2503496_-\|polyphosphate-kinase-2-family-protein	unknown	unknown	gnl\|CDD\|274737
NC_019793.1\|WP_015236272.1\|2510281_2510524_-\|hypothetical-protein	unknown	unknown	unknown
NC_019793.1\|WP_015236261.1\|2496548_2496782_+\|hypothetical-protein	unknown	unknown	unknown
NC_019793.1\|WP_157448853.1\|2512275_2512464_-\|hypothetical-protein	unknown	unknown	unknown
NC_019793.1\|WP_157449018.1\|2495747_2496470_+\|endonuclease-III	unknown	unknown	gnl\|CDD\|223255
NC_019793.1\|WP_052326790.1\|2498106_2498649_-\|signal-peptidase-II	unknown	unknown	gnl\|CDD\|237814
NC_019793.1\|WP_052326697.1\|2507072_2509100_+\|tetratricopeptide-repeat-protein	unknown	unknown	gnl\|CDD\|225971

Protein	Function_ID	Function_description	E-value
NC_019793.1\|WP_015236268.1\|2506541_2506775_+\|50S-ribosomal-protein-L28	gnl\|CDD\|272851	TIGR00009, 50S_ribosomal_protein_L28, ribosomal protein L28. This model describes bacterial and chloroplast forms of the 50S ribosomal protein L28, a polypeptide about 60 amino acids in length. Mitochondrial homologs differ substantially in architecture (e.g. SP\|P36525 from Saccharomyces cerevisiae, which is 258 amino acids long) and are not included. [Protein synthesis, Ribosomal proteins: synthesis and modification].	1.49977e-10
NC_019793.1\|WP_052326789.1\|2493970_2494681_-\|hypothetical-protein	gnl\|CDD\|223498	COG0421, SpeE, Spermidine synthase [Amino acid transport and metabolism].	8.90444e-25
NC_019793.1\|WP_015236259.1\|2494836_2495595_+\|alpha/beta-fold-hydrolase	gnl\|CDD\|224423	COG1506, DAP2, Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism].	3.41117e-10
NC_019793.1\|WP_015236274.1\|2511907_2512264_+\|(2Fe-2S)-binding-protein	gnl\|CDD\|223706	COG0633, Fdx, Ferredoxin [Energy production and conversion].	4.49821e-14
NC_019793.1\|WP_015236273.1\|2510615_2511671_-\|DNA-topoisomerase-IB	gnl\|CDD\|226099	COG3569, COG3569, Topoisomerase IB [DNA replication, recombination, and repair].	4.52106e-102
NC_019793.1\|WP_015236262.1\|2496785_2497433_+\|rhomboid-family-intramembrane-serine-protease	gnl\|CDD\|223777	COG0705, COG0705, Membrane associated serine protease [Amino acid transport and metabolism].	1.26738e-31
NC_019793.1\|WP_015236271.1\|2509570_2510260_+\|LexA-family-transcriptional-regulator	gnl\|CDD\|119397	cd06529, S24_LexA-like, Peptidase S24 LexA-like proteins are involved in the SOS response leading to the repair of single-stranded DNA within the bacterial cell. This family includes: the lambda repressor CI/C2 family and related bacterial prophage repressor proteins; LexA (EC 3.4.21.88), the repressor of genes in the cellular SOS response to DNA damage; MucA and the related UmuD proteins, which are lesion-bypass DNA polymerases, induced in response to mitogenic DNA damage; RulA, a component of the rulAB locus that confers resistance to UV, and RuvA, which is a component of the RuvABC resolvasome that catalyzes the resolution of Holliday junctions that arise during genetic recombination and DNA repair. The LexA-like proteins contain two-domains: an N-terminal DNA binding domain and a C-terminal domain (CTD) that provides LexA dimerization as well as cleavage activity. They undergo autolysis, cleaving at an Ala-Gly or a Cys-Gly bond, separating the DNA-binding domain from the rest of the protein. In the presence of single-stranded DNA, the LexA, UmuD and MucA proteins interact with RecA, activating self cleavage, thus either derepressing transcription in the case of LexA or activating the lesion-bypass polymerase in the case of UmuD and MucA. The LexA proteins are serine proteases that carry out catalysis using a serine/lysine dyad instead of the prototypical serine/histidine/aspartic acid triad found in most serine proteases. LexA sequence homologs are found in almost all of the bacterial genomes sequenced to date, covering a large number of phyla, suggesting both, an ancient origin and a widespread distribution of lexA and the SOS response.	1.31603e-14
NC_019793.1\|WP_015236276.1\|2512481_2513147_-\|phosphatase-PAP2-family-protein	gnl\|CDD\|239486	cd03392, PAP2_like_2, PAP2_like_2 proteins. PAP2 is a super-family of phosphatases and haloperoxidases. This subgroup, which is specific to bacteria, lacks functional characterization and may act as a membrane-associated lipid phosphatase.	1.78551e-37
NC_019793.1\|WP_041231484.1\|2498710_2499178_+\|S-ribosylhomocysteine-lyase	gnl\|CDD\|179399	PRK02260, PRK02260, S-ribosylhomocysteine lyase.	1.33623e-81
NC_019793.1\|WP_041231483.1\|2497726_2498002_+\|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein	gnl\|CDD\|225170	COG2261, COG2261, Predicted membrane protein [Function unknown].	4.41226e-07
NC_019793.1\|WP_015236266.1\|2502695_2503496_-\|polyphosphate-kinase-2-family-protein	gnl\|CDD\|274737	TIGR03709, PPK2_rel_1, polyphosphate:nucleotide phosphotransferase, PPK2 family. Members of this protein family belong to the polyphosphate kinase 2 (PPK2) family, which is not related in sequence to PPK1. While PPK1 tends to act in the biosynthesis of polyphosphate, or poly(P), members of the PPK2 family tend to use the terminal phosphate of poly(P) to regenerate ATP or GTP from the corresponding nucleoside diphosphate, or ADP from AMP as is the case with polyphosphate:AMP phosphotransferase (PAP). Members of this protein family most likely transfer the terminal phosphate between poly(P) and some nucleotide, but it is not clear which. [Central intermediary metabolism, Phosphorus compounds].	4.69207e-143
NC_019793.1\|WP_157449018.1\|2495747_2496470_+\|endonuclease-III	gnl\|CDD\|223255	COG0177, Nth, Predicted EndoIII-related endonuclease [DNA replication, recombination, and repair].	7.4105e-61
NC_019793.1\|WP_052326790.1\|2498106_2498649_-\|signal-peptidase-II	gnl\|CDD\|237814	PRK14777, PRK14777, lipoprotein signal peptidase; Provisional.	2.08021e-61
NC_019793.1\|WP_052326697.1\|2507072_2509100_+\|tetratricopeptide-repeat-protein	gnl\|CDD\|225971	COG3437, COG3437, Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription / Signal transduction mechanisms].	2.89344e-71

>NC_019793.1|WP_015236266.1|2502695_2503496_-|polyphosphate-kinase-2-family-protein
MTWESYRVRPGPVQLQDWPTSDGSALSRPEAEARSAEVLGLLSDLQERLYAEGQQSLLIILQARDAGGKDGTVKHVFSGLNPQGIRVVSFKVPTLQERAHDFLWRIHAQVPAAGEIVVFNRSHYEDVLVPRVHAHTDLATIQERLEFIRAFEQLLHSRGTRILKFYLHISPEEQLKRLKKRLENPQKHWKFDPGDLIERARWNDYTLAYEAAISITSTESAPWYIIPADQKWFRNLTISECILHRLQEMNPRFPTPSFDPLTVAIE
>NC_019793.1|WP_041231484.1|2498710_2499178_+|S-ribosylhomocysteine-lyase
MANVESFDLDHTKVYAPYVRLAGAKRTPRGDAISKYDLRLLQPNQGAISPSALHTLEHLLAGYLRDHLEDVIDVSPMGCRTGMYMSVLGEADEEGVLVAFRAALQDVAEHDRPIPGVSELECGNYRDHDLAQARIHAREALEAGLKIQPTLLIER
>NC_019793.1|WP_052326790.1|2498106_2498649_-|signal-peptidase-II
MTNRDLHASARPEAASRLWVPLTLFAVLLLADQWLKWWSEANLQFGQPVDVLIPGLLGLTLTYNTGAAWSLLSGAALPLALGRLLVGLGILVYLVRRPQPPVLAVSLGMIAAGAVGNAIDGLRAGKVTDMLSSPALDAVTRTIHGQPFPIFNIADSAVVVGVLLLLISSVLPGQAGGVKN
>NC_019793.1|WP_041231483.1|2497726_2498002_+|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein
MSWIVAILVGAFCGWIASIVMRTNAQQGALANIVIGIVGAILARLIFGDLLGIGSAGATNAAAGFSFWNVIWGIVGSIVLIAILKALRVLR
>NC_019793.1|WP_015236262.1|2496785_2497433_+|rhomboid-family-intramembrane-serine-protease
MFPLYDDNRSGRVPWVTRTLIVLNILIFGYEFTLSEGELNRFIVQFGFIPASLGENLAQAGFSTLTSQFLHGGVMHLLGNVWFLWIFGDNIEDRYGHLPFLGLYLLWGVAAALSQAFFGEDPTVPMIGASGAISGVLGAYLVTYPRARIRTFVPIFIIFLLPWVRALIFLPYWLIIQIFSSQSGDSGVAFLAHIGGFVAGAVVALLPWSPAKRLL
>NC_019793.1|WP_015236261.1|2496548_2496782_+|hypothetical-protein
MSQLPDLNEIMRQVIDLARQARRLARAGHNEVAARSAEHFEQGAATAYRNQNREQLENNLAAVRALVDQLRARLPGA
>NC_019793.1|WP_157449018.1|2495747_2496470_+|endonuclease-III
MDARQAPGARTFNFSGLDQKALEVHRRLLEAYGERAHEARREPMHELISTILSQRTNWRNEDLAYRRMMERFVSWEGVEQADVTALAEAISPSNFAEVKAPNIQRTLRAIREARGEYNIDFLADLPVEEGLRWLLALPGVGLKTATLVLLFCFRKSVLPVDTHVHRVSQRVGLIGPKVMHEAAHRLLLALLPPEPALLYNFHLNLLTHGQKICTFSRPRCSKCVLREVCDYYHDPTTEKY
>NC_019793.1|WP_015236259.1|2494836_2495595_+|alpha/beta-fold-hydrolase
MPAQLLLQTDHEHEVAGGRRVSVTFGATRTEIPGVLLLPASGTPTAGVLLLHGYSSHKEAMSETVGQALLRRQIASLAIDLPLHGARADPLRLYSLRQPQEVMGVWRQALRDATLGLRLLQEQPDIRAPHLAVMGYSLGSFLALMLAARESQVSSVVLAAGGDLPLGTPLTPIARMVADPLRAVRRLAGRPLLMVSGRHDRTVRPEQAERLYAAAREPKELRWYDVGHILPPVAVEEAAAWLRRQLPERVEE
>NC_019793.1|WP_052326789.1|2493970_2494681_-|hypothetical-protein
MKHWILLGRTDVPGSVEELRLMQRGEEFSIVLAQGGELMNSRVHASEDALAHLACALIAERAQPRVLIGGLGMGFTLAAALRTLPDTAEVTVAELVSGLVEWNRGPLGACAGHPLLDHRVRLHVGDVGQLLRAQTSAFDAIVLDVDNGPEGLTRPGNDQLYSAAGLRAAAQALRTGGVLAVWSAHRSEVFTRRLRQEGFHVEEHTVRARPGAKGARHTIWLAERRFGAPSRSSTRG
>NC_019793.1|WP_015236257.1|2493440_2493713_-|hypothetical-protein
MWSDAYSERAASEVRELLVHIQRHHDLPANLPRLTELMHTLALQLTHHPSPAEDVEYVLNGGPGALDHVLQRYRQEQLMIFGKLVSNDRD
>NC_019793.1|WP_157448852.1|2505277_2505478_+|hypothetical-protein
MTVTDRIGLLLERPDLVGAATLTGTLTGVRTTAADEARTAGTAGTLAGVLYTGAGLLALLGGMAAR
>NC_019793.1|WP_015236268.1|2506541_2506775_+|50S-ribosomal-protein-L28
MAKKCFVTGKSGMVVNSVIRRGKAKAQGGVGRKVTGVTKHRQKANLQKKTVIVDGEVKRVWLSTKALRRLPENIQVI
>NC_019793.1|WP_052326697.1|2507072_2509100_+|tetratricopeptide-repeat-protein
MLAEAAEALDRDSREAERLALAAREVAVTHDLLGEAAWALFVAGQAAWRQGAVMRATEAMESSFELFRVVGRWLDAARVQLSLGGWRSASEQYETAVEAAEMALVFAEQDGDPKVQAEALELLAHIRQRQDRSQDAWRLLERALTLYRSSGDVPTQVRCLGKLGDTLNALGDDAPALSHLLEAERLVREGQSDESCDDSSLKAALLIRLGGLYRKLGDLQRSQAALQEALTLSQGGQNRSHEMVSHETVATLELGQLQLALNAPEQAQVSLQRGLALARLHALRAQEFAALGGLGKLHALRGDLMEAAAAHREAAEVARGVTDAAGEASALLDLARVHLSLQQVHSAHGVLQRALALVGDPAWKTAPLEIHELLAHTCALLGDFQAALAHHRHFHVLDQQRFDGYTTRRASRLTDALELERARHDAEVYRLRTEAARQARAEAEGQVRDRTLELEHSQLEAFTRLALAGEYRDDETGQHTWRVGQYTASIARAMGLPDEQVDLLGVAARLHDVGKIGIPDAILLKPGKFTPEEYERMKTHTIIGARLLSGSRSTLLQLAEVIAWTHHERWDGQGYPHGLADEAIPLPGRIVAVADVFDALTHARTYKPAWTHQAALDELMKQKGAQFDPQVVEAALGVFSTSGFFEGLERDQTAQQSSLARGAARPPGAARPESR
>NC_019793.1|WP_015236270.1|2509136_2509466_-|hypothetical-protein
MPPVAPSLFTLLLTAFLAAFITQLARQLMKETLPRMRRTLATAFSAGIASVATVALMLEWFTVSHVALLGISCIVGWSGAGVLTTLGIALEHGLGVDDTRTKPRHKRGP
>NC_019793.1|WP_015236271.1|2509570_2510260_+|LexA-family-transcriptional-regulator
MSSANPNEVAVWLRELRVRLRLRQDQVEAHSATIGESCRISQSYLSKLERGTKTLSSLTPQKMNALRLIYRVSPEEWASHTGLSVVTGHGEDDVVGGLEFVRVPVHALAAAGLPLSEDGSSIIDTELVPREEFKNGMVVLEVQGESMTSSDGGLRHGDRIYVDVNDLELREGKVYVLHVQGGGILVKRVRRFDGDFWLTSDNPEFPPIRPDQVTLVGRVYYHQPRGRRL
>NC_019793.1|WP_015236272.1|2510281_2510524_-|hypothetical-protein
MRSDRGWEQAGPAEQQATWQRLLQERLRAHLPSSRPAGLSQRQWMSYVVRACEQAEREATDELLFTQPRTYSLEELLTDP
>NC_019793.1|WP_015236273.1|2510615_2511671_-|DNA-topoisomerase-IB
MTSRTELLQDEYLRREGSKVDEFRYFYPDGTELTDQAALARIARLAVPPAYQEVFVSPDPDAELQAFGRDAAGRLQYRYHPDFLQAGALRKWQRLARFAFALPQLRQLTTADLRRAELPPRKVLALMTRLLYVAHFRVGSDAYATRHKTYGLSTLHKRHVKVVGNTVEFHFKGKHGIWQHKALTDRTLAANIEKLLALPGRFLFQARGEQGVTRVRSAELNAYIRELIGPFTAKDFRTWGGTLLAGEYLAEAGVAASEREARKTVVECVKVVAADLGNTPAVVRAHYICPVIFDRYFEGRILDDFEPRSSRGVNALEGLSRSELALQRMLDAEHRPDGRPRRAARTPSKAA
>NC_019793.1|WP_015236274.1|2511907_2512264_+|(2Fe-2S)-binding-protein
MPKLNVQGYGEFEVGASERLVLALERVGVDILHRCGGQARCTSCRVEFMEGEPERMTQAERSVLEAKGLLGQARLSCQMLCDHDMSLRPVQTVASSGLESGKTPAGQIEPEPVWDSGA
>NC_019793.1|WP_157448853.1|2512275_2512464_-|hypothetical-protein
MTWLRRRNALWERLRAAETSSPEFEETLDELQALIHWPRERILAGLGFPGETPGPTTDRSDS
>NC_019793.1|WP_015236276.1|2512481_2513147_-|phosphatase-PAP2-family-protein
MKEHLVHLGQLLKTHWRALSILALTVLVPLFLFADIAEDVYEQETLAVDEAIMRFVHGFTSDPANHAAAAFSIFGSAKLMLPIAVTLFVVYFRRRRRLGWFVLLALGGVASVNFALKQFFDRPRPDLWVPFLPETDSSFPSGHSMFASALACTLIVLLWSARFRVFAVVLGLLYTVGMMLSRVYIGVHYPTDVAAGALFSVAWVLGLARILHIPRILRSNP

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NC_019793_1	1.2\|2503978\|19\|NC_019793\|CRT	2503978-2503996	19	NC_019793.1	877703-877721	2	0.895
NC_019793_1	1.2\|2503978\|19\|NC_019793\|CRT	2503978-2503996	19	NC_019789.1	497422-497440	2	0.895
NC_019793_1	1.6\|2504167\|19\|NC_019793\|CRT	2504167-2504185	19	NC_019793.1	877703-877721	2	0.895
NC_019793_1	1.6\|2504167\|19\|NC_019793\|CRT	2504167-2504185	19	NC_019789.1	497422-497440	2	0.895

1. spacer 1.2|2503978|19|NC_019793|CRT matches to position: 877703-877721, mismatch: 2, identity: 0.895

cggcgccgcgccgcgtgaa	CRISPR spacer
cggtgccgcgccgggtgaa	Protospacer
***.********* *****

2. spacer 1.2|2503978|19|NC_019793|CRT matches to position: 497422-497440, mismatch: 2, identity: 0.895

cggcgccgcgccgcgtgaa	CRISPR spacer
cggggccgcgcagcgtgaa	Protospacer
*** ******* *******

3. spacer 1.6|2504167|19|NC_019793|CRT matches to position: 877703-877721, mismatch: 2, identity: 0.895

cggcgccgcgccgcgtgaa	CRISPR spacer
cggtgccgcgccgggtgaa	Protospacer
***.********* *****

4. spacer 1.6|2504167|19|NC_019793|CRT matches to position: 497422-497440, mismatch: 2, identity: 0.895

cggcgccgcgccgcgtgaa	CRISPR spacer
cggggccgcgcagcgtgaa	Protospacer
*** ******* *******

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_019793_1	1.2\|2503978\|19\|NC_019793\|CRT	2503978-2503996	19	NZ_CP007130	Gemmatirosa kalamazoonesis strain KBS708 plasmid 2, complete sequence	371446-371464	0	1.0
NC_019793_1	1.6\|2504167\|19\|NC_019793\|CRT	2504167-2504185	19	NZ_CP007130	Gemmatirosa kalamazoonesis strain KBS708 plasmid 2, complete sequence	371446-371464	0	1.0
NC_019793_1	1.3\|2504023\|25\|NC_019793\|CRT	2504023-2504047	25	NZ_CP023071	Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence	1026215-1026239	4	0.84
NC_019793_1	1.3\|2504023\|25\|NC_019793\|CRT	2504023-2504047	25	NZ_CP047317	Burkholderia glumae AU6208 plasmid pwszb, complete sequence	35133-35157	4	0.84
NC_019793_1	1.3\|2504023\|25\|NC_019793\|CRT	2504023-2504047	25	NZ_CP029357	Azospirillum sp. CFH 70021 plasmid unnamed2	179623-179647	4	0.84
NC_019793_1	1.3\|2504023\|25\|NC_019793\|CRT	2504023-2504047	25	NC_022043	Paracoccus aminophilus JCM 7686 plasmid pAMI5, complete sequence	143698-143722	4	0.84
NC_019793_1	1.7\|2504212\|25\|NC_019793\|CRT	2504212-2504236	25	NZ_CP015585	Roseomonas gilardii strain U14-5 plasmid 1, complete sequence	87140-87164	4	0.84
NC_019793_1	1.7\|2504212\|25\|NC_019793\|CRT	2504212-2504236	25	NZ_CP024583	Roseomonas sp. FDAARGOS_362 plasmid unnamed2, complete sequence	123953-123977	4	0.84
NC_019793_1	1.7\|2504212\|25\|NC_019793\|CRT	2504212-2504236	25	NZ_CP013110	Sinorhizobium americanum strain CFNEI 73 plasmid C, complete sequence	1496160-1496184	4	0.84
NC_019793_1	1.7\|2504212\|25\|NC_019793\|CRT	2504212-2504236	25	NZ_CP013054	Sinorhizobium americanum CCGM7 plasmid C, complete sequence	914791-914815	4	0.84
NC_019793_1	1.3\|2504023\|25\|NC_019793\|CRT	2504023-2504047	25	NZ_CP028348	Novosphingobium sp. THN1 plasmid pTHN, complete sequence	18296-18320	6	0.76

1. spacer 1.2|2503978|19|NC_019793|CRT matches to NZ_CP007130 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 2, complete sequence) position: , mismatch: 0, identity: 1.0

cggcgccgcgccgcgtgaa	CRISPR spacer
cggcgccgcgccgcgtgaa	Protospacer
*******************

2. spacer 1.6|2504167|19|NC_019793|CRT matches to NZ_CP007130 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 2, complete sequence) position: , mismatch: 0, identity: 1.0

cggcgccgcgccgcgtgaa	CRISPR spacer
cggcgccgcgccgcgtgaa	Protospacer
*******************

3. spacer 1.3|2504023|25|NC_019793|CRT matches to NZ_CP023071 (Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence) position: , mismatch: 4, identity: 0.84

tggcggcgaccgaggcaatgaccgt	CRISPR spacer
cggcggcgagcgcggcaatgaccgc	Protospacer
.******** ** ***********.

4. spacer 1.3|2504023|25|NC_019793|CRT matches to NZ_CP047317 (Burkholderia glumae AU6208 plasmid pwszb, complete sequence) position: , mismatch: 4, identity: 0.84

tggcggcgaccgaggcaatgaccgt	CRISPR spacer
cggcgtcgaccaaggcaatgaccgc	Protospacer
.**** *****.************.

5. spacer 1.3|2504023|25|NC_019793|CRT matches to NZ_CP029357 (Azospirillum sp. CFH 70021 plasmid unnamed2) position: , mismatch: 4, identity: 0.84

tggcggcgaccgaggcaatgaccgt	CRISPR spacer
aggcggcggccgaggcgatgaccgc	Protospacer
 *******.*******.*******.

6. spacer 1.3|2504023|25|NC_019793|CRT matches to NC_022043 (Paracoccus aminophilus JCM 7686 plasmid pAMI5, complete sequence) position: , mismatch: 4, identity: 0.84

tggcggcgaccgaggcaatgaccgt	CRISPR spacer
cggcggcgaccgaggccatgacgat	Protospacer
.*************** ***** .*

7. spacer 1.7|2504212|25|NC_019793|CRT matches to NZ_CP015585 (Roseomonas gilardii strain U14-5 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.84

tggtggcgaccgaggcaatgaccgt	CRISPR spacer
tggtggcgacccaggccatgacctc	Protospacer
*********** **** ****** .

8. spacer 1.7|2504212|25|NC_019793|CRT matches to NZ_CP024583 (Roseomonas sp. FDAARGOS_362 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.84

tggtggcgaccgaggcaatgaccgt	CRISPR spacer
tggtggcgacccaggccatgacctc	Protospacer
*********** **** ****** .

9. spacer 1.7|2504212|25|NC_019793|CRT matches to NZ_CP013110 (Sinorhizobium americanum strain CFNEI 73 plasmid C, complete sequence) position: , mismatch: 4, identity: 0.84

tggtggcgaccgaggcaatgaccgt	CRISPR spacer
cggtggagaccgcggcaatgaccgg	Protospacer
.***** ***** ***********

10. spacer 1.7|2504212|25|NC_019793|CRT matches to NZ_CP013054 (Sinorhizobium americanum CCGM7 plasmid C, complete sequence) position: , mismatch: 4, identity: 0.84

tggtggcgaccgaggcaatgaccgt	CRISPR spacer
cggtggagaccgcggcaatgaccgg	Protospacer
.***** ***** ***********

11. spacer 1.3|2504023|25|NC_019793|CRT matches to NZ_CP028348 (Novosphingobium sp. THN1 plasmid pTHN, complete sequence) position: , mismatch: 6, identity: 0.76

tggcggcgaccgaggcaatgaccgt	CRISPR spacer
tggcggcgaccgaggcaatcgttcc	Protospacer
******************* ... .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

459943 : 505291

Bacillus_phage(20.0%)

holin,terminase,head,integrase,transposase,capsid

attL 470641:470657|attR 483467:483483

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015231680.1\|459943_460960_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_015234334.1\|461461_461647_+	hypothetical protein	NA	NA	NA	NA
WP_015234335.1\|461727_462303_-	hypothetical protein	NA	NA	NA	NA
WP_015234336.1\|462699_463800_+	ATP phosphoribosyltransferase regulatory subunit	NA	NA	NA	NA
WP_015234337.1\|463796_464474_+	ATP phosphoribosyltransferase	NA	NA	NA	NA
WP_015234338.1\|464473_465445_+	phosphotransferase	NA	NA	NA	NA
WP_015234339.1\|465685_466564_-	hypothetical protein	NA	NA	NA	NA
WP_015234340.1\|466887_468792_+	peptidyl-prolyl cis-trans isomerase	NA	NA	NA	NA
WP_015234341.1\|468859_469381_-	DUF4388 domain-containing protein	NA	NA	NA	NA
WP_015234342.1\|469488_470772_-	UDP-N-acetylglucosamine 1-carboxyvinyltransferase	NA	NA	NA	NA
470641:470657	attL	NA	NA	NA	NA
WP_015234343.1\|471059_471281_+	hypothetical protein	NA	NA	NA	NA
WP_015234344.1\|471392_473306_+	PQQ-binding-like beta-propeller repeat protein	A0A142BKH6	Avian_leukosis_and_sarcoma_virus	6.5e-14	28.9
WP_015234345.1\|473426_473693_+	twin-arginine translocase TatA/TatE family subunit	NA	NA	NA	NA
WP_015234346.1\|473853_474468_+	DedA family protein	NA	NA	NA	NA
WP_015234347.1\|474604_475582_+	YifB family Mg chelatase-like AAA ATPase	NA	NA	NA	NA
WP_157448950.1\|475613_475808_+	hypothetical protein	NA	NA	NA	NA
WP_157448734.1\|475829_476051_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_015234350.1\|476149_476464_+	hypothetical protein	NA	NA	NA	NA
WP_015234351.1\|476489_477263_+	DNA (cytosine-5-)-methyltransferase	B3VG55	Mycobacterium_virus	5.0e-50	47.1
WP_015234352.1\|477259_477718_+	hypothetical protein	A0A0Y0AEU3	Bacillus_phage	3.2e-36	50.0
WP_015234353.1\|477882_478284_+	hypothetical protein	NA	NA	NA	NA
WP_015234354.1\|478294_478552_+	hypothetical protein	NA	NA	NA	NA
WP_157448736.1\|478529_478868_+	hypothetical protein	NA	NA	NA	NA
WP_041230646.1\|478901_479087_+	hypothetical protein	NA	NA	NA	NA
WP_015234356.1\|479104_479260_+	hypothetical protein	NA	NA	NA	NA
WP_015234357.1\|479256_479532_+	hypothetical protein	NA	NA	NA	NA
WP_015234358.1\|479542_479764_+	hypothetical protein	NA	NA	NA	NA
WP_015234359.1\|479788_479977_+	DUF1653 domain-containing protein	NA	NA	NA	NA
WP_157448737.1\|480157_480313_+	hypothetical protein	NA	NA	NA	NA
WP_015234361.1\|480383_481316_-\|integrase	site-specific integrase	W8EHC2	Mycobacterium_phage	4.0e-09	26.9
WP_015234362.1\|481594_482020_-	hypothetical protein	NA	NA	NA	NA
WP_015234363.1\|482016_482364_-	hypothetical protein	NA	NA	NA	NA
WP_015234364.1\|482438_484337_-	discoidin domain-containing protein	NA	NA	NA	NA
483467:483483	attR	NA	NA	NA	NA
WP_015234365.1\|484333_484828_-	secretion activating protein	NA	NA	NA	NA
WP_015234366.1\|484824_485292_-\|holin	phage holin family protein	D0R7H7	Paenibacillus_phage	2.0e-25	46.2
WP_015234367.1\|485537_486047_+	hypothetical protein	NA	NA	NA	NA
WP_015234369.1\|486302_489080_-	right-handed parallel beta-helix repeat-containing protein	NA	NA	NA	NA
WP_015234370.1\|489089_489587_-	hypothetical protein	NA	NA	NA	NA
WP_015234371.1\|489583_491188_-	hypothetical protein	NA	NA	NA	NA
WP_015234372.1\|491292_495639_-	tape measure protein	M1I8I2	Bacillus_virus	2.0e-31	33.2
WP_157448738.1\|495635_495947_-	hypothetical protein	NA	NA	NA	NA
WP_015234374.1\|496003_496387_-	hypothetical protein	NA	NA	NA	NA
WP_157448739.1\|496383_496533_-	hypothetical protein	NA	NA	NA	NA
WP_015234376.1\|496631_497087_-	hypothetical protein	NA	NA	NA	NA
WP_015234377.1\|497089_497449_-	hypothetical protein	NA	NA	NA	NA
WP_015234378.1\|497445_497808_-	hypothetical protein	A0A088FB12	Idiomarinaceae_phage	1.0e-05	45.6
WP_015234379.1\|497804_498122_-	hypothetical protein	NA	NA	NA	NA
WP_015234380.1\|498121_498481_-	hypothetical protein	NA	NA	NA	NA
WP_015234381.1\|498489_498819_-	hypothetical protein	NA	NA	NA	NA
WP_015234382.1\|498787_499024_-	hypothetical protein	NA	NA	NA	NA
WP_015234383.1\|499025_499271_-	hypothetical protein	NA	NA	NA	NA
WP_015234384.1\|499339_500290_-\|capsid	N4-gp56 family major capsid protein	A0A0S2SXJ0	Bacillus_phage	1.1e-57	41.2
WP_085931720.1\|500303_500879_-	DUF4355 domain-containing protein	NA	NA	NA	NA
WP_015234386.1\|501024_501213_-	hypothetical protein	NA	NA	NA	NA
WP_015234387.1\|501209_501953_-\|head	phage head morphogenesis protein, SPP1 gp7	NA	NA	NA	NA
WP_015234388.1\|501949_503320_-	hypothetical protein	NA	NA	NA	NA
WP_015234389.1\|503334_504618_-	Terminase-like family	A0A2H4J4X1	uncultured_Caudovirales_phage	3.8e-10	25.8
WP_015234390.1\|504607_505291_-\|terminase	terminase small subunit	A0A2H4JBF3	uncultured_Caudovirales_phage	1.5e-05	26.6

DBSCAN-SWA_2

1594314 : 1677756

Bacillus_phage(25.0%)

integrase,transposase,protease

attL 1630438:1630463|attR 1679494:1679519

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015235462.1\|1594314_1595292_-\|protease	Zn-dependent protease	NA	NA	NA	NA
WP_015235463.1\|1595294_1596086_-	ion transporter	NA	NA	NA	NA
WP_015235464.1\|1596197_1597373_+	hypothetical protein	NA	NA	NA	NA
WP_015235465.1\|1598489_1598720_+	DUF2132 domain-containing protein	NA	NA	NA	NA
WP_015235466.1\|1598911_1600258_+	beta-glucosidase	A0A0B5JD41	Pandoravirus	1.8e-74	36.0
WP_015235467.1\|1600315_1600738_-	response regulator	NA	NA	NA	NA
WP_052326659.1\|1600730_1604753_-	PAS domain S-box protein	A0A1V0SGX0	Hokovirus	2.7e-14	30.0
WP_041231298.1\|1605146_1605839_-	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_015235470.1\|1607285_1607720_+	hypothetical protein	NA	NA	NA	NA
WP_015235471.1\|1608821_1610321_-	hypothetical protein	NA	NA	NA	NA
WP_157448802.1\|1610548_1611358_-	hypothetical protein	NA	NA	NA	NA
WP_015235473.1\|1611885_1614984_+	DEAD/DEAH box helicase	A0A1B1IUI1	uncultured_Mediterranean_phage	1.6e-102	30.8
WP_015235474.1\|1614983_1619228_+	ATP phosphoribosyltransferase regulatory subunit	A0A1B1IUC6	uncultured_Mediterranean_phage	6.2e-49	27.3
WP_015235475.1\|1619224_1623130_+	helicase family protein with metal-binding cysteine cluster	NA	NA	NA	NA
WP_015235476.1\|1623126_1624974_+	DUF1998 domain-containing protein	NA	NA	NA	NA
WP_041231301.1\|1624999_1625731_+	hypothetical protein	NA	NA	NA	NA
WP_041231302.1\|1625808_1626873_+	DNA (cytosine-5-)-methyltransferase	A0A0R6PG08	Moraxella_phage	2.3e-93	52.3
WP_015235479.1\|1626855_1627284_-	very short patch repair endonuclease	V5UTF4	Oenococcus_phage	3.8e-23	47.2
WP_015235480.1\|1627396_1627876_-	hypothetical protein	NA	NA	NA	NA
WP_015235481.1\|1629107_1629308_+	hypothetical protein	NA	NA	NA	NA
1630438:1630463	attL	NA	NA	NA	NA
WP_157448803.1\|1630698_1631208_+	hypothetical protein	NA	NA	NA	NA
WP_015235483.1\|1631259_1631622_-	hypothetical protein	NA	NA	NA	NA
WP_015235484.1\|1631618_1632803_-	ThiF family adenylyltransferase	NA	NA	NA	NA
WP_015235485.1\|1632777_1633059_-	multiubiquitin domain-containing protein	NA	NA	NA	NA
WP_015235486.1\|1633221_1633632_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_041230770.1\|1633667_1634471_+	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_015235489.1\|1634733_1635924_-\|integrase	site-specific integrase	A0A1B0T6A8	Bacillus_phage	7.8e-34	29.3
WP_015235490.1\|1636102_1638430_-	DUF927 domain-containing protein	NA	NA	NA	NA
WP_015235491.1\|1638426_1639560_-\|integrase	site-specific integrase	A0A1B0T6A8	Bacillus_phage	2.1e-36	31.5
WP_015235492.1\|1640080_1640410_+	hypothetical protein	NA	NA	NA	NA
WP_015235493.1\|1640534_1640771_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_015235494.1\|1641080_1642976_+	hypothetical protein	NA	NA	NA	NA
WP_015235495.1\|1643278_1644133_-	hypothetical protein	NA	NA	NA	NA
WP_157448804.1\|1644145_1644727_-	hypothetical protein	NA	NA	NA	NA
WP_015235497.1\|1644879_1645203_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_015235498.1\|1645307_1646147_+	hypothetical protein	NA	NA	NA	NA
WP_015235499.1\|1646255_1646573_+	hypothetical protein	NA	NA	NA	NA
WP_015235500.1\|1647172_1647502_-	hypothetical protein	NA	NA	NA	NA
WP_169316596.1\|1647498_1657209_-	hypothetical protein	NA	NA	NA	NA
WP_157448806.1\|1657469_1658615_+	hypothetical protein	NA	NA	NA	NA
WP_157448807.1\|1658737_1660687_+	S8 family serine peptidase	A0A217EQY2	Bacillus_phage	3.7e-25	38.0
WP_015235504.1\|1660687_1661872_+	type II secretion system protein GspD	R9TEZ5	Vibrio_phage	1.9e-11	24.7
WP_015235505.1\|1661958_1662315_+	hypothetical protein	NA	NA	NA	NA
WP_015235506.1\|1662317_1663274_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_169316588.1\|1663433_1663925_+	hypothetical protein	NA	NA	NA	NA
WP_015235508.1\|1664117_1665041_+	DUF3800 domain-containing protein	NA	NA	NA	NA
WP_157448808.1\|1665160_1665304_-	hypothetical protein	NA	NA	NA	NA
WP_083865759.1\|1665359_1665758_-\|transposase	transposase	NA	NA	NA	NA
WP_015235509.1\|1665778_1668004_-	hypothetical protein	NA	NA	NA	NA
WP_015235510.1\|1668014_1669091_-	AAA family ATPase	G3MAU6	Bacillus_virus	8.1e-22	27.4
WP_157448809.1\|1670643_1670868_+	hypothetical protein	NA	NA	NA	NA
WP_157448810.1\|1670864_1670990_+\|transposase	transposase	NA	NA	NA	NA
WP_041230776.1\|1671227_1671422_+	hypothetical protein	NA	NA	NA	NA
WP_015235511.1\|1671441_1673394_+	hypothetical protein	NA	NA	NA	NA
WP_015235512.1\|1673684_1675472_-	putative DNA binding domain-containing protein	A0A1B3AYT3	Gordonia_phage	3.5e-14	26.6
WP_015235513.1\|1675713_1676043_+	hypothetical protein	NA	NA	NA	NA
WP_157448811.1\|1676172_1676526_+	hypothetical protein	NA	NA	NA	NA
WP_157448813.1\|1677258_1677756_-\|transposase	transposase	NA	NA	NA	NA
1679494:1679519	attR	NA	NA	NA	NA

DBSCAN-SWA_3

1960709 : 2005702

Acinetobacter_phage(26.67%)

integrase,transposase,protease

attL 1993329:1993346|attR 2007919:2007936

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015235764.1\|1960709_1961831_-\|protease	cysteine protease StiP family protein	A0A172Q0S8	Acinetobacter_phage	4.4e-39	32.6
WP_015235765.1\|1961817_1962582_-	hypothetical protein	A0A172Q0Q4	Acinetobacter_phage	9.8e-06	23.1
WP_015235766.1\|1962572_1963673_-	phosphoribosyltransferase domain-containing protein	A0A172Q0Y1	Acinetobacter_phage	2.7e-12	27.0
WP_015235767.1\|1963669_1964707_-	ATP-grasp domain-containing protein	NA	NA	NA	NA
WP_015235768.1\|1964950_1966057_-	DUF475 domain-containing protein	A0A172Q0Y5	Acinetobacter_phage	2.0e-68	44.0
WP_015235769.1\|1966126_1966702_-	TerD family protein	K4JRX3	Caulobacter_phage	2.1e-29	38.0
WP_015235770.1\|1966820_1967417_-	TerD family protein	K4JRX3	Caulobacter_phage	2.5e-12	30.2
WP_157449000.1\|1967749_1968457_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_157448827.1\|1968516_1969608_-	hypothetical protein	NA	NA	NA	NA
WP_015235773.1\|1969782_1970223_-	hypothetical protein	NA	NA	NA	NA
WP_015235774.1\|1970468_1971026_-	DUF1802 family protein	NA	NA	NA	NA
WP_015235775.1\|1971172_1971472_+	type II toxin-antitoxin system prevent-host-death family antitoxin	NA	NA	NA	NA
WP_052326674.1\|1971464_1971899_+	PIN domain-containing protein	NA	NA	NA	NA
WP_015235777.1\|1972202_1973801_-	pilus assembly PilX N-terminal domain-containing protein	NA	NA	NA	NA
WP_015235778.1\|1973809_1974613_-	type II secretion system protein	NA	NA	NA	NA
WP_015235779.1\|1974609_1975047_-	type II secretion system protein	NA	NA	NA	NA
WP_015235780.1\|1975043_1975535_-	GspH/FimT family pseudopilin	NA	NA	NA	NA
WP_041230670.1\|1975892_1976411_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_157448751.1\|1976446_1976854_-	winged helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_169316599.1\|1977346_1978006_-\|transposase	IS630 family transposase	A0A1V0SCG6	Indivirus	5.8e-15	26.7
WP_041230612.1\|1977920_1978280_-	hypothetical protein	NA	NA	NA	NA
WP_015235782.1\|1979205_1979394_+	hypothetical protein	NA	NA	NA	NA
WP_015235783.1\|1979393_1980911_+	hypothetical protein	NA	NA	NA	NA
WP_015235784.1\|1980921_1981362_+	prepilin-type N-terminal cleavage/methylation domain-containing protein	NA	NA	NA	NA
WP_015235785.1\|1981406_1981865_+	type II secretion system protein	NA	NA	NA	NA
WP_015235786.1\|1981875_1982583_+	prepilin-type N-terminal cleavage/methylation domain-containing protein	NA	NA	NA	NA
WP_015235787.1\|1982744_1983110_-	hypothetical protein	NA	NA	NA	NA
WP_015235788.1\|1983587_1984208_+\|protease	ATP-dependent Clp protease proteolytic subunit	A0A223W000	Agrobacterium_phage	7.9e-46	46.1
WP_015235789.1\|1984197_1985394_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	2.5e-112	54.5
WP_015235790.1\|1985632_1988026_+	endopeptidase La	A0A0R6PGP8	Moraxella_phage	2.7e-174	43.5
WP_157448829.1\|1988411_1988669_+	PIG-L family deacetylase	NA	NA	NA	NA
WP_052326676.1\|1988598_1989303_+	PIG-L family deacetylase	NA	NA	NA	NA
WP_015235791.1\|1989304_1989997_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_083865875.1\|1990000_1990369_-	thioesterase family protein	NA	NA	NA	NA
WP_015235793.1\|1990542_1990758_-	hypothetical protein	NA	NA	NA	NA
WP_015235794.1\|1990928_1991423_+	hypothetical protein	NA	NA	NA	NA
WP_015235795.1\|1991414_1992245_-	5'-3' exonuclease	NA	NA	NA	NA
WP_157448830.1\|1992434_1993517_+	diguanylate cyclase	A0A127AWB9	Bacillus_phage	2.4e-13	31.2
1993329:1993346	attL	NA	NA	NA	NA
WP_052326678.1\|1994300_1994900_+	metal ABC transporter permease	NA	NA	NA	NA
WP_015235797.1\|1995045_1995513_-	response regulator	NA	NA	NA	NA
WP_015235798.1\|1995808_1996588_-	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_015235799.1\|1996709_1997378_-	response regulator transcription factor	NA	NA	NA	NA
WP_015235800.1\|1997519_1998554_-	response regulator	W8CYM9	Bacillus_phage	1.7e-16	32.5
WP_015235801.1\|1998770_1999079_+	30S ribosomal protein S6	NA	NA	NA	NA
WP_015235802.1\|1999225_2000092_+	single-stranded DNA-binding protein	A0A059T5E0	Listeria_phage	3.7e-09	52.4
WP_015235803.1\|2000143_2000407_+	30S ribosomal protein S18	NA	NA	NA	NA
WP_015235804.1\|2000403_2000847_+	50S ribosomal protein L9	NA	NA	NA	NA
WP_015235805.1\|2001014_2001764_+	metallophosphoesterase family protein	NA	NA	NA	NA
WP_015235806.1\|2001879_2003871_+	transketolase	NA	NA	NA	NA
WP_015235807.1\|2003946_2004603_+	guanylate kinase	U5TH34	Cowpox_virus	6.6e-19	33.2
WP_015235808.1\|2004604_2005126_+	macro domain-containing protein	A0A0K1L687	Scale_drop_disease_virus	4.2e-24	45.0
WP_015235809.1\|2005138_2005702_-\|integrase	site-specific integrase	NA	NA	NA	NA
2007919:2007936	attR	NA	NA	NA	NA

DBSCAN-SWA_4

2111843 : 2164371

Bacillus_phage(20.0%)

transposase,protease,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015235927.1\|2111843_2113427_+\|tail	phage tail sheath family protein	J9PVC2	Bacillus_phage	3.1e-70	34.2
WP_015235928.1\|2113555_2113999_+\|tail	phage tail protein	NA	NA	NA	NA
WP_157449003.1\|2114206_2114572_+	hypothetical protein	NA	NA	NA	NA
WP_015235930.1\|2114568_2114742_+	hypothetical protein	NA	NA	NA	NA
WP_015235931.1\|2114914_2115373_+\|tail	phage tail protein	NA	NA	NA	NA
WP_041230833.1\|2116496_2119136_+	DUF4157 domain-containing protein	NA	NA	NA	NA
WP_015235933.1\|2119201_2119522_-	hypothetical protein	NA	NA	NA	NA
WP_015235934.1\|2119533_2119743_-	hypothetical protein	NA	NA	NA	NA
WP_015235935.1\|2119903_2120326_+	response regulator	NA	NA	NA	NA
WP_015235936.1\|2120425_2120845_+	hypothetical protein	NA	NA	NA	NA
WP_015235937.1\|2120954_2121338_+	hypothetical protein	NA	NA	NA	NA
WP_015235938.1\|2121387_2123031_-	RecQ family ATP-dependent DNA helicase	F2NZ48	Diadromus_pulchellus_ascovirus	2.1e-61	41.7
WP_015235939.1\|2123228_2123666_-	SufE family protein	NA	NA	NA	NA
WP_015235940.1\|2123817_2124678_+	sulfurtransferase	NA	NA	NA	NA
WP_015235941.1\|2124729_2125722_-	metallophosphoesterase	NA	NA	NA	NA
WP_015235942.1\|2125916_2126375_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_015235943.1\|2126679_2126964_+	hypothetical protein	NA	NA	NA	NA
WP_015235944.1\|2127253_2127469_-	hypothetical protein	NA	NA	NA	NA
WP_015235945.1\|2127561_2128713_-	type IV pilus twitching motility protein PilT	NA	NA	NA	NA
WP_015235946.1\|2128763_2131430_-	Flp pilus assembly complex ATPase component TadA	NA	NA	NA	NA
WP_015235947.1\|2131481_2131988_-	YqeG family HAD IIIA-type phosphatase	NA	NA	NA	NA
WP_015235948.1\|2132043_2132805_-	peptidoglycan editing factor PgeF	NA	NA	NA	NA
WP_015235949.1\|2132943_2133726_+	enoyl-ACP reductase	NA	NA	NA	NA
WP_083865793.1\|2133842_2133980_-	hypothetical protein	NA	NA	NA	NA
WP_015235950.1\|2134116_2136999_+	PAS domain S-box protein	A0A2K9L5I4	Tupanvirus	4.4e-06	22.0
WP_015235951.1\|2137192_2137393_-	hypothetical protein	NA	NA	NA	NA
WP_015231360.1\|2138248_2139349_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_015231253.1\|2139672_2140773_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_015235953.1\|2141030_2141201_-	hypothetical protein	NA	NA	NA	NA
WP_052326685.1\|2141424_2142330_+	ChbG/HpnK family deacetylase	NA	NA	NA	NA
WP_041230836.1\|2143312_2143558_-	AAC(3) family N-acetyltransferase	NA	NA	NA	NA
WP_015235955.1\|2143727_2144687_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_015235956.1\|2144683_2145448_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.2e-29	34.5
WP_041230837.1\|2145444_2146200_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_015235958.1\|2146313_2146628_+	DsrE family protein	NA	NA	NA	NA
WP_015235959.1\|2146965_2147871_-	YegS/Rv2252/BmrU family lipid kinase	A0A1V0SBJ0	Catovirus	5.0e-09	23.6
WP_015235960.1\|2147950_2148817_+	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_015235961.1\|2148813_2150358_+	AMP-binding protein	NA	NA	NA	NA
WP_015235962.1\|2150529_2153637_+	hypothetical protein	NA	NA	NA	NA
WP_015235963.1\|2153753_2154434_-	hypothetical protein	NA	NA	NA	NA
WP_083865794.1\|2154630_2154885_+	zinc ribbon domain-containing protein	NA	NA	NA	NA
WP_015235964.1\|2155143_2156934_-	hypothetical protein	NA	NA	NA	NA
WP_015235965.1\|2156930_2159819_-	PQQ-binding-like beta-propeller repeat protein	NA	NA	NA	NA
WP_015235966.1\|2159815_2161168_-	hypothetical protein	NA	NA	NA	NA
WP_015235967.1\|2161295_2162939_-	trypsin-like peptidase domain-containing protein	NA	NA	NA	NA
WP_169316601.1\|2162947_2163532_-	hypothetical protein	NA	NA	NA	NA
WP_015235969.1\|2163540_2164371_-\|protease	PrsW family intramembrane metalloprotease	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_019789

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NC_019790

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NC_019793

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection