CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NC_020229	Lactobacillus plantarum ZJ316, complete sequence	1 crisprs	csa3,cas9,cas1,cas2,csn2,DinG,cas3,DEDDh	2	9
NC_021912	Lactobacillus plantarum ZJ316 plasmid pLP-ZJ103, complete sequence	0 crisprs	NA	0	4
NC_021904	Lactobacillus plantarum ZJ316 plasmid pLP-ZJ102, complete sequence	0 crisprs	NA	0	4
NC_021903	Lactobacillus plantarum ZJ316 plasmid pLP-ZJ101, complete sequence	0 crisprs	RT	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_020229_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_020229_1

359930-360361

TypeII

Consensus_repeat	Method
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	PILER-CR
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	CRISPRCasFinder
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	CRT

6 spacers

csn2,cas2,cas1,cas9,csa3

The CRISPR arrays of NC_020229_1

>merge|NC_020229|1|359930-360361|PILER-CR,CRISPRCasFinder,CRT
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAACATGTCAAGGATTGGAACAGTTTGCCGACGTGTCTTGAATAGTAGTCATATCAAACAGGTTTAGAACCTTGAAGAAGTTAAGGCACAAACTCCAACGGTCTTGAATAGTAGTCATATCAAACAGGTTTAGAACTAACACGTCTAAAAGCGATAAACGAGAATAGTCTTGAATAGTAGTCATATCAAACAGGTTTAGAACTGTCACTAGCGGAGTCAATGGATCGTATTAGTCTTGAATAGTAGTCATATCAAACAGGTTTAGAACTCAGACCTGAACGTTTACAACCTATTTACGGTCTTGAATAGTAGTCATATCAAACAGGTTTAGAACGATGCTGAGGAAACGAAGCATAGAACGTTTGTCTTGAATAGCGGCCACATCAAAAACAGTTTCACG

>NC_020229|1|1|359930-360295|PILER-CR
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	ATGTCAAGGATTGGAACAGTTTGCCGACGT
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	CTTGAAGAAGTTAAGGCACAAACTCCAACG
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	TAACACGTCTAAAAGCGATAAACGAGAATA
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	TGTCACTAGCGGAGTCAATGGATCGTATTA
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	TCAGACCTGAACGTTTACAACCTATTTACG
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC

>NC_020229|1|1|359930-360295|CRISPRCasFinder
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	ATGTCAAGGATTGGAACAGTTTGCCGACGT
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	CTTGAAGAAGTTAAGGCACAAACTCCAACG
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	TAACACGTCTAAAAGCGATAAACGAGAATA
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	TGTCACTAGCGGAGTCAATGGATCGTATTA
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	TCAGACCTGAACGTTTACAACCTATTTACG
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC

>NC_020229|1|1|359930-360361|CRT
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	ATGTCAAGGATTGGAACAGTTTGCCGACGT
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	CTTGAAGAAGTTAAGGCACAAACTCCAACG
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	TAACACGTCTAAAAGCGATAAACGAGAATA
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	TGTCACTAGCGGAGTCAATGGATCGTATTA
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	TCAGACCTGAACGTTTACAACCTATTTACG
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	GATGCTGAGGAAACGAAGCATAGAACGTTT
GTCTTGAATAGCGGCCACATCAAAAACAGTTTCACG

Protein	Signature genes	Signature genes Name	Protein_function
NC_020229.1\|WP_015379639.1\|358042_358948_+\|type-II-CRISPR-associated-endonuclease-Cas1	cas1	cd09720_cas1_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|187851
NC_020229.1\|WP_015379642.1\|360425_363164_-\|cation-transporting-P-type-ATPase	unknown	unknown	gnl\|CDD\|319775
NC_020229.1\|WP_003646321.1\|365225_365699_+\|winged-helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197670
NC_020229.1\|WP_021357178.1\|351969_352677_+\|hypothetical-protein	unknown	unknown	unknown
NC_020229.1\|WP_015379640.1\|358925_359231_+\|CRISPR-associated-endonuclease-Cas2	cas2	mkCas0206_cas2_CAS-I:CAS-II:CAS-III	gnl\|CDD\|226043
NC_020229.1\|WP_003643663.1\|367389_368622_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340949
NC_020229.1\|WP_071542797.1\|366806_367091_-\|LytTR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197918
NC_020229.1\|WP_003646323.1\|366354_366810_-\|DUF3021-domain-containing-protein	unknown	unknown	gnl\|CDD\|378668
NC_020229.1\|WP_011100893.1\|352701_353484_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223669
NC_020229.1\|WP_015379645.1\|368712_369012_+\|winged-helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|238042
NC_020229.1\|WP_003641733.1\|365844_366267_+\|Hsp20/alpha-crystallin-family-protein	unknown	unknown	gnl\|CDD\|107228
NC_020229.1\|WP_015379635.1\|348094_349687_+\|HIRAN-domain-containing-protein	unknown	unknown	gnl\|CDD\|214906
NC_020229.1\|WP_003641725.1\|350505_351870_+\|amino-acid-permease	unknown	unknown	gnl\|CDD\|182694
NC_020229.1\|WP_003646320.1\|364509_365112_-\|NAD(P)H-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|377026
NC_020229.1\|WP_015379638.1\|353772_357849_+\|type-II-CRISPR-RNA-guided-endonuclease-Cas9	cas9	mkCas0193_cas9_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|374653
NC_020229.1\|WP_015379634.1\|347110_347851_+\|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|224982
NC_020229.1\|WP_015379641.1\|359227_359905_+\|type-II-A-CRISPR-associated-protein-Csn2	csn2	cd12218_csn2_CAS-II-A	gnl\|CDD\|213411
NC_020229.1\|WP_003641730.1\|364249_364444_-\|PspC-domain-containing-protein	unknown	unknown	gnl\|CDD\|377200
NC_020229.1\|WP_015379636.1\|349802_350273_-\|NUDIX-hydrolase	unknown	unknown	gnl\|CDD\|240033
NC_020229.1\|WP_003646319.1\|363448_364207_+\|nucleoside-phosphorylase	unknown	unknown	gnl\|CDD\|350158

Protein	Function_ID	Function_description	E-value
NC_020229.1\|WP_015379639.1\|358042_358948_+\|type-II-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|187851	cd09720, Cas1_II, CRISPR/Cas system-associated protein Cas1. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas1 is the most universal CRISPR system protein thought to be involved in spacer intergration. Cas1 is metal-dependent deoxyribonuclease, also binds RNA; Shown to possess a unique fold consisting of a N-terminal beta-strand domain and a C-terminal alpha-helical domain.	1.7681e-88
NC_020229.1\|WP_015379642.1\|360425_363164_-\|cation-transporting-P-type-ATPase	gnl\|CDD\|319775	cd02080, P-type_ATPase_cation, P-type cation-transporting ATPase similar to Exiguobacterium aurantiacum Mna, an Na(+)-ATPase, and Synechocystis sp. PCC 6803 PMA1, a putative Ca(2+)-ATPase. This subfamily includes the P-type Na(+)-ATPase of an alkaliphilic bacterium Exiguobacterium aurantiacum Mna and cyanobacterium Synechocystis sp. PCC 6803 PMA1, a cation-transporting ATPase which may translocate calcium. The P-type ATPases, are a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.	0
NC_020229.1\|WP_003646321.1\|365225_365699_+\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	0.000122978
NC_020229.1\|WP_071542797.1\|366806_367091_-\|LytTR-family-transcriptional-regulator	gnl\|CDD\|197918	smart00850, LytTR, LytTr DNA-binding domain. This domain is found in a variety of bacterial transcriptional regulators. The domain binds to a specific DNA sequence pattern.	6.75435e-19
NC_020229.1\|WP_015379640.1\|358925_359231_+\|CRISPR-associated-endonuclease-Cas2	gnl\|CDD\|226043	COG3512, COG3512, CRISPR-associated protein, Cas2 homolog [Defense mechanisms].	2.01798e-25
NC_020229.1\|WP_003643663.1\|367389_368622_+\|MFS-transporter	gnl\|CDD\|340949	cd17391, MFS_MdtG_MDR_like, Multidrug resistance protein MdtG and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This subfamily is composed of Escherichia coli multidrug resistance protein MdtG, Streptococcus pneumoniae multidrug resistance efflux pump PmrA, and similar multidrug resistance (MDR) transporters from bacteria. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. MdtG confers resistance to fosfomycin and deoxycholate. PmrA serves as an efflux pump for various substrates and is associated with fluoroquinolone resistance. MdtG-like MDR transporters belong to the bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	7.1962e-140
NC_020229.1\|WP_003646323.1\|366354_366810_-\|DUF3021-domain-containing-protein	gnl\|CDD\|378668	pfam11457, DUF3021, Protein of unknown function (DUF3021). This is a bacterial family of uncharacterized proteins.	7.07627e-26
NC_020229.1\|WP_011100893.1\|352701_353484_+\|alpha/beta-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	8.96404e-26
NC_020229.1\|WP_015379645.1\|368712_369012_+\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238042	cd00090, HTH_ARSR, Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to dissociate from DNA in the presence of metal ions.	2.33489e-13
NC_020229.1\|WP_003641733.1\|365844_366267_+\|Hsp20/alpha-crystallin-family-protein	gnl\|CDD\|107228	cd06471, ACD_LpsHSP_like, Group of bacterial proteins containing an alpha crystallin domain (ACD) similar to Lactobacillus plantarum (Lp) small heat shock proteins (sHsp) HSP 18.5, HSP 18.55 and HSP 19.3. sHsps are molecular chaperones that suppress protein aggregation and protect against cell stress, and are generally active as large oligomers consisting of multiple subunits. Transcription of the genes encoding Lp HSP 18.5, 18.55 and 19.3 is regulated by a variety of stresses including heat, cold and ethanol. Early growing L. plantarum cells contain elevated levels of these mRNAs which rapidly fall of as the cells enter stationary phase. Also belonging to this group is Bifidobacterium breve (Bb) HSP20 and Oenococcus oenis (syn. Leuconostoc oenos) (Oo) HSP18. Transcription of the gene encoding BbHSP20 is strongly induced following heat or osmotic shock, and that of the gene encoding OoHSP18 following heat, ethanol or acid shock. OoHSP18 is peripherally associated with the cytoplasmic membrane.	2.47416e-43
NC_020229.1\|WP_015379635.1\|348094_349687_+\|HIRAN-domain-containing-protein	gnl\|CDD\|214906	smart00910, HIRAN, The HIRAN protein (HIP116, Rad5p N-terminal) is found in the N-terminal regions of the SWI2/SNF2 proteins typified by HIP116 and Rad5p. HIRAN is found as a standalone protein in several bacteria and prophages, or fused to other catalytic domains, such as a nuclease of the restriction endonuclease fold and TDP1-like DNA phosphoesterases, in the eukaryotes. It has been predicted that this protein functions as a DNA-binding domain that probably recognises features associated with damaged DNA or stalled replication forks.	4.41904e-17
NC_020229.1\|WP_003641725.1\|350505_351870_+\|amino-acid-permease	gnl\|CDD\|182694	PRK10746, PRK10746, putative transport protein YifK; Provisional.	0
NC_020229.1\|WP_003646320.1\|364509_365112_-\|NAD(P)H-dependent-oxidoreductase	gnl\|CDD\|377026	pfam03358, FMN_red, NADPH-dependent FMN reductase.	3.18179e-31
NC_020229.1\|WP_015379638.1\|353772_357849_+\|type-II-CRISPR-RNA-guided-endonuclease-Cas9	gnl\|CDD\|374653	pfam16592, Cas9_REC, REC lobe of CRISPR-associated endonuclease Cas9. The REC lobe of Cas9 - the CRISPR-associated endonuclease Cas9 - includes the REC1 and REC2 domains. REC1 forms an elongated, alpha-helical structure consisting of 25 alpha helices and two beta-sheets, whereas REC2 inserted within REC1 adopts a six-helix bundle structure. The REC lobe and the NUC lobe of Cas9 fold to present a positively charged groove at their interface which accommodates the negatively charged sgRNA:target DNA heteroduplex. CRISPR (clustered regularly interspaced short palindromic repeat)-Cas system occurs naturally in bacteria as a defense against invasion by phages or other mobile genetic elements. Cas9 is targeted to specific genomic locations by sgRNAs or single guide RNAs, in order to complex with invading DNA in order to cleave it and render it inactive.	4.18308e-127
NC_020229.1\|WP_015379634.1\|347110_347851_+\|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein	gnl\|CDD\|224982	COG2071, COG2071, Predicted glutamine amidotransferases [General function prediction only].	1.48244e-86
NC_020229.1\|WP_015379641.1\|359227_359905_+\|type-II-A-CRISPR-associated-protein-Csn2	gnl\|CDD\|213411	cd12218, Csn2, CRISPR/Cas system-associated protein Csn2. Csn2 is a Nmeni subtype-specific Cas protein, which may function in the adaptation process which mediates the incorporation of foreign nucleic acids into the microbial host genome. Csn 2 may interact directly with double-stranded DNA. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA. Csn2 has been predicted to be a functional analog of Cas4 based on anti-correlated phyletic patterns; also known as SPy1049 family.	4.14563e-81
NC_020229.1\|WP_003641730.1\|364249_364444_-\|PspC-domain-containing-protein	gnl\|CDD\|377200	pfam04024, PspC, PspC domain. This family includes Phage shock protein C (PspC) that is thought to be a transcriptional regulator. The presumed domain is 60 amino acid residues in length.	2.12668e-17
NC_020229.1\|WP_015379636.1\|349802_350273_-\|NUDIX-hydrolase	gnl\|CDD\|240033	cd04677, Nudix_Hydrolase_18, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.	1.04055e-57
NC_020229.1\|WP_003646319.1\|363448_364207_+\|nucleoside-phosphorylase	gnl\|CDD\|350158	cd09007, NP-I_spr0068, uncharacterized subfamily of the nucleoside phosphorylase-I family. This subfamily is composed of uncharacterized members including Streptococcus pneumoniae hypothetical protein spr0068. The nucleoside phosphorylase-I (NP-I) family members accept a range of purine nucleosides as well as the pyrimidine nucleoside uridine. The NP-1 family includes phosphorolytic nucleosidases such as purine nucleoside phosphorylase (PNP, EC. 2.4.2.1), uridine phosphorylase (UP, EC 2.4.2.3), and 5'-deoxy-5'-methylthioadenosine phosphorylase (MTAP, EC 2.4.2.28), and hydrolytic nucleosidases such as AMP nucleosidase (AMN, EC 3.2.2.4) and 5'-methylthioadenosine/S-adenosylhomocysteine (MTA/SAH) nucleosidase (MTAN, EC 3.2.2.16). Members of the NP-I family display different physiologically relevant quaternary structures: hexameric (trimer-of-dimers arrangement of Shewanella oneidensis MR-1 UP); homotrimeric (human PNP and Escherichia coli PNPII or XapA); hexameric (with some evidence for co-existence of a trimeric form) such as E. coli PNPI (DeoD); or homodimeric such as human and Trypanosoma brucei UP. The NP-I family is distinct from nucleoside phosphorylase-II, which belongs to a different structural family.	7.37287e-90

>NC_020229.1|WP_015379641.1|359227_359905_+|type-II-A-CRISPR-associated-protein-Csn2
MNITYYPFPPFKIDAGKVNVLDLGNSNMYAEVCQGFRDRIDSVRISNDDLELQTISSQCNWYGDLMLSVDLNRLFLKKVQTQIIKLMADDRQVAVLDENRKVVSQVMEASFLLDLPLDVDESPSLEQILKFTGIHFPTALMNDPRAILEALVQTHVELGLKQKLVLTNVSHYLNQKQWASFEQLVHDLGATVIVIEYSEINRMEKFKNSCYYYVDEDLVDWRDMN
>NC_020229.1|WP_015379640.1|358925_359231_+|CRISPR-associated-endonuclease-Cas2
MRLIVMFDVPMDTSEERRAYRHFHKALVREGFLMMQYSTYVRVCVNKKAAEFVEKRIAPLAPKGGKVQTMTVTEKQYQAMHYIQGTPSNDILNSAERTIVI
>NC_020229.1|WP_015379639.1|358042_358948_+|type-II-CRISPR-associated-endonuclease-Cas1
MGWRNVIITQHAKVSYSMNRILVQTSSDKYAVPISDIQLLLVGTTQAVITSAALCALTEAHVKVIFTDHQGEPISETNDYYPTRRTADLVRQQVTWPEARIATLWTKNVGSKILNQIQVIDFVGGDTQTLVDELDKLELNDVTNREAVVANKYFSLLFGDQFYRRDFSPINAALNYGYAVLLSMVNREIVLNGYLTCIGIHHENNENEFNLGSDLMEPFRPIVDQWVSQQRFKDFTPDIKIGLVSLLDLEIGFNGHQTIVSHAITEYVAACLHYLSGETEELKIEVKLPNEVSSDAINSHV
>NC_020229.1|WP_015379638.1|353772_357849_+|type-II-CRISPR-RNA-guided-endonuclease-Cas9
MKEPYGVGLDIGTNSVGWTVVDASGHVRKIKGQTGIGVRLFKEGAAAADRRGFRTTRRRLKRVKWRLRLLREFFDQPISKVDINFFARRKYSDVSPRDPNYNGLEKTLFNDRSDQDFYHDYPTIYHLREALMTQHRKFDVREIYLAIHHIVKYRGNFLRNDAATAYRSGTLDLQQHFETLNHLFSQADLELNLNLTTDVALLDSIKQTLVRTDISRSDRQKLIMPLLAVLTGATTAEKKRQKAVVTEFAKALVGNKTKIDVLTLTDIDATEAKDWAFSLEENQDKLPGIEDRFSEVGQQIIDEVIRLYASVNLAQLIPEGKRFSQSMVEKYKRHGEDLKLLKAYIRSQSDAKRGRAIRATYDQYIDGVKSKQVTQEAFQKALGKFVDADVDLNSWAAQIKQAIDSEQFMPKLRTKQNGAIPYQVQQNELDQIISNQKEYYPWLGEENPVIKRRGKFPYKLDELFGFRVPYYVGPLITKEMQAATANAGFAWMVRKADGPITPWNFDDKVDRVASATAFIQRMQTTDTYLIGEEVLPARSLIYQRFMVLNELNNIRVDDGQLTPRQKQRLYNQVFKKHKRVTAKNIQDNLVAAREFPTAPRITGLADPKVFNSSLSTYHDLKQVLPEAMSDVRKQADIEKIILWSTIFEDSTIFKQKLTEISWLTAAQLKQLGQLRYRGWGQLLRKLLTGLKDDNNRSIMDGLWETNANFMQLRSQPAIENQIKSANQANLTTADLQDTINELYTSPQNKKAIREVMVVLADIKDAMHGQTPNWIFVEAARGGGVAGRRTQSRSKQIVAAYQGTAQAIVRDQVQRELKEKIKNKANFNTRLVLYFLQNGRDLYTGDAINIDRLSEYDIDHILPQSLVKDDSLDNRVLTNARINREKNDTFASEKFGKKMGAKWKEMHRMGLMTKRKLDHLLMRPDEISKYATGFINRQLVETRQVIKLVEELINAEYPSTAIVSVKANLTHQFRQTFDFPKIREVNDYHHAFDAALTAFIGTYLLKRYPKLERFFVYGKFAKQPVNLTRFNVIRKLAKTDTPITDIDTGEVLWDKLTDIKYFETLYDYKRLLVTREVSENYGAMFDQTLLKASDNGKRLIRKKQSFDTAIYGGYTGKTLAYMAIVKVSTKKDVQYQVVGVPTTMVTQIEQLEQQGMTNKQAVTKVIEPLIAANNKKMLTYEVLLPKVRFEQVVRDRIKGQTHRFALGTDTYYHNIQELYLPLTLQRAFLGKQNESEVQLNQNLLTVFDATLAQVNRYFPLYEMNKFKKILNSARDQIELLEAKNQFVKNKLVLGKQGILTNMFIGLHANASYGDLKVLGVKIDFGKLQVPGGIKLTGDAEIIYQSPTGLFERKIALKDL
>NC_020229.1|WP_011100893.1|352701_353484_+|alpha/beta-hydrolase
MRFITSDHVQLDYTDEGQGQPIVILTGFGGAKDIWRAQIPVLIQAGYRVINLDGRCQGLSEHTAKGLRMSRRAVDAHELIEKLQLEQPILLGNSMGAATWFAYVSLYGDTGIKALIDVDQTPRMINTPHWQYGFKQVQWQDIPDYFRMPLGHSTFKHIDDATYARVKAVEAQAPFDAKLMFPLLVNHAVQDWRDVIRQLTVPFLIIAGAKSPFFNPDFAAVTAQMALRGQSVVIPEAGHIVMAEQSAAFNKALLEFLATC
>NC_020229.1|WP_021357178.1|351969_352677_+|hypothetical-protein
MVKQGHYAKVSKQKRLRQLKQRRQAQEKRAIMPEMVSEFLQVRYHLTQAAKQRPVMRQMMQRFMAQWLAAGQAELSDNGQTTWSVVALTKQTLQTFNRQLPWQGYALVDQEMARWTAFLNKEVPAVPLSERITLTEALSPATWQACLSEQLAINALLALTGDSRQLGQITTEQVRQLQTSIQTATGIDWEKVAQLLDSTVIAQNTLSEAGLDDKTRQWLEKLKKLTPQDFNDHVE
>NC_020229.1|WP_003641725.1|350505_351870_+|amino-acid-permease
MQRKLSTGQMQMIALGGTIGVGLFMGSSSTIKWTGPSVLIAYIVSGAFLYLIMRALGEMLYVDPNTGSFAKFASEYIHPVFGYLTAWSNIFQFVVVGMSEMIALGGYCRYWWPNLPDWIPGLIAIVFLCAANLISVKMFGTLETWFSLIKVVTIILMIIAGLGLIIFGIGNGGHPIGISNLWTHGGFFTGGVKGFVFALAIVLASYQGIELIGVTAGEAENPQSTIVKAIRSTVARILIFYVGAIFVIVSIYPWDKLSQIGSPFVQTFAKIGITAAASIINFVVITASLSGTNSGIYSASRMTYTLAESHQLPRKMTLLNRHGVPFYSVIAIATGILIGVVLNVVLPMFFKDASEIFVMVYSSSVLPGMVPWFVILVSQIAFRKQNAAKMANHPFKMPLSPYSNYLTLAFLALTLVFMFINPETRYSILVGVVFLVIMTLIYFRKYAGNKEETL
>NC_020229.1|WP_015379636.1|349802_350273_-|NUDIX-hydrolase
MANYIKEIRALVGHKPIILNTAAGILVNDQQEILLNLRTDTHNWSLPGGYLEYGETYATACVREYKEDSGIDVEVVDRIGIFDKGETAYPNGDVAQTISALFLVKPIGGHVLTQATDETLKLDYFDFDNLPPLLNQQNADMIHAAQEYLQTHSATK
>NC_020229.1|WP_015379635.1|348094_349687_+|HIRAN-domain-containing-protein
MERIEAGMSVMTLKKQTYRVIAVINQGQELLVRAHEPETADIEIIPVTTVVQVTEQNSTGDAAVALDTVTVVGERYVDDIVATLTTLRVGMAVLLQRESGNQYDDNAISVWTLQHAKLGYIARYQNQPYAALMDQGQRLYGIVTVLDQQKQHLELMLWRTTAVPSPIEALQIRQRLAKSRTNLGAVLTHSLQTPLGTIVMMCNGHPIKYQQVPLSPWLTPADELHVTKRYLLTPDWSQVPPDSLITCQVTAKADVVQRWQNEHISAAVLTNASSFYVVGISAQTKTGLNDNLVDDAAQPAVIYRVGQVSAHMQAGFMVSWAPFGDPRVQPALKLALHFSSQPLVPYHPVTPSRTNATFTQQELAALLVSALPNYQGGQRLEPSVTTITVEKLRQTLGDQTYHALANYQRHVQLVAGSTEGVNETLLQALIHAVTYHELTTMHYYQPTVGMVDQVIYPIQLFSTTTKDEDDAQLVGCLALYNYETFEIQQVPLTAIARIAIIADPEHPQTTPETESPDWLRIFLHGWNDDF
>NC_020229.1|WP_015379634.1|347110_347851_+|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein
MVKPIIGIAPGVVTVNSQMFPGRVRDYVNRDYLKSVTDNGGVPLVLPVTTDATTIERYVGMIDGLLLCGGADVAPLTYGEEPQPKLGGVDPERDQYEIALICATHAVGKPVLGICRGLQILNVCYGGNLYQDMSELPAGQGTLKHMQGQLAAYGMHHVKVVPGTTLAEYLGTTSDAITVNSFHHQAVKQVATGFQVVAQSADQVVEAIEATAGGLQLGVQWHPEMMQQVNSVQARLFAAFMRACVA
>NC_020229.1|WP_015379642.1|360425_363164_-|cation-transporting-P-type-ATPase
MIKDDNQSLTSNEEQNDTQNPPDADNLWQLDESALAAKYATDPENGLSTAEAAERLQHNGRNELETKRTSRFVQFIKQFNNSIIYILAAAAVLTFFMHHYSDSIVIGLVIIANAIIGYVQERQAGNALERIREMLISKNFVIRDGKKLEIDARELVVGDLVNLEAGDAVPADMRLISADNFNVQESVLTGETNPVEKQEEPITETTPALADRKNMVYASTAVTSGSAVGIVTATAEDTEIGHIQQSVSDVKQTTTPLMRNLNSLGVGLSIAIVVAAVLLFLLGMVMDTYSLPTLLIAVITMVVGSMPEGLPASTSVVLAMGTRQMTKKNVIVKSLPAVETLGAVDIVNTDKTGTLTKNEMTVTKVVTPEHTFDVTGVGYDDNGGVNFDGHLKLNGNKVDWHQDNAIEWLVKIAGQTTDAELHFENNRWELTGEPTDGALTTLYRKMTGHDPEVEEVDSLPFDSAFRFSARLADLDGQRLLMVKGSPATVLRLTDQANQTAYWDDAMDDLTADGLRVVALAYQEVDDDVTTIDAQAIGGLHLAGLVGIIDPPREEAATAIAELRQAGVQVKMITGDHPDTAMAIANKLNLAANVKAITGPEIDAMDDQQLQAHIDDYNVFARATPNNKLRIVRAQQANNHVVSMTGDGVNDAPALKQADIGVAMGIKGTEVAKESADMVLADDDFADIVAAVREGRHVFDNIRKTIRFLLPTSFAEGLVVIISILMGHELPLYPTQLLWINMVSALTIQFAFIFEPPEAGIMARGPRNVKSGLLSKLDYFEIGYVSFLISGLGIFAYDYLTALGLPNVVGSTMSLNIIIFGKIFYLFNLRNDHPVISKYFFQNKMAFYIIGILILLQLGIIYLPFMQSVFHTTSINFWYGWGIPIICGIVVLIVTEVGKSIRFRWMGKDGVID
>NC_020229.1|WP_003646319.1|363448_364207_+|nucleoside-phosphorylase
MTDKLTLLQYDPNPTAMVGPDVDGRFTVPAKLLYIFSGDDYFQQFVTRYHGHRLGQFNTITKVSWVYQIGYRGQKLAVAQAPLGSPAATMYLEMLIDFGARTVIAVGSCGALTALPEEQLLIPTVALRDEGTSFHYLAAADWVPLDPKVIQVLGTTLTKACLPWQMVKTWTTDAFFRETVSKVKAARQQGCQVVEMECSALAACSAFRQVSFGQLLYTADTLAQLEHYDPRHWGAGGVLVAIELATESLAAY
>NC_020229.1|WP_003641730.1|364249_364444_-|PspC-domain-containing-protein
MKIDIHRSATDRVIAGVIGGIAEHFNWNTNVTRLLFVVLAITPMFPGIIAYLILWLLMKDPIKD
>NC_020229.1|WP_003646320.1|364509_365112_-|NAD(P)H-dependent-oxidoreductase
MFKIAIILGSTRSQANGRALFNHLKLIIDQLPTHSTIHYQFLDLANYQLPLFDEPEPPMANPHRELPANQQQWLTDMASADGYIILTPEYNHAMPAGLKNAFDFLAFEGARKPAKIISYSDNMRGGQFGAAALVPVLQRLGMVVLPKPTPIGNVPQTLQSNGHFIDNAPLSKRYDHALHQALTEITYYTTVLTTTPFPTD
>NC_020229.1|WP_003646321.1|365225_365699_+|winged-helix-turn-helix-transcriptional-regulator
MTTPLVSQLMTELNQFLTQDSVDDQEKRWAMQQTTDPQLQAALKQLSTTDIKIIAYLGRRGASRAKSLPAPTELSQATISRGLTKLSRLKLATKYRDLTNNKEILVRLTTLGEAVADLHTQLDAAIAAKAQAIADDYSDAELRRFVSLMRRIREIKI
>NC_020229.1|WP_003641733.1|365844_366267_+|Hsp20/alpha-crystallin-family-protein
MANTLMNRNDFGMLDPFERMARSFWAPLENMDQVLKTDINETDDQYQVKVDVPGIDKQDVKLDYRDNVLSIKVQKDSFVDHEDQDQNIVMNERHTGTLQRQYMLPNVAADKITASQADGVLTITLPKTQPSANDGQIEIQ
>NC_020229.1|WP_003646323.1|366354_366810_-|DUF3021-domain-containing-protein
MKRLWHTLLIGAIGGIVIGYLMALGFSTFFNTTYLFPSNPTFVSHWSSPLAATQLSTLLWILIGEVWAFSSWLFEIETWSITKQTIAHCLCSYLGMTPLAILCGWFPLNVRWFGFYTLVYTGAYIGLWLIEMALARIKVIQLNQQLTNHRS
>NC_020229.1|WP_071542797.1|366806_367091_-|LytTR-family-transcriptional-regulator
MPLQSVSRFYTANKRLYCETTTGAYLVHSHLHTLMDQLPPHQFLRISSSEIVRIACVKNFTLTKWGSFQVNLTTGTTTYASRRYTQQIRKAAQL
>NC_020229.1|WP_003643663.1|367389_368622_+|MFS-transporter
MDDAERERGPWHRNLIVLWFCTFVAGMAFSEIMPFLSLFVSQLGDFTKAQITFYSGLAFAADYAISAISAPLWGIIADKKGRKIMLLRASLGMAVAMGLMGFVTNVWQLVALRALQGVFAGFISNAQALVASQTPRKYSGRALSTLITGAVSGQLFGPVIGGLLAQLFSIRNTFFITAGLLMVAFLLSLFFVQEHFKPVAHHREPGDSRNPLAAFQNPRLIIVMLCSTAIVQFGNASIAPIISLYVRELMHYRGPITVVAGIIAALPGISNIFSAPRLGRYGDQHGSGKVLLFGYIFAVIMYFPQGIVTSVVALGILRFAIGISDGALYPEIQTVLTKNTPVHLTSTIFSYNQSFQAIGNMFGALLGGLVAGWFNYNAVFIMTALLLLINLGLILWLVPDIWKNGKRAVS
>NC_020229.1|WP_015379645.1|368712_369012_+|winged-helix-turn-helix-transcriptional-regulator
MNIEISKQDQADQQRVAIFKALADANRLRIIRVLYQAQREMTCSEVGAQLNISKSTVSYHFKTLRLVGLTNTRRKAQTKYLSLQLATFDRFLPGFLATL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_020229_1	1.5\|360230\|30\|NC_020229\|PILER-CR,CRISPRCasFinder,CRT	360230-360259	30	JX486087	Lactobacillus phage ATCC 8014-B1, complete genome	790-819	1	0.967
NC_020229_1	1.5\|360230\|30\|NC_020229\|PILER-CR,CRISPRCasFinder,CRT	360230-360259	30	JN051154	Pediococcus phage clP1, complete genome	6473-6502	1	0.967
NC_020229_1	1.2\|360032\|30\|NC_020229\|PILER-CR,CRISPRCasFinder,CRT	360032-360061	30	JX486088	Lactobacillus phage ATCC 8014-B2, complete genome	12816-12845	3	0.9
NC_020229_1	1.2\|360032\|30\|NC_020229\|PILER-CR,CRISPRCasFinder,CRT	360032-360061	30	NC_047764	Lactobacillus phage P1, complete genome	8195-8224	4	0.867
NC_020229_1	1.2\|360032\|30\|NC_020229\|PILER-CR,CRISPRCasFinder,CRT	360032-360061	30	KY381600	Lactobacillus phage P2, complete genome	11699-11728	4	0.867
NC_020229_1	1.2\|360032\|30\|NC_020229\|PILER-CR,CRISPRCasFinder,CRT	360032-360061	30	MG744354	Lactobacillus phage Satyr, complete genome	69206-69235	4	0.867
NC_020229_1	1.2\|360032\|30\|NC_020229\|PILER-CR,CRISPRCasFinder,CRT	360032-360061	30	MG765274	Lactobacillus phage Maenad, complete genome	67131-67160	4	0.867
NC_020229_1	1.2\|360032\|30\|NC_020229\|PILER-CR,CRISPRCasFinder,CRT	360032-360061	30	MK448823	Streptococcus phage Javan633, complete genome	14256-14285	9	0.7
NC_020229_1	1.2\|360032\|30\|NC_020229\|PILER-CR,CRISPRCasFinder,CRT	360032-360061	30	MK448996	Streptococcus phage Javan628, complete genome	14256-14285	9	0.7

1. spacer 1.5|360230|30|NC_020229|PILER-CR,CRISPRCasFinder,CRT matches to JX486087 (Lactobacillus phage ATCC 8014-B1, complete genome) position: , mismatch: 1, identity: 0.967

tcagacctgaacgtttacaacctatttacg	CRISPR spacer
tcagacctgaacgtttacaacctattcacg	Protospacer
**************************.***

2. spacer 1.5|360230|30|NC_020229|PILER-CR,CRISPRCasFinder,CRT matches to JN051154 (Pediococcus phage clP1, complete genome) position: , mismatch: 1, identity: 0.967

tcagacctgaacgtttacaacctatttacg	CRISPR spacer
tcagacctgaacgtttacaacctattcacg	Protospacer
**************************.***

3. spacer 1.2|360032|30|NC_020229|PILER-CR,CRISPRCasFinder,CRT matches to JX486088 (Lactobacillus phage ATCC 8014-B2, complete genome) position: , mismatch: 3, identity: 0.9

cttgaagaagttaaggcacaaactccaacg	CRISPR spacer
cttgaagaagtcaaggcacaaaccccaact	Protospacer
***********.***********.*****

4. spacer 1.2|360032|30|NC_020229|PILER-CR,CRISPRCasFinder,CRT matches to NC_047764 (Lactobacillus phage P1, complete genome) position: , mismatch: 4, identity: 0.867

cttgaagaagttaaggcacaaactccaacg	CRISPR spacer
cttgaagaagtaaaagcacaaactccatca	Protospacer
*********** **.************ *.

5. spacer 1.2|360032|30|NC_020229|PILER-CR,CRISPRCasFinder,CRT matches to KY381600 (Lactobacillus phage P2, complete genome) position: , mismatch: 4, identity: 0.867

cttgaagaagttaaggcacaaactccaacg	CRISPR spacer
cttgaagaagtaaaagcacaaactccatca	Protospacer
*********** **.************ *.

6. spacer 1.2|360032|30|NC_020229|PILER-CR,CRISPRCasFinder,CRT matches to MG744354 (Lactobacillus phage Satyr, complete genome) position: , mismatch: 4, identity: 0.867

cttgaagaagttaaggcacaaactccaacg	CRISPR spacer
cttgaagaagtaaaagcacaaactccatca	Protospacer
*********** **.************ *.

7. spacer 1.2|360032|30|NC_020229|PILER-CR,CRISPRCasFinder,CRT matches to MG765274 (Lactobacillus phage Maenad, complete genome) position: , mismatch: 4, identity: 0.867

cttgaagaagttaaggcacaaactccaacg	CRISPR spacer
cttgaagaagtaaaagcacaaactccatca	Protospacer
*********** **.************ *.

8. spacer 1.2|360032|30|NC_020229|PILER-CR,CRISPRCasFinder,CRT matches to MK448823 (Streptococcus phage Javan633, complete genome) position: , mismatch: 9, identity: 0.7

cttgaagaagttaaggcacaaactccaacg	CRISPR spacer
cttgaagcagttaaggcacaattgatagga	Protospacer
******* ************* .  .*. .

9. spacer 1.2|360032|30|NC_020229|PILER-CR,CRISPRCasFinder,CRT matches to MK448996 (Streptococcus phage Javan628, complete genome) position: , mismatch: 9, identity: 0.7

cttgaagaagttaaggcacaaactccaacg	CRISPR spacer
cttgaagcagttaaggcacaattgatagga	Protospacer
******* ************* .  .*. .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

576587 : 675010

unidentified_phage(16.67%)

transposase,protease,tRNA,bacteriocin

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015379748.1\|576587_577151_-\|protease	matrixin family metalloprotease	NA	NA	NA	NA
WP_015379749.1\|577344_578013_+	ribose 5-phosphate isomerase A	NA	NA	NA	NA
WP_015379750.1\|578170_579676_+	multicopper oxidase domain-containing protein	NA	NA	NA	NA
WP_003643763.1\|579940_580309_+	DUF1304 domain-containing protein	NA	NA	NA	NA
WP_003641932.1\|580421_580931_-	YbhB/YbcL family Raf kinase inhibitor-like protein	NA	NA	NA	NA
WP_011100975.1\|580961_582158_-	DUF2075 domain-containing protein	NA	NA	NA	NA
WP_003641934.1\|582267_582738_+	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_015379751.1\|582756_583212_+	hypothetical protein	NA	NA	NA	NA
WP_003641936.1\|583315_583888_+	acetyl-CoA carboxylase biotin carboxyl carrier protein subunit	NA	NA	NA	NA
WP_003646441.1\|584053_584974_-	ribonucleoside hydrolase RihC	NA	NA	NA	NA
WP_015379753.1\|585110_586010_+	oxidoreductase	NA	NA	NA	NA
WP_043992582.1\|587895_588819_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	8.7e-33	31.9
WP_015379757.1\|589559_590006_-	ribonuclease H-like protein	NA	NA	NA	NA
WP_003643770.1\|590243_591770_+	ABC transporter permease/substrate-binding protein	NA	NA	NA	NA
WP_003641941.1\|591770_592742_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.7e-23	31.7
WP_043992584.1\|592819_594151_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_015379759.1\|594616_596134_+	glycerol kinase GlpK	NA	NA	NA	NA
WP_003643774.1\|596148_597978_+	type 1 glycerol-3-phosphate oxidase	NA	NA	NA	NA
WP_003641945.1\|597992_598715_+	aquaporin family protein	M1HWZ0	Paramecium_bursaria_Chlorella_virus	3.2e-30	31.9
WP_015379760.1\|598910_599528_-	sugar O-acetyltransferase	NA	NA	NA	NA
WP_003646460.1\|599531_600686_-	MFS transporter	NA	NA	NA	NA
WP_015379761.1\|600689_601481_-	HAD family hydrolase	NA	NA	NA	NA
WP_015379762.1\|601551_602424_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_003641966.1\|602583_603399_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_015379763.1\|603926_605303_+	branched-chain amino acid transport system II carrier protein	NA	NA	NA	NA
WP_011100995.1\|605347_606532_+	cation:proton antiporter	NA	NA	NA	NA
WP_003643800.1\|607193_607337_+	hypothetical protein	NA	NA	NA	NA
WP_050495850.1\|607348_607537_+	hypothetical protein	NA	NA	NA	NA
WP_080125207.1\|607998_608310_-\|transposase	transposase	NA	NA	NA	NA
WP_120787350.1\|608416_608620_-\|transposase	transposase	NA	NA	NA	NA
WP_015379767.1\|608775_609291_+	cation:proton antiporter	NA	NA	NA	NA
WP_003641969.1\|609495_609699_+	hypothetical protein	NA	NA	NA	NA
WP_003643805.1\|610110_610779_-	hypothetical protein	NA	NA	NA	NA
WP_003641972.1\|610775_610949_-\|bacteriocin	two-peptide bacteriocin plantaricin JK subunit PlnK	NA	NA	NA	NA
WP_015379769.1\|610979_611147_-\|bacteriocin	two-peptide bacteriocin plantaricin JK subunit PlnJ	NA	NA	NA	NA
WP_015379772.1\|612253_613000_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003643807.1\|613131_613281_+	hypothetical protein	NA	NA	NA	NA
WP_015379773.1\|613294_613846_+	hypothetical protein	NA	NA	NA	NA
WP_015379774.1\|613877_615053_-\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_004271307.1\|615252_616176_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	6.7e-33	31.9
WP_015379778.1\|618628_620008_+	HlyD family secretion protein	NA	NA	NA	NA
WP_015379779.1\|620094_620784_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_015379780.1\|620851_621520_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_015379781.1\|621606_622287_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_015379782.1\|622380_623067_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_027821496.1\|623204_623408_+	hypothetical protein	NA	NA	NA	NA
WP_015379783.1\|623502_625812_-	ATP-binding domain-containing protein	NA	NA	NA	NA
WP_015379784.1\|626070_626847_+	carbon-nitrogen family hydrolase	NA	NA	NA	NA
WP_043992597.1\|627280_628297_+\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_003641997.1\|628702_629413_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_015379786.1\|629485_630847_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_003641999.1\|630853_631042_+	hypothetical protein	NA	NA	NA	NA
WP_003642000.1\|631031_631454_+	DUF3284 domain-containing protein	NA	NA	NA	NA
WP_043992963.1\|631676_633032_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_003642002.1\|633049_634486_+	6-phospho-beta-glucosidase	A0A0B5JD41	Pandoravirus	9.7e-31	25.5
WP_015379788.1\|634606_635503_+	ROK family protein	NA	NA	NA	NA
WP_015379789.1\|635652_636399_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_043992598.1\|636511_637525_+\|tRNA	tRNA-dihydrouridine synthase family protein	NA	NA	NA	NA
WP_003642008.1\|637924_638842_+	Ppx/GppA family phosphatase	NA	NA	NA	NA
WP_015379791.1\|638887_640162_+	hydroxymethylglutaryl-CoA reductase, degradative	NA	NA	NA	NA
WP_003642010.1\|640154_641114_+	hypothetical protein	NA	NA	NA	NA
WP_015379792.1\|641135_641840_+	NAD-dependent protein deacylase	NA	NA	NA	NA
WP_015379793.1\|641839_642682_+	DUF72 domain-containing protein	NA	NA	NA	NA
WP_015379795.1\|643276_643666_+	NUDIX domain-containing protein	NA	NA	NA	NA
WP_015379796.1\|643987_646039_+\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	4.5e-90	35.8
WP_015379797.1\|646517_646844_+	hypothetical protein	NA	NA	NA	NA
WP_015379798.1\|647173_648358_+	multidrug effflux MFS transporter	NA	NA	NA	NA
WP_043992601.1\|648391_649282_-	XRE family transcriptional regulator	NA	NA	NA	NA
WP_015379801.1\|649844_650333_+	hypothetical protein	NA	NA	NA	NA
WP_003643825.1\|650584_651361_+	TatD family hydrolase	NA	NA	NA	NA
WP_003643826.1\|651347_651911_+	ribonuclease M5	NA	NA	NA	NA
WP_015379803.1\|651907_652798_+	16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA	NA	NA	NA	NA
WP_003642020.1\|652902_653154_+	Veg family protein	NA	NA	NA	NA
WP_015379804.1\|653286_654153_+	4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase	NA	NA	NA	NA
WP_015379805.1\|654462_655407_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_003642023.1\|655674_656373_+	ABC transporter ATP-binding protein	A0A1V0SGN0	Hokovirus	1.2e-15	27.8
WP_003646500.1\|656365_657163_+	metal ABC transporter permease	NA	NA	NA	NA
WP_003646503.1\|658345_658888_+	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_003642029.1\|658902_659166_+	hypothetical protein	NA	NA	NA	NA
WP_003642030.1\|659658_660495_+	pur operon repressor	NA	NA	NA	NA
WP_003646504.1\|660563_661946_+	bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU	A0A2K9L140	Tupanvirus	5.7e-28	33.2
WP_015379807.1\|662181_663006_+	serine hydrolase	NA	NA	NA	NA
WP_003643830.1\|663371_664352_+	ribose-phosphate diphosphokinase	A0A2K9L8D8	Tupanvirus	4.9e-42	36.3
WP_015379808.1\|664640_665663_+	YdcF family protein	NA	NA	NA	NA
WP_043992605.1\|665745_666732_+	hypothetical protein	NA	NA	NA	NA
WP_015379810.1\|666901_667711_-	sugar-phosphatase	NA	NA	NA	NA
WP_187291423.1\|667730_669089_-	HD domain-containing protein	A0A1B1ISR1	uncultured_Mediterranean_phage	5.2e-26	32.9
WP_024971479.1\|669097_670030_-	lipoate--protein ligase family protein	NA	NA	NA	NA
WP_003642040.1\|670392_670833_+	DUF1934 domain-containing protein	NA	NA	NA	NA
WP_003642041.1\|670877_671486_+	DNA-directed RNA polymerase subunit delta	NA	NA	NA	NA
WP_003642042.1\|671658_673272_+	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	1.2e-143	49.9
WP_015379813.1\|673738_675010_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	4.5e-96	43.7

DBSCAN-SWA_2

811035 : 819659

Streptococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015379866.1\|811035_812733_+	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	3.9e-55	37.0
WP_003640956.1\|812754_813063_+	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_003637790.1\|813078_813678_+	recombination protein RecR	NA	NA	NA	NA
WP_003640957.1\|813692_813944_+	YaaL family protein	NA	NA	NA	NA
WP_016510978.1\|814341_815007_+	dTMP kinase	M1PSC7	Streptococcus_phage	1.4e-53	52.7
WP_003640965.1\|815003_815333_+	cyclic-di-AMP receptor	NA	NA	NA	NA
WP_003640966.1\|815349_816369_+	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	2.1e-32	33.5
WP_015379867.1\|816393_816741_+	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	2.4e-12	33.3
WP_015379868.1\|816839_817736_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	1.9e-80	55.3
WP_003640969.1\|817739_818525_+	acyl-ACP thioesterase	NA	NA	NA	NA
WP_015379869.1\|818663_819659_+	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	7.7e-51	37.9

DBSCAN-SWA_3

1014488 : 1083197

Lactobacillus_phage(25.0%)

transposase,protease,bacteriocin,tRNA,integrase

attL 1041795:1041816|attR 1044624:1044645

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004271307.1\|1014488_1015412_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	6.7e-33	31.9
WP_015379932.1\|1017234_1017603_-	hypothetical protein	NA	NA	NA	NA
WP_003641165.1\|1017836_1018205_-	helix-turn-helix transcriptional regulator	E9LUL4	Lactobacillus_phage	5.9e-17	42.7
WP_015379934.1\|1018770_1019454_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_015379935.1\|1019673_1020018_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_003645768.1\|1020173_1020881_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_015640093.1\|1020889_1021765_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	2.8e-20	28.9
WP_043992660.1\|1021841_1023140_-	MFS transporter	NA	NA	NA	NA
WP_015379937.1\|1023413_1025921_+	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_003645764.1\|1026405_1026789_+	hypothetical protein	NA	NA	NA	NA
WP_003645763.1\|1026778_1028626_+	acetyltransferase	A0A1R3Y5Q6	Salmonella_virus	5.8e-20	23.7
WP_003641172.1\|1028866_1029121_+	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
WP_003644045.1\|1029132_1029678_+	alkaline shock response membrane anchor protein AmaP	NA	NA	NA	NA
WP_003641174.1\|1029690_1029873_+	hypothetical protein	NA	NA	NA	NA
WP_003644046.1\|1029887_1030310_+	Asp23/Gls24 family envelope stress response protein	NA	NA	NA	NA
WP_003641176.1\|1030370_1030811_+	Asp23/Gls24 family envelope stress response protein	NA	NA	NA	NA
WP_016511031.1\|1031014_1031815_+	fumarylacetoacetate hydrolase family protein	NA	NA	NA	NA
WP_003645760.1\|1031946_1032957_+	DUF4767 domain-containing protein	NA	NA	NA	NA
WP_003644049.1\|1033318_1033651_+	PTS lactose/cellobiose transporter subunit IIA	NA	NA	NA	NA
WP_003644050.1\|1033756_1034329_+	hypothetical protein	NA	NA	NA	NA
WP_003645758.1\|1034510_1037045_+	M1 family metallopeptidase	A0A0P0IY26	Acinetobacter_phage	3.5e-68	27.4
WP_015379940.1\|1037272_1040146_+	type I restriction endonuclease subunit R	NA	NA	NA	NA
WP_043992664.1\|1040159_1041746_+	type I restriction-modification system subunit M	A0A2H4PQP4	Staphylococcus_phage	3.5e-175	62.7
1041795:1041816	attL	NA	NA	NA	NA
WP_015379944.1\|1043084_1044002_+\|integrase	site-specific integrase	A8ATM2	Listeria_phage	2.7e-74	44.7
WP_080125224.1\|1044012_1044594_-	restriction endonuclease subunit S	NA	NA	NA	NA
WP_120787327.1\|1044598_1045003_+	restriction endonuclease subunit S	NA	NA	NA	NA
1044624:1044645	attR	NA	NA	NA	NA
WP_080125226.1\|1044969_1045203_+	restriction endonuclease subunit S	NA	NA	NA	NA
WP_015379946.1\|1045516_1046047_-	histidine phosphatase family protein	NA	NA	NA	NA
WP_003645748.1\|1049939_1050059_+	putative metal homeostasis protein	NA	NA	NA	NA
WP_015379951.1\|1050708_1051461_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_015379952.1\|1051560_1052112_+	helix-turn-helix domain-containing protein	X2CXD8	Lactobacillus_phage	8.4e-07	48.4
WP_003645746.1\|1052182_1053109_-	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	3.2e-19	25.8
WP_015379953.1\|1053295_1055185_+	FAD-binding protein	A0A2P0ZL82	Lactobacillus_phage	5.2e-16	26.2
WP_015379956.1\|1055460_1055934_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_043992667.1\|1056042_1056660_-	NAD(P)H-dependent oxidoreductase	NA	NA	NA	NA
WP_015379958.1\|1056720_1058016_-\|tRNA	asparagine--tRNA ligase	A0A2P1EMB4	Moumouvirus	1.1e-57	31.4
WP_015379959.1\|1058054_1059062_-	aspartate--ammonia ligase	A0A1C9C5F0	Heterosigma_akashiwo_virus	1.4e-63	43.0
WP_015379960.1\|1059513_1060920_-	C69 family dipeptidase	NA	NA	NA	NA
WP_015379961.1\|1060955_1062188_-	hypothetical protein	NA	NA	NA	NA
WP_003644064.1\|1062238_1062505_-	hypothetical protein	NA	NA	NA	NA
WP_003641200.1\|1062724_1062922_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_015379962.1\|1063179_1064988_+	DNA helicase RecQ	M1PGQ0	Moumouvirus	1.0e-77	36.1
WP_015379963.1\|1065030_1065912_+	RluA family pseudouridine synthase	NA	NA	NA	NA
WP_003641203.1\|1066103_1066430_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_015379964.1\|1066764_1067547_+	NAD(P)H-dependent oxidoreductase	NA	NA	NA	NA
WP_015379965.1\|1067966_1068968_+	hypothetical protein	NA	NA	NA	NA
WP_080125228.1\|1068931_1070182_+	YibE/F family protein	NA	NA	NA	NA
WP_003641207.1\|1070178_1070943_+	YibE/F family protein	NA	NA	NA	NA
WP_016526995.1\|1070993_1071563_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_015379968.1\|1071694_1072363_+	histidine phosphatase family protein	NA	NA	NA	NA
WP_015379969.1\|1072455_1073598_-	lactonase family protein	NA	NA	NA	NA
WP_015379970.1\|1073613_1074828_-	mandelate racemase/muconate lactonizing enzyme family protein	Q6A202	Oenococcus_phage	2.5e-48	33.8
WP_015379971.1\|1075077_1076412_+	gluconate transporter	NA	NA	NA	NA
WP_086989537.1\|1076745_1077520_+\|transposase	IS5-like element ISLpl3 family transposase	A0A0N9SHJ4	Paenibacillus_phage	2.1e-27	53.2
WP_015379972.1\|1077823_1079221_-	anion permease	NA	NA	NA	NA
WP_043992670.1\|1079235_1080213_-	hydroxyacid dehydrogenase	A0A285PXZ1	Cedratvirus	2.1e-32	32.3
WP_015379974.1\|1080361_1081255_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_015379975.1\|1081403_1082732_+	glucarate dehydratase	NA	NA	NA	NA
WP_021357097.1\|1082867_1083197_-\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA

DBSCAN-SWA_4

1428704 : 1473182

Lactobacillus_phage(95.45%)

portal,protease,capsid,terminase,tail,integrase

attL 1434410:1434435|attR 1474285:1474310

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645251.1\|1428704_1429391_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_015380148.1\|1430062_1430539_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_003643148.1\|1430655_1431168_-	hypothetical protein	NA	NA	NA	NA
WP_003643147.1\|1431282_1431570_+	hypothetical protein	NA	NA	NA	NA
WP_015380149.1\|1431634_1433902_+	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	2.6e-118	31.4
1434410:1434435	attL	NA	NA	NA	NA
WP_015380150.1\|1434489_1435620_-\|integrase	site-specific integrase	A0A0M9JJ77	Lactobacillus_phage	1.2e-92	48.2
WP_015380151.1\|1435790_1438583_-	N-6 DNA methylase	Q6NE04	Leptospira_phage	9.4e-147	35.4
WP_015380152.1\|1438705_1439329_-	hypothetical protein	NA	NA	NA	NA
WP_015380153.1\|1439416_1439857_-	hypothetical protein	NA	NA	NA	NA
WP_003643876.1\|1439880_1440312_-	hypothetical protein	A0A2P0ZLA0	Lactobacillus_phage	7.6e-80	100.0
WP_015380154.1\|1440321_1440711_-	helix-turn-helix transcriptional regulator	A0A2P0ZLA1	Lactobacillus_phage	1.5e-66	97.6
WP_015380155.1\|1441017_1441227_+	hypothetical protein	A0A2P0ZL97	Lactobacillus_phage	1.6e-30	98.6
WP_015380156.1\|1441230_1441434_+	hypothetical protein	A0A2P0ZLA4	Lactobacillus_phage	5.5e-25	85.1
WP_043993003.1\|1441499_1441772_+	DUF771 domain-containing protein	E9LUT3	Lactobacillus_phage	4.5e-30	66.7
WP_015380158.1\|1441886_1442168_+	hypothetical protein	NA	NA	NA	NA
WP_015380159.1\|1442148_1442325_+	hypothetical protein	A0A2P0ZLB1	Lactobacillus_phage	6.5e-22	82.8
WP_015380160.1\|1442317_1442503_+	hypothetical protein	A0A2P0ZLA3	Lactobacillus_phage	7.0e-27	88.5
WP_021730257.1\|1442474_1442645_+	hypothetical protein	A0A2P0ZLA6	Lactobacillus_phage	5.5e-26	98.2
WP_015380163.1\|1442747_1443227_+	siphovirus Gp157 family protein	A0A2P0ZLB3	Lactobacillus_phage	1.1e-79	93.7
WP_043992724.1\|1443226_1444603_+	DEAD/DEAH box helicase family protein	A0A2P0ZLA5	Lactobacillus_phage	3.1e-236	96.5
WP_015380165.1\|1444599_1445316_+	AAA family ATPase	A0A2P0ZLB2	Lactobacillus_phage	7.8e-114	98.6
WP_015380166.1\|1445318_1445942_+	hypothetical protein	A0A2P0ZLB9	Lactobacillus_phage	2.0e-102	98.4
WP_015380167.1\|1445955_1446510_+	hypothetical protein	NA	NA	NA	NA
WP_015380168.1\|1446947_1447742_+	bifunctional DNA primase/polymerase	A0A2P0ZLB0	Lactobacillus_phage	7.1e-124	85.6
WP_015380169.1\|1447738_1449013_+	helicase	A0A2P0ZLC4	Lactobacillus_phage	4.8e-239	97.4
WP_015380170.1\|1449270_1449603_+	VRR-NUC domain-containing protein	A0A2P0ZLB6	Lactobacillus_phage	3.7e-58	95.5
WP_015380172.1\|1449780_1450260_+	hypothetical protein	A0A2P0ZL79	Lactobacillus_phage	2.7e-78	93.2
WP_015380173.1\|1450396_1450708_+	hypothetical protein	A0A2P0ZLD0	Lactobacillus_phage	2.1e-47	91.3
WP_015380174.1\|1450719_1451133_+	hypothetical protein	A0A2P0ZLC0	Lactobacillus_phage	1.4e-70	99.3
WP_015380175.1\|1451208_1451898_+	hypothetical protein	NA	NA	NA	NA
WP_015380176.1\|1452077_1452647_+	YfbU family protein	NA	NA	NA	NA
WP_015380177.1\|1452852_1453068_+	hypothetical protein	A0A2P0ZLC2	Lactobacillus_phage	1.4e-29	87.3
WP_043992727.1\|1453051_1453390_+	HNH endonuclease	A0A2P0ZLC6	Lactobacillus_phage	2.2e-58	91.1
WP_015380178.1\|1453389_1453632_+	hypothetical protein	A0A2P0ZLD3	Lactobacillus_phage	9.5e-32	82.5
WP_015380179.1\|1453776_1454028_+	hypothetical protein	A0A2P0ZLD2	Lactobacillus_phage	3.9e-36	91.6
WP_015380180.1\|1454136_1454424_+\|terminase	P27 family phage terminase small subunit	A0A2P0ZLC8	Lactobacillus_phage	2.2e-43	96.8
WP_015380181.1\|1454420_1456100_+\|terminase	terminase large subunit	A0A2P0ZLE5	Lactobacillus_phage	0.0e+00	98.8
WP_015380182.1\|1456118_1457261_+\|portal	phage portal protein	A0A2P0ZLC9	Lactobacillus_phage	5.3e-213	97.4
WP_015380183.1\|1457247_1458000_+\|protease	Clp protease ClpP	A0A2P0ZLE3	Lactobacillus_phage	7.1e-134	99.6
WP_015380184.1\|1458020_1459199_+\|capsid	phage major capsid protein	A0A2P0ZLD6	Lactobacillus_phage	2.3e-219	99.7
WP_015380185.1\|1459337_1459643_+	hypothetical protein	A0A2P0ZLD5	Lactobacillus_phage	6.6e-46	94.1
WP_015380186.1\|1459623_1460013_+	hypothetical protein	A0A2P0ZLD1	Lactobacillus_phage	3.8e-62	87.6
WP_015380187.1\|1460009_1460417_+	HK97 gp10 family phage protein	A0A2P0ZLD7	Lactobacillus_phage	2.0e-66	94.1
WP_015380188.1\|1460413_1460836_+	hypothetical protein	A0A2P0ZLE4	Lactobacillus_phage	6.3e-71	97.1
WP_015380189.1\|1460850_1461462_+	hypothetical protein	A0A2P0ZLF5	Lactobacillus_phage	3.3e-105	96.6
WP_015380190.1\|1461553_1461868_+	hypothetical protein	A0A2P0ZLF3	Lactobacillus_phage	9.5e-48	90.4
WP_003643912.1\|1461891_1462113_+	hypothetical protein	A0A2P0ZLD9	Lactobacillus_phage	3.9e-32	98.6
WP_015380191.1\|1462131_1466679_+\|tail	phage tail tape measure protein	A0A2P0ZLF1	Lactobacillus_phage	0.0e+00	82.7
WP_015380192.1\|1466682_1467504_+	hypothetical protein	A0A2P0ZLE2	Lactobacillus_phage	6.8e-154	100.0
WP_015380193.1\|1467523_1471330_+	hypothetical protein	A0A2P0ZLE1	Lactobacillus_phage	0.0e+00	70.6
WP_015380194.1\|1471358_1471850_+	DUF1617 family protein	A0A2P0ZLE0	Lactobacillus_phage	1.6e-49	65.0
WP_015380196.1\|1472302_1472683_+	hypothetical protein	A0A2P0ZLF7	Lactobacillus_phage	7.2e-50	75.2
WP_015380197.1\|1472688_1472898_+	hypothetical protein	A0A2P0ZLG4	Lactobacillus_phage	1.3e-08	58.0
WP_015380198.1\|1472897_1473182_+	hypothetical protein	A0A2P0ZLE8	Lactobacillus_phage	2.0e-41	96.8
1474285:1474310	attR	NA	NA	NA	NA

DBSCAN-SWA_5

1521919 : 1531757

Lactobacillus_phage(87.5%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015640258.1\|1521919_1523149_+	hypothetical protein	A0A2P0ZL72	Lactobacillus_phage	2.7e-215	97.7
WP_015640259.1\|1523239_1524211_-	Nisin resistance protein	A0A2P0ZL68	Lactobacillus_phage	2.0e-181	98.8
WP_003643099.1\|1524396_1525344_-	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	2.7e-178	100.0
WP_003643097.1\|1525687_1526302_+	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	6.3e-112	100.0
WP_015380220.1\|1526304_1528743_+	flavocytochrome c	A0A2P0ZL82	Lactobacillus_phage	0.0e+00	99.5
WP_003643095.1\|1528830_1529391_+	hypothetical protein	A0A2P0ZL75	Lactobacillus_phage	2.7e-101	100.0
WP_003643094.1\|1529461_1529902_-	nucleoside 2-deoxyribosyltransferase	A0A2P0ZL88	Lactobacillus_phage	8.0e-77	99.3
WP_015380221.1\|1529997_1530135_+	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_003645220.1\|1530761_1531757_+	glycosyltransferase family 2 protein	S5FKN0	Shigella_phage	3.1e-52	38.8

DBSCAN-SWA_6

2035204 : 2116504

Lactobacillus_phage(80.0%)

portal,protease,capsid,head,tRNA,tail,terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015380446.1\|2035204_2036128_-\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA
WP_003645967.1\|2036612_2037134_-	shikimate kinase	NA	NA	NA	NA
WP_003645966.1\|2037136_2038234_-	prephenate dehydrogenase	NA	NA	NA	NA
WP_015380447.1\|2038236_2039535_-	3-phosphoshikimate 1-carboxyvinyltransferase	NA	NA	NA	NA
WP_003645964.1\|2039548_2040076_-	amino acid biosynthesis protein	NA	NA	NA	NA
WP_003640721.1\|2040084_2041254_-	chorismate synthase	NA	NA	NA	NA
WP_015380448.1\|2041246_2042701_-	MFS transporter	NA	NA	NA	NA
WP_003640723.1\|2043349_2043703_-	30S ribosome-binding factor RbfA	NA	NA	NA	NA
WP_003645962.1\|2043725_2046302_-	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	9.6e-21	23.3
WP_003640725.1\|2046316_2046622_-	ribosomal L7Ae/L30e/S12e/Gadd45 family protein	NA	NA	NA	NA
WP_003640726.1\|2046611_2046911_-	YlxR family protein	NA	NA	NA	NA
WP_003640727.1\|2046955_2048173_-	transcription termination/antitermination protein NusA	NA	NA	NA	NA
WP_003640728.1\|2048193_2048670_-	ribosome maturation factor RimP	NA	NA	NA	NA
WP_015380449.1\|2048965_2053279_-	DNA polymerase III subunit alpha	A0A1X9SH08	Bradyrhizobium_phage	1.0e-14	34.0
WP_003640732.1\|2053772_2055482_-\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
WP_003640733.1\|2055521_2056799_-\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
WP_003640734.1\|2056836_2057622_-	phosphatidate cytidylyltransferase	NA	NA	NA	NA
WP_003640735.1\|2057637_2058417_-	isoprenyl transferase	R9W0U9	Flavobacterium_phage	1.1e-23	43.1
WP_015380452.1\|2058536_2059100_-	ribosome recycling factor	NA	NA	NA	NA
WP_003640737.1\|2059101_2059824_-	UMP kinase	NA	NA	NA	NA
WP_003644498.1\|2060023_2060902_-	elongation factor Ts	NA	NA	NA	NA
WP_003640739.1\|2061004_2061808_-	30S ribosomal protein S2	NA	NA	NA	NA
WP_003640740.1\|2062032_2062755_+	HAD family hydrolase	NA	NA	NA	NA
WP_003640741.1\|2063044_2064043_-	D-2-hydroxyacid dehydrogenase	M1HKI4	Acanthocystis_turfacea_Chlorella_virus	2.3e-47	34.9
WP_015380454.1\|2064127_2064433_-	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_003645629.1\|2064416_2065175_-\|tRNA	tRNA1(Val) (adenine(37)-N6)-methyltransferase	NA	NA	NA	NA
WP_003645630.1\|2065286_2065922_+	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_003640745.1\|2065978_2066215_-	YneF family protein	NA	NA	NA	NA
WP_003644501.1\|2066312_2066552_-	DUF896 domain-containing protein	NA	NA	NA	NA
WP_003640747.1\|2066703_2067336_+	transcriptional repressor LexA	A0A1B2APZ1	Phage_Wrath	2.3e-16	56.2
WP_089197934.1\|2067425_2067656_-	DNA alkylation repair protein	NA	NA	NA	NA
WP_003645631.1\|2067959_2068589_+	hypothetical protein	NA	NA	NA	NA
WP_015380455.1\|2068638_2069808_-	hydroxymethylglutaryl-CoA synthase	NA	NA	NA	NA
WP_015380456.1\|2069843_2070236_-	hypothetical protein	NA	NA	NA	NA
WP_015380457.1\|2070399_2070792_+	hypothetical protein	NA	NA	NA	NA
WP_003645635.1\|2071237_2072179_+	glycosyltransferase family 2 protein	V9QJB1	Oenococcus_phage	3.1e-78	48.7
WP_003645636.1\|2072878_2073451_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_003644505.1\|2073602_2074787_-	LCP family protein	NA	NA	NA	NA
WP_003645638.1\|2074767_2075559_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.5e-30	36.8
WP_003645640.1\|2077797_2079009_-	FtsW/RodA/SpoVE family cell cycle protein	NA	NA	NA	NA
WP_015380463.1\|2079796_2080171_-	nitrate/sulfonate/bicarbonate ABC transporter permease	A0A2K9VCG4	Lactobacillus_phage	2.6e-20	76.2
WP_003644510.1\|2080180_2080444_-	hemolysin XhlA family protein	E9LUR9	Lactobacillus_phage	2.0e-38	100.0
WP_015380464.1\|2080443_2081622_-	LysM peptidoglycan-binding domain-containing protein	E9LUR8	Lactobacillus_phage	6.9e-200	89.0
WP_015380465.1\|2081633_2081846_-	hypothetical protein	A0A0A1ENR9	Lactobacillus_phage	2.0e-17	80.3
WP_015380466.1\|2081842_2082940_-	collagen-like protein	A0A2P0ZLF6	Lactobacillus_phage	8.1e-62	87.1
WP_015380467.1\|2082923_2083085_-	hypothetical protein	A0A2P0ZLG1	Lactobacillus_phage	8.9e-18	94.3
WP_015380468.1\|2083088_2083331_-	hypothetical protein	A0A2K9VDF6	Lactobacillus_phage	6.2e-31	92.5
WP_015380469.1\|2083323_2086122_-	hypothetical protein	E9LUR4	Lactobacillus_phage	2.1e-223	73.3
WP_015380470.1\|2086138_2088508_-\|tail	phage tail protein	E9LUR3	Lactobacillus_phage	0.0e+00	92.8
WP_015380471.1\|2088574_2090347_-\|tail	phage tail family protein	E9LUR2	Lactobacillus_phage	0.0e+00	96.6
WP_015380472.1\|2090418_2095641_-\|tail	Putative minor tail protein	E9LUR1	Lactobacillus_phage	0.0e+00	71.4
WP_015380473.1\|2095653_2095845_-	hypothetical protein	E9LUR0	Lactobacillus_phage	1.5e-27	98.4
WP_015380474.1\|2095841_2096225_-	hypothetical protein	E9LUQ9	Lactobacillus_phage	2.0e-63	99.2
WP_015380475.1\|2096426_2097065_-\|tail	phage tail protein	E9LUQ8	Lactobacillus_phage	1.4e-109	93.9
WP_015380476.1\|2097065_2097449_-	DUF806 family protein	E9LUQ7	Lactobacillus_phage	1.0e-64	96.9
WP_015380477.1\|2097445_2097886_-	hypothetical protein	E9LUQ6	Lactobacillus_phage	4.2e-78	97.9
WP_015380478.1\|2097875_2098238_-\|head	phage head closure protein	E9LUQ5	Lactobacillus_phage	6.4e-64	97.5
WP_015380479.1\|2098221_2098560_-\|head,tail	phage gp6-like head-tail connector protein	E9LUQ4	Lactobacillus_phage	5.8e-51	91.1
WP_015380480.1\|2098632_2099865_-\|capsid	phage major capsid protein	E9LUQ3	Lactobacillus_phage	4.3e-213	94.1
WP_015380481.1\|2099864_2100620_-\|protease	Clp protease ClpP	E9LUQ2	Lactobacillus_phage	3.9e-124	93.2
WP_015380482.1\|2100597_2101791_-\|portal	phage portal protein	E9LUQ1	Lactobacillus_phage	3.1e-224	98.7
WP_015380483.1\|2101793_2101988_-	DUF1056 family protein	E9LUQ0	Lactobacillus_phage	3.7e-26	93.8
WP_015380484.1\|2101977_2103876_-\|terminase	terminase large subunit	E9LUP9	Lactobacillus_phage	0.0e+00	94.0
WP_015380485.1\|2103885_2104341_-\|terminase	phage terminase small subunit P27 family	E9LUP8	Lactobacillus_phage	2.7e-80	96.7
WP_015380486.1\|2104538_2105006_-	HNH endonuclease	E9LUP7	Lactobacillus_phage	2.0e-78	91.5
WP_015380487.1\|2105016_2105196_-	hypothetical protein	E9LUP6	Lactobacillus_phage	3.1e-19	86.4
WP_015380489.1\|2105529_2105958_-	phage transcriptional activator RinA	E9LUP5	Lactobacillus_phage	1.1e-65	86.5
WP_015380490.1\|2106008_2106458_-	hypothetical protein	A0A2K9VC44	Lactobacillus_phage	1.9e-41	66.4
WP_015380491.1\|2106460_2106886_-	DUF1642 domain-containing protein	E9LUP3	Lactobacillus_phage	2.2e-39	61.7
WP_043992815.1\|2106958_2107360_-	hypothetical protein	K4I239	Lactobacillus_phage	5.5e-32	54.5
WP_015380493.1\|2107606_2108212_-	hypothetical protein	E9LUN9	Lactobacillus_phage	3.1e-111	95.0
WP_015380494.1\|2108322_2108634_-	hypothetical protein	A0A2P0ZLB4	Lactobacillus_phage	6.1e-47	88.3
WP_043992819.1\|2109096_2109972_-	ATP-binding protein	A0A0P0I3L9	Lactobacillus_phage	2.2e-49	41.6
WP_015380497.1\|2109965_2110769_-	hypothetical protein	E9LUM6	Lactobacillus_phage	6.4e-40	56.9
WP_043992822.1\|2110875_2111133_-	hypothetical protein	NA	NA	NA	NA
WP_162936256.1\|2111132_2111303_-	hypothetical protein	NA	NA	NA	NA
WP_043992823.1\|2111351_2111576_-	hypothetical protein	E9LUT8	Lactobacillus_phage	1.2e-28	86.3
WP_015380498.1\|2111587_2111788_-	hypothetical protein	E9LUT7	Lactobacillus_phage	1.7e-26	89.4
WP_015380499.1\|2111790_2112039_-	hypothetical protein	E9LUT6	Lactobacillus_phage	1.9e-35	84.1
WP_015380500.1\|2112181_2112442_-	hypothetical protein	NA	NA	NA	NA
WP_015380501.1\|2112499_2112826_+	hypothetical protein	E9LUT2	Lactobacillus_phage	2.7e-53	98.1
WP_003641364.1\|2112941_2113151_-	hypothetical protein	NA	NA	NA	NA
WP_043992824.1\|2113162_2113861_-	Rha family transcriptional regulator	D2IYT0	Enterococcus_phage	6.7e-70	62.2
WP_015380504.1\|2113875_2114097_-	hypothetical protein	NA	NA	NA	NA
WP_043992826.1\|2114344_2114683_+	helix-turn-helix transcriptional regulator	Q8W5Y0	Listeria_phage	1.0e-15	42.2
WP_015380505.1\|2114692_2114971_+	hypothetical protein	D2KRD5	Lactobacillus_phage	1.3e-21	59.3
WP_027822123.1\|2115028_2115415_+	hypothetical protein	NA	NA	NA	NA
WP_015380507.1\|2115423_2116122_+	hypothetical protein	Q9AZW5	Lactococcus_phage	2.1e-18	36.8
WP_043992828.1\|2116303_2116504_+	hypothetical protein	E9LUS6	Lactobacillus_phage	5.5e-25	97.0

DBSCAN-SWA_7

2401567 : 2430154

Lactobacillus_phage(43.75%)

portal,capsid,holin,tail,terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003644665.1\|2401567_2403298_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.6e-46	27.6
WP_011101730.1\|2403525_2403918_-	YxeA family protein	NA	NA	NA	NA
WP_043992864.1\|2404140_2404992_+	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_015380596.1\|2405912_2406290_-\|holin	holin	A0A2K9VCG4	Lactobacillus_phage	3.2e-18	71.2
WP_015380597.1\|2406276_2406573_-	hypothetical protein	A0A1I9KK55	Lactobacillus_phage	1.2e-39	77.6
WP_015380598.1\|2406573_2407746_-	LysM peptidoglycan-binding domain-containing protein	E9LUR8	Lactobacillus_phage	2.0e-199	89.0
WP_015380599.1\|2407757_2408003_-	hypothetical protein	A0A0A1ENR9	Lactobacillus_phage	1.4e-17	84.2
WP_015380600.1\|2407999_2409367_-	hypothetical protein	A0A2K9VCK7	Lactobacillus_phage	2.6e-33	47.1
WP_015380601.1\|2409384_2409534_-	XkdX family protein	NA	NA	NA	NA
WP_015380602.1\|2409533_2409845_-	hypothetical protein	NA	NA	NA	NA
WP_015380603.1\|2409856_2412016_-	hypothetical protein	M4ZSB3	Bacillus_phage	1.1e-38	33.7
WP_015380604.1\|2412016_2412307_-	hypothetical protein	NA	NA	NA	NA
WP_015380605.1\|2412303_2412525_-	hypothetical protein	NA	NA	NA	NA
WP_015380606.1\|2412517_2413645_-\|tail	phage tail protein	O03938	Lactobacillus_phage	6.8e-72	42.0
WP_015380607.1\|2413656_2414475_-\|tail	phage tail family protein	NA	NA	NA	NA
WP_015380608.1\|2414475_2420124_-\|tail	phage tail tape measure protein	A0A1S5SFC1	Streptococcus_phage	2.7e-23	26.0
WP_043992865.1\|2420139_2420781_-	hypothetical protein	O03936	Lactobacillus_phage	9.7e-07	26.7
WP_015380610.1\|2420777_2421296_-	hypothetical protein	NA	NA	NA	NA
WP_015380611.1\|2421414_2422032_-	hypothetical protein	NA	NA	NA	NA
WP_015380612.1\|2422049_2422475_-	hypothetical protein	NA	NA	NA	NA
WP_015380613.1\|2422474_2422876_-	hypothetical protein	NA	NA	NA	NA
WP_015380614.1\|2422872_2423262_-	hypothetical protein	NA	NA	NA	NA
WP_015380615.1\|2423262_2423667_-	hypothetical protein	A5GYM1	Lactococcus_phage	2.6e-05	27.5
WP_015380616.1\|2423677_2423938_-	hypothetical protein	NA	NA	NA	NA
WP_015380617.1\|2424026_2424974_-\|capsid	N4-gp56 family major capsid protein	A8ASJ6	Listeria_phage	3.0e-89	59.5
WP_015380618.1\|2424987_2425599_-	hypothetical protein	NA	NA	NA	NA
WP_015380619.1\|2425662_2426748_-\|capsid	Putative minor capsid protein	A0A059T7W2	Listeria_phage	6.2e-38	30.5
WP_144063632.1\|2426740_2428336_-\|portal	phage portal protein	B5LPR1	Bacillus_virus	3.8e-84	37.8
WP_015380621.1\|2428338_2429664_-\|terminase	PBSX family phage terminase large subunit	A0A1S5SA45	Streptococcus_phage	1.7e-138	55.9
WP_015380622.1\|2429644_2430154_-	helix-turn-helix domain-containing protein	A0A2H4IYT3	uncultured_Caudovirales_phage	4.5e-07	36.8

DBSCAN-SWA_8

2433490 : 2443810

Lactobacillus_phage(62.5%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015380627.1\|2433490_2434009_-	hypothetical protein	O03915	Lactobacillus_phage	3.5e-55	68.4
WP_003642800.1\|2434005_2434293_-	hypothetical protein	NA	NA	NA	NA
WP_015380628.1\|2434289_2435198_-	DnaD domain protein	NA	NA	NA	NA
WP_015380629.1\|2435278_2436031_-	PD-(D/E)XK nuclease-like domain-containing protein	A0A0P0IZH9	Lactobacillus_phage	4.3e-70	49.8
WP_015380630.1\|2436062_2436962_-	recombinase RecT	E9LUM3	Lactobacillus_phage	7.9e-63	47.7
WP_080125261.1\|2436958_2437345_-	hypothetical protein	NA	NA	NA	NA
WP_015380633.1\|2437733_2438246_-	transcriptional regulator	D6PST4	Lactobacillus_phage	2.5e-29	44.7
WP_015380634.1\|2438312_2438618_-	DUF771 domain-containing protein	NA	NA	NA	NA
WP_003642792.1\|2438629_2438800_-	hypothetical protein	NA	NA	NA	NA
WP_043992870.1\|2438796_2439051_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_015380636.1\|2439196_2439700_+	helix-turn-helix transcriptional regulator	S6C481	Thermus_phage	2.2e-22	43.2
WP_015380637.1\|2439714_2440137_+	ImmA/IrrE family metallo-endopeptidase	A0A0S2SXM3	Bacillus_phage	1.0e-12	35.1
WP_043992871.1\|2440202_2440616_+	hypothetical protein	NA	NA	NA	NA
WP_043992872.1\|2440639_2441488_+	hypothetical protein	NA	NA	NA	NA
WP_043992873.1\|2441591_2442311_+	hypothetical protein	NA	NA	NA	NA
WP_003642778.1\|2442583_2442760_+	hypothetical protein	A0A2P0ZL93	Lactobacillus_phage	2.6e-10	51.7
WP_015380641.1\|2442946_2443810_+	AAA family ATPase	A0A1X9IGI7	Lactococcus_phage	3.2e-29	34.8

DBSCAN-SWA_9

2641767 : 2650278

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645867.1\|2641767_2642346_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.3e-21	33.9
WP_015380733.1\|2642338_2643364_-	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	1.2e-59	41.0
WP_015380734.1\|2643360_2644815_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	7.3e-50	33.8
WP_015380735.1\|2644799_2647019_-	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	1.0e-143	38.9
WP_015380736.1\|2647011_2647692_-	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_003642588.1\|2647691_2647946_-	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_015380737.1\|2647947_2648679_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	M4SM18	Cyanophage	1.2e-37	38.6
WP_015380738.1\|2648681_2649812_-	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_003645861.1\|2649795_2650278_-	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	2.3e-16	41.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NC_021912

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 9983

Enterococcus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_043993132.1\|886_3034_-	class 1b ribonucleoside-diphosphate reductase subunit alpha	A8E2R1	Enterococcus_phage	3.0e-254	60.3
WP_187291424.1\|3061_3520_-	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	NA	NA	NA	NA
WP_144063634.1\|4072_4162_-	hypothetical protein	NA	NA	NA	NA
WP_020923829.1\|5485_6040_-	recombinase family protein	A0A1J1J8Z4	Escherichia_phage	8.9e-33	45.1
WP_020923830.1\|6410_6848_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_020923831.1\|7235_9272_-	KUP/HAK/KT family potassium transporter	M1HZV6	Acanthocystis_turfacea_Chlorella_virus	1.6e-63	33.4
WP_020923832.1\|9386_9983_-	recombinase family protein	M9Q1K0	Clostridium_phage	3.5e-19	34.0

DBSCAN-SWA_2

22059 : 22845

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_020923849.1\|22059_22845_+	ParA family protein	A0A1X9I765	Streptococcus_phage	4.5e-38	37.2

DBSCAN-SWA_3

26628 : 32850

Bacillus_virus(25.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013356276.1\|26628_27825_-	glycine betaine/L-proline ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	9.9e-29	36.4
WP_020923854.1\|28241_29228_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	1.5e-43	36.0
WP_020923855.1\|29610_30327_+	LysM peptidoglycan-binding domain-containing protein	K4ID66	Lactobacillus_phage	3.6e-10	55.7
WP_020923856.1\|31623_32850_-\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	9.6e-88	48.0

DBSCAN-SWA_4

36838 : 41347

Paenibacillus_phage(20.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_086989537.1\|36838_37614_-\|transposase	IS5-like element ISLpl3 family transposase	A0A0N9SHJ4	Paenibacillus_phage	2.1e-27	53.2
WP_020923858.1\|37721_38624_-	YitT family protein	M1Q1P6	Streptococcus_phage	8.2e-52	40.3
WP_016526668.1\|38710_39343_-	recombinase family protein	A0A286S1P7	Klebsiella_phage	3.6e-14	33.2
WP_020923859.1\|39456_40269_+\|transposase	IS3 family transposase	Q716C2	Shigella_phage	9.4e-15	29.0
WP_020923860.1\|40396_41347_-	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A096XT60	Enterococcus_phage	9.4e-99	54.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NC_021904

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 5264

Moumouvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_020923879.1\|762_2607_+	polysaccharide biosynthesis protein	A0A2P1ELS8	Moumouvirus	2.1e-25	27.6
WP_020923880.1\|2608_3250_+	sugar transferase	NA	NA	NA	NA
WP_020923881.1\|3224_4115_+	NAD-dependent epimerase/dehydratase family protein	NA	NA	NA	NA
WP_020923882.1\|4115_5264_+	glycosyltransferase	A0A2P0VNG4	Tetraselmis_virus	1.7e-06	30.8

DBSCAN-SWA_2

11459 : 18556

Hokovirus(20.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_020923888.1\|11459_11843_+	glycerol-3-phosphate cytidylyltransferase	A0A1V0SGE7	Hokovirus	8.1e-17	40.7
WP_020923889.1\|11885_12386_+	hypothetical protein	NA	NA	NA	NA
WP_020923890.1\|12501_13677_+\|transposase	IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	7.0e-27	28.8
WP_003636336.1\|14056_14638_+	recombinase family protein	A0A1J1J8Z4	Escherichia_phage	7.2e-33	45.1
WP_020923895.1\|15744_16173_+	hypothetical protein	NA	NA	NA	NA
WP_020923896.1\|16165_16930_+	glycoside hydrolase	F7V9F0	Lactobacillus_virus	2.7e-27	34.3
WP_016511698.1\|17406_17754_-	hypothetical protein	NA	NA	NA	NA
WP_016511697.1\|17755_18556_-	ParA family protein	F0PIG8	Enterococcus_phage	2.7e-67	50.6

DBSCAN-SWA_3

29612 : 32086

unidentified_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_043993121.1\|29612_30542_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	7.4e-24	29.5
WP_020923913.1\|30676_30847_-	hypothetical protein	NA	NA	NA	NA
WP_043993122.1\|30918_31227_-	hypothetical protein	NA	NA	NA	NA
WP_016526732.1\|31219_32086_-	AAA family ATPase	F0PIG8	Enterococcus_phage	3.4e-55	44.4

DBSCAN-SWA_4

37148 : 38329

Lactobacillus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_020923925.1\|37148_37400_+\|transposase	IS3 family transposase	Q6J1X3	Lactobacillus_phage	4.6e-37	95.2
WP_020923926.1\|37453_38329_+\|transposase	IS3 family transposase	Q6J1X2	Lactobacillus_phage	5.0e-147	93.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_020229

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NC_021912

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NC_021904

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection