CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NC_020822	Lactobacillus brevis KB290 plasmid pKB290-4, complete sequence	0 crisprs	NA	0	0
NC_020827	Lactobacillus brevis KB290 plasmid pKB290-6, complete sequence	0 crisprs	NA	0	0
NC_020828	Lactobacillus brevis KB290 plasmid pKB290-8, complete sequence	0 crisprs	NA	0	0
NC_020820	Lactobacillus brevis KB290 plasmid pKB290-1, complete sequence	0 crisprs	NA	0	0
NC_020823	Lactobacillus brevis KB290 plasmid pKB290-5, complete sequence	0 crisprs	csa3	0	0
NC_020826	Lactobacillus brevis KB290 plasmid pKB290-3, complete sequence	0 crisprs	NA	0	0
NC_020825	Lactobacillus brevis KB290 plasmid pKB290-9, complete sequence	0 crisprs	NA	0	0
NC_020824	Lactobacillus brevis KB290 plasmid pKB290-7, complete sequence	0 crisprs	NA	0	0
NC_020821	Lactobacillus brevis KB290 plasmid pKB290-2, complete sequence	2 crisprs	NA	2	0
NC_020819	Lactobacillus brevis KB290, complete genome	2 crisprs	cas3,csa3,DEDDh,DinG	8	7

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_020821_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_020821_1

35132-35207

Orphan

Consensus_repeat	Method
ACTACGGAACTAAAGAACTACGGCACT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_020821_1

>merge|NC_020821|1|35132-35207|CRISPRCasFinder
ACTATAGAATAAAAGAACTACAGCACTACAGAATATAAGCACTACAGCACTATAGCACTATAGAACTACGGAACTA

>NC_020821|1|1|35132-35207|CRISPRCasFinder
ACTATAGAATAAAAGAACTACAGCACT	ACAGAATATAAGCACTACAGC
ACTATAGCACTATAGAACTACGGAACTA

Protein	Signature genes	Signature genes Name	Protein_function
NC_020821.1\|WP_011373852.1\|31174_32095_-\|IS30-like-element-ISLsa1-family-transposase	unknown	unknown	gnl\|CDD\|225382
NC_020821.1\|WP_015474667.1\|32934_33618_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|180933
NC_020821.1\|WP_143453535.1\|29061_29849_+\|IS5-family-transposase	unknown	unknown	gnl\|CDD\|379129
NC_020821.1\|WP_003681285.1\|32400_32898_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NC_020821.1\|WP_041816190.1\|33798_33996_-\|hypothetical-protein	unknown	unknown	unknown
NC_020821.1\|WP_041816187.1\|27449_27659_+\|hypothetical-protein	unknown	unknown	unknown
NC_020821.1\|WP_041816186.1\|25117_27181_-\|MobA/MobL-family-protein	unknown	unknown	gnl\|CDD\|367473
NC_020821.1\|WP_015474661.1\|22885_25021_-\|type-IA-DNA-topoisomerase	unknown	unknown	gnl\|CDD\|236078
NC_020821.1\|WP_013356307.1\|27681_27960_+\|hypothetical-protein	unknown	unknown	unknown
NC_020821.1\|WP_015474666.1\|30139_31048_-\|magnesium-transporter-CorA-family-protein	unknown	unknown	gnl\|CDD\|213361

Protein	Function_ID	Function_description	E-value
NC_020821.1\|WP_011373852.1\|31174_32095_-\|IS30-like-element-ISLsa1-family-transposase	gnl\|CDD\|225382	COG2826, Tra8, Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair].	4.37768e-76
NC_020821.1\|WP_015474667.1\|32934_33618_-\|hypothetical-protein	gnl\|CDD\|180933	PRK07329, PRK07329, hypothetical protein; Provisional.	1.27506e-90
NC_020821.1\|WP_143453535.1\|29061_29849_+\|IS5-family-transposase	gnl\|CDD\|379129	pfam13340, DUF4096, Putative transposase of IS4/5 family (DUF4096).	5.8362e-19
NC_020821.1\|WP_003681285.1\|32400_32898_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	1.77895e-14
NC_020821.1\|WP_041816186.1\|25117_27181_-\|MobA/MobL-family-protein	gnl\|CDD\|367473	pfam03389, MobA_MobL, MobA/MobL family. This family includes of the MobA protein from the E. coli plasmid RSF1010, and the MobL protein from the Thiobacillus ferrooxidans plasmid PTF1. These sequences are mobilisation proteins, which are essential for specific plasmid transfer.	2.23047e-103
NC_020821.1\|WP_015474661.1\|22885_25021_-\|type-IA-DNA-topoisomerase	gnl\|CDD\|236078	PRK07726, PRK07726, DNA topoisomerase 3.	0
NC_020821.1\|WP_015474666.1\|30139_31048_-\|magnesium-transporter-CorA-family-protein	gnl\|CDD\|213361	cd12827, EcCorA_ZntB-like_u2, uncharacterized bacterial subfamily of the Escherichia coli CorA-Salmonella typhimurium ZntB family. A uncharacterized subfamily of the Escherichia coli CorA-Salmonella typhimurium ZntB (EcCorA-ZntB_like) family of the MIT superfamily of essential membrane proteins involved in transporting divalent cations (uptake or efflux) across membranes.The EcCorA-ZntB-like family includes the Mg2+ transporters Escherichia coli and Salmonella typhimurium CorAs, which can also transport Co2+, and Ni2+. Structures of the intracellular domain of EcCorA-ZntB-like family members, Vibrio parahaemolyticus and Salmonella typhimurium ZntB, form funnel-shaped homopentamers, the tip of the funnel is formed from two C-terminal transmembrane (TM) helices from each monomer, and the large opening of the funnel from the N-terminal cytoplasmic domains. The GMN signature motif of the MIT superfamily occurs just after TM1, mutation within this motif is known to abolish Mg2+ transport through Salmonella typhimurium CorA. Natural variants such as GVN and GIN, such as occur in some ZntB family proteins, may be associated with the transport of different divalent cations, such as zinc and cadmium. The functional diversity of MIT transporters may also be due to minor structural differences regulating gating, substrate selection, and transport.	1.09504e-88

>NC_020821.1|WP_041816190.1|33798_33996_-|hypothetical-protein
MINWVNIAVLIPFLILIGVICLVVGFWHDFKDLTVIQKTGIILCVIGYIVPVVLNQVVRIFHLKG
>NC_020821.1|WP_015474667.1|32934_33618_-|hypothetical-protein
MTTEHFDLANPVTKVDDIPDYEMYSQTIDSLNKRFGNRVLKGIEIGYIASEKDRIIDYLADKDYDLKLLSVHHNGQFDYLDDEVKDMDPAIVIPQYFAQLSEALVVIEADVFAHFDYGFRVFGLSVAEFKQYEAQFLPILDQVIKNKLAFELNAKSAYLYDNLALYEYVIDLYLSRGGTLFSVGSDGHYLEHFRFNFDDLFALLKAKGVTELAIYQKEKRIMVPLPV
>NC_020821.1|WP_003681285.1|32400_32898_+|GNAT-family-N-acetyltransferase
MNNQITLAYLDYDDLDALQVVSVVSFYESFIDGADPLDMQGYLQTQLTTEILAVELAQSTSKFIGIKDHQILIGYMKVNDEKDAIEIQRIYLLKDYQNKGLGQRLLDEANRYAKTKQKRYLRLAVYEKNHAGIRFYERHGFKKIGIKHFPLGKQDRICPILEKEI
>NC_020821.1|WP_011373852.1|31174_32095_-|IS30-like-element-ISLsa1-family-transposase
MGTSTLSRFQRGALAQLVNEGNKSYQVMADALGVAKATISYELDRVKPYDPELAQQDADRKRRNCGRRSMLTAALATLITNHLRLTWSPETIAAAYNLSTASIYNWLNRGWLPFKLTDLPNRNVRQHRVSENRGKFTSGTSIEQRPTTVNQRLAFGHWEVDTVLSSRSESRSCLVTFVERKTRLLWAIKAPNRTAKALNTAFGKFMGAFGPQVKSITVDHGKEFANYQALEQDYQIKVYFCHPYSPWERGSNEYFNRRLRWFFPKKTNFSQVTTDEILAALELINQRPLKIHHQQTAIERFRACSD
>NC_020821.1|WP_015474666.1|30139_31048_-|magnesium-transporter-CorA-family-protein
MIKPEKTINGTKWIETIQINAEERATLEDQYGIDEDIIEYVTDNDESTNYVYDINEDDQLFIFLAPYALDKDALRYITQPFGMLLHKGVLFTFNQSHIPEVNTALYSALDNPEVKSVDAFILETLFTVVDSFIPISRGITKKRNYLDKMLNRKTKNSDLVSLSYLQQTLTFLSSAVQTNLSELDRLPKTHFGVGAEQDKIDLFEDVQIEGEQVQRMFEIETQVVDRIDHTFNSLANNNLNDTMKFLTIWSLTMAVPTIITGFYGMNVKLPLAGMQYAWMLTLGISVALIVAMLIMLKVWRKM
>NC_020821.1|WP_143453535.1|29061_29849_+|IS5-family-transposase
MKNYPSNITRQQFELIRPALENFRKRTKPRKYELYEVFCAVLYVLKTGCQWRQVPGDFPEWRSVYNYYKIWSTKAEPTADSLLEQVFKKIVIARRTYQGRSALTSFIIVDAQSVKNTATAENKGYDAGKKISGIKRHLAVDIHGFPQAIHMTRANVSDRDGASAMIALHAMHLRQVQNVLVDGGYSGVNFQLDVASNLNATVQVAKRNELHRFEVIPQRWVVERSFSWLENCRRLWKNCERQLTTSLQMVVLAFLALLLKRF
>NC_020821.1|WP_013356307.1|27681_27960_+|hypothetical-protein
MSNQYEKLVEQQARLKQKIEREDFKLRQSKYYENRQARKARSRRLIQKGALLEKYFQANNLSVEQTEELLKTFADYVNTHKPDKLKNDQPNN
>NC_020821.1|WP_041816187.1|27449_27659_+|hypothetical-protein
MQQSNLEKQEAKLKALNQKIKAEKNNIEQRLGKQIISQSNLDYANLSNDQIKLLAKQFSEFLKVKPVDH
>NC_020821.1|WP_041816186.1|25117_27181_-|MobA/MobL-family-protein
MAIFHMSFSNISAGKGRSAIASAAYRSGEKLFDDKEGRHYFYARSVMPESFILTPKNAPAWASDREQLWNEVERKDRRANSRYAKEFNVALPVELIEDEQKELLTKYVQENFVDEGMVADVVIHRDHPDNPHAHVMLTNRPFNSDGTWGIKSKKQYILDENGNKTYTGTSKYPKSRKILMVDWDKKEKIIEWRHNWAVSVNQVLEQKNIPERISEKSFTEQGIDDTPTQHEGINSNRYERKEFNQQVKNYRKAKASYKNNQEKAINRGHLDSLSEHFSFNEKRVVNELSHELKTYISLESLDDKRRMLFNWKNSTLIKHAVGEDVTKELLTINQQESSLKKADELLNKVVDRTTKKLYPELNFEQTTQAERRELIKETESEQTVFKGSELNERLMNIRDDLLTQQLLTFTKRPYVGFKLLMQQEKEAKIDLKYTLMIHSDSLESLEHVDKGLLEKYSPAEQQTITRAVKDLRTIMAVKQVIQTQYQEVLRKAFPNGNFNELPMIKQEQAYTAVMYYDPALKPCKVETIAQWQENPPRVFSTQEHQQGLAYLSGQLSLDQLENHHLQRVLKHDGTKQLFLGECKADPMIKNSQIEKIQKQLKEQQAKDDQYRKSQLAHYQPLNYKPVSPEYYLKTAFSDAIMAALYARDEDYQRQRQAQGLKEAEWEMTKKQRQHQTRNRHEDGGMHL
>NC_020821.1|WP_015474661.1|22885_25021_-|type-IA-DNA-topoisomerase
MTTVILAEKPSQARSYVQAFQKSTKKQGYYTVSDPVLPENTLVTYGLGHLVELATPDKYDQKYQQWALSNLPIFPDKYKFEVSTSKRAQFKIVKDLLAKADTIIVATDSGREGSNIAWSIMNQAQIDVKKKTIKRLWLNSLEKDAIITGFKNLGDWHKDYLAYKEAQTRQISDWLIGMNGSPLYTLLLRQNGVRGVYSIGRVQTPTLYMVYQRDQAIKDFKPEPYFELNAEILANQQKFTAKLDPYQRFKDETCLMTFMQAKHVQKGSQSGLIKDVQKQAKKSASPQLFSLSSLQSAMNKRYHASASQTLAAIQSLYEAKLLSYPRTDCAYITNEEFEYLVANLTKYLGLVSKRVALTNTTPNKRYVNGKKVEEHYAIIMTKVVPTKEKLASLPKLQQQVYDLVLRTTLAMFADPYEYEETTIVTQVGDTSFKATGKVPTKLGWQALFDDHKADQKETATLPFVHQGDQVQANLQTPQKETTPPVPFTEGTLITAMKTAGKTLDDEEAQAILKDVQGIGTSATRANVLEVLKKRGYLVTEKNKLHVSEAGITLCKAVELEPLLTSPEMTAKWEQALQQISTEERTPDNFLSQIKKFVAKLIADVPTQLTGNAAIKQQIDHQQQAQKATEVFLETPQATVLNKQKFYIVKPKQGEDFTLPKKWSSKTLGKTAIKALITKGETSKLKGFKSKKGKSFDAKLKLDGHKLSFDFD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_020821_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_020821_2

35281-35355

Orphan

Consensus_repeat	Method
ACTACGGAACTAAAGAACTACGGCACT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_020821_2

>merge|NC_020821|2|35281-35355|CRISPRCasFinder
ACTACGGAACTAAAGAACTACAGCACTATAGCACTGTAGAACATAAGCACTACAGAACAACAGCATTATAGAACT

>NC_020821|2|2|35281-35355|CRISPRCasFinder
ACTACGGAACTAAAGAACTACAGCACT	ATAGCACTGTAGAACATAAGC
ACTACAGAACAACAGCATTATAGAACT

Protein	Signature genes	Signature genes Name	Protein_function
NC_020821.1\|WP_011373852.1\|31174_32095_-\|IS30-like-element-ISLsa1-family-transposase	unknown	unknown	gnl\|CDD\|225382
NC_020821.1\|WP_015474667.1\|32934_33618_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|180933
NC_020821.1\|WP_143453535.1\|29061_29849_+\|IS5-family-transposase	unknown	unknown	gnl\|CDD\|379129
NC_020821.1\|WP_003681285.1\|32400_32898_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NC_020821.1\|WP_041816190.1\|33798_33996_-\|hypothetical-protein	unknown	unknown	unknown
NC_020821.1\|WP_041816187.1\|27449_27659_+\|hypothetical-protein	unknown	unknown	unknown
NC_020821.1\|WP_041816186.1\|25117_27181_-\|MobA/MobL-family-protein	unknown	unknown	gnl\|CDD\|367473
NC_020821.1\|WP_015474661.1\|22885_25021_-\|type-IA-DNA-topoisomerase	unknown	unknown	gnl\|CDD\|236078
NC_020821.1\|WP_013356307.1\|27681_27960_+\|hypothetical-protein	unknown	unknown	unknown
NC_020821.1\|WP_015474666.1\|30139_31048_-\|magnesium-transporter-CorA-family-protein	unknown	unknown	gnl\|CDD\|213361

Protein	Function_ID	Function_description	E-value
NC_020821.1\|WP_011373852.1\|31174_32095_-\|IS30-like-element-ISLsa1-family-transposase	gnl\|CDD\|225382	COG2826, Tra8, Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair].	4.37768e-76
NC_020821.1\|WP_015474667.1\|32934_33618_-\|hypothetical-protein	gnl\|CDD\|180933	PRK07329, PRK07329, hypothetical protein; Provisional.	1.27506e-90
NC_020821.1\|WP_143453535.1\|29061_29849_+\|IS5-family-transposase	gnl\|CDD\|379129	pfam13340, DUF4096, Putative transposase of IS4/5 family (DUF4096).	5.8362e-19
NC_020821.1\|WP_003681285.1\|32400_32898_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	1.77895e-14
NC_020821.1\|WP_041816186.1\|25117_27181_-\|MobA/MobL-family-protein	gnl\|CDD\|367473	pfam03389, MobA_MobL, MobA/MobL family. This family includes of the MobA protein from the E. coli plasmid RSF1010, and the MobL protein from the Thiobacillus ferrooxidans plasmid PTF1. These sequences are mobilisation proteins, which are essential for specific plasmid transfer.	2.23047e-103
NC_020821.1\|WP_015474661.1\|22885_25021_-\|type-IA-DNA-topoisomerase	gnl\|CDD\|236078	PRK07726, PRK07726, DNA topoisomerase 3.	0
NC_020821.1\|WP_015474666.1\|30139_31048_-\|magnesium-transporter-CorA-family-protein	gnl\|CDD\|213361	cd12827, EcCorA_ZntB-like_u2, uncharacterized bacterial subfamily of the Escherichia coli CorA-Salmonella typhimurium ZntB family. A uncharacterized subfamily of the Escherichia coli CorA-Salmonella typhimurium ZntB (EcCorA-ZntB_like) family of the MIT superfamily of essential membrane proteins involved in transporting divalent cations (uptake or efflux) across membranes.The EcCorA-ZntB-like family includes the Mg2+ transporters Escherichia coli and Salmonella typhimurium CorAs, which can also transport Co2+, and Ni2+. Structures of the intracellular domain of EcCorA-ZntB-like family members, Vibrio parahaemolyticus and Salmonella typhimurium ZntB, form funnel-shaped homopentamers, the tip of the funnel is formed from two C-terminal transmembrane (TM) helices from each monomer, and the large opening of the funnel from the N-terminal cytoplasmic domains. The GMN signature motif of the MIT superfamily occurs just after TM1, mutation within this motif is known to abolish Mg2+ transport through Salmonella typhimurium CorA. Natural variants such as GVN and GIN, such as occur in some ZntB family proteins, may be associated with the transport of different divalent cations, such as zinc and cadmium. The functional diversity of MIT transporters may also be due to minor structural differences regulating gating, substrate selection, and transport.	1.09504e-88

>NC_020821.1|WP_041816190.1|33798_33996_-|hypothetical-protein
MINWVNIAVLIPFLILIGVICLVVGFWHDFKDLTVIQKTGIILCVIGYIVPVVLNQVVRIFHLKG
>NC_020821.1|WP_015474667.1|32934_33618_-|hypothetical-protein
MTTEHFDLANPVTKVDDIPDYEMYSQTIDSLNKRFGNRVLKGIEIGYIASEKDRIIDYLADKDYDLKLLSVHHNGQFDYLDDEVKDMDPAIVIPQYFAQLSEALVVIEADVFAHFDYGFRVFGLSVAEFKQYEAQFLPILDQVIKNKLAFELNAKSAYLYDNLALYEYVIDLYLSRGGTLFSVGSDGHYLEHFRFNFDDLFALLKAKGVTELAIYQKEKRIMVPLPV
>NC_020821.1|WP_003681285.1|32400_32898_+|GNAT-family-N-acetyltransferase
MNNQITLAYLDYDDLDALQVVSVVSFYESFIDGADPLDMQGYLQTQLTTEILAVELAQSTSKFIGIKDHQILIGYMKVNDEKDAIEIQRIYLLKDYQNKGLGQRLLDEANRYAKTKQKRYLRLAVYEKNHAGIRFYERHGFKKIGIKHFPLGKQDRICPILEKEI
>NC_020821.1|WP_011373852.1|31174_32095_-|IS30-like-element-ISLsa1-family-transposase
MGTSTLSRFQRGALAQLVNEGNKSYQVMADALGVAKATISYELDRVKPYDPELAQQDADRKRRNCGRRSMLTAALATLITNHLRLTWSPETIAAAYNLSTASIYNWLNRGWLPFKLTDLPNRNVRQHRVSENRGKFTSGTSIEQRPTTVNQRLAFGHWEVDTVLSSRSESRSCLVTFVERKTRLLWAIKAPNRTAKALNTAFGKFMGAFGPQVKSITVDHGKEFANYQALEQDYQIKVYFCHPYSPWERGSNEYFNRRLRWFFPKKTNFSQVTTDEILAALELINQRPLKIHHQQTAIERFRACSD
>NC_020821.1|WP_015474666.1|30139_31048_-|magnesium-transporter-CorA-family-protein
MIKPEKTINGTKWIETIQINAEERATLEDQYGIDEDIIEYVTDNDESTNYVYDINEDDQLFIFLAPYALDKDALRYITQPFGMLLHKGVLFTFNQSHIPEVNTALYSALDNPEVKSVDAFILETLFTVVDSFIPISRGITKKRNYLDKMLNRKTKNSDLVSLSYLQQTLTFLSSAVQTNLSELDRLPKTHFGVGAEQDKIDLFEDVQIEGEQVQRMFEIETQVVDRIDHTFNSLANNNLNDTMKFLTIWSLTMAVPTIITGFYGMNVKLPLAGMQYAWMLTLGISVALIVAMLIMLKVWRKM
>NC_020821.1|WP_143453535.1|29061_29849_+|IS5-family-transposase
MKNYPSNITRQQFELIRPALENFRKRTKPRKYELYEVFCAVLYVLKTGCQWRQVPGDFPEWRSVYNYYKIWSTKAEPTADSLLEQVFKKIVIARRTYQGRSALTSFIIVDAQSVKNTATAENKGYDAGKKISGIKRHLAVDIHGFPQAIHMTRANVSDRDGASAMIALHAMHLRQVQNVLVDGGYSGVNFQLDVASNLNATVQVAKRNELHRFEVIPQRWVVERSFSWLENCRRLWKNCERQLTTSLQMVVLAFLALLLKRF
>NC_020821.1|WP_013356307.1|27681_27960_+|hypothetical-protein
MSNQYEKLVEQQARLKQKIEREDFKLRQSKYYENRQARKARSRRLIQKGALLEKYFQANNLSVEQTEELLKTFADYVNTHKPDKLKNDQPNN
>NC_020821.1|WP_041816187.1|27449_27659_+|hypothetical-protein
MQQSNLEKQEAKLKALNQKIKAEKNNIEQRLGKQIISQSNLDYANLSNDQIKLLAKQFSEFLKVKPVDH
>NC_020821.1|WP_041816186.1|25117_27181_-|MobA/MobL-family-protein
MAIFHMSFSNISAGKGRSAIASAAYRSGEKLFDDKEGRHYFYARSVMPESFILTPKNAPAWASDREQLWNEVERKDRRANSRYAKEFNVALPVELIEDEQKELLTKYVQENFVDEGMVADVVIHRDHPDNPHAHVMLTNRPFNSDGTWGIKSKKQYILDENGNKTYTGTSKYPKSRKILMVDWDKKEKIIEWRHNWAVSVNQVLEQKNIPERISEKSFTEQGIDDTPTQHEGINSNRYERKEFNQQVKNYRKAKASYKNNQEKAINRGHLDSLSEHFSFNEKRVVNELSHELKTYISLESLDDKRRMLFNWKNSTLIKHAVGEDVTKELLTINQQESSLKKADELLNKVVDRTTKKLYPELNFEQTTQAERRELIKETESEQTVFKGSELNERLMNIRDDLLTQQLLTFTKRPYVGFKLLMQQEKEAKIDLKYTLMIHSDSLESLEHVDKGLLEKYSPAEQQTITRAVKDLRTIMAVKQVIQTQYQEVLRKAFPNGNFNELPMIKQEQAYTAVMYYDPALKPCKVETIAQWQENPPRVFSTQEHQQGLAYLSGQLSLDQLENHHLQRVLKHDGTKQLFLGECKADPMIKNSQIEKIQKQLKEQQAKDDQYRKSQLAHYQPLNYKPVSPEYYLKTAFSDAIMAALYARDEDYQRQRQAQGLKEAEWEMTKKQRQHQTRNRHEDGGMHL
>NC_020821.1|WP_015474661.1|22885_25021_-|type-IA-DNA-topoisomerase
MTTVILAEKPSQARSYVQAFQKSTKKQGYYTVSDPVLPENTLVTYGLGHLVELATPDKYDQKYQQWALSNLPIFPDKYKFEVSTSKRAQFKIVKDLLAKADTIIVATDSGREGSNIAWSIMNQAQIDVKKKTIKRLWLNSLEKDAIITGFKNLGDWHKDYLAYKEAQTRQISDWLIGMNGSPLYTLLLRQNGVRGVYSIGRVQTPTLYMVYQRDQAIKDFKPEPYFELNAEILANQQKFTAKLDPYQRFKDETCLMTFMQAKHVQKGSQSGLIKDVQKQAKKSASPQLFSLSSLQSAMNKRYHASASQTLAAIQSLYEAKLLSYPRTDCAYITNEEFEYLVANLTKYLGLVSKRVALTNTTPNKRYVNGKKVEEHYAIIMTKVVPTKEKLASLPKLQQQVYDLVLRTTLAMFADPYEYEETTIVTQVGDTSFKATGKVPTKLGWQALFDDHKADQKETATLPFVHQGDQVQANLQTPQKETTPPVPFTEGTLITAMKTAGKTLDDEEAQAILKDVQGIGTSATRANVLEVLKKRGYLVTEKNKLHVSEAGITLCKAVELEPLLTSPEMTAKWEQALQQISTEERTPDNFLSQIKKFVAKLIADVPTQLTGNAAIKQQIDHQQQAQKATEVFLETPQATVLNKQKFYIVKPKQGEDFTLPKKWSSKTLGKTAIKALITKGETSKLKGFKSKKGKSFDAKLKLDGHKLSFDFD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_020821_1	1.1\|35159\|21\|NC_020821\|CRISPRCasFinder	35159-35179	21	NZ_CP031187	Lactobacillus brevis strain SA-C12 plasmid pSAC12_B, complete sequence	12047-12067	0	1.0
NC_020821_1	1.1\|35159\|21\|NC_020821\|CRISPRCasFinder	35159-35179	21	NZ_CP021478	Lactobacillus brevis strain SRCM101174 plasmid pLB1174-1, complete sequence	13762-13782	0	1.0
NC_020821_1	1.1\|35159\|21\|NC_020821\|CRISPRCasFinder	35159-35179	21	NZ_CP021672	Lactobacillus brevis strain SRCM101106 plasmid pLB1106-1, complete sequence	1539-1559	0	1.0
NC_020821_1	1.1\|35159\|21\|NC_020821\|CRISPRCasFinder	35159-35179	21	NZ_CP033886	Lactobacillus brevis strain LMT1-73 plasmid p1, complete sequence	18920-18940	0	1.0
NC_020821_1	1.1\|35159\|21\|NC_020821\|CRISPRCasFinder	35159-35179	21	NZ_CP014926	Lactobacillus paracollinoides strain TMW 1.1995 plasmid pL11995-2, complete sequence	42712-42732	0	1.0
NC_020821_1	1.1\|35159\|21\|NC_020821\|CRISPRCasFinder	35159-35179	21	NZ_CP014926	Lactobacillus paracollinoides strain TMW 1.1995 plasmid pL11995-2, complete sequence	42736-42756	0	1.0
NC_020821_1	1.1\|35159\|21\|NC_020821\|CRISPRCasFinder	35159-35179	21	NZ_CP014874	Lactobacillus backii strain TMW 1.1989 plasmid pL11989-1, complete sequence	19449-19469	0	1.0
NC_020821_1	1.1\|35159\|21\|NC_020821\|CRISPRCasFinder	35159-35179	21	NZ_CP016802	Lactobacillus brevis strain TMW 1.2112 plasmid pl12112-5, complete sequence	22550-22570	0	1.0
NC_020821_1	1.1\|35159\|21\|NC_020821\|CRISPRCasFinder	35159-35179	21	NZ_CP019751	Lactobacillus brevis strain TMW 1.2113 plasmid pl12113-1, complete sequence	40323-40343	0	1.0
NC_020821_1	1.1\|35159\|21\|NC_020821\|CRISPRCasFinder	35159-35179	21	NZ_CP012655	Lactobacillus plantarum strain HFC8 isolate Lactobacillus plantarum plasmid pMK02, complete sequence	1327-1347	0	1.0
NC_020821_1	1.1\|35159\|21\|NC_020821\|CRISPRCasFinder	35159-35179	21	NZ_CP012655	Lactobacillus plantarum strain HFC8 isolate Lactobacillus plantarum plasmid pMK02, complete sequence	42348-42368	0	1.0
NC_020821_1	1.1\|35159\|21\|NC_020821\|CRISPRCasFinder	35159-35179	21	NZ_CP015340	Lactobacillus brevis strain 100D8 plasmid unnamed2, complete sequence	5776-5796	0	1.0
NC_020821_1	1.1\|35159\|21\|NC_020821\|CRISPRCasFinder	35159-35179	21	NZ_CP015340	Lactobacillus brevis strain 100D8 plasmid unnamed2, complete sequence	33202-33222	0	1.0
NC_020821_1	1.1\|35159\|21\|NC_020821\|CRISPRCasFinder	35159-35179	21	NZ_CP014900	Lactobacillus backii strain TMW 1.2002 plasmid pL12002-1, complete sequence	12434-12454	0	1.0
NC_020821_1	1.1\|35159\|21\|NC_020821\|CRISPRCasFinder	35159-35179	21	NC_020821	Lactobacillus brevis KB290 plasmid pKB290-2, complete sequence	35159-35179	0	1.0
NC_020821_2	2.1\|35308\|21\|NC_020821\|CRISPRCasFinder	35308-35328	21	NZ_CP017997	Lactobacillus crustorum strain MN047 plasmid unnamed1, complete sequence	25498-25518	0	1.0
NC_020821_2	2.1\|35308\|21\|NC_020821\|CRISPRCasFinder	35308-35328	21	NZ_CP031187	Lactobacillus brevis strain SA-C12 plasmid pSAC12_B, complete sequence	12196-12216	0	1.0
NC_020821_2	2.1\|35308\|21\|NC_020821\|CRISPRCasFinder	35308-35328	21	NZ_CP021672	Lactobacillus brevis strain SRCM101106 plasmid pLB1106-1, complete sequence	1688-1708	0	1.0
NC_020821_2	2.1\|35308\|21\|NC_020821\|CRISPRCasFinder	35308-35328	21	NZ_CP033886	Lactobacillus brevis strain LMT1-73 plasmid p1, complete sequence	19069-19089	0	1.0
NC_020821_2	2.1\|35308\|21\|NC_020821\|CRISPRCasFinder	35308-35328	21	NZ_CP014874	Lactobacillus backii strain TMW 1.1989 plasmid pL11989-1, complete sequence	19598-19618	0	1.0
NC_020821_2	2.1\|35308\|21\|NC_020821\|CRISPRCasFinder	35308-35328	21	NZ_CP016802	Lactobacillus brevis strain TMW 1.2112 plasmid pl12112-5, complete sequence	22699-22719	0	1.0
NC_020821_2	2.1\|35308\|21\|NC_020821\|CRISPRCasFinder	35308-35328	21	NZ_CP019751	Lactobacillus brevis strain TMW 1.2113 plasmid pl12113-1, complete sequence	40472-40492	0	1.0
NC_020821_2	2.1\|35308\|21\|NC_020821\|CRISPRCasFinder	35308-35328	21	NZ_CP015340	Lactobacillus brevis strain 100D8 plasmid unnamed2, complete sequence	5925-5945	0	1.0
NC_020821_2	2.1\|35308\|21\|NC_020821\|CRISPRCasFinder	35308-35328	21	NZ_CP015340	Lactobacillus brevis strain 100D8 plasmid unnamed2, complete sequence	33351-33371	0	1.0
NC_020821_2	2.1\|35308\|21\|NC_020821\|CRISPRCasFinder	35308-35328	21	NZ_CP014900	Lactobacillus backii strain TMW 1.2002 plasmid pL12002-1, complete sequence	12583-12603	0	1.0
NC_020821_2	2.1\|35308\|21\|NC_020821\|CRISPRCasFinder	35308-35328	21	NC_020821	Lactobacillus brevis KB290 plasmid pKB290-2, complete sequence	35308-35328	0	1.0
NC_020821_2	2.1\|35308\|21\|NC_020821\|CRISPRCasFinder	35308-35328	21	NZ_CP021478	Lactobacillus brevis strain SRCM101174 plasmid pLB1174-1, complete sequence	13613-13633	0	1.0
NC_020821_2	2.1\|35308\|21\|NC_020821\|CRISPRCasFinder	35308-35328	21	NZ_CP012655	Lactobacillus plantarum strain HFC8 isolate Lactobacillus plantarum plasmid pMK02, complete sequence	1178-1198	0	1.0
NC_020821_2	2.1\|35308\|21\|NC_020821\|CRISPRCasFinder	35308-35328	21	NZ_CP012655	Lactobacillus plantarum strain HFC8 isolate Lactobacillus plantarum plasmid pMK02, complete sequence	42199-42219	0	1.0
NC_020821_1	1.1\|35159\|21\|NC_020821\|CRISPRCasFinder	35159-35179	21	NZ_CP017997	Lactobacillus crustorum strain MN047 plasmid unnamed1, complete sequence	25349-25369	1	0.952
NC_020821_2	2.1\|35308\|21\|NC_020821\|CRISPRCasFinder	35308-35328	21	NZ_CP014926	Lactobacillus paracollinoides strain TMW 1.1995 plasmid pL11995-2, complete sequence	42563-42583	1	0.952

1. spacer 1.1|35159|21|NC_020821|CRISPRCasFinder matches to NZ_CP031187 (Lactobacillus brevis strain SA-C12 plasmid pSAC12_B, complete sequence) position: , mismatch: 0, identity: 1.0

acagaatataagcactacagc	CRISPR spacer
acagaatataagcactacagc	Protospacer
*********************

2. spacer 1.1|35159|21|NC_020821|CRISPRCasFinder matches to NZ_CP021478 (Lactobacillus brevis strain SRCM101174 plasmid pLB1174-1, complete sequence) position: , mismatch: 0, identity: 1.0

acagaatataagcactacagc	CRISPR spacer
acagaatataagcactacagc	Protospacer
*********************

3. spacer 1.1|35159|21|NC_020821|CRISPRCasFinder matches to NZ_CP021672 (Lactobacillus brevis strain SRCM101106 plasmid pLB1106-1, complete sequence) position: , mismatch: 0, identity: 1.0

acagaatataagcactacagc	CRISPR spacer
acagaatataagcactacagc	Protospacer
*********************

4. spacer 1.1|35159|21|NC_020821|CRISPRCasFinder matches to NZ_CP033886 (Lactobacillus brevis strain LMT1-73 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

acagaatataagcactacagc	CRISPR spacer
acagaatataagcactacagc	Protospacer
*********************

5. spacer 1.1|35159|21|NC_020821|CRISPRCasFinder matches to NZ_CP014926 (Lactobacillus paracollinoides strain TMW 1.1995 plasmid pL11995-2, complete sequence) position: , mismatch: 0, identity: 1.0

acagaatataagcactacagc	CRISPR spacer
acagaatataagcactacagc	Protospacer
*********************

6. spacer 1.1|35159|21|NC_020821|CRISPRCasFinder matches to NZ_CP014926 (Lactobacillus paracollinoides strain TMW 1.1995 plasmid pL11995-2, complete sequence) position: , mismatch: 0, identity: 1.0

acagaatataagcactacagc	CRISPR spacer
acagaatataagcactacagc	Protospacer
*********************

7. spacer 1.1|35159|21|NC_020821|CRISPRCasFinder matches to NZ_CP014874 (Lactobacillus backii strain TMW 1.1989 plasmid pL11989-1, complete sequence) position: , mismatch: 0, identity: 1.0

acagaatataagcactacagc	CRISPR spacer
acagaatataagcactacagc	Protospacer
*********************

8. spacer 1.1|35159|21|NC_020821|CRISPRCasFinder matches to NZ_CP016802 (Lactobacillus brevis strain TMW 1.2112 plasmid pl12112-5, complete sequence) position: , mismatch: 0, identity: 1.0

acagaatataagcactacagc	CRISPR spacer
acagaatataagcactacagc	Protospacer
*********************

9. spacer 1.1|35159|21|NC_020821|CRISPRCasFinder matches to NZ_CP019751 (Lactobacillus brevis strain TMW 1.2113 plasmid pl12113-1, complete sequence) position: , mismatch: 0, identity: 1.0

acagaatataagcactacagc	CRISPR spacer
acagaatataagcactacagc	Protospacer
*********************

10. spacer 1.1|35159|21|NC_020821|CRISPRCasFinder matches to NZ_CP012655 (Lactobacillus plantarum strain HFC8 isolate Lactobacillus plantarum plasmid pMK02, complete sequence) position: , mismatch: 0, identity: 1.0

acagaatataagcactacagc	CRISPR spacer
acagaatataagcactacagc	Protospacer
*********************

11. spacer 1.1|35159|21|NC_020821|CRISPRCasFinder matches to NZ_CP012655 (Lactobacillus plantarum strain HFC8 isolate Lactobacillus plantarum plasmid pMK02, complete sequence) position: , mismatch: 0, identity: 1.0

acagaatataagcactacagc	CRISPR spacer
acagaatataagcactacagc	Protospacer
*********************

12. spacer 1.1|35159|21|NC_020821|CRISPRCasFinder matches to NZ_CP015340 (Lactobacillus brevis strain 100D8 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

acagaatataagcactacagc	CRISPR spacer
acagaatataagcactacagc	Protospacer
*********************

13. spacer 1.1|35159|21|NC_020821|CRISPRCasFinder matches to NZ_CP015340 (Lactobacillus brevis strain 100D8 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

acagaatataagcactacagc	CRISPR spacer
acagaatataagcactacagc	Protospacer
*********************

14. spacer 1.1|35159|21|NC_020821|CRISPRCasFinder matches to NZ_CP014900 (Lactobacillus backii strain TMW 1.2002 plasmid pL12002-1, complete sequence) position: , mismatch: 0, identity: 1.0

acagaatataagcactacagc	CRISPR spacer
acagaatataagcactacagc	Protospacer
*********************

15. spacer 1.1|35159|21|NC_020821|CRISPRCasFinder matches to NC_020821 (Lactobacillus brevis KB290 plasmid pKB290-2, complete sequence) position: , mismatch: 0, identity: 1.0

acagaatataagcactacagc	CRISPR spacer
acagaatataagcactacagc	Protospacer
*********************

16. spacer 2.1|35308|21|NC_020821|CRISPRCasFinder matches to NZ_CP017997 (Lactobacillus crustorum strain MN047 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

atagcactgtagaacataagc	CRISPR spacer
atagcactgtagaacataagc	Protospacer
*********************

17. spacer 2.1|35308|21|NC_020821|CRISPRCasFinder matches to NZ_CP031187 (Lactobacillus brevis strain SA-C12 plasmid pSAC12_B, complete sequence) position: , mismatch: 0, identity: 1.0

atagcactgtagaacataagc	CRISPR spacer
atagcactgtagaacataagc	Protospacer
*********************

18. spacer 2.1|35308|21|NC_020821|CRISPRCasFinder matches to NZ_CP021672 (Lactobacillus brevis strain SRCM101106 plasmid pLB1106-1, complete sequence) position: , mismatch: 0, identity: 1.0

atagcactgtagaacataagc	CRISPR spacer
atagcactgtagaacataagc	Protospacer
*********************

19. spacer 2.1|35308|21|NC_020821|CRISPRCasFinder matches to NZ_CP033886 (Lactobacillus brevis strain LMT1-73 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

atagcactgtagaacataagc	CRISPR spacer
atagcactgtagaacataagc	Protospacer
*********************

20. spacer 2.1|35308|21|NC_020821|CRISPRCasFinder matches to NZ_CP014874 (Lactobacillus backii strain TMW 1.1989 plasmid pL11989-1, complete sequence) position: , mismatch: 0, identity: 1.0

atagcactgtagaacataagc	CRISPR spacer
atagcactgtagaacataagc	Protospacer
*********************

21. spacer 2.1|35308|21|NC_020821|CRISPRCasFinder matches to NZ_CP016802 (Lactobacillus brevis strain TMW 1.2112 plasmid pl12112-5, complete sequence) position: , mismatch: 0, identity: 1.0

atagcactgtagaacataagc	CRISPR spacer
atagcactgtagaacataagc	Protospacer
*********************

22. spacer 2.1|35308|21|NC_020821|CRISPRCasFinder matches to NZ_CP019751 (Lactobacillus brevis strain TMW 1.2113 plasmid pl12113-1, complete sequence) position: , mismatch: 0, identity: 1.0

atagcactgtagaacataagc	CRISPR spacer
atagcactgtagaacataagc	Protospacer
*********************

23. spacer 2.1|35308|21|NC_020821|CRISPRCasFinder matches to NZ_CP015340 (Lactobacillus brevis strain 100D8 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

atagcactgtagaacataagc	CRISPR spacer
atagcactgtagaacataagc	Protospacer
*********************

24. spacer 2.1|35308|21|NC_020821|CRISPRCasFinder matches to NZ_CP015340 (Lactobacillus brevis strain 100D8 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

atagcactgtagaacataagc	CRISPR spacer
atagcactgtagaacataagc	Protospacer
*********************

25. spacer 2.1|35308|21|NC_020821|CRISPRCasFinder matches to NZ_CP014900 (Lactobacillus backii strain TMW 1.2002 plasmid pL12002-1, complete sequence) position: , mismatch: 0, identity: 1.0

atagcactgtagaacataagc	CRISPR spacer
atagcactgtagaacataagc	Protospacer
*********************

26. spacer 2.1|35308|21|NC_020821|CRISPRCasFinder matches to NC_020821 (Lactobacillus brevis KB290 plasmid pKB290-2, complete sequence) position: , mismatch: 0, identity: 1.0

atagcactgtagaacataagc	CRISPR spacer
atagcactgtagaacataagc	Protospacer
*********************

27. spacer 2.1|35308|21|NC_020821|CRISPRCasFinder matches to NZ_CP021478 (Lactobacillus brevis strain SRCM101174 plasmid pLB1174-1, complete sequence) position: , mismatch: 0, identity: 1.0

atagcactgtagaacataagc	CRISPR spacer
atagcactgtagaacataagc	Protospacer
*********************

28. spacer 2.1|35308|21|NC_020821|CRISPRCasFinder matches to NZ_CP012655 (Lactobacillus plantarum strain HFC8 isolate Lactobacillus plantarum plasmid pMK02, complete sequence) position: , mismatch: 0, identity: 1.0

atagcactgtagaacataagc	CRISPR spacer
atagcactgtagaacataagc	Protospacer
*********************

29. spacer 2.1|35308|21|NC_020821|CRISPRCasFinder matches to NZ_CP012655 (Lactobacillus plantarum strain HFC8 isolate Lactobacillus plantarum plasmid pMK02, complete sequence) position: , mismatch: 0, identity: 1.0

atagcactgtagaacataagc	CRISPR spacer
atagcactgtagaacataagc	Protospacer
*********************

30. spacer 1.1|35159|21|NC_020821|CRISPRCasFinder matches to NZ_CP017997 (Lactobacillus crustorum strain MN047 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

acagaatataagcactacagc	CRISPR spacer
acagaatataagcactatagc	Protospacer
*****************.***

31. spacer 2.1|35308|21|NC_020821|CRISPRCasFinder matches to NZ_CP014926 (Lactobacillus paracollinoides strain TMW 1.1995 plasmid pL11995-2, complete sequence) position: , mismatch: 1, identity: 0.952

atagcactgtagaacataagc	CRISPR spacer
atagaactgtagaacataagc	Protospacer
**** ****************

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NC_020819

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_020819_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_020819_1

1071990-1072505

Orphan

I-B,III-A,III-B

Consensus_repeat	Method
GTATTCCCCACACATGTGGGGGTGATCC	PILER-CR
GTATTCCCCACACATGTGGGGGTGATCC	CRISPRCasFinder
GTATTCCCCACACATGTGGGGGTGATCC	CRT

8 spacers

The CRISPR arrays of NC_020819_1

>merge|NC_020819|1|1071990-1072505|PILER-CR,CRISPRCasFinder,CRT
GTATTCCCCACACATGTGGGGGTGATCCTCAAGGCAAAATAAAAAACAGGCGCTATGCCTGGTATTCCCCACACATGTGGGGGTGATCCTCAGCACGATAGATAGCCGTTTGGCCACTATACGTATTCCCCACACATGTGGGGGTGATCCCTGGATGGTCGTAGGTTCGACCCCTACAAAGTCGTATTCCCCACACATGTGGGGGTGATCCTGTCGAAGGCGATGTACGTGAACTGAAAAGTAAGTATTCCCCACACATGTGGGGGTGATCCCTCCCGGTTGACTGACACCATAAGCGGCCACCCGTATTCCCCACACATGTGGGGGTGATCCCCATTGAATGCGGAATGACGGCTTTTTTATGAAGTATTCCCCACACATGTGGGGGTGATCCTAGATGGCCTTTTTCGGCTTAGCTGCCTTAGTGGTATTCCCCACACGTGTGGGGGTGATCCTGGCTGAAAACGAGCTTGTAGCATTTGAACCAAGTATTCCCCACATATGTAGGGGTGGTCT

>NC_020819|1|1|1071990-1072444|PILER-CR
GTATTCCCCACACATGTGGGGGTGATCC	TCAAGGCAAAATAAAAAACAGGCGCTATGCCTG
GTATTCCCCACACATGTGGGGGTGATCC	TCAGCACGATAGATAGCCGTTTGGCCACTATAC
GTATTCCCCACACATGTGGGGGTGATCC	CTGGATGGTCGTAGGTTCGACCCCTACAAAGTC
GTATTCCCCACACATGTGGGGGTGATCC	TGTCGAAGGCGATGTACGTGAACTGAAAAGTAA
GTATTCCCCACACATGTGGGGGTGATCC	CTCCCGGTTGACTGACACCATAAGCGGCCACCC
GTATTCCCCACACATGTGGGGGTGATCC	CCATTGAATGCGGAATGACGGCTTTTTTATGAA
GTATTCCCCACACATGTGGGGGTGATCC	TAGATGGCCTTTTTCGGCTTAGCTGCCTTAGTG
GTATTCCCCACACGTGTGGGGGTGATCC

>NC_020819|1|1|1071990-1072505|CRISPRCasFinder
GTATTCCCCACACATGTGGGGGTGATCC	TCAAGGCAAAATAAAAAACAGGCGCTATGCCTG
GTATTCCCCACACATGTGGGGGTGATCC	TCAGCACGATAGATAGCCGTTTGGCCACTATAC
GTATTCCCCACACATGTGGGGGTGATCC	CTGGATGGTCGTAGGTTCGACCCCTACAAAGTC
GTATTCCCCACACATGTGGGGGTGATCC	TGTCGAAGGCGATGTACGTGAACTGAAAAGTAA
GTATTCCCCACACATGTGGGGGTGATCC	CTCCCGGTTGACTGACACCATAAGCGGCCACCC
GTATTCCCCACACATGTGGGGGTGATCC	CCATTGAATGCGGAATGACGGCTTTTTTATGAA
GTATTCCCCACACATGTGGGGGTGATCC	TAGATGGCCTTTTTCGGCTTAGCTGCCTTAGTG
GTATTCCCCACACGTGTGGGGGTGATCC	TGGCTGAAAACGAGCTTGTAGCATTTGAACCAA
GTATTCCCCACATATGTAGGGGTGGTCT

>NC_020819|1|1|1071990-1072505|CRT
GTATTCCCCACACATGTGGGGGTGATCC	TCAAGGCAAAATAAAAAACAGGCGCTATGCCTG
GTATTCCCCACACATGTGGGGGTGATCC	TCAGCACGATAGATAGCCGTTTGGCCACTATAC
GTATTCCCCACACATGTGGGGGTGATCC	CTGGATGGTCGTAGGTTCGACCCCTACAAAGTC
GTATTCCCCACACATGTGGGGGTGATCC	TGTCGAAGGCGATGTACGTGAACTGAAAAGTAA
GTATTCCCCACACATGTGGGGGTGATCC	CTCCCGGTTGACTGACACCATAAGCGGCCACCC
GTATTCCCCACACATGTGGGGGTGATCC	CCATTGAATGCGGAATGACGGCTTTTTTATGAA
GTATTCCCCACACATGTGGGGGTGATCC	TAGATGGCCTTTTTCGGCTTAGCTGCCTTAGTG
GTATTCCCCACACGTGTGGGGGTGATCC	TGGCTGAAAACGAGCTTGTAGCATTTGAACCAA
GTATTCCCCACATATGTAGGGGTGGTCT

Protein	Signature genes	Signature genes Name	Protein_function
NC_020819.1\|WP_015473668.1\|1068957_1069278_+\|MazG-like-family-protein	unknown	unknown	gnl\|CDD\|212133
NC_020819.1\|WP_011667644.1\|1070259_1070718_-\|DUF3021-domain-containing-protein	unknown	unknown	gnl\|CDD\|378668
NC_020819.1\|WP_015473674.1\|1075619_1075850_-\|hypothetical-protein	unknown	unknown	unknown
NC_020819.1\|WP_158414576.1\|1070714_1070882_-\|LytTR-family-transcriptional-regulator-DNA-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|335768
NC_020819.1\|WP_011667648.1\|1068191_1068713_+\|biotin-transporter-BioY	unknown	unknown	gnl\|CDD\|224187
NC_020819.1\|WP_015473665.1\|1065820_1066588_+\|acetyl-CoA-carboxylase-carboxyl-transferase-subunit-alpha	unknown	unknown	gnl\|CDD\|235580
NC_020819.1\|WP_024855043.1\|1066618_1067377_+\|enoyl-ACP-reductase-FabI	unknown	unknown	gnl\|CDD\|235694
NC_020819.1\|WP_011667636.1\|1077285_1078374_-\|NAD(P)-dependent-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|176239
NC_020819.1\|WP_144054546.1\|1072701_1074189_+\|VaFE-repeat-containing-surface-anchored-protein	unknown	unknown	gnl\|CDD\|375630
NC_020819.1\|WP_015473681.1\|1081061_1082126_-\|ribosome-small-subunit-dependent-GTPase-A	unknown	unknown	gnl\|CDD\|234988
NC_020819.1\|WP_011667631.1\|1082683_1084150_+\|catalase	unknown	unknown	gnl\|CDD\|365942
NC_020819.1\|WP_011667649.1\|1067389_1068181_+\|biotin--[acetyl-CoA-carboxylase]-ligase	unknown	unknown	gnl\|CDD\|223417
NC_020819.1\|WP_015473669.1\|1069589_1070105_+\|isochorismatase-family-protein	unknown	unknown	gnl\|CDD\|238496
NC_020819.1\|WP_041815318.1\|1076525_1077158_+\|DJ-1/PfpI-family-protein	unknown	unknown	gnl\|CDD\|153234
NC_020819.1\|WP_041815834.1\|1079947_1080955_+\|aldo/keto-reductase	unknown	unknown	gnl\|CDD\|381305
NC_020819.1\|WP_108477558.1\|1074287_1075250_-\|CAP-domain-containing-protein	unknown	unknown	gnl\|CDD\|365934
NC_020819.1\|WP_011667642.1\|1071467_1071782_+\|type-II-toxin-antitoxin-system-HicB-family-antitoxin	unknown	unknown	gnl\|CDD\|374224
NC_020819.1\|WP_144054545.1\|1070839_1071220_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|197918
NC_020819.1\|WP_015473679.1\|1079472_1079826_-\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133384
NC_020819.1\|WP_015473678.1\|1078492_1079389_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223656

Protein	Function_ID	Function_description	E-value
NC_020819.1\|WP_015473668.1\|1068957_1069278_+\|MazG-like-family-protein	gnl\|CDD\|212133	cd11523, NTP-PPase, Nucleoside Triphosphate Pyrophosphohydrolase (EC 3.6.1.8) MazG-like domain superfamily. This superfamily contains enzymes that hydrolyze the alpha-beta phosphodiester bond of all canonical NTPs into monophosphate derivatives and pyrophosphate (PPi). Divalent ions, such as Mg2+ ion(s), are essential to activate a proposed water nucleophile and stabilize the charged intermediates to facilitate catalysis. These enzymes share a conserved divalent ion-binding motif EXX[E/D] in their active sites. They also share a highly conserved four-helix bundle, where one face forms the active site, while the other participates in oligomer assembly. The four-helix bundle consists of two central antiparallel alpha-helices that can be contained within a single protomer or form upon dimerization. The superfamily members include dimeric dUTP pyrophosphatases (dUTPases; EC 3.6.1.23), the nonspecific NTP-PPase MazG proteins, HisE-encoded phosphoribosyl ATP pyrophosphohydolase (PRA-PH), fungal histidine biosynthesis trifunctional proteins, and several uncharacterized protein families.	1.13154e-11
NC_020819.1\|WP_011667644.1\|1070259_1070718_-\|DUF3021-domain-containing-protein	gnl\|CDD\|378668	pfam11457, DUF3021, Protein of unknown function (DUF3021). This is a bacterial family of uncharacterized proteins.	2.29851e-27
NC_020819.1\|WP_158414576.1\|1070714_1070882_-\|LytTR-family-transcriptional-regulator-DNA-binding-domain-containing-protein	gnl\|CDD\|335768	pfam04397, LytTR, LytTr DNA-binding domain. This domain is found in a variety of bacterial transcriptional regulators. The domain binds to a specific DNA sequence pattern.	5.56172e-06
NC_020819.1\|WP_011667648.1\|1068191_1068713_+\|biotin-transporter-BioY	gnl\|CDD\|224187	COG1268, BioY, Uncharacterized conserved protein [General function prediction only].	1.07517e-24
NC_020819.1\|WP_015473665.1\|1065820_1066588_+\|acetyl-CoA-carboxylase-carboxyl-transferase-subunit-alpha	gnl\|CDD\|235580	PRK05724, PRK05724, acetyl-CoA carboxylase carboxyltransferase subunit alpha; Validated.	7.40202e-114
NC_020819.1\|WP_024855043.1\|1066618_1067377_+\|enoyl-ACP-reductase-FabI	gnl\|CDD\|235694	PRK06079, PRK06079, enoyl-[acyl-carrier-protein] reductase FabI.	5.56711e-169
NC_020819.1\|WP_011667636.1\|1077285_1078374_-\|NAD(P)-dependent-alcohol-dehydrogenase	gnl\|CDD\|176239	cd08278, benzyl_alcohol_DH, Benzyl alcohol dehydrogenase. Benzyl alcohol dehydrogenase is similar to liver alcohol dehydrogenase, but has some amino acid substitutions near the active site, which may determine the enzyme's specificity of oxidizing aromatic substrates. Also known as aryl-alcohol dehydrogenases, they catalyze the conversion of an aromatic alcohol + NAD+ to an aromatic aldehyde + NADH + H+. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction.	0
NC_020819.1\|WP_144054546.1\|1072701_1074189_+\|VaFE-repeat-containing-surface-anchored-protein	gnl\|CDD\|375630	pfam18202, TQ, T-Q ester bond containing domain. This domain is found in gram positive bacterial surface proteins. It contains a very unusual isopeptide bond between a conserved N-terminal threonine residue on the first beta strand of the Ig-like fold and and a glutamine residue in the final strand of the domain.	0.000543888
NC_020819.1\|WP_015473681.1\|1081061_1082126_-\|ribosome-small-subunit-dependent-GTPase-A	gnl\|CDD\|234988	PRK01889, PRK01889, GTPase RsgA; Reviewed.	5.62285e-138
NC_020819.1\|WP_011667631.1\|1082683_1084150_+\|catalase	gnl\|CDD\|365942	pfam00199, Catalase, Catalase.	0
NC_020819.1\|WP_011667649.1\|1067389_1068181_+\|biotin--[acetyl-CoA-carboxylase]-ligase	gnl\|CDD\|223417	COG0340, BirA, Biotin-(acetyl-CoA carboxylase) ligase [Coenzyme metabolism].	1.3895e-46
NC_020819.1\|WP_015473669.1\|1069589_1070105_+\|isochorismatase-family-protein	gnl\|CDD\|238496	cd01014, nicotinamidase_related, Nicotinamidase_ related amidohydrolases. Cysteine hydrolases of unknown function that share the catalytic triad with other amidohydrolases, like nicotinamidase, which converts nicotinamide to nicotinic acid and ammonia.	1.02031e-41
NC_020819.1\|WP_041815318.1\|1076525_1077158_+\|DJ-1/PfpI-family-protein	gnl\|CDD\|153234	cd03140, GATase1_PfpI_3, Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus. Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus. PfpI is an ATP-independent intracellular proteases which may hydrolyze small peptides to provide a nutritional source. Only Cys of the catalytic triad typical of GATase1 domains is conserved in this group. This Cys residue is found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow.	3.5534e-61
NC_020819.1\|WP_041815834.1\|1079947_1080955_+\|aldo/keto-reductase	gnl\|CDD\|381305	cd19079, AKR_EcYajO-like, Escherichia coli YajO and similar proteins. Escherichia coli YajO is the prototype of this family. It is an uncharacterized aldo/keto reductase family oxidoreductase.	1.87515e-162
NC_020819.1\|WP_108477558.1\|1074287_1075250_-\|CAP-domain-containing-protein	gnl\|CDD\|365934	pfam00188, CAP, Cysteine-rich secretory protein family. This is a large family of cysteine-rich secretory proteins, antigen 5, and pathogenesis-related 1 proteins (CAP) that are found in a wide range of organisms, including prokaryotes and non-vertebrate eukaryotes, The nine subfamilies of the mammalian CAP 'super'family include: the human glioma pathogenesis-related 1 (GLIPR1), Golgi associated pathogenesis related-1 (GAPR1) proteins, peptidase inhibitor 15 (PI15), peptidase inhibitor 16 (PI16), cysteine-rich secretory proteins (CRISPs), CRISP LCCL domain containing 1 (CRISPLD1), CRISP LCCL domain containing 2 (CRISPLD2), mannose receptor like and the R3H domain containing like proteins. Members are most often secreted and have an extracellular endocrine or paracrine function and are involved in processes including the regulation of extracellular matrix and branching morphogenesis, potentially as either proteases or protease inhibitors; in ion channel regulation in fertility; as tumor suppressor or pro-oncogenic genes in tissues including the prostate; and in cell-cell adhesion during fertilisation. The overall protein structural conservation within the CAP 'super'family results in fundamentally similar functions for the CAP domain in all members, yet the diversity outside of this core region dramatically alters the target specificity and, thus, the biological consequences. The Ca++-chelating function would fit with the various signalling processes (e.g. the CRISP proteins) that members of this family are involved in, and also the sequence and structural evidence of a conserved pocket containing two histidines and a glutamate. It also may explain how the cysteine-rich venom protein helothermine blocks the Ca++ transporting ryanodine receptors.	3.8596e-13
NC_020819.1\|WP_011667642.1\|1071467_1071782_+\|type-II-toxin-antitoxin-system-HicB-family-antitoxin	gnl\|CDD\|374224	pfam15919, HicB_lk_antitox, HicB_like antitoxin of bacterial toxin-antitoxin system. This is a family of HicB-like antitoxins.	1.54624e-06
NC_020819.1\|WP_144054545.1\|1070839_1071220_-\|hypothetical-protein	gnl\|CDD\|197918	smart00850, LytTR, LytTr DNA-binding domain. This domain is found in a variety of bacterial transcriptional regulators. The domain binds to a specific DNA sequence pattern.	0.000178773
NC_020819.1\|WP_015473679.1\|1079472_1079826_-\|MerR-family-transcriptional-regulator	gnl\|CDD\|133384	cd01109, HTH_YyaN, Helix-Turn-Helix DNA binding domain of the MerR-like transcription regulators YyaN and YraB. Putative helix-turn-helix (HTH) MerR-like transcription regulators of Bacillus subtilis, YyaN and YraB, and related proteins; N-terminal domain. Based on sequence similarity, these proteins are predicted to function as transcription regulators that mediate responses to stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.	1.32722e-39
NC_020819.1\|WP_015473678.1\|1078492_1079389_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|223656	COG0583, LysR, Transcriptional regulator [Transcription].	3.0758e-21

>NC_020819.1|WP_011667642.1|1071467_1071782_+|type-II-toxin-antitoxin-system-HicB-family-antitoxin
MTKSNIVTYPAVFHDNEVGGYTVTFPDIEDATTSGQTLGESLVNAAIVLGQTLHDQPTVLPSATTITELMHQYPMAFIQFVAVDLNQVIARAVPTDQVDLQLIQ
>NC_020819.1|WP_144054545.1|1070839_1071220_-|hypothetical-protein
MLNLSERQAVTMHVTFNLKASFIPPFITINAPAETPELQHLATNISQLTNSQLIAGISPRGTRELVPVNQIIRIHTDAKHVVMETKATSYTLTQRIYQLKQLLPSESTSSNNSCPATYFCNFRVAN
>NC_020819.1|WP_158414576.1|1070714_1070882_-|LytTR-family-transcriptional-regulator-DNA-binding-domain-containing-protein
MPSDLFLQLSSGELVNRQHIRHFSLTPSGQVLLSTGATTFVSRRCMQQIRKEFLK
>NC_020819.1|WP_011667644.1|1070259_1070718_-|DUF3021-domain-containing-protein
MKRLGILTSGAFLGLSIGFICALFFSLTNHATTFMPSSPDFVAHLSSNTMATLAAAGLWAAIGLLFSLTSLIFFNEHWSIARQTIWHLGLSYLGFTPLAILAGWFPLNVTWLLLYTLIFVGIYLVIWTYSMLRARKTVQHLNDVLLPHKYTN
>NC_020819.1|WP_015473669.1|1069589_1070105_+|isochorismatase-family-protein
MAQALIVIDMQQALAKIDRRNQMVATINQRIDRYREAQRPIIFIQHTEPGMEVASAGWQLFPDLHAAGSDVYYNKTRPDSFYQTGLEAFLKMNQLRTIEICGAQVEYCVDTTIRVAYHLGFQIELLMAGISTLDSDLLTATQIKQHHAHIWEHRFADFVTADTELDGQYQK
>NC_020819.1|WP_015473668.1|1068957_1069278_+|MazG-like-family-protein
MSISDHQQWLVDFYRQRNWYQYSPFVHLNFLTEEVGEVSRAIRAEEIGRDHPGERQATMAEKRANLKEELADALDQVLVISSLYDIDAADLLTASEQKLTQRFKQK
>NC_020819.1|WP_011667648.1|1068191_1068713_+|biotin-transporter-BioY
MQERQSIPLVGLFIAIIVIFGFFPAIPLAISPVPLVLQNMGVMVVTLLLPTRQSLAAIGLFLLLVLVGLPVLASRQAGPAVFLGPNGGYLVGWLIMPLMLQGLTYGRVPRLVAILLSAMGVDILGAVWLSTVTTMSLPQALVATLAFIPGDSLKAVGAWWLAQRLRKWAPKMI
>NC_020819.1|WP_011667649.1|1067389_1068181_+|biotin--[acetyl-CoA-carboxylase]-ligase
MQPKGNQLAVDRIRELRQTTCPIAIQLRSTVDSTNAWAKRVPAASDSPMQAFLAEQQTAGYGKRQRAFFSPAFQGVYLTVRTAVTAPVNPGRLTTAVGVMVVRCLAATYPKQTFQLKWVNDILLHQRKCGGILIENLLDRQEVLIGIGLNVTTRFSTELANKATSIVGGNWVDRNGLVAGLLDELVMGLPHYQDAQFLADYQQLCTTLGQAVRVQVGPDWVQGVAVTLTDQGALVIQLASGERRIVASSEAIKVMTPVGDYRG
>NC_020819.1|WP_024855043.1|1066618_1067377_+|enoyl-ACP-reductase-FabI
MNGILTDKVIVVMGVANQRSIAWGCVQAILAQGGTPVLTYQNERLKKSIQRFVPEDIQLVACDVAEDAAIQQAFQQIGERYGNIDGVIHAIAYADPETLKQGLVETRRTGYNLAQEISAYSFIAVARYARPWLTKPASLITLTYFGATRAIPNYNMMGVAKAALESSVRYLATDLGTEQIRVNAISAGAVKTLAVTGIKGHGDLLKMSTSLTVDQQSVTTSEIGNVAAFLLSDLSTGMTGDILYVDKGVHLM
>NC_020819.1|WP_015473665.1|1065820_1066588_+|acetyl-CoA-carboxylase-carboxyl-transferase-subunit-alpha
MVKSAYQTVQAARSQDKITTEALIDGLVTDFFECHGDRVDGDDPTIIGGIGRLNGQPITVIGTRKGRNLTENVARHFGSPMPQGYRKVQRLLQQAEKFGRPVLTLINTPGAYPDVASEFHGQGEAIAQCLYQGMQLKVPYISLIFGEGGSGGALALACGDRVYMTVDSIYSVLSPEGYASIMWKDASRVREAAAALALTPQDLKREKVIDDILPEVHTAAELSQLTDFLHEQFKILGKLPISTLIDQRQTRFDQY
>NC_020819.1|WP_144054546.1|1072701_1074189_+|VaFE-repeat-containing-surface-anchored-protein
MVAKASDPMSATDKTEIVAAFSNVVSKIKDIQNSDQNTVDQNTGDNASNPNHANTGYTTNLSETAAANKRLSENKLVPVKPDYDTTPINPHDKKYLIDTTALRGQKMVMIEDMSTGQGTKEDQITSEVDVNNTKQTVRVTNPAIHTMQTVNNKKNFVLKGDGSNVQEPIVDKVSFTDFAPGEKMVLTAVEMDAGTQQPVILDNQYLIGRKTLTPTTSDGVATVQFNEFDGAPNARYMTPVLNSAGLVTNNAVNDGISSAQDSDNNADAVNRDETNDAQADGTTTGAYQGVAGLGLGTDDTDAETDTTAYNINLQSLNSLAALSDGDQAKWVAYETAQSADGSIVAEHKDSSDTGQTISITHNAGTTDNNAQGGLTVNNQNGQKQGNDGKLDSHNNNNPSNGSGSLSNGSNPTTGSSTTPGSQYTTTQPGQNGMTPTTQVPSQLPSQARSVFSQGQPLQGTTYVRPSVTRPTFGQTGGTDKLSNNWFYNFIYRFMK
>NC_020819.1|WP_108477558.1|1074287_1075250_-|CAP-domain-containing-protein
MSKKARKLLCIAFSALVSFSITAAIPTTSQAAKRKPGKVVRTMKYKTMKVKAKKGYVYTSTKLTKRGVHLTKYKNKVMTTKKAYLIKVPGKPAVWYDRVSSKNKKLNGYVYNNYLKVIKKSSTNGKTSTKTTNKIPVDPDANVPLKDLYSYGTNSKNNSTQKLGLDGDQSYYDTDIFSKYPANLDEFKSTFVELLNQERQSRGLSPVSVDSDLSQIANKRALDSQKINDLVHLDSAGNSIAAVYAKKAGLNVPPFSECLGFVENAPTRMVVRESLRDYIYQDAASDWGHRNILLNPSYTRIGVGITTAKNKMTVNAIEMY
>NC_020819.1|WP_015473674.1|1075619_1075850_-|hypothetical-protein
MSIETAHDSIVLWENKAVELQDHIDDLCIILESHDDPEIEKMVHRAMQEKARYNKKIQKAQNELDSAIGSILSGIN
>NC_020819.1|WP_041815318.1|1076525_1077158_+|DJ-1/PfpI-family-protein
MKQAIFVMMDQYADWEGAHLSSRLNQMTDWTVKTASNQPEVTSIGGWTTRVDYQISELNPEMTLLVLIGGNAWQHDDPRLTALIQQCLQRKVIVGAICGAVDYLARNGLLTGYRHTGNAQFSWQSFPKYQNPTDFELQQVVVDRQLVTANGTAALSFTSAVLKASGQLTIAAKQALDLQQLGYYDNTETHLNCRGDRSWIRLVLKKVTDC
>NC_020819.1|WP_011667636.1|1077285_1078374_-|NAD(P)-dependent-alcohol-dehydrogenase
MQIKTAFSDGTSEQLKIIDATLDEPKANEVLIKMVATGVCHTDTAGRDGLTTPLPVSLGHEGAGIVEQVGSSVMDLQPGDHVVLSFAYCGRCQHCLTGHPGMCEHFNELNFAGHNFDGSHRIHTLDGQPISTFFGQSSFSTHTVVDQHNVIKVDPTVDLRLLGPLGCGIQTGAGTILNYLQPKFGESLVIFGTGAVGLSAIMAAKITGANHIIAIDIFDNRLALAKELGATEVINSHQADVEATLKEILPTGADYAIDTTGVSPVVMNALHALKPGGECAVVGMGRGLTFNLMDDLMAEGKKISGVIEGDAIPQLFIPKLVDYYKQGRFPFDKLIKFYDFDQINDGFAASKDGSVLKPVITF
>NC_020819.1|WP_015473678.1|1078492_1079389_+|LysR-family-transcriptional-regulator
MRNDNLILFVETAQLGSFQKTAELNLMSQRAVSKRISALETEIGATLFDRQKNKINLTAAGKHFLTRATELLNTMRMTTYEVQQITQQAKEQFNVGYFSPFEGVLLRMALLDLPTTTNFMIEEAGIEHLISDVLLKKIDCAVIIDNPLFNAKIDQTDLESVTLVTDHMTLGLSPDLITDQTDSPADYLAKFPVIYYSSEESTYLEEVFKSSIGQLADTFNARRVNSYEQMQLLVGMGKAISFYPTELIKYMATPYDHITYLSLDGVTTAHSEFKLIYHHGNHQPLIKQIQRYFDTHQF
>NC_020819.1|WP_015473679.1|1079472_1079826_-|MerR-family-transcriptional-regulator
MKIETVAQRYHISTSAIRYYEQQGLIGPINRINGIRDFNTTDLERMDFILCVKQCGMTIKQMKQFIATYEQGDSTLRERLTILQTQLSASEEQLTTLTRSINHLKKKIGDIRIRLAE
>NC_020819.1|WP_041815834.1|1079947_1080955_+|aldo/keto-reductase
MQYTKLGHTEIMASKICVGAMSFGQPGTMHDWTLDYPASERVIGHALSLGINFFDTANGYSAGTSETYLGRALKAQRVARDQVVLASKVYFNPGRLSAKAIHHEIDGTLKRLGTDYLDLYIIHRFDYDTPIEETMVALNELVTAGKVRAIGASAMYGYQFNNMQQVAKDRGWAQFQTMENHYNLLYREDERELIPICQQQGVSLTPYSPLAAGHLSHSAWQVDTLRSQTDRVAMGKYDRTETEDQRIVARVAELAHKYQVSMTQIALAWQWAKGVAAPIVGSTKTSHLDEAVAALSVKLTTADIDYLEDLYRPHPIVGALDHNPAAGTILIDQKK
>NC_020819.1|WP_015473681.1|1081061_1082126_-|ribosome-small-subunit-dependent-GTPase-A
MSNSNLLSYGVTSTLIHQFADISDRQVGRIVRQERQQYQVITAVGVVSAQTSGRFNHHVLDTSDFPVIGDFVGIQLTPTKDAAIIHQELPRNSLFVRQAAGTTHQVQSVAANVNVALICMSLNHDFNPHRLERYLTVCWDSGATPVVVLTKSDLCSDTEAKLAVIAPMTLGVTVLTTTTTTANGLAPLQTFLQAGQTFALLGSSGVGKSILINRLLGKTIITTDGLRNDDKGHHTTTSRELYQLSSGALMIDTPGMRALGLWGADTGLAQNFSDVADLIRHCRFRNCHHQTEPGCAVKAALATGQLTTERGQSYQKLQAENAYSHDTQAYLAQKQRTEVANAKQIRQIYHPKHY
>NC_020819.1|WP_011667631.1|1082683_1084150_+|catalase
MREDLKNSAGQPWGDNEHSLTAGQRGPVLIQDYNLLEKLAHFNRERIPERVVHAKGAGAEGTFRLTKDMHQYTKAKIFTEMGKSVPMRIRFSQVAGEMGSADTVRDVRGFALRFYTDDGNYDIVGNNTPVFFVNDPLKFPDFIHSQKRDPRTHERSQDMQWDFWAHSPESVHQVTILMSDRGIPASYRKMHGYGSHTFKWVNEAGEVFWVKYHFRTAQGIQNLSNDVAQRLAGENPDYLQADLYHAIEAGDFPTWKVCVQVIPEQAGLDYPADIFDVTQVVSQKDYPLIEIGEFTLNKNPDNYFEGVEEAAFSPANLVPGIEPSPDKLLQGRLFAYKDAARYRLGVNYEQLPANRPLNHPNNYERDGFMQTDNHGDQVNYEPNSQGGPQEDPAGRLTPYTVSGKAGNYAYQTDYGRAAGKLYRLLPADERQRLIETIVMNLGQVKSHDVKRLETAQFYEADHDYGLAVAKGLGLKLDEIKDYPFDTTH

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_020819_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_020819_2

2353847-2353930

Orphan

Consensus_repeat	Method
GCCCCCACACCTGTGGGGAATAC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_020819_2

>merge|NC_020819|2|2353847-2353930|CRISPRCasFinder
GCCCCCACACCTGTGGGGAATACTGACAACCAAAAAATATACGACTTTAACTTCTGGGATCACCCCCACACCTGTGGGGAATAC

>NC_020819|2|2|2353847-2353930|CRISPRCasFinder
GCCCCCACACCTGTGGGGAATAC	TGACAACCAAAAAATATACGACTTTAACTTCTGGGATC
ACCCCCACACCTGTGGGGAATAC

Protein	Signature genes	Signature genes Name	Protein_function
NC_020819.1\|WP_011668944.1\|2357645_2360762_-\|YfhO-family-protein	unknown	unknown	gnl\|CDD\|370572
NC_020819.1\|WP_173391371.1\|2352379_2353681_+\|NCS2-family-permease	unknown	unknown	gnl\|CDD\|225161
NC_020819.1\|WP_041815761.1\|2337687_2338449_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197666
NC_020819.1\|WP_011668938.1\|2351106_2352090_+\|aldo/keto-reductase	unknown	unknown	gnl\|CDD\|381309
NC_020819.1\|WP_011668945.1\|2361022_2361544_+\|QueT-transporter-family-protein	unknown	unknown	gnl\|CDD\|377623
NC_020819.1\|WP_011668834.1\|2338863_2339769_+\|hypothetical-protein	unknown	unknown	unknown
NC_020819.1\|WP_041815770.1\|2362245_2362935_-\|hypothetical-protein	unknown	unknown	unknown
NC_020819.1\|WP_011668950.1\|2365826_2367449_-\|glycoside-hydrolase-family-43-protein	unknown	unknown	gnl\|CDD\|226038
NC_020819.1\|WP_041815768.1\|2354745_2355681_+\|daunorubicin-resistance-protein-DrrA-family-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|130256
NC_020819.1\|WP_011668940.1\|2354069_2354600_-\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197670
NC_020819.1\|WP_015474578.1\|2343632_2347238_-\|PD-(D/E)XK-nuclease-family-protein	unknown	unknown	gnl\|CDD\|213736
NC_020819.1\|WP_011668934.1\|2347532_2348675_+\|ArgE/DapE-family-deacylase	unknown	unknown	gnl\|CDD\|181490
NC_020819.1\|WP_015474579.1\|2348777_2349791_-\|polysaccharide-deacetylase-family-protein	unknown	unknown	gnl\|CDD\|200578
NC_020819.1\|WP_015474590.1\|2367468_2368944_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|225121
NC_020819.1\|WP_041815764.1\|2339860_2343649_-\|helicase-exonuclease-AddAB-subunit-AddA	unknown	unknown	gnl\|CDD\|274299
NC_020819.1\|WP_015474584.1\|2355695_2356472_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|272861
NC_020819.1\|WP_011668936.1\|2349922_2350288_-\|hypothetical-protein	unknown	unknown	unknown
NC_020819.1\|WP_015474585.1\|2356629_2357544_-\|prenyltransferase	unknown	unknown	gnl\|CDD\|260125
NC_020819.1\|WP_041815773.1\|2363266_2365087_-\|DUF2207-domain-containing-protein	unknown	unknown	gnl\|CDD\|378333
NC_020819.1\|WP_011668937.1\|2350364_2350964_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|379199

Protein	Function_ID	Function_description	E-value
NC_020819.1\|WP_011668944.1\|2357645_2360762_-\|YfhO-family-protein	gnl\|CDD\|370572	pfam09586, YfhO, Bacterial membrane protein YfhO. This protein is a conserved membrane protein. The yfhO gene is transcribed in Difco sporulation medium and the transcription is affected by the YvrGHb two-component system. Some members of this family have been annotated as glycosyl transferases of the PMT family.	3.69128e-73
NC_020819.1\|WP_173391371.1\|2352379_2353681_+\|NCS2-family-permease	gnl\|CDD\|225161	COG2252, COG2252, Xanthine/uracil/vitamin C permease [Nucleotide transport and metabolism].	1.75848e-141
NC_020819.1\|WP_041815761.1\|2337687_2338449_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|197666	smart00342, HTH_ARAC, helix_turn_helix, arabinose operon control protein.	2.64006e-19
NC_020819.1\|WP_011668938.1\|2351106_2352090_+\|aldo/keto-reductase	gnl\|CDD\|381309	cd19083, AKR_AKR11A1_11D1, AKR11A and AKR11D families of aldo-keto reductase (AKR). Bacillus subtilis aldo-keto reductase IolS, also called vegetative protein 147 (VEG147), is a founding member of aldo-keto reductase family 11 member A1 (AKR11A1). It is able to reduce the standard aldo-keto reductase (AKR) substrates DL-glyceraldehyde, D-erythrose, and methylglyoxal in the presence of NADPH, albeit with poor efficiency in vitro. Bacillus aryabhattai aldo keto reductase is a founding member of aldo-keto reductase family 11 member D1 (AKR11D1).	1.4297e-166
NC_020819.1\|WP_011668945.1\|2361022_2361544_+\|QueT-transporter-family-protein	gnl\|CDD\|377623	pfam06177, QueT, QueT transporter. This family includes the queT gene encoding a hypothetical integral membrane protein with 5 predicted transmembrane regions. The queT genes in Firmicutes are often preceded by the PreQ1 (7-aminomethyl-7-deazaguanine) riboswitches of two distinct classes, suggesting involvement of the QueT transporters in uptake of a queuosine biosynthetic intermediate.	2.03886e-36
NC_020819.1\|WP_011668950.1\|2365826_2367449_-\|glycoside-hydrolase-family-43-protein	gnl\|CDD\|226038	COG3507, XynB, Beta-xylosidase [Carbohydrate transport and metabolism].	0
NC_020819.1\|WP_015474584.1\|2355695_2356472_+\|ABC-transporter-permease	gnl\|CDD\|272861	TIGR00025, Mtu_efflux, ABC transporter efflux protein, DrrB family. The seed members for this model are a paralogous family of Mycobacterium tuberculosis. Nearly all proteins scoring above the noise cutoff are from high-GC Gram-positive organisms. The members of this paralogous family of efflux proteins are all found in operons with ATP-binding chain partners. They are related to a putative daunorubicin resistance efflux protein of Streptomyces peucetius. This model represents a branch of a larger superfamily that also includes NodJ, a part of the NodIJ pair of nodulation-triggering signal efflux proteins. The members of this branch may all act in antibiotic resistance.	1.33606e-17
NC_020819.1\|WP_011668940.1\|2354069_2354600_-\|MarR-family-transcriptional-regulator	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	2.64201e-15
NC_020819.1\|WP_015474578.1\|2343632_2347238_-\|PD-(D/E)XK-nuclease-family-protein	gnl\|CDD\|213736	TIGR02773, ATP-dependent_helicase/deoxyribonuclease_subunit_B, helicase-exonuclease AddAB, AddB subunit. DNA repair is accomplished by several different systems in prokaryotes. Recombinational repair of double-stranded DNA breaks involves the RecBCD pathway in some lineages, and AddAB (also called RexAB) in other. The AddA protein is conserved between the firmicutes and the alphaproteobacteria, while the partner protein is not. Nevertheless, the partner is designated AddB in both systems. This model describes the AddB protein as found Bacillus subtilis and related species. Although the RexB protein of Streptococcus and Lactococcus is considered to be orthologous, functionally equivalent, and merely named differently, all members of this protein family have a P-loop nucleotide binding motif GxxGxGK[ST] at the N-terminus, unlike RexB proteins, and a CxxCxxxxxC motif at the C-terminus, both of which may be relevant to function. [DNA metabolism, DNA replication, recombination, and repair].	0
NC_020819.1\|WP_011668934.1\|2347532_2348675_+\|ArgE/DapE-family-deacylase	gnl\|CDD\|181490	PRK08588, PRK08588, succinyl-diaminopimelate desuccinylase; Reviewed.	0
NC_020819.1\|WP_015474579.1\|2348777_2349791_-\|polysaccharide-deacetylase-family-protein	gnl\|CDD\|200578	cd10954, CE4_CtAXE_like, Catalytic NodB homology domain of Clostridium thermocellum acetylxylan esterase and its bacterial homologs. This family is represented by Clostridium thermocellum acetylxylan esterase (CtAXE, EC 3.1.1.72), a member of the carbohydrate esterase 4 (CE4) superfamily. CtAXE deacetylates O-acetylated xylan, a key component of plant cell walls. It shows no detectable activity on generic esterase substrates including para-nitrophenyl acetate. It is specific for sugar-based substrates and will precipitate acetylxylan, as a consequence of deacetylation. CtAXE is a monomeric protein containing a catalytic NodB homology domain with the same overall topology and a deformed (beta/alpha)8 barrel fold as other CE4 esterases. However, due to differences in the topography of the substrate-binding groove, the chemistry of the active center, and metal ion coordination, CtAXE has different metal ion preference and lacks activity on N-acetyl substrates. It is significantly activated by Co2+. Moreover, CtAXE displays distinctly different ligand coordination to the metal ion, utilizing an aspartate, a histidine, and four water molecules, as opposed to the conserved His-His-Asp zinc-binding triad of other CE4 esterases.	4.51273e-78
NC_020819.1\|WP_011668937.1\|2350364_2350964_-\|SDR-family-oxidoreductase	gnl\|CDD\|379199	pfam13460, NAD_binding_10, NAD(P)H-binding.	8.82255e-28
NC_020819.1\|WP_041815764.1\|2339860_2343649_-\|helicase-exonuclease-AddAB-subunit-AddA	gnl\|CDD\|274299	TIGR02785, ATP-dependent_helicase/nuclease_subunit_A, helicase-exonuclease AddAB, AddA subunit, Firmicutes type. AddAB, also called RexAB, substitutes for RecBCD in several bacterial lineages. These DNA recombination proteins act before synapse and are particularly important for DNA repair of double-stranded breaks by homologous recombination. The term AddAB is used broadly, with AddA homologous between the Firmicutes (as modeled here) and the alphaproteobacteria, while the partner AddB proteins show no strong homology across the two groups of species. [DNA metabolism, DNA replication, recombination, and repair].	0
NC_020819.1\|WP_015474590.1\|2367468_2368944_-\|MFS-transporter	gnl\|CDD\|225121	COG2211, MelB, Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism].	1.79677e-117
NC_020819.1\|WP_015474585.1\|2356629_2357544_-\|prenyltransferase	gnl\|CDD\|260125	cd13962, PT_UbiA_UBIAD1, 1,4-Dihydroxy-2-naphthoate octaprenyltransferase. Human UBIAD1 is an enzyme involved in the synthesis of MK-4. Menaquinones (MKs, also called bacterial forms) are one of the two forms of natural vitamin K, the other being the plant form, phylloquinone (PK). All forms of vitamin K have a 2-methyl-1,4-naphthoquinone (menadione; K3) ring structure in common. At the 3-position of the ring, PK has a phytyl side chain while MKs have several repeating prenyl units. Prenyltransferases (PTs) catalyze the regioselective transfer of prenyl moieties onto a wide variety of substrates and play an important role in many biosynthetic pathways.	1.75764e-58
NC_020819.1\|WP_041815773.1\|2363266_2365087_-\|DUF2207-domain-containing-protein	gnl\|CDD\|378333	pfam09972, DUF2207, Predicted membrane protein (DUF2207). This domain, found in various hypothetical bacterial proteins, has no known function.	7.19019e-111
NC_020819.1\|WP_041815768.1\|2354745_2355681_+\|daunorubicin-resistance-protein-DrrA-family-ABC-transporter-ATP-binding-protein	gnl\|CDD\|130256	TIGR01188, drrA, daunorubicin resistance ABC transporter ATP-binding subunit. This model describes daunorubicin resistance ABC transporter, ATP binding subunit in bacteria and archaea. This model is restricted in its scope to preferentially recognize the ATP binding subunit associated with effux of the drug, daunorubicin. This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily. The characteristic feature of these transporter is the obligatory coupling of ATP hydrolysis to substrate translocation. The minimal configuration of bacterial ABC transport system: an ATPase or ATP binding subunit; An integral membrane protein; a hydrophilic polypetpide, which likely functions as substrate binding protein. In eukaryotes proteins of similar function include p-gyco proteins, multidrug resistance protein etc. [Transport and binding proteins, Other].	6.47864e-106

>NC_020819.1|WP_173391371.1|2352379_2353681_+|NCS2-family-permease
MANFFHFEELGTNYKTEILAGLTTFVSMAYILFVNPQVLGASGISQGAVFTATAFASAFGCMLMGILANYPIAISASLGINAFFAYSVVIGMKVPWQTALAGVFVASILFMILTAFKLREKVVDAIPRDLKMAISAGIGLFIAFIGLSQGGLVAADKSTIVSLGSLQVGSTWLTIFGLLVTVLLMSARVPGAIFIGMVANSILGLVTGLIPMPSHIVAAVPSISSTFMVGLTHVGSINSLQMIVVVLTFLLVTFFDTTGTLVGLAEQAGLVKNNKLPRIGKALMADSSTMVVGSLLGTSPMGAFVESSAGIAVGGRTGFTAIVTGILFIFGAFFSPLLAVVTDQVTAPALIIVGVLMAQSLKNIHWEKFEVAAPAFLIMLGMPLTYSISDGIALGFITYPLTMLAAKRGKEVGAMMYGLAVVFVLFLWILNAA
>NC_020819.1|WP_011668938.1|2351106_2352090_+|aldo/keto-reductase
MTHELVTLGKTDVRTTPLGLGTNAVGGYNLFPNLKDDDGLNLVKAGLNHGIQLLDTAFVYGLGHSEELVGQAMHDFDRHSFTLATKGAQDFSSGEQVINNDPAFLTAQVDASLKRLNTDYLDIYYIHFPDKQTPKAEAVGALQRLREQGKIRAIGLSNFSLVQVKEANADGYVDVVEDEFSLLHRDHETDLMPYLADHQISFVPYFPLASGLLTGKYDQSVQFPADDIRSQISDFQEPRYSQALTAIDQVRPIAQAHQATVAQTILAWYMQNPLVSVVIPGAKRAAQVEANAQALEVTLTAAEYQTIDTAFAGFKATANGKSLADPD
>NC_020819.1|WP_011668937.1|2350364_2350964_-|SDR-family-oxidoreductase
MTTYLIIGANRVGQLVARQLATESATVRLLHDGKETLPSDLATQVTELTGDLTQEATYTAALQDQPIIFSALTGMDVDLAFEALFDAQYHQRLTFQRFVMLSTAGVDQEVTGDLAYPGITDVAEYLKQQRYAAKLVDEAEFPYTILRPVTLADSPRRDPQIIKEGAAVPAGTVSRETVAQVAVSLLQAGGADYQSLAIC
>NC_020819.1|WP_011668936.1|2349922_2350288_-|hypothetical-protein
MALQIDEQQLQAIRERMDEANQRAHFVIFQSVERESGKVLRLITDIDSFRAIQEQHQDDSDMVIIQDIVPITDTLARWAVAENMAAQQGDNAEVLADLERYTNEVLKENHQTVNPPESTDD
>NC_020819.1|WP_015474579.1|2348777_2349791_-|polysaccharide-deacetylase-family-protein
MVKIGKVLGVLVATVALGVGSVPVTGQAKSTNKTVTFGQLTNKNTHRLAAIRQAARQEILTTTKAKSSRVAAVYQVKLPTHMTKTATLTKSGLRMNLLKNSFKVKQITIPYAQLKGKVLNRYLPKANRTSTIKTSKLVALTFDDGPDPTLTSRLLKTLKKYHAHATFFEVGQSVSRYPKISRAVLAGGNEIGNHSWNHLNFNSIGTAQTVSQVTRTNRAIYQATGTLPQYVRPPYGNITAAEGRAIEQPIIRWSVDSRDWAYLNSSKDINEVMHDTHGGDIILMHDIHAQSVAAAPTIIKRLQAKGYKLVTVSQLLNSQALPGLQYFGAHDYRTVGK
>NC_020819.1|WP_011668934.1|2347532_2348675_+|ArgE/DapE-family-deacylase
MEDSEQIQILQHLISINSVNDHEADVAAYIQQLFADHGITSQVIPYADGRANIIAEIGDTTSDQVFALAGHLDTVATGDVADWKFDPFSAHIVDNQLYGRGAADMKSGLAAMVITLINLADQQTPLTGRLRFIGTVGEENGAMGSRMLTEKGVADDLTAMVIGEPTGGNLVYAHNGSLNYHVYSRGVGAHSSMPEKGINAITNLIKYVTAEATAFDDAPVSPELGPLVHSVTVFNGGEQVNSIPAKAELQGNIRPIPEFDNTAVIHRLHETVDRLNQEPGVDLALHVDYSFKPIISAKDSPLVQTTKAIADQEFGHAIDLQVIHGATDASEFTKSSHDFPVIVYGAGKWDAAHALNESVDLDEFRHVQHVYQQLVEKFLS
>NC_020819.1|WP_015474578.1|2343632_2347238_-|PD-(D/E)XK-nuclease-family-protein
MSLQFILGSAGQDHRTPMVTALAQQVTAHPTDQSYYLVPNHIKFETEVDVLSALKEQIAPEQALFAQTQVQVFSFTRLAWFFMKNEPIYQLPRISPAGLNMLIYQIIQTHADELTIFRGEVDRPGFVSQLATQLAEFKVGQVTAADLMSAIEQLDTTNTDLQAKLHDLMIIYEAFETQMMGKFVENTDLLNQLATYLEQQVDLQHAHFYLEGFSQLSAQERQLVAILIQRSASVTVALNLDHGYPQKLPDKTMLFFQSAKLYQQLYLVAQANRVPILIDQQAKTARVSADLQALDTYWQASQTLSPQPSVVEKPTHIQIVQAANRYVEVSRVATQIRQLVATGNYRYRDFLVLTRHLDAYQTVIDPIFQAQAVPYFDDADIRMADHPFVELLNALFDVQRRNYRYADVFRVLKSELLLPRDADGELMAVPAYRQALALTENFVLKNGLEGQHWWTQDKDWVYNRFAVGDGGVQTTRDDQISAQINRIRRFVKQTLPPFFARLKVAATYTDAAAVLYQFVANAGVSERLMTWRDQAIAAGDLTKAGQPEQTWAAFCDILDEFHTILGDLPTVLPDFQALLQAGFAGAKFSQIPSTLDQVVISESGIVQANNRKITFIMGATADTMPDNQIPTTLLADNDRQDLSARLQQVDDGTYLRDDAATQLAGEPYLNYLAFMSGSERLIFSYPAMSDDARSGLQLSPYVARIKDYFGLSIDIAAANPVAEDEAILPFVGTRRTTLRHLVQASHDSQLREVPLSRSWLYVLNLLRTDPTYGELTTKLLGSLSYRNVPTQLTPDIVTQLYGTKINTSISKLEEYYANPYAYFLKYGLNLQERDVFALSPASTGEFFHATLDGLMKLVNDQKLNLAALDDQQLREMTDEVMAKLLDTTENPQFAILESSHRMGYIRQQLMKTMRQMAKTLQEQSKRTKLRPKRTEVQFGLGDERGLAALSFDVGKRRQVTVRGRIDRLDAVQVKDKTYLGIVDYKSSEHKFSYQEAYYGRAMQMLTYLDAVKQNLPTLLDAPTAKDAELAGAVYLHLQNPILKAAEVLGEDPLTSLLKAEQYQGLLLDDPDLLTNLDTLFGTPDYSGSSLLFRGLRRTKTGKITSYGKLLVNSNELDLLLTHTERLIKRAATDIFDGRVDLAPFREQNRTALQYSPYKSVMQFDPLLKENNYRDLPSLNKDDVMARIAAEQEQEATDEHEI
>NC_020819.1|WP_041815764.1|2339860_2343649_-|helicase-exonuclease-AddAB-subunit-AddA
MSTKFSFTPSQDQAIHQTGNNLLVSASAGSGKTRVLVQRVIERLKTGVGIDQILIVTFTKAAAAEMRERIQTALRQELAVSQGDSAQQQFYLRQLNQLPVADISTLDAFCLRLLQRYYYVIDLDPVFRLLADETENGLLRDEVWADLREDLYANDDSGLFARLTENFSGDRNDQGLADLVQQTYTFANATPNPTAWLAELPQPYQLDSDQLMTTSFYQQRLRPFFQSQLQQLQADLTSAQALANQAGLDKQAAHVTAVLENVAAVQQLVTGDSWNALRAAIQDFAWGRMPAVRKTNEDYPIYNELKTTYYDPARKQLDSLKKTYLIQDEQQAMTTIRRSGELVGELSRVVTAFRTAYRQEKQRRHVLDFADVEHAALAILTQDSDQSRQVAAQLRHQFAEIMVDEYQDTNGLQEAILTAIAEPAPQGNLFMVGDVKQSIYRFRQADPTLFMTKTDQYAADAAAGELIVLAENFRSMKNVDDFTNLIFKQLMDRELGEIDYTGAAQLKFGASYYPDTVTSTAELLVYLTEDAPESAGDADSEAMDATFQVDNKHQGEVLMVGQKIQQLIADQTPIYDREAKQVRPMTYGDITLLTPTRTNNLIITDELRRLGIPVVVNDAQNYFKTTEIQIMMALLQIIDNPYQDIPLAAVLRSPIVGLNENELALLRINQRTGDYYQAVLHFQRSFVPNQASDFQQAVYQKVSHFLEQLQEFRDIAQQDELVTLIWRIYQETGFLDYVGGMPAGEQRQANLHALYERAKSYEQSSFKGLFQFVRFVERLQERDDDLADAPVQAADDAVSVMTIHGSKGLEFPVVFIMDASRQFNKQDQQGNYVMSGKTGIGIDYLDPDSRVKAPSLQKLVTAQAISRASLAEEMRKLYVALTRAESRVYIVGSHKTQEAAISAWEQAYQSPNLVLNATLREKNTLANYLDWIGMCLVRDPKFAAELRQGTTTFSGLAGDPATFAVHFVTAHDLGPTQGVNETAVDWLQAASETAAKVTTPPVDTEQLHQIMDFRYPHQAATATTAYQSVSEAKRLFEDPDNATIGEYQASATGQVGGHRFVTHDFARPDFLQTVREPLATEIGSATHLVLQQLDVTVTPTLDRVQGVIDQLVADQVLTAEVAQRIQPELILRFFSSSVGQQVLAAPDQLHREVPFSLLMPARSLFQDFQETDSQVLVHGIIDGYLTTPAGVILFDYKTDHVNAQNQAASIEKIVERYGGQVNLYAAALKQMTGQPIVGQYLYLLVIGELVAVPEQQVRRLSE
>NC_020819.1|WP_011668834.1|2338863_2339769_+|hypothetical-protein
MTIITRIIKGCLCLLALGTVTVGSLSGRAQTEKPSALVKVGDYRASTDFLNLSAYYQTIRPVTVKVAYVSTYKTQHTIMQKLTLPAGLTVAGNLTTTKHGSYLVPSLQLYLARLSYPALQNSAKANYTLDPGTSAYSPQATISDTTKLRAFKRVAAPDYMPGYSHGDLYIGGAKAALSPVEPTTKSIRITPDGYVEVLKYDTKANAGLGFYQKPVSLAKIVKTRFHDPNRTLYLNHPLASVKTKAITQNGQTRYRLTLKNLHTPQHIAGDPETGTAGTFDSLYSIGGTTYYTFIGYDGVSN
>NC_020819.1|WP_041815761.1|2337687_2338449_-|helix-turn-helix-transcriptional-regulator
MGWDLQFTHYLDDMQTYRSRDQTAKALILLGYVERDFIRFYRAGRIAEGIQFAKENLARSRLLLNELPPQQKRAQLHGLVDILAFEGVQNHAFIYEFIQLRDDYHRQIKTLPVTTARYVPWIIEIVQDFGNLAAKDGLPYDDHLESTLDIIYYVSAHLRDKLTVKQVVDHVNQRCNPVGVQRAFSDEMQMSIRDYINVKKIREAQRALLTTTVSVKKIAQELGFYDTSDFSKRFKREIGQTPLEYRQINSQKD
>NC_020819.1|WP_011668940.1|2354069_2354600_-|MarR-family-transcriptional-regulator
MSDLFKQETTASKLIEFGMLRHVADDIADRDDDHPERQMIFQGQGKILLALMQEDHLAQKELAERLNLTAQSTAEFVRKLEKKGFVTRMKSPTDQRVTVVSITDAGRKETTKNVQQIPPFLTILDDTELDQLAHILDKVNQHMYEEVNAANPTWFNKFHQVIMNRMLSQLHSGEDR
>NC_020819.1|WP_041815768.1|2354745_2355681_+|daunorubicin-resistance-protein-DrrA-family-ABC-transporter-ATP-binding-protein
MQPSTAITVSHLSKTFGVKTVVDDLSFAVKPGEVFGLLGPNGAGKTTTLRMMTTLLKATSGTVTIFGHDVRKESRLARAMFGLTGQYASIDEDISARENLMIFSRLNGLSRTAAKQRTTELLEEFSLTASANKALSDFSGGMRRRLDLAVSLITRPGLIFLDEPTTGLDPRTRSQMWTTIRQLVAHGSTIVLTTQYLDEADALADRIAVIDHGKLIKLGTPTALKQQIGGATLTLSLAKATQGPLAQRLLAQALHAQPTLHGAQLTAHLENPNQITDLLVQLQAADISLANIAVQEPSLDDVFFALTTGKN
>NC_020819.1|WP_015474584.1|2355695_2356472_+|ABC-transporter-permease
MEIQTQHGNLIGNTLTMAYRNLLKTLHNPDRFMDAIIQPVMFMLLFGYLFGGAIAGGVQAYLPTIVPGILIQTLLSAASGSGAQIREDLDSGVFDRFKSLPMAHIAPLAGQLFADILRLLVATVVSLLTGYAMGWRPTVGFGWIIVIAALAIFIGWAISWVFALFGLLAKSSSMVQSVSMMVMMLLSFLSNAFIPLKTLPHFMRVIADANPITYVITAIRQILAQGAWNNNAWIVLVFGIGIVVLFAPLTVWAYNHNN
>NC_020819.1|WP_015474585.1|2356629_2357544_-|prenyltransferase
MPKWLNWSVFYELTEIYTAPLNVMWFILGAAIAQYHVHTVDWINVGLCLAVVFIFDLAVNVADNYYDYLHAHDREDYAQKTNPIGRLHLPAKGVFWLAWVLYAVAAIPGIVLVMRTGWSVAVFGVVGYLIGIFYTAGPHPINATPVSAAVVALAIAFGIQLTCVYVSIYGQQPLSWSIVGTTFLLCMPLTLIFFTVQLANDTSDRDEDIANHRYTLAVYLGKRRSVRLIQLFLVIGTLWTLVNVGLGLAPLVTALAVILLPVMWRGMRPFFAIQDKRKTFMAMVKSASLFFIAYPVLFALGTWL
>NC_020819.1|WP_011668944.1|2357645_2360762_-|YfhO-family-protein
MRIAHHRWPLWVLYTLAFAVIAAISFGIFGVANRTLIWNMDGITQHYPLIREFHQLLMKSGLAGVTGWSWTFGLGADKLTTLAYYVLGDPFAYALALLPTRLLEVGYGWAIVLRLYAAGLAFLVLAKRYAFKPGSQLVGAVTYAFTGYSLMVGVHHPFFLLPMVWLPLLFVGIDRILQGKGWGFLAAVTGITILSNFYFAYILGLGSLIYALIRYFSCRERGQLAVSWLVATARFLAAAVTGLLISGVLLLPSLLMMLKSTRTVSIFANGLWLYPLNYYLTLSNTILTTGNTLNYWAVLGITGFGFLGCVYTLVHWRQHRWLAITLLAVIVGLLFPAVAAFFNVLSTPSNRWILLAAVPFGLALMTLMDHLTALSLPDRWWLLGSSFGLLGVIYLSNGFTFSNPARDLLTYGLLLATTLLVVVALPRRWTFGGIGILIGLNLINNAWGYYDPNLSNQATQQLRVSDATRYIQDYFDGAQSAVQSDHAFSRVSATRNYNLFRTVGNNMTMSHGLHGIMSYFSVQNGYVGQFSRDLGNAEYAMNAPMGQADDRTTLTQLLGVKYLFARTDQVTNHAALPYGYRAAKKIYPEQPVYGLSNGVGTQVLTTNLAFPLVYTQPQVLTTKAWHRLSLVDRERSLTQAAVTSQPVAGVKAAHYQSPKRTLAYTVTPDTIPVIDSTNKVIQYRLKQAAAGQKTGLNDKQLATYGTTIQTPQLTVDKNGLLSKQEVQQYGPMVQLNRDQAALQRVLTHNQQIIQRTTQANQTGLHQLTSDAQGQPIKYTVTLKHPQQAQGTELYLELDGISSQQLTTKDQLQTADNTSVLGNTPRSNLTKLNAWRTAISNPDLGDYWVTAKTRNATKTFSQFGLDNLSDYEPKHQVLLNLGYSQQLRKTIDVTFNATKQLNIKSAKLIAVPFGARYDQQVHAVQRRGLQHAQIRDNAVTGELTTPQASVMTTSIPYSSGWRLTVDGRPTATTVVNEGFVGARLAAGTHRIRLTYRTPGLIGGLILTIVGLVVWLGEMSWWHWRHPQAKTRATKSKSDA
>NC_020819.1|WP_011668945.1|2361022_2361544_+|QueT-transporter-family-protein
MNSKKRVSGVSDTRSMVLAALIAALYVVLTTVLSALSFGPFQIRLSEMFNHLVVFNKRYIAAVTLGVFIANIIASPFGFLDIATGTIQTLLALLVMYWLSKFVHNRIAQMAINTVVAVFFMCMIAWEIAIVSKTAFWPTFWANWLSIGWGELVSMIFGGVVIYLLSLKIDFTK
>NC_020819.1|WP_041815770.1|2362245_2362935_-|hypothetical-protein
MDIGAREKTKSGYKPIYIKKNKLLSISAMNIRGKYPHFKTYVAVTLGDIHYAKINKVIYMKKFIRYTTANFTPVKTLRAPIRTQLLRQGTGFVMSSTHINQPTYSSALFVTLDNYIQTYSQARMTKINDKWMNADVDSDFAKLKPTDSVKVTKLVKTGTAYKIDYARPLKSFSDKKIGPHHYRLTIKQLGRQYQNYTPIDDTYDTAASWTNFTINTKPYFSGFADWGLD
>NC_020819.1|WP_041815773.1|2363266_2365087_-|DUF2207-domain-containing-protein
MRYRQGVWWLLGLILALIGGCQMTTINAAASYTIKPFRMNVDVTRRGDANVTETMTYHFDDDYHGVYNVQDLRGIQGGRLTGVSTRLNDGGMRPARAVDSGDSRYQVSQSNQRLKVKVYRAVSAGDRLQVTYRFHLTGVVTNYADTAELNWKLIGAGWDEPLHNVRLTIQLPTQPVKQLQAWTHGPLTGHTAVQSKTGRVVMTIPENPANTFVESHLLFPTQVTAANPNTCTQKRRAAAQKQEAKLAADANAKRQQQRWLVVGGYAALTVGLVALLAGSYHWMRHHPANRYPHPIPVDHFFDVPGVAPAVAVALLNFRSPDTDALSGELMMAASRHEIKLEPVREKKHDTVRLTKTGTVTNIFLQRAFERLGSLDSFTLRDLKQFAKKDKGSRVSHWFKEWQNQVDEAAEVYQDGDNIAIRQRLLGIAWGLTFVIAAWIGVSALVDPLVFKLSVGLGLVVLFGSWTYISRQRRQVDRNTAEGLVLINEIGGFRRMLKDIGHFNTAKIGDLILWEQILPYAAAFGLAKQVADKLAIDFGKDVVAGALVAYPLYYPGAFNLSLGDMVQTSIAGAIDTSANFSSPSGGSGGFSGGSSGGFGGGSGGGAF
>NC_020819.1|WP_011668950.1|2365826_2367449_-|glycoside-hydrolase-family-43-protein
MKIQNPVLPGFNADPSMIRVGDTYYIANSTFEWFPGVRLHESKDLVHWNLLPSPLSTTTLLDMKGNPASGGIWAPDLSYADGKFWLIYTDVKITEGPFKDMTNYLTTATDIRGPWTDPIAVNGVGFDASLFHDENGRKYLVQQTWDHREYHHPFNGITLTEFDTATMQLKPETARNIYNGTDVKLVEGPHLYQINGYYYLFAAEGGTVFTHQEVVARSKTLDELSFESEPDGPFITNMDTPDFYLQKQGHGALTSTPSGEWYYASLVSRPWNHTNESSHDPRGWSTLGRETSIQKVEWDDAGWPRVVGGHGGQVEVDAPKDAIETTAPKDHSQHDDFDQPTLDLNWNTLRQPFTAQMGSVGNGELKLIGQQTMSSNFDVSLIARRWQAFNFDAETKVKFDPFTYQQMAGLANIYNDKHYSWIFITWDEKKGHVIEVAQNDNNNYTSYLKDDAIKIPDGTDYVWFRTKVRKQSYTYEYSFDGQNWETVPVELDAAILSDDYVLQNYGGFFTGAFVGLMAADYAGYKRVATFDYFDYQELPD
>NC_020819.1|WP_015474590.1|2367468_2368944_-|MFS-transporter
MASNTQATAQPAANDEFAKLSWRERISYGAGDLAQNLIFGTVGSMLLFYLTTVYGISAAVGATIFLVVRWVNVFWDPWVGAFVDKHGFKRGKYRPYLIYGGIPLTIMAALLFLPIDAVRGNVFYAFIAYLATALIYSFVNIPYGALNASLTRDNDEISTLTTVRMTEANIGNLLVYTFLPLFVQLASPNPQSKDIGFFGIHMNLGDYTSPKSGGAYFMVMAIYMIIGFIMLMCTYFGIKERVLPTEKESSAVKYADLWVEFKQNKPLQILGLFFLIGFTFMFFGNTVWPFYMQYNIGHSEWVASINLIGSIPGIFLVFLWPIVRKKIGKRQFFYAFLTLFIIGTLVLWVWSFPAFKNSVALGYIGRFLMQWGITAATGYMWSLVPEVVSYGEYHSKKRVAGIINAIMGLFFKIGLALGGIIPGYINAFFKFDGTKTTQSAGALAGIQWSMIWLPIILAFVAMWVMSRYTLTDSDVNKMNEELTAERKANQV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_020819_1	1.6\|1072323\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072323-1072355	33	NZ_CP037431	Lactobacillus plantarum strain EM plasmid pEM2, complete sequence	26271-26303	0	1.0
NC_020819_1	1.6\|1072323\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072323-1072355	33	NZ_CP037431	Lactobacillus plantarum strain EM plasmid pEM2, complete sequence	41503-41535	0	1.0
NC_020819_1	1.6\|1072323\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072323-1072355	33	NZ_CP018327	Lactobacillus plantarum subsp. plantarum strain TS12 plasmid pLP12-3, complete sequence	14222-14254	0	1.0
NC_020819_1	1.6\|1072323\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072323-1072355	33	NZ_CP018212	Lactobacillus plantarum strain BLS41 plasmid pLPBLS41_3, complete sequence	3698-3730	0	1.0
NC_020819_1	1.6\|1072323\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072323-1072355	33	NZ_CP035157	Lactobacillus plantarum strain SRCM103362 plasmid unnamed1	14175-14207	0	1.0
NC_020819_1	1.6\|1072323\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072323-1072355	33	NC_021904	Lactobacillus plantarum ZJ316 plasmid pLP-ZJ102, complete sequence	18655-18687	0	1.0
NC_020819_1	1.6\|1072323\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072323-1072355	33	NZ_CP035145	Lactobacillus plantarum strain SRCM103357 plasmid unnamed2	42350-42382	0	1.0
NC_020819_1	1.6\|1072323\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072323-1072355	33	NZ_CP028277	Lactobacillus plantarum strain SRCM100995 plasmid unnamed2, complete sequence	36435-36467	0	1.0
NC_020819_1	1.6\|1072323\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072323-1072355	33	NZ_CP014893	Lactobacillus backii strain TMW 1.1992 plasmid pL11992-3, complete sequence	18265-18297	0	1.0
NC_020819_1	1.6\|1072323\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072323-1072355	33	NZ_CP014624	Lactobacillus backii strain TMW 1.1988 plasmid L11988-1, complete sequence	2807-2839	0	1.0
NC_020819_1	1.6\|1072323\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072323-1072355	33	NC_005952	Lactobacillus brevis plasmid pRH45II, complete sequence	20354-20386	0	1.0
NC_020819_1	1.2\|1072079\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072079-1072111	33	NC_047983	Lactobacillus phage Lb, complete genome	3960-3992	1	0.97
NC_020819_1	1.6\|1072323\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072323-1072355	33	NZ_CP053341	Lactobacillus paraplantarum strain CK401 plasmid pCK401D, complete sequence	33190-33222	1	0.97
NC_020819_1	1.6\|1072323\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072323-1072355	33	NZ_CP035559	Lactobacillus plantarum strain SRCM103297 plasmid unnamed3	30139-30171	1	0.97
NC_020819_1	1.6\|1072323\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072323-1072355	33	NZ_CP035572	Lactobacillus plantarum strain SRCM103303 plasmid unnamed1	27889-27921	1	0.97
NC_020819_1	1.6\|1072323\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072323-1072355	33	NZ_CP035175	Lactobacillus plantarum strain SRCM103426 plasmid unnamed1	96450-96482	1	0.97
NC_020819_1	1.6\|1072323\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072323-1072355	33	NZ_CP032758	Lactobacillus pentosus strain DSM 20314 plasmid unnamed1, complete sequence	41922-41954	1	0.97
NC_020819_1	1.6\|1072323\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072323-1072355	33	NZ_CP014878	Lactobacillus backii strain TMW 1.1989 plasmid pL11989-5, complete sequence	9724-9756	1	0.97
NC_020819_1	1.6\|1072323\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072323-1072355	33	NZ_CP035116	Lactobacillus plantarum strain SRCM103295 plasmid unnamed3	103056-103088	1	0.97
NC_020819_1	1.6\|1072323\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072323-1072355	33	NZ_CP032461	Lactobacillus plantarum strain ATG-K2 plasmid pK2-1, complete sequence	8944-8976	1	0.97
NC_020819_1	1.6\|1072323\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072323-1072355	33	NZ_CP032461	Lactobacillus plantarum strain ATG-K2 plasmid pK2-1, complete sequence	50558-50590	1	0.97
NC_020819_1	1.6\|1072323\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072323-1072355	33	NZ_CP017958	Lactobacillus plantarum strain C410L1 plasmid unnamed4, complete sequence	33329-33361	1	0.97
NC_020819_1	1.6\|1072323\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072323-1072355	33	NZ_CP032660	Lactobacillus pentosus strain ZFM94 plasmid unnamed1, complete sequence	51968-52000	1	0.97
NC_020819_1	1.6\|1072323\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072323-1072355	33	NZ_CP025415	Lactobacillus plantarum strain X7021 plasmid unnamed3, complete sequence	18629-18661	1	0.97
NC_020819_1	1.6\|1072323\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072323-1072355	33	NZ_CP028263	Lactobacillus plantarum strain SRCM102737 plasmid unnamed2, complete sequence	9561-9593	1	0.97
NC_020819_1	1.6\|1072323\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072323-1072355	33	NC_020823	Lactobacillus brevis KB290 plasmid pKB290-5, complete sequence	900-932	1	0.97
NC_020819_1	1.6\|1072323\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072323-1072355	33	NZ_CP013152	Lactobacillus plantarum strain MF1298 plasmid pMF1298-4, complete sequence	28177-28209	1	0.97
NC_020819_1	1.6\|1072323\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072323-1072355	33	NZ_CP032754	Lactobacillus plantarum subsp. argentoratensis strain DSM 16365 plasmid unnamed3, complete sequence	198-230	1	0.97
NC_020819_1	1.6\|1072323\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072323-1072355	33	NZ_CP028228	Lactobacillus plantarum strain SRCM101187 plasmid unnamed2, complete sequence	12578-12610	1	0.97
NC_020819_1	1.6\|1072323\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072323-1072355	33	NZ_CP012296	Pediococcus damnosus strain TMW 2.1536 plasmid pL21536-2, complete sequence	32889-32921	1	0.97
NC_020819_1	1.6\|1072323\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072323-1072355	33	NZ_CP012280	Pediococcus damnosus strain TMW 2.1533 plasmid pL21533-5, complete sequence	9955-9987	1	0.97
NC_020819_1	1.6\|1072323\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072323-1072355	33	NZ_CP014887	Lactobacillus backii strain TMW 1.1991 plasmid pL11991-6, complete sequence	1562-1594	1	0.97
NC_020819_1	1.6\|1072323\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072323-1072355	33	NZ_CP023773	Lactobacillus plantarum strain PC520 plasmid p1, complete sequence	53323-53355	1	0.97
NC_020819_1	1.6\|1072323\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072323-1072355	33	NZ_CP023302	Lactobacillus plantarum strain pc-26 plasmid p.pc-2601, complete sequence	16481-16513	1	0.97
NC_020819_1	1.6\|1072323\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072323-1072355	33	NZ_CP028237	Lactobacillus plantarum strain SRCM101511 plasmid unnamed2, complete sequence	26410-26442	1	0.97
NC_020819_1	1.6\|1072323\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072323-1072355	33	NZ_CP014904	Lactobacillus backii strain TMW 1.2002 plasmid pL12002-5, complete sequence	26558-26590	1	0.97
NC_020819_1	1.6\|1072323\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072323-1072355	33	NZ_CP032655	Lactobacillus pentosus strain ZFM222 plasmid unnamed1, complete sequence	59779-59811	1	0.97
NC_020819_1	1.2\|1072079\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072079-1072111	33	NZ_CP016798	Lactobacillus brevis strain TMW 1.2112 plasmid pl12112-1, complete sequence	10148-10180	2	0.939
NC_020819_1	1.2\|1072079\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072079-1072111	33	NZ_CP019739	Lactobacillus brevis strain TMW 1.2108 plasmid pl12108-5, complete sequence	22839-22871	2	0.939
NC_020819_1	1.4\|1072201\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072201-1072233	33	NZ_CP031209	Lactobacillus brevis strain UCCLB521 plasmid pUCCLB521_A, complete sequence	16832-16864	2	0.939
NC_020819_1	1.4\|1072201\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072201-1072233	33	NZ_CP019739	Lactobacillus brevis strain TMW 1.2108 plasmid pl12108-5, complete sequence	15248-15280	2	0.939
NC_020819_1	1.4\|1072201\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072201-1072233	33	NZ_CP015861	Lactobacillus plantarum strain LZ227 plasmid LZ227p3, complete sequence	5230-5262	2	0.939
NC_020819_1	1.5\|1072262\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072262-1072294	33	NZ_CP031171	Lactobacillus brevis strain UCCLBBS124 plasmid pUCCLBBS124_B, complete sequence	12816-12848	2	0.939
NC_020819_1	1.5\|1072262\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072262-1072294	33	NZ_CP031172	Lactobacillus brevis strain UCCLBBS124 plasmid pUCCLBBS124_C, complete sequence	17059-17091	2	0.939
NC_020819_1	1.5\|1072262\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072262-1072294	33	NZ_CP014917	Lactobacillus paracollinoides strain TMW 1.1994 plasmid pL11994-2, complete sequence	13476-13508	2	0.939
NC_020819_1	1.5\|1072262\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072262-1072294	33	NZ_CP016798	Lactobacillus brevis strain TMW 1.2112 plasmid pl12112-1, complete sequence	2696-2728	2	0.939
NC_020819_1	1.5\|1072262\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072262-1072294	33	NZ_CP019738	Lactobacillus brevis strain TMW 1.2108 plasmid pl12108-4, complete sequence	20372-20404	2	0.939
NC_020819_1	1.5\|1072262\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072262-1072294	33	NZ_CP012655	Lactobacillus plantarum strain HFC8 isolate Lactobacillus plantarum plasmid pMK02, complete sequence	3182-3214	2	0.939
NC_020819_1	1.5\|1072262\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072262-1072294	33	NZ_CP012655	Lactobacillus plantarum strain HFC8 isolate Lactobacillus plantarum plasmid pMK02, complete sequence	44211-44243	2	0.939
NC_020819_1	1.5\|1072262\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072262-1072294	33	NC_005952	Lactobacillus brevis plasmid pRH45II, complete sequence	22401-22433	2	0.939
NC_020819_1	1.5\|1072262\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072262-1072294	33	NZ_CP019747	Lactobacillus brevis strain TMW 1.2111 plasmid pl12111-4, complete sequence	49790-49822	2	0.939
NC_020819_1	1.5\|1072262\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072262-1072294	33	NC_047983	Lactobacillus phage Lb, complete genome	39944-39976	2	0.939
NC_020819_1	1.6\|1072323\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072323-1072355	33	NZ_CP035568	Lactobacillus plantarum strain SRCM103300 plasmid unnamed2	23741-23773	2	0.939
NC_020819_1	1.6\|1072323\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072323-1072355	33	NZ_CP025588	Lactobacillus plantarum strain KC3 plasmid unnamed2, complete sequence	4082-4114	2	0.939
NC_020819_1	1.6\|1072323\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072323-1072355	33	NZ_CP012272	Pediococcus damnosus strain TMW 2.1532 plasmid pL21532-3, complete sequence	22046-22078	2	0.939
NC_020819_1	1.6\|1072323\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072323-1072355	33	NZ_CP012285	Pediococcus damnosus strain TMW 2.1534 plasmid pL21534-2, complete sequence	7341-7373	2	0.939
NC_020819_1	1.5\|1072262\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072262-1072294	33	NZ_CP031209	Lactobacillus brevis strain UCCLB521 plasmid pUCCLB521_A, complete sequence	17417-17449	3	0.909
NC_020819_1	1.5\|1072262\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072262-1072294	33	NC_021904	Lactobacillus plantarum ZJ316 plasmid pLP-ZJ102, complete sequence	16608-16640	3	0.909
NC_020819_2	2.1\|2353870\|38\|NC_020819\|CRISPRCasFinder	2353870-2353907	38	MN830254	Lactobacillus phage JNU_P2, complete genome	17234-17271	5	0.868
NC_020819_2	2.1\|2353870\|38\|NC_020819\|CRISPRCasFinder	2353870-2353907	38	MN830255	Lactobacillus phage JNU_P4, complete genome	3757-3794	5	0.868
NC_020819_1	1.3\|1072140\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072140-1072172	33	NC_011774	Bacillus cereus G9842 plasmid pG9842_140, complete sequence	8131-8163	6	0.818
NC_020819_1	1.1\|1072018\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072018-1072050	33	NZ_CP044046	Klebsiella pneumoniae strain FDAARGOS_629 plasmid unnamed4, complete sequence	75825-75857	8	0.758
NC_020819_1	1.3\|1072140\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072140-1072172	33	KC595513	Bacillus phage Shanette, complete genome	34365-34397	8	0.758
NC_020819_1	1.3\|1072140\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072140-1072172	33	NC_028982	Bacillus phage JL, complete genome	33600-33632	8	0.758
NC_020819_1	1.8\|1072445\|33\|NC_020819\|CRISPRCasFinder,CRT	1072445-1072477	33	MN657132	Psychrobacter sp. strain ANT_H9 plasmid pA9H1, complete sequence	4496-4528	8	0.758
NC_020819_1	1.2\|1072079\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072079-1072111	33	AP013998	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C17C-MedDCM-OCT-S25-C10, * SEQUENCING IN PROGRESS *	21351-21383	9	0.727
NC_020819_1	1.2\|1072079\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072079-1072111	33	AP013530	Uncultured Mediterranean phage uvMED DNA, complete genome, group G4, isolate: uvMED-CGR-C17C-MedDCM-OCT-S23-C4	20250-20282	9	0.727
NC_020819_1	1.2\|1072079\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072079-1072111	33	GU943045	Uncultured phage MedDCM-OCT-S12-C473 genomic sequence	99-131	9	0.727
NC_020819_1	1.2\|1072079\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072079-1072111	33	AP014004	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C17C-MedDCM-OCT-S35-C33, * SEQUENCING IN PROGRESS *	16828-16860	9	0.727
NC_020819_1	1.2\|1072079\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072079-1072111	33	AP014006	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C17C-MedDCM-OCT-S42-C43, * SEQUENCING IN PROGRESS *	21400-21432	9	0.727
NC_020819_1	1.2\|1072079\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072079-1072111	33	AP014002	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C17C-MedDCM-OCT-S34-C142, * SEQUENCING IN PROGRESS *	3193-3225	9	0.727
NC_020819_1	1.2\|1072079\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072079-1072111	33	AP013531	Uncultured Mediterranean phage uvMED DNA, complete genome, group G4, isolate: uvMED-CGR-C17C-MedDCM-OCT-S44-C5	20799-20831	9	0.727
NC_020819_1	1.2\|1072079\|33\|NC_020819\|PILER-CR,CRISPRCasFinder,CRT	1072079-1072111	33	AP014001	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C17C-MedDCM-OCT-S29-C89, * SEQUENCING IN PROGRESS *	20226-20258	9	0.727

1. spacer 1.6|1072323|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP037431 (Lactobacillus plantarum strain EM plasmid pEM2, complete sequence) position: , mismatch: 0, identity: 1.0

ccattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
ccattgaatgcggaatgacggcttttttatgaa	Protospacer
*********************************

2. spacer 1.6|1072323|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP037431 (Lactobacillus plantarum strain EM plasmid pEM2, complete sequence) position: , mismatch: 0, identity: 1.0

ccattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
ccattgaatgcggaatgacggcttttttatgaa	Protospacer
*********************************

3. spacer 1.6|1072323|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP018327 (Lactobacillus plantarum subsp. plantarum strain TS12 plasmid pLP12-3, complete sequence) position: , mismatch: 0, identity: 1.0

ccattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
ccattgaatgcggaatgacggcttttttatgaa	Protospacer
*********************************

4. spacer 1.6|1072323|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP018212 (Lactobacillus plantarum strain BLS41 plasmid pLPBLS41_3, complete sequence) position: , mismatch: 0, identity: 1.0

ccattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
ccattgaatgcggaatgacggcttttttatgaa	Protospacer
*********************************

5. spacer 1.6|1072323|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP035157 (Lactobacillus plantarum strain SRCM103362 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

ccattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
ccattgaatgcggaatgacggcttttttatgaa	Protospacer
*********************************

6. spacer 1.6|1072323|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to NC_021904 (Lactobacillus plantarum ZJ316 plasmid pLP-ZJ102, complete sequence) position: , mismatch: 0, identity: 1.0

ccattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
ccattgaatgcggaatgacggcttttttatgaa	Protospacer
*********************************

7. spacer 1.6|1072323|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP035145 (Lactobacillus plantarum strain SRCM103357 plasmid unnamed2) position: , mismatch: 0, identity: 1.0

ccattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
ccattgaatgcggaatgacggcttttttatgaa	Protospacer
*********************************

8. spacer 1.6|1072323|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP028277 (Lactobacillus plantarum strain SRCM100995 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

ccattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
ccattgaatgcggaatgacggcttttttatgaa	Protospacer
*********************************

9. spacer 1.6|1072323|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP014893 (Lactobacillus backii strain TMW 1.1992 plasmid pL11992-3, complete sequence) position: , mismatch: 0, identity: 1.0

ccattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
ccattgaatgcggaatgacggcttttttatgaa	Protospacer
*********************************

10. spacer 1.6|1072323|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP014624 (Lactobacillus backii strain TMW 1.1988 plasmid L11988-1, complete sequence) position: , mismatch: 0, identity: 1.0

ccattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
ccattgaatgcggaatgacggcttttttatgaa	Protospacer
*********************************

11. spacer 1.6|1072323|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to NC_005952 (Lactobacillus brevis plasmid pRH45II, complete sequence) position: , mismatch: 0, identity: 1.0

ccattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
ccattgaatgcggaatgacggcttttttatgaa	Protospacer
*********************************

12. spacer 1.2|1072079|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to NC_047983 (Lactobacillus phage Lb, complete genome) position: , mismatch: 1, identity: 0.97

tcagcacgatagatagccgtttggccactatac	CRISPR spacer
tcagcacgatagatagccgtttggccaccatac	Protospacer
****************************.****

13. spacer 1.6|1072323|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP053341 (Lactobacillus paraplantarum strain CK401 plasmid pCK401D, complete sequence) position: , mismatch: 1, identity: 0.97

ccattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
caattgaatgcggaatgacggcttttttatgaa	Protospacer
* *******************************

14. spacer 1.6|1072323|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP035559 (Lactobacillus plantarum strain SRCM103297 plasmid unnamed3) position: , mismatch: 1, identity: 0.97

ccattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
caattgaatgcggaatgacggcttttttatgaa	Protospacer
* *******************************

15. spacer 1.6|1072323|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP035572 (Lactobacillus plantarum strain SRCM103303 plasmid unnamed1) position: , mismatch: 1, identity: 0.97

ccattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
caattgaatgcggaatgacggcttttttatgaa	Protospacer
* *******************************

16. spacer 1.6|1072323|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP035175 (Lactobacillus plantarum strain SRCM103426 plasmid unnamed1) position: , mismatch: 1, identity: 0.97

ccattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
caattgaatgcggaatgacggcttttttatgaa	Protospacer
* *******************************

17. spacer 1.6|1072323|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032758 (Lactobacillus pentosus strain DSM 20314 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.97

ccattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
caattgaatgcggaatgacggcttttttatgaa	Protospacer
* *******************************

18. spacer 1.6|1072323|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP014878 (Lactobacillus backii strain TMW 1.1989 plasmid pL11989-5, complete sequence) position: , mismatch: 1, identity: 0.97

ccattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
caattgaatgcggaatgacggcttttttatgaa	Protospacer
* *******************************

19. spacer 1.6|1072323|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP035116 (Lactobacillus plantarum strain SRCM103295 plasmid unnamed3) position: , mismatch: 1, identity: 0.97

ccattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
caattgaatgcggaatgacggcttttttatgaa	Protospacer
* *******************************

20. spacer 1.6|1072323|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032461 (Lactobacillus plantarum strain ATG-K2 plasmid pK2-1, complete sequence) position: , mismatch: 1, identity: 0.97

ccattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
caattgaatgcggaatgacggcttttttatgaa	Protospacer
* *******************************

21. spacer 1.6|1072323|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032461 (Lactobacillus plantarum strain ATG-K2 plasmid pK2-1, complete sequence) position: , mismatch: 1, identity: 0.97

ccattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
caattgaatgcggaatgacggcttttttatgaa	Protospacer
* *******************************

22. spacer 1.6|1072323|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP017958 (Lactobacillus plantarum strain C410L1 plasmid unnamed4, complete sequence) position: , mismatch: 1, identity: 0.97

ccattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
caattgaatgcggaatgacggcttttttatgaa	Protospacer
* *******************************

23. spacer 1.6|1072323|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032660 (Lactobacillus pentosus strain ZFM94 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.97

ccattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
caattgaatgcggaatgacggcttttttatgaa	Protospacer
* *******************************

24. spacer 1.6|1072323|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP025415 (Lactobacillus plantarum strain X7021 plasmid unnamed3, complete sequence) position: , mismatch: 1, identity: 0.97

ccattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
caattgaatgcggaatgacggcttttttatgaa	Protospacer
* *******************************

25. spacer 1.6|1072323|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP028263 (Lactobacillus plantarum strain SRCM102737 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.97

ccattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
caattgaatgcggaatgacggcttttttatgaa	Protospacer
* *******************************

26. spacer 1.6|1072323|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to NC_020823 (Lactobacillus brevis KB290 plasmid pKB290-5, complete sequence) position: , mismatch: 1, identity: 0.97

ccattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
caattgaatgcggaatgacggcttttttatgaa	Protospacer
* *******************************

27. spacer 1.6|1072323|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013152 (Lactobacillus plantarum strain MF1298 plasmid pMF1298-4, complete sequence) position: , mismatch: 1, identity: 0.97

ccattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
caattgaatgcggaatgacggcttttttatgaa	Protospacer
* *******************************

28. spacer 1.6|1072323|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032754 (Lactobacillus plantarum subsp. argentoratensis strain DSM 16365 plasmid unnamed3, complete sequence) position: , mismatch: 1, identity: 0.97

ccattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
caattgaatgcggaatgacggcttttttatgaa	Protospacer
* *******************************

29. spacer 1.6|1072323|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP028228 (Lactobacillus plantarum strain SRCM101187 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.97

ccattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
caattgaatgcggaatgacggcttttttatgaa	Protospacer
* *******************************

30. spacer 1.6|1072323|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP012296 (Pediococcus damnosus strain TMW 2.1536 plasmid pL21536-2, complete sequence) position: , mismatch: 1, identity: 0.97

ccattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
caattgaatgcggaatgacggcttttttatgaa	Protospacer
* *******************************

31. spacer 1.6|1072323|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP012280 (Pediococcus damnosus strain TMW 2.1533 plasmid pL21533-5, complete sequence) position: , mismatch: 1, identity: 0.97

ccattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
caattgaatgcggaatgacggcttttttatgaa	Protospacer
* *******************************

32. spacer 1.6|1072323|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP014887 (Lactobacillus backii strain TMW 1.1991 plasmid pL11991-6, complete sequence) position: , mismatch: 1, identity: 0.97

ccattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
caattgaatgcggaatgacggcttttttatgaa	Protospacer
* *******************************

33. spacer 1.6|1072323|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP023773 (Lactobacillus plantarum strain PC520 plasmid p1, complete sequence) position: , mismatch: 1, identity: 0.97

ccattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
caattgaatgcggaatgacggcttttttatgaa	Protospacer
* *******************************

34. spacer 1.6|1072323|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP023302 (Lactobacillus plantarum strain pc-26 plasmid p.pc-2601, complete sequence) position: , mismatch: 1, identity: 0.97

ccattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
caattgaatgcggaatgacggcttttttatgaa	Protospacer
* *******************************

35. spacer 1.6|1072323|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP028237 (Lactobacillus plantarum strain SRCM101511 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.97

ccattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
caattgaatgcggaatgacggcttttttatgaa	Protospacer
* *******************************

36. spacer 1.6|1072323|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP014904 (Lactobacillus backii strain TMW 1.2002 plasmid pL12002-5, complete sequence) position: , mismatch: 1, identity: 0.97

ccattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
caattgaatgcggaatgacggcttttttatgaa	Protospacer
* *******************************

37. spacer 1.6|1072323|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032655 (Lactobacillus pentosus strain ZFM222 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.97

ccattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
caattgaatgcggaatgacggcttttttatgaa	Protospacer
* *******************************

38. spacer 1.2|1072079|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP016798 (Lactobacillus brevis strain TMW 1.2112 plasmid pl12112-1, complete sequence) position: , mismatch: 2, identity: 0.939

tcagcacgatagatagccgtttggccactatac	CRISPR spacer
tcagcacgatagatagccgtttgaccaccatac	Protospacer
***********************.****.****

39. spacer 1.2|1072079|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP019739 (Lactobacillus brevis strain TMW 1.2108 plasmid pl12108-5, complete sequence) position: , mismatch: 2, identity: 0.939

tcagcacgatagatagccgtttggccactatac	CRISPR spacer
tcagcacgatagatagccgtttgaccaccatac	Protospacer
***********************.****.****

40. spacer 1.4|1072201|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP031209 (Lactobacillus brevis strain UCCLB521 plasmid pUCCLB521_A, complete sequence) position: , mismatch: 2, identity: 0.939

tgtcgaaggcgatgtacgtgaactgaaaagtaa	CRISPR spacer
tgttgaagacgatgtacgtgaactgaaaagtaa	Protospacer
***.****.************************

41. spacer 1.4|1072201|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP019739 (Lactobacillus brevis strain TMW 1.2108 plasmid pl12108-5, complete sequence) position: , mismatch: 2, identity: 0.939

tgtcgaaggcgatgtacgtgaactgaaaagtaa	CRISPR spacer
tgttgaagacgatgtacgtgaactgaaaagtaa	Protospacer
***.****.************************

42. spacer 1.4|1072201|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP015861 (Lactobacillus plantarum strain LZ227 plasmid LZ227p3, complete sequence) position: , mismatch: 2, identity: 0.939

tgtcgaaggcgatgtacgtgaactgaaaagtaa	CRISPR spacer
tgtcgaaggcgatgtacgtgaattgaaaaataa	Protospacer
**********************.******.***

43. spacer 1.5|1072262|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP031171 (Lactobacillus brevis strain UCCLBBS124 plasmid pUCCLBBS124_B, complete sequence) position: , mismatch: 2, identity: 0.939

ctcccggttgactgacaccataagcggccaccc	CRISPR spacer
ctcccggttgactgacaccataggccgccaccc	Protospacer
**********************.** *******

44. spacer 1.5|1072262|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP031172 (Lactobacillus brevis strain UCCLBBS124 plasmid pUCCLBBS124_C, complete sequence) position: , mismatch: 2, identity: 0.939

ctcccggttgactgacaccataagcggccaccc	CRISPR spacer
cccccggttgactgacaccataagccgccaccc	Protospacer
*.*********************** *******

45. spacer 1.5|1072262|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP014917 (Lactobacillus paracollinoides strain TMW 1.1994 plasmid pL11994-2, complete sequence) position: , mismatch: 2, identity: 0.939

ctcccggttgactgacaccataagcggccaccc	CRISPR spacer
cccccggttgactgacaccataagccgccaccc	Protospacer
*.*********************** *******

46. spacer 1.5|1072262|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP016798 (Lactobacillus brevis strain TMW 1.2112 plasmid pl12112-1, complete sequence) position: , mismatch: 2, identity: 0.939

ctcccggttgactgacaccataagcggccaccc	CRISPR spacer
cccccggttgactgacaccataagccgccaccc	Protospacer
*.*********************** *******

47. spacer 1.5|1072262|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP019738 (Lactobacillus brevis strain TMW 1.2108 plasmid pl12108-4, complete sequence) position: , mismatch: 2, identity: 0.939

ctcccggttgactgacaccataagcggccaccc	CRISPR spacer
ctcccggttgactgacaccataggccgccaccc	Protospacer
**********************.** *******

48. spacer 1.5|1072262|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP012655 (Lactobacillus plantarum strain HFC8 isolate Lactobacillus plantarum plasmid pMK02, complete sequence) position: , mismatch: 2, identity: 0.939

ctcccggttgactgacaccataagcggccaccc	CRISPR spacer
ctccaggttgactgacaccataagccgccaccc	Protospacer
**** ******************** *******

49. spacer 1.5|1072262|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP012655 (Lactobacillus plantarum strain HFC8 isolate Lactobacillus plantarum plasmid pMK02, complete sequence) position: , mismatch: 2, identity: 0.939

ctcccggttgactgacaccataagcggccaccc	CRISPR spacer
ctccaggttgactgacaccataagccgccaccc	Protospacer
**** ******************** *******

50. spacer 1.5|1072262|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to NC_005952 (Lactobacillus brevis plasmid pRH45II, complete sequence) position: , mismatch: 2, identity: 0.939

ctcccggttgactgacaccataagcggccaccc	CRISPR spacer
cccccggttgactgacaccataagccgccaccc	Protospacer
*.*********************** *******

51. spacer 1.5|1072262|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP019747 (Lactobacillus brevis strain TMW 1.2111 plasmid pl12111-4, complete sequence) position: , mismatch: 2, identity: 0.939

ctcccggttgactgacaccataagcggccaccc	CRISPR spacer
ctcccggttgactgacaccataggccgccaccc	Protospacer
**********************.** *******

52. spacer 1.5|1072262|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to NC_047983 (Lactobacillus phage Lb, complete genome) position: , mismatch: 2, identity: 0.939

ctcccggttgactgacaccataagcggccaccc	CRISPR spacer
cccccggttgactgacaccataagccgccaccc	Protospacer
*.*********************** *******

53. spacer 1.6|1072323|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP035568 (Lactobacillus plantarum strain SRCM103300 plasmid unnamed2) position: , mismatch: 2, identity: 0.939

ccattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
caatttaatgcggaatgacggcttttttatgaa	Protospacer
* *** ***************************

54. spacer 1.6|1072323|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP025588 (Lactobacillus plantarum strain KC3 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.939

ccattgaatgcggaatgacggcttttttatgaa	CRISPR spacer
caattgaatgcggaatgacggctttttaatgaa	Protospacer
* ************************* *****

55. spacer 1.6|1072323|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP012272 (Pediococcus damnosus strain TMW 2.1532 plasmid pL21532-3, complete sequence) position: , mismatch: 2, identity: 0.939

ccattgaatgcggaatgacggc-ttttttatgaa	CRISPR spacer
caattgaatgcggaatgacggctttttttatga-	Protospacer
* ******************** **********

56. spacer 1.6|1072323|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP012285 (Pediococcus damnosus strain TMW 2.1534 plasmid pL21534-2, complete sequence) position: , mismatch: 2, identity: 0.939

ccattgaatgcggaatgacggc-ttttttatgaa	CRISPR spacer
caattgaatgcggaatgacggctttttttatga-	Protospacer
* ******************** **********

57. spacer 1.5|1072262|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP031209 (Lactobacillus brevis strain UCCLB521 plasmid pUCCLB521_A, complete sequence) position: , mismatch: 3, identity: 0.909

ctcccggttgactgacaccataagcggccaccc	CRISPR spacer
cccccggttgactgacaccataagccgcaaccc	Protospacer
*.*********************** ** ****

58. spacer 1.5|1072262|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to NC_021904 (Lactobacillus plantarum ZJ316 plasmid pLP-ZJ102, complete sequence) position: , mismatch: 3, identity: 0.909

ctcccggttgactgacaccataagcggccaccc	CRISPR spacer
cccccggttgactgacatcataagccgccaccc	Protospacer
*.***************.******* *******

59. spacer 2.1|2353870|38|NC_020819|CRISPRCasFinder matches to MN830254 (Lactobacillus phage JNU_P2, complete genome) position: , mismatch: 5, identity: 0.868

tgacaaccaaaaaatatacgactttaacttctgggatc	CRISPR spacer
tggcaaccaaaaaatatacgactttaacttctgtaaaa	Protospacer
**.****************************** .*

60. spacer 2.1|2353870|38|NC_020819|CRISPRCasFinder matches to MN830255 (Lactobacillus phage JNU_P4, complete genome) position: , mismatch: 5, identity: 0.868

tgacaaccaaaaaatatacgactttaacttctgggatc	CRISPR spacer
tggcaaccaaaaaatatacgactttaacttctgtaaaa	Protospacer
**.****************************** .*

61. spacer 1.3|1072140|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to NC_011774 (Bacillus cereus G9842 plasmid pG9842_140, complete sequence) position: , mismatch: 6, identity: 0.818

ctggatggtcgtaggttcgacccctacaaagtc	CRISPR spacer
ccgtcaggtcgtaggttcgaaccctacaaggtc	Protospacer
*.*   ************** ********.***

62. spacer 1.1|1072018|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP044046 (Klebsiella pneumoniae strain FDAARGOS_629 plasmid unnamed4, complete sequence) position: , mismatch: 8, identity: 0.758

tcaaggcaaaataaaaaacaggcgctatgcctg	CRISPR spacer
tcgtattacaataaaaaacagacgctacgcctg	Protospacer
**. . .* ************.*****.*****

63. spacer 1.3|1072140|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to KC595513 (Bacillus phage Shanette, complete genome) position: , mismatch: 8, identity: 0.758

ctggatggtcgtaggttcgacccctacaaagtc	CRISPR spacer
gcggatggttgtaggttcgactcctatcagggc	Protospacer
 .*******.***********.****. *.* *

64. spacer 1.3|1072140|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to NC_028982 (Bacillus phage JL, complete genome) position: , mismatch: 8, identity: 0.758

ctggatggtcgtaggttcgacccctacaaagtc	CRISPR spacer
gcggatggttgtaggttcgactcctatcagggc	Protospacer
 .*******.***********.****. *.* *

65. spacer 1.8|1072445|33|NC_020819|CRISPRCasFinder,CRT matches to MN657132 (Psychrobacter sp. strain ANT_H9 plasmid pA9H1, complete sequence) position: , mismatch: 8, identity: 0.758

tggctgaaaacgagcttgtagcatttgaaccaa	CRISPR spacer
gggccaaaaacgagcttgtagcattagctcaag	Protospacer
 ***..******************* *  * *.

66. spacer 1.2|1072079|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to AP013998 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C17C-MedDCM-OCT-S25-C10, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 9, identity: 0.727

tcagcacgatagatagccgtttggccactatac	CRISPR spacer
gcgccacgatagaaagccgtttggcgacagagc	Protospacer
 *. ********* *********** ** . .*

67. spacer 1.2|1072079|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to AP013530 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G4, isolate: uvMED-CGR-C17C-MedDCM-OCT-S23-C4) position: , mismatch: 9, identity: 0.727

tcagcacgatagatagccgtttggccactatac	CRISPR spacer
gcgccacgatagaaagccgtttggcgacagagc	Protospacer
 *. ********* *********** ** . .*

68. spacer 1.2|1072079|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to GU943045 (Uncultured phage MedDCM-OCT-S12-C473 genomic sequence) position: , mismatch: 9, identity: 0.727

tcagcacgatagatagccgtttggccactatac	CRISPR spacer
gcgccacgatagaaagccgtttggcgacagagc	Protospacer
 *. ********* *********** ** . .*

69. spacer 1.2|1072079|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to AP014004 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C17C-MedDCM-OCT-S35-C33, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 9, identity: 0.727

tcagcacgatagatagccgtttggccactatac	CRISPR spacer
gcgccacgatagaaagccgtttggcgacagagc	Protospacer
 *. ********* *********** ** . .*

70. spacer 1.2|1072079|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to AP014006 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C17C-MedDCM-OCT-S42-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 9, identity: 0.727

tcagcacgatagatagccgtttggccactatac	CRISPR spacer
gcgccacgatagaaagccgtttggcgacagagc	Protospacer
 *. ********* *********** ** . .*

71. spacer 1.2|1072079|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to AP014002 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C17C-MedDCM-OCT-S34-C142, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 9, identity: 0.727

tcagcacgatagatagccgtttggccactatac	CRISPR spacer
gcgccacgatagaaagccgtttggcgacagagc	Protospacer
 *. ********* *********** ** . .*

72. spacer 1.2|1072079|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to AP013531 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G4, isolate: uvMED-CGR-C17C-MedDCM-OCT-S44-C5) position: , mismatch: 9, identity: 0.727

tcagcacgatagatagccgtttggccactatac	CRISPR spacer
gcgccacgatagaaagccgtttggcgacagagc	Protospacer
 *. ********* *********** ** . .*

73. spacer 1.2|1072079|33|NC_020819|PILER-CR,CRISPRCasFinder,CRT matches to AP014001 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C17C-MedDCM-OCT-S29-C89, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 9, identity: 0.727

tcagcacgatagatagccgtttggccactatac	CRISPR spacer
gcgccacgatagaaagccgtttggcgacagagc	Protospacer
 *. ********* *********** ** . .*

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

752995 : 796752

Paenibacillus_phage(15.38%)

integrase,transposase

attL 761315:761374|attR 791643:792685

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_096109514.1\|752995_753771_-\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	5.4e-28	54.1
WP_015473470.1\|753858_755244_+	class II fumarate hydratase	NA	NA	NA	NA
WP_015473471.1\|755571_756927_+	M20/M25/M40 family metallo-hydrolase	NA	NA	NA	NA
WP_015473472.1\|757136_758156_+	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_041815225.1\|758388_759135_+	hypothetical protein	NA	NA	NA	NA
WP_041815230.1\|759188_760184_+	DMT family transporter	NA	NA	NA	NA
WP_015473475.1\|760197_761247_+	linear amide C-N hydrolase	M1H001	Paramecium_bursaria_Chlorella_virus	9.6e-28	27.1
761315:761374	attL	NA	NA	NA	NA
WP_015473476.1\|761413_762343_+\|transposase	IS30-like element ISLpl1 family transposase	H7BW61	unidentified_phage	8.5e-20	29.9
WP_015473477.1\|762404_763637_-	arginine deiminase	NA	NA	NA	NA
WP_015473478.1\|764038_764689_-	hypothetical protein	NA	NA	NA	NA
WP_015473481.1\|765892_767047_-\|integrase	site-specific integrase	S6C485	Thermus_phage	5.0e-54	36.3
WP_041815232.1\|767104_767929_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_015473483.1\|768071_768308_+	hypothetical protein	NA	NA	NA	NA
WP_015473484.1\|768319_768997_+	Rha family transcriptional regulator	A0A192Y918	Salmonella_phage	6.2e-12	29.4
WP_041815234.1\|769010_769295_+	hypothetical protein	NA	NA	NA	NA
WP_041815237.1\|769605_769962_+	hypothetical protein	NA	NA	NA	NA
WP_015473487.1\|769954_770269_+	hypothetical protein	NA	NA	NA	NA
WP_015473488.1\|770261_770486_+	hypothetical protein	NA	NA	NA	NA
WP_015473489.1\|770488_771277_+	bifunctional DNA primase/polymerase	A0A060ADS5	Enterococcus_phage	1.4e-18	33.6
WP_015473490.1\|771281_772691_+	virulence-associated E family protein	A0A2I6PF19	Staphylococcus_phage	3.8e-72	37.7
WP_015473491.1\|772928_773303_+	hypothetical protein	NA	NA	NA	NA
WP_041815240.1\|773308_773653_+	hypothetical protein	NA	NA	NA	NA
WP_015473493.1\|773649_774063_+	hypothetical protein	NA	NA	NA	NA
WP_051053370.1\|775775_776171_-	DUF1093 domain-containing protein	NA	NA	NA	NA
WP_024525558.1\|777063_777798_+	response regulator transcription factor	W8CYM9	Bacillus_phage	9.7e-35	36.4
WP_015473494.1\|777794_779264_+	HAMP domain-containing histidine kinase	A0A1V0SGX0	Hokovirus	1.9e-21	30.8
WP_015473495.1\|779322_780471_+	class I SAM-dependent rRNA methyltransferase	NA	NA	NA	NA
WP_015473496.1\|780653_781520_+	sugar uptake protein	NA	NA	NA	NA
WP_011667989.1\|781649_782996_+	glucose-6-phosphate isomerase	NA	NA	NA	NA
WP_015473497.1\|783283_786301_+	YfhO family protein	NA	NA	NA	NA
WP_015473498.1\|786666_787221_-	tryptophan-rich sensory protein	NA	NA	NA	NA
WP_011667986.1\|787326_787890_+	DUF1211 domain-containing protein	NA	NA	NA	NA
WP_011667984.1\|788574_789540_+	VIP2 family actin-ADP-ribosylating toxin	NA	NA	NA	NA
WP_011667983.1\|789678_790782_-	anion permease	NA	NA	NA	NA
WP_011667982.1\|790851_791514_-	EAL domain-containing protein	NA	NA	NA	NA
WP_015473476.1\|791741_792671_+\|transposase	IS30-like element ISLpl1 family transposase	H7BW61	unidentified_phage	8.5e-20	29.9
WP_107696654.1\|793124_793919_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	7.5e-17	32.3
791643:792685	attR	NA	NA	NA	NA
WP_011667978.1\|793997_794204_+	hypothetical protein	NA	NA	NA	NA
WP_041815243.1\|794266_795529_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	8.5e-47	31.4
WP_096109514.1\|795976_796752_-\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	5.4e-28	54.1

DBSCAN-SWA_2

1200747 : 1209833

Staphylococcus_phage(28.57%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015473476.1\|1200747_1201677_-\|transposase	IS30-like element ISLpl1 family transposase	H7BW61	unidentified_phage	8.5e-20	29.9
WP_024855005.1\|1202417_1202909_-	dihydrofolate reductase	A0A0N9S8H6	Staphylococcus_phage	1.5e-23	37.8
WP_015473768.1\|1202925_1203876_-	thymidylate synthase	A0A0N9SH48	Staphylococcus_phage	2.0e-117	62.1
WP_011667557.1\|1203887_1205780_-	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L0W2	Tupanvirus	6.1e-49	29.3
WP_024855004.1\|1205808_1207002_-\|tRNA	CCA tRNA nucleotidyltransferase	G3MAR3	Bacillus_virus	1.9e-35	40.2
WP_042254316.1\|1207177_1208074_+	YitT family protein	M1Q1P6	Streptococcus_phage	1.6e-52	38.8
WP_041815344.1\|1208192_1209452_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_011667553.1\|1209557_1209833_-	HU family DNA-binding protein	A0A0H3UZA0	Geobacillus_virus	3.1e-26	68.5

DBSCAN-SWA_3

1263791 : 1324292

Bacillus_phage(11.76%)

tRNA,integrase,protease,transposase

attL 1288579:1288593|attR 1318548:1318562

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_087609254.1\|1263791_1264691_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	2.4e-43	35.8
WP_015473803.1\|1264687_1265221_-\|transposase	transposase	NA	NA	NA	NA
WP_015473804.1\|1265309_1265951_-	HAD-IA family hydrolase	NA	NA	NA	NA
WP_041815352.1\|1266062_1266506_-\|tRNA	D-tyrosyl-tRNA(Tyr) deacylase	NA	NA	NA	NA
WP_015473806.1\|1266525_1268760_-	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	S4TRQ0	Salmonella_phage	6.2e-08	43.6
WP_011667501.1\|1268788_1269124_-	hypothetical protein	NA	NA	NA	NA
WP_011667500.1\|1269191_1269944_-	16S rRNA (uracil(1498)-N(3))-methyltransferase	NA	NA	NA	NA
WP_011667499.1\|1269946_1270897_-	50S ribosomal protein L11 methyltransferase	NA	NA	NA	NA
WP_051053372.1\|1270999_1271317_-	hypothetical protein	NA	NA	NA	NA
WP_011667497.1\|1271656_1272040_+	large-conductance mechanosensitive channel protein MscL	NA	NA	NA	NA
WP_015473808.1\|1272263_1272626_+	hypothetical protein	NA	NA	NA	NA
WP_011667495.1\|1273121_1273373_+	hypothetical protein	NA	NA	NA	NA
WP_041815355.1\|1273874_1275056_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_011667492.1\|1275674_1276034_+	hypothetical protein	NA	NA	NA	NA
WP_080628783.1\|1276076_1276244_-	DUF3923 family protein	NA	NA	NA	NA
WP_015473476.1\|1276244_1277174_-\|transposase	IS30-like element ISLpl1 family transposase	H7BW61	unidentified_phage	8.5e-20	29.9
WP_015473810.1\|1277948_1279781_-	elongation factor 4	E4ZFJ7	Streptococcus_phage	8.6e-24	27.5
WP_024855607.1\|1279961_1281251_-	D-alanyl-lipoteichoic acid biosynthesis protein DltD	NA	NA	NA	NA
WP_011667999.1\|1281254_1281488_-	D-alanine--poly(phosphoribitol) ligase subunit DltC	NA	NA	NA	NA
WP_011668000.1\|1281525_1282734_-	D-alanyl-lipoteichoic acid biosynthesis protein DltB	A0A125RNP0	Pseudomonas_phage	1.1e-22	27.8
WP_015473813.1\|1282733_1284260_-	D-alanine--poly(phosphoribitol) ligase subunit DltA	A0A2K9KZV5	Tupanvirus	1.1e-37	28.1
WP_011668002.1\|1284299_1284449_-	teichoic acid D-Ala incorporation-associated protein DltX	NA	NA	NA	NA
WP_015473814.1\|1284748_1285897_-	molecular chaperone DnaJ	M1PC06	Moumouvirus	5.4e-16	28.3
WP_041815358.1\|1286013_1287873_-	molecular chaperone DnaK	A0A2P1EIW2	Megavirus	2.8e-131	46.2
WP_011668005.1\|1287912_1288497_-	nucleotide exchange factor GrpE	NA	NA	NA	NA
WP_011668006.1\|1288517_1289555_-	heat-inducible transcriptional repressor HrcA	NA	NA	NA	NA
1288579:1288593	attL	NA	NA	NA	NA
WP_011668007.1\|1289806_1290754_-	riboflavin biosynthesis protein RibF	NA	NA	NA	NA
WP_011668008.1\|1290774_1291686_-\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA
WP_011668009.1\|1291766_1292117_-	30S ribosome-binding factor RbfA	NA	NA	NA	NA
WP_015473817.1\|1292136_1294479_-	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	5.1e-21	24.4
WP_011668011.1\|1294526_1294829_-	ribosomal L7Ae/L30e/S12e/Gadd45 family protein	NA	NA	NA	NA
WP_011668012.1\|1294821_1295118_-	YlxR family protein	NA	NA	NA	NA
WP_011668013.1\|1295144_1296350_-	transcription termination/antitermination protein NusA	NA	NA	NA	NA
WP_011668014.1\|1296373_1296847_-	ribosome maturation factor RimP	NA	NA	NA	NA
WP_011668015.1\|1296973_1297249_-	hypothetical protein	NA	NA	NA	NA
WP_011668016.1\|1297397_1301735_-	PolC-type DNA polymerase III	A0A0K2SUJ2	Clostridium_phage	1.0e-19	37.6
WP_011668017.1\|1301826_1303536_-\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
WP_015473823.1\|1303571_1304849_-\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
WP_011668019.1\|1304944_1305736_-	phosphatidate cytidylyltransferase	NA	NA	NA	NA
WP_041815361.1\|1305757_1306546_-	isoprenyl transferase	R9W0U9	Flavobacterium_phage	4.5e-22	41.0
WP_011668021.1\|1306648_1307071_-	hypothetical protein	NA	NA	NA	NA
WP_024855604.1\|1307097_1307661_-	ribosome recycling factor	NA	NA	NA	NA
WP_011668022.1\|1307657_1308380_-	UMP kinase	NA	NA	NA	NA
WP_011668023.1\|1308526_1309411_-	elongation factor Ts	NA	NA	NA	NA
WP_011668024.1\|1309560_1310364_-	30S ribosomal protein S2	NA	NA	NA	NA
WP_041815364.1\|1310780_1312226_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	A0A1X9I6E7	Streptococcus_phage	1.5e-07	27.7
WP_011668025.1\|1312369_1313089_+	HAD family hydrolase	NA	NA	NA	NA
WP_011668026.1\|1313211_1314210_-	D-2-hydroxyacid dehydrogenase	A0A1J0F959	Only_Syngen_Nebraska_virus	3.7e-45	35.5
WP_041815367.1\|1314293_1314563_-	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_041815370.1\|1314549_1315296_-\|tRNA	tRNA1(Val) (adenine(37)-N6)-methyltransferase	NA	NA	NA	NA
WP_051053373.1\|1315364_1316033_+	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_015473831.1\|1316093_1317890_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.1e-44	26.1
WP_011668031.1\|1319786_1320011_-	YneF family protein	NA	NA	NA	NA
1318548:1318562	attR	NA	NA	NA	NA
WP_011668032.1\|1320110_1320359_-	DUF896 domain-containing protein	NA	NA	NA	NA
WP_024855599.1\|1320541_1321171_+	transcriptional repressor LexA	A0A1B2APZ1	Phage_Wrath	1.6e-14	50.7
WP_015473837.1\|1321210_1321651_-	nucleoside 2-deoxyribosyltransferase	A0A1D3SPR3	Enterococcus_phage	2.0e-19	38.6
WP_041815372.1\|1321877_1322468_+	hypothetical protein	NA	NA	NA	NA
WP_015473839.1\|1322618_1324292_+\|transposase	IS1182 family transposase	A0ZS58	Staphylococcus_virus	3.7e-90	40.1

DBSCAN-SWA_4

1429080 : 1488893

unidentified_phage(18.18%)

tRNA,protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_041815392.1\|1429080_1430004_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	1.5e-29	29.8
WP_011668196.1\|1430371_1431271_-	RluA family pseudouridine synthase	NA	NA	NA	NA
WP_021740943.1\|1431267_1432071_-	NAD kinase	NA	NA	NA	NA
WP_011668198.1\|1432072_1432732_-	GTP pyrophosphokinase family protein	NA	NA	NA	NA
WP_011668199.1\|1433045_1433684_+	DsbA family protein	NA	NA	NA	NA
WP_041815395.1\|1433845_1434709_+	DegV family protein	NA	NA	NA	NA
WP_015473911.1\|1434762_1436568_-	oligoendopeptidase F	NA	NA	NA	NA
WP_015473912.1\|1436634_1437729_-	hypothetical protein	NA	NA	NA	NA
WP_015473913.1\|1437855_1438503_-\|tRNA	tRNA (guanosine(46)-N7)-methyltransferase TrmB	NA	NA	NA	NA
WP_041815397.1\|1438568_1439360_-	phosphotransferase family protein	NA	NA	NA	NA
WP_011668205.1\|1439421_1440648_-	ABC transporter permease	NA	NA	NA	NA
WP_011668206.1\|1440644_1441379_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	8.5e-23	28.3
WP_011668207.1\|1441588_1442047_+	HIT family protein	NA	NA	NA	NA
WP_015473917.1\|1442049_1442370_+	hypothetical protein	NA	NA	NA	NA
WP_011668209.1\|1442482_1443400_+	peptidylprolyl isomerase	NA	NA	NA	NA
WP_015473919.1\|1443463_1444438_-	TraI domain-containing protein	NA	NA	NA	NA
WP_015473920.1\|1444450_1447075_-	AAA family ATPase	NA	NA	NA	NA
WP_041815870.1\|1447064_1448279_-	DNA repair exonuclease	NA	NA	NA	NA
WP_015473922.1\|1448361_1448706_-	YlbF family regulator	NA	NA	NA	NA
WP_011668214.1\|1448796_1450893_-	PBP1A family penicillin-binding protein	NA	NA	NA	NA
WP_011668215.1\|1451058_1451526_-	arginine repressor	NA	NA	NA	NA
WP_011668216.1\|1451760_1453452_-\|tRNA	arginine--tRNA ligase	A0A2I2L3K1	Orpheovirus	7.6e-75	32.0
WP_011668217.1\|1453923_1454145_-	DUF2187 domain-containing protein	NA	NA	NA	NA
WP_011668218.1\|1454478_1455738_+	N-acetylmuramoyl-L-alanine amidase	A0A2H4JAS1	uncultured_Caudovirales_phage	1.8e-17	40.0
WP_011668219.1\|1455798_1456332_+	dihydrofolate reductase family protein	NA	NA	NA	NA
WP_011668220.1\|1456398_1456740_+	YisL family protein	NA	NA	NA	NA
WP_011666857.1\|1456993_1457917_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	6.2e-31	30.4
WP_011668221.1\|1458011_1458725_-	amino acid racemase	NA	NA	NA	NA
WP_041815400.1\|1458731_1459988_-	carboxylate--amine ligase	NA	NA	NA	NA
WP_011668223.1\|1460122_1462006_-	asparagine synthase (glutamine-hydrolyzing)	NA	NA	NA	NA
WP_041815402.1\|1462149_1462848_-	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_011668225.1\|1462986_1464396_+	C69 family dipeptidase	NA	NA	NA	NA
WP_011668226.1\|1464465_1464702_+	hypothetical protein	NA	NA	NA	NA
WP_011668227.1\|1464849_1466652_-	hypothetical protein	NA	NA	NA	NA
WP_011668228.1\|1467203_1467455_-	hypothetical protein	NA	NA	NA	NA
WP_015473928.1\|1468190_1470701_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	1.3e-139	32.4
WP_087609254.1\|1470906_1471806_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	2.4e-43	35.8
WP_015473803.1\|1471802_1472336_-\|transposase	transposase	NA	NA	NA	NA
WP_011668232.1\|1472614_1472908_-	heavy metal-binding domain-containing protein	NA	NA	NA	NA
WP_015473929.1\|1472898_1473417_-	VanZ family protein	NA	NA	NA	NA
WP_015473930.1\|1473972_1474449_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_107696657.1\|1474499_1475123_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_011668236.1\|1475488_1475734_-	hypothetical protein	NA	NA	NA	NA
WP_011668237.1\|1475883_1476846_+	NAD(P)-binding domain-containing protein	A0A1B1IVB5	uncultured_Mediterranean_phage	8.2e-26	29.0
WP_011668238.1\|1477065_1479780_+	glycoside hydrolase family 65 protein	NA	NA	NA	NA
WP_011668239.1\|1479792_1480464_+	beta-phosphoglucomutase	NA	NA	NA	NA
WP_011668240.1\|1480518_1481289_-	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_011668241.1\|1481442_1482090_+	deoxynucleoside kinase	C1KFI3	Lactobacillus_virus	9.1e-45	45.9
WP_011668242.1\|1482137_1482464_-	DUF960 domain-containing protein	NA	NA	NA	NA
WP_011668243.1\|1482537_1484013_-	MFS transporter	NA	NA	NA	NA
WP_015473935.1\|1484218_1485406_-	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	9.5e-149	69.4
WP_011668245.1\|1485649_1486357_+	hypothetical protein	NA	NA	NA	NA
WP_011668246.1\|1486463_1486826_+	hypothetical protein	NA	NA	NA	NA
WP_011668247.1\|1486853_1487423_-	hypothetical protein	NA	NA	NA	NA
WP_011668248.1\|1487629_1487953_+	heavy metal-binding domain-containing protein	M4STD1	Rhodobacter_phage	1.2e-05	35.6
WP_011668249.1\|1488323_1488893_+\|protease	matrixin family metalloprotease	NA	NA	NA	NA

DBSCAN-SWA_5

1660024 : 1745673

Lactobacillus_phage(73.17%)

tail,transposase,tRNA,terminase,capsid,protease,plate,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015474035.1\|1660024_1662511_-\|protease	ATP-dependent Clp protease ATP-binding subunit	K4FB40	Cronobacter_phage	4.0e-125	39.7
WP_015474036.1\|1662528_1662996_-	CtsR family transcriptional regulator	NA	NA	NA	NA
WP_021741310.1\|1664315_1665587_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	3.2e-86	48.1
WP_024526557.1\|1665870_1666503_-	deoxynucleoside kinase	C1KFI3	Lactobacillus_virus	2.6e-52	47.7
WP_035465420.1\|1666819_1668082_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	2.9e-47	31.9
WP_024526556.1\|1668155_1669655_-	amino acid permease	NA	NA	NA	NA
WP_015474041.1\|1670004_1670559_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_015474042.1\|1670642_1671437_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_011668516.1\|1671540_1672209_-	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_021741305.1\|1672320_1672770_-	threonine/serine exporter family protein	NA	NA	NA	NA
WP_011668518.1\|1672786_1673548_-	threonine/serine exporter family protein	NA	NA	NA	NA
WP_011668519.1\|1673672_1674320_-	metal-dependent transcriptional regulator	NA	NA	NA	NA
WP_015474047.1\|1674381_1675278_-	cation transporter	A0A1V0SED0	Indivirus	4.0e-06	29.1
WP_024526551.1\|1675450_1676014_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_015474049.1\|1676546_1676984_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_011668525.1\|1677207_1678704_+	multidrug efflux MFS transporter	NA	NA	NA	NA
WP_011668524.1\|1678703_1679429_+	DUF4811 domain-containing protein	NA	NA	NA	NA
WP_021741297.1\|1679560_1679800_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_015474051.1\|1679989_1680700_+	AzlC family ABC transporter permease	NA	NA	NA	NA
WP_015474052.1\|1680684_1681017_+	AzlD domain-containing protein	NA	NA	NA	NA
WP_041815468.1\|1681060_1682338_-	uracil permease	Q9KX94	Enterobacteria_phage	2.0e-67	37.6
WP_015474054.1\|1682520_1683714_-	MFS transporter	NA	NA	NA	NA
WP_011668531.1\|1683745_1684144_-	hypothetical protein	NA	NA	NA	NA
WP_011668351.1\|1684178_1684697_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_011668352.1\|1684799_1685285_-	pyridoxamine 5'-phosphate oxidase family protein	NA	NA	NA	NA
WP_042254898.1\|1685405_1685942_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_011668354.1\|1686130_1686907_-	DUF1003 domain-containing protein	NA	NA	NA	NA
WP_015474058.1\|1686914_1687799_-	RluA family pseudouridine synthase	NA	NA	NA	NA
WP_041815471.1\|1687817_1688135_-	glycine cleavage system protein H (lipoate-binding)	NA	NA	NA	NA
WP_011668357.1\|1688266_1688467_+	hypothetical protein	NA	NA	NA	NA
WP_087609254.1\|1688915_1689815_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	2.4e-43	35.8
WP_015473803.1\|1689811_1690345_-\|transposase	transposase	NA	NA	NA	NA
WP_015474060.1\|1690462_1691026_-	sugar O-acetyltransferase	NA	NA	NA	NA
WP_015474061.1\|1691102_1692527_-	L-arabinose isomerase	NA	NA	NA	NA
WP_011668360.1\|1692575_1693304_-	L-ribulose-5-phosphate 4-epimerase	NA	NA	NA	NA
WP_015474062.1\|1693323_1694925_-	FGGY-family carbohydrate kinase	NA	NA	NA	NA
WP_015474063.1\|1694956_1696354_-	sugar porter family MFS transporter	NA	NA	NA	NA
WP_041815473.1\|1696852_1698115_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	6.5e-47	32.1
WP_041815476.1\|1698166_1699252_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_015474066.1\|1699440_1700004_-	sugar O-acetyltransferase	NA	NA	NA	NA
WP_015474067.1\|1700115_1701006_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_015474068.1\|1701249_1702230_+	family 43 glycosylhydrolase	NA	NA	NA	NA
WP_015474069.1\|1702243_1703533_+	oligosaccharide MFS transporter	NA	NA	NA	NA
WP_011668368.1\|1703598_1705089_+	alpha-N-arabinofuranosidase	NA	NA	NA	NA
WP_015474071.1\|1705125_1706901_-	DNA helicase RecQ	M1PGQ0	Moumouvirus	2.9e-77	36.1
WP_024855499.1\|1707145_1707568_-	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_041815479.1\|1707709_1708285_+	NAD(P)-binding domain-containing protein	NA	NA	NA	NA
WP_041815481.1\|1708474_1709878_+	C69 family dipeptidase	NA	NA	NA	NA
WP_015474075.1\|1709969_1711412_-	arginine-ornithine antiporter	NA	NA	NA	NA
WP_015474076.1\|1711784_1714319_-	M1 family metallopeptidase	A0A0P0IY26	Acinetobacter_phage	2.0e-63	26.6
WP_011668375.1\|1714476_1714875_-	iron-sulfur cluster biosynthesis family protein	NA	NA	NA	NA
WP_041815484.1\|1714949_1717163_-	alpha-galactosidase	NA	NA	NA	NA
WP_015474078.1\|1717818_1718121_+	hypothetical protein	NA	NA	NA	NA
WP_041815489.1\|1718304_1718850_-	hypothetical protein	NA	NA	NA	NA
WP_015474079.1\|1719281_1720334_-	hypothetical protein	D6PSS2	Lactobacillus_phage	3.6e-176	96.3
WP_015474080.1\|1720333_1720846_-	hypothetical protein	D6PSS1	Lactobacillus_phage	3.5e-60	74.9
WP_015474081.1\|1720842_1721247_-\|holin	phage holin family protein	A0A097BY69	Enterococcus_phage	1.7e-17	41.4
WP_015474082.1\|1721303_1721474_-	hypothetical protein	D6PSR8	Lactobacillus_phage	1.2e-17	82.1
WP_015474084.1\|1721632_1722085_-	hypothetical protein	NA	NA	NA	NA
WP_015474086.1\|1723450_1724110_-	hypothetical protein	D6PT00	Lactobacillus_phage	1.6e-73	83.0
WP_041815491.1\|1724099_1725278_-\|plate	baseplate J/gp47 family protein	D6PSZ9	Lactobacillus_phage	1.6e-180	81.6
WP_015474088.1\|1725264_1725663_-	DUF2634 domain-containing protein	D6PSZ8	Lactobacillus_phage	4.9e-49	78.6
WP_041815492.1\|1725662_1726007_-	hypothetical protein	D6PSZ7	Lactobacillus_phage	1.3e-50	88.6
WP_158414577.1\|1726006_1727287_-	hypothetical protein	D6PSZ6	Lactobacillus_phage	3.2e-182	82.3
WP_041815494.1\|1727237_1727630_-	hypothetical protein	D6PSZ5	Lactobacillus_phage	4.6e-68	99.2
WP_015474091.1\|1727641_1728289_-	LysM peptidoglycan-binding domain-containing protein	D6PSZ4	Lactobacillus_phage	3.4e-108	92.1
WP_015474092.1\|1728288_1733892_-\|tail	phage tail tape measure protein	D6PSY9	Lactobacillus_phage	4.4e-180	89.4
WP_155275711.1\|1733906_1734077_-	hypothetical protein	D6PSY6	Lactobacillus_phage	8.7e-24	98.1
WP_015474094.1\|1734087_1734462_-	hypothetical protein	D6PSY5	Lactobacillus_phage	1.9e-63	92.7
WP_015474095.1\|1734532_1734931_-	hypothetical protein	D6PSY4	Lactobacillus_phage	4.5e-71	97.7
WP_015474096.1\|1734945_1735983_-	DUF3383 family protein	D6PSY3	Lactobacillus_phage	4.9e-141	94.7
WP_015474097.1\|1735995_1736466_-	hypothetical protein	D6PSY2	Lactobacillus_phage	2.5e-60	95.8
WP_015474098.1\|1736458_1736833_-	hypothetical protein	D6PSY1	Lactobacillus_phage	3.2e-66	97.6
WP_041815496.1\|1736832_1737432_-	hypothetical protein	D6PSY0	Lactobacillus_phage	4.5e-107	97.5
WP_015474100.1\|1737431_1737758_-	DUF4054 domain-containing protein	D6PSX9	Lactobacillus_phage	5.6e-51	93.5
WP_015474101.1\|1737769_1738132_-	hypothetical protein	D6PSX8	Lactobacillus_phage	3.6e-59	100.0
WP_015474102.1\|1738142_1739021_-	encapsulin	D6PSX7	Lactobacillus_phage	8.0e-161	99.0
WP_015474103.1\|1739035_1739500_-	hypothetical protein	D6PSX6	Lactobacillus_phage	4.9e-77	98.1
WP_015474104.1\|1739514_1740618_-	DUF2213 domain-containing protein	D6PSX5	Lactobacillus_phage	1.5e-177	94.8
WP_041815498.1\|1740629_1740899_-	LysM peptidoglycan-binding domain-containing protein	D6PSX4	Lactobacillus_phage	5.6e-25	97.8
WP_015474106.1\|1740921_1741749_-\|capsid	minor capsid protein	D6PSX3	Lactobacillus_phage	3.8e-128	94.2
WP_015474107.1\|1741751_1743113_-	DUF1073 domain-containing protein	D6PSX2	Lactobacillus_phage	1.4e-260	99.1
WP_041815501.1\|1743129_1744467_-\|terminase	terminase	D6PSX1	Lactobacillus_phage	3.0e-167	99.3
WP_015474109.1\|1744450_1745203_-	hypothetical protein	D6PSW8	Lactobacillus_phage	4.8e-106	88.0
WP_041815504.1\|1745261_1745495_-	hypothetical protein	D6PSW7	Lactobacillus_phage	1.2e-34	89.6
WP_041815506.1\|1745478_1745673_-	hypothetical protein	D6PSW6	Lactobacillus_phage	1.6e-29	95.2

DBSCAN-SWA_6

1748807 : 1766261

Lactobacillus_phage(75.0%)

integrase

attL 1749732:1749745|attR 1767970:1767983

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_041815897.1\|1748807_1749245_-	transcriptional regulator	D6PSV8	Lactobacillus_phage	1.2e-77	98.6
WP_051053380.1\|1749465_1749927_-	hypothetical protein	A0A2H4PBD2	Lactobacillus_phage	2.0e-30	54.3
1749732:1749745	attL	NA	NA	NA	NA
WP_051053381.1\|1750052_1750481_-	hypothetical protein	D6PSU8	Lactobacillus_phage	1.0e-20	59.8
WP_051053382.1\|1750596_1751040_-	RusA family crossover junction endodeoxyribonuclease	D6PSU4	Lactobacillus_phage	5.8e-43	61.8
WP_125692949.1\|1751032_1751719_-	antA/AntB antirepressor family protein	U5U413	Lactobacillus_phage	4.6e-31	45.1
WP_015474116.1\|1751754_1752543_-	DnaD domain protein	NA	NA	NA	NA
WP_041815906.1\|1752554_1753310_-	PD-(D/E)XK nuclease-like domain-containing protein	A0A0P0IZH9	Lactobacillus_phage	2.0e-72	54.2
WP_015474118.1\|1753344_1754403_-	recombinase RecT	D7RWF9	Brochothrix_phage	1.7e-56	49.3
WP_015474119.1\|1754403_1754619_-	hypothetical protein	NA	NA	NA	NA
WP_041815513.1\|1754609_1754903_-	hypothetical protein	NA	NA	NA	NA
WP_156646391.1\|1755012_1755171_-	hypothetical protein	D6PST6	Lactobacillus_phage	7.4e-17	76.9
WP_041815516.1\|1755182_1755476_-	hypothetical protein	NA	NA	NA	NA
WP_015474121.1\|1755480_1756002_-	hypothetical protein	NA	NA	NA	NA
WP_015474122.1\|1756068_1756242_-	hypothetical protein	NA	NA	NA	NA
WP_041815519.1\|1756364_1756562_-	hypothetical protein	NA	NA	NA	NA
WP_041815522.1\|1756905_1757154_+	hypothetical protein	NA	NA	NA	NA
WP_041815524.1\|1757142_1757328_-	hypothetical protein	NA	NA	NA	NA
WP_051053383.1\|1757327_1757585_-	helix-turn-helix transcriptional regulator	D6PST0	Lactobacillus_phage	3.3e-38	97.6
WP_080628795.1\|1758138_1758525_+	ImmA/IrrE family metallo-endopeptidase	D6PSS8	Lactobacillus_phage	1.4e-69	97.7
WP_041815530.1\|1758625_1759219_+	zinc ribbon domain-containing protein	D6PSS6	Lactobacillus_phage	1.4e-92	96.4
WP_041815533.1\|1759231_1759864_+	DUF805 domain-containing protein	D6PSS5	Lactobacillus_phage	3.9e-85	91.5
WP_041815535.1\|1759970_1760339_+	zinc ribbon domain-containing protein	D6PSS7	Lactobacillus_phage	1.4e-47	89.3
WP_144054551.1\|1760457_1761306_+	hypothetical protein	NA	NA	NA	NA
WP_015474129.1\|1761738_1762920_+\|integrase	tyrosine-type recombinase/integrase	A0A1S5SA16	Streptococcus_phage	4.5e-34	28.3
WP_172757523.1\|1763096_1764638_-	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	1.4e-14	28.1
WP_144054552.1\|1764746_1765325_-	hypothetical protein	NA	NA	NA	NA
WP_011668379.1\|1765337_1766261_-	type I pantothenate kinase	A0A1B1ISL9	uncultured_Mediterranean_phage	2.2e-28	33.9
1767970:1767983	attR	NA	NA	NA	NA

DBSCAN-SWA_7

2133730 : 2175535

Lactobacillus_phage(59.52%)

tail,head,portal,terminase,plate,integrase

attL 2135794:2135810|attR 2175451:2175467

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_041815643.1\|2133730_2133997_-	DUF3102 domain-containing protein	C5IUM1	Streptococcus_phage	3.3e-17	56.6
WP_015474392.1\|2134033_2134573_-	hypothetical protein	NA	NA	NA	NA
WP_015474393.1\|2134637_2135090_-	hypothetical protein	D6PSV8	Lactobacillus_phage	3.4e-38	54.1
WP_015474394.1\|2135566_2136415_-	conserved phage C-terminal domain-containing protein	A0A1W6JNI1	Staphylococcus_phage	5.5e-34	38.2
2135794:2135810	attL	NA	NA	NA	NA
WP_158414579.1\|2136426_2136669_-	hypothetical protein	NA	NA	NA	NA
WP_024526214.1\|2137161_2137431_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_015474397.1\|2137447_2138140_-	Rha family transcriptional regulator	A0A2H4PAV0	Aphanizomenon_phage	4.4e-05	34.8
WP_015474398.1\|2138157_2138352_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_015474399.1\|2138483_2138978_+	helix-turn-helix domain-containing protein	L0P7E1	Lactobacillus_phage	4.2e-10	57.6
WP_041815649.1\|2139042_2140191_+\|integrase	site-specific integrase	A0A172LN96	Lactococcus_phage	9.7e-58	35.4
WP_080628796.1\|2140427_2141171_-	N-acetylmuramoyl-L-alanine amidase	A0A1W6JN27	Lactococcus_phage	4.4e-59	60.8
WP_041815652.1\|2141179_2141467_-	DUF3792 family protein	NA	NA	NA	NA
WP_041815655.1\|2141468_2141666_-	hypothetical protein	NA	NA	NA	NA
WP_015474404.1\|2141658_2142054_-	hypothetical protein	A0A2P0ZLF7	Lactobacillus_phage	1.8e-24	43.3
WP_015474405.1\|2142069_2142228_-	XkdX family protein	NA	NA	NA	NA
WP_041815657.1\|2142665_2143277_-	hypothetical protein	NA	NA	NA	NA
WP_041815660.1\|2143278_2144121_-	hypothetical protein	L0P6E1	Lactobacillus_phage	1.9e-10	26.5
WP_015474409.1\|2144122_2144749_-	DUF2313 domain-containing protein	Q9AZ88	Lactobacillus_prophage	1.2e-25	43.1
WP_015474410.1\|2144741_2145887_-\|plate	baseplate J/gp47 family protein	L0P7C2	Lactobacillus_phage	6.8e-120	55.6
WP_144054554.1\|2145864_2146302_-	DUF2634 domain-containing protein	A9D9X1	Lactobacillus_prophage	1.6e-29	52.9
WP_041815662.1\|2146294_2146615_-	DUF2577 domain-containing protein	A9D9W8	Lactobacillus_prophage	4.2e-19	44.2
WP_041815665.1\|2146614_2147664_-	hypothetical protein	X2CXX6	Lactobacillus_phage	7.6e-41	32.0
WP_015474414.1\|2147666_2148353_-	hypothetical protein	A9D9W2	Lactobacillus_prophage	1.4e-32	43.0
WP_041815969.1\|2148354_2148852_-	hypothetical protein	L0P7B8	Lactobacillus_phage	7.5e-23	47.5
WP_015474417.1\|2151235_2151376_-	hypothetical protein	NA	NA	NA	NA
WP_015474418.1\|2151420_2151825_-	XkdN-Like protein	NA	NA	NA	NA
WP_041815975.1\|2151841_2152330_-\|tail	phage tail tube protein	Q20DC7	Lactobacillus_phage	8.9e-61	73.9
WP_015474420.1\|2152353_2153775_-\|tail	phage tail sheath subtilisin-like domain-containing protein	Q20DC8	Lactobacillus_phage	8.5e-112	50.0
WP_015474421.1\|2153776_2153929_-	hypothetical protein	NA	NA	NA	NA
WP_015474422.1\|2153918_2154335_-	hypothetical protein	NA	NA	NA	NA
WP_015474423.1\|2154331_2154736_-	HK97 gp10 family phage protein	A0A0A7RVN8	Clostridium_phage	1.3e-17	32.3
WP_015474424.1\|2154735_2155113_-	hypothetical protein	X2CXE4	Lactobacillus_phage	5.1e-40	71.8
WP_015474425.1\|2155109_2155499_-	hypothetical protein	Q20DD3	Lactobacillus_phage	3.7e-09	47.7
WP_015474426.1\|2155510_2155822_-	hypothetical protein	NA	NA	NA	NA
WP_015474427.1\|2155896_2156808_-	hypothetical protein	Q20DD4	Lactobacillus_phage	5.8e-130	76.3
WP_015474428.1\|2156829_2157378_-	phage scaffolding protein	X2CYF9	Lactobacillus_phage	4.5e-37	48.1
WP_041815667.1\|2157504_2157834_-	hypothetical protein	NA	NA	NA	NA
WP_051053391.1\|2157866_2158901_-\|head	phage head morphogenesis protein	A9D9S7	Lactobacillus_prophage	2.1e-80	43.4
WP_015474431.1\|2158887_2160306_-\|portal	phage portal protein	X2CY64	Lactobacillus_phage	1.1e-151	56.3
WP_041815670.1\|2160296_2161547_-\|terminase	PBSX family phage terminase large subunit	B6CXD2	Clostridium_phage	8.9e-97	43.3
WP_015474433.1\|2161533_2161968_-\|terminase	terminase small subunit	A7J290	Streptococcus_phage	4.1e-33	50.7
WP_041815672.1\|2161990_2162620_-	hypothetical protein	NA	NA	NA	NA
WP_015474435.1\|2162732_2163260_-	hypothetical protein	A0A097BY45	Enterococcus_phage	1.8e-19	35.0
WP_015474436.1\|2163259_2163463_-	hypothetical protein	NA	NA	NA	NA
WP_041815675.1\|2163492_2163684_-	hypothetical protein	D6PSV7	Lactobacillus_phage	2.5e-27	95.2
WP_041815677.1\|2163664_2163904_-	hypothetical protein	NA	NA	NA	NA
WP_051053392.1\|2163896_2164334_-	hypothetical protein	D6PSV5	Lactobacillus_phage	1.6e-37	61.9
WP_041815684.1\|2164468_2164894_-	hypothetical protein	D6PSU8	Lactobacillus_phage	1.8e-17	54.9
WP_173391369.1\|2165010_2165325_-	VRR-NUC domain-containing protein	A0A1B0YA93	Lactobacillus_phage	4.1e-27	53.9
WP_051053393.1\|2165579_2167904_-	DNA primase	Q9T0Y1	Lactobacillus_phage	3.6e-285	61.9
WP_015474440.1\|2167915_2168521_-	DUF669 domain-containing protein	Q9T0Y2	Lactobacillus_phage	1.8e-50	50.3
WP_144054555.1\|2168536_2169040_-	hypothetical protein	F8UBL7	Clostridium_phage	2.9e-38	46.9
WP_041815687.1\|2169036_2170392_-	DEAD/DEAH box helicase	A0A0P0ID30	Lactobacillus_phage	9.1e-156	60.8
WP_015474442.1\|2170324_2171095_-	AAA family ATPase	A0A1P8BM36	Lactococcus_phage	8.5e-82	64.3
WP_015474443.1\|2171095_2171956_-	DUF1351 domain-containing protein	A0A2D1GPE4	Lactobacillus_phage	3.2e-37	37.1
WP_015474444.1\|2171945_2172179_-	hypothetical protein	NA	NA	NA	NA
WP_041815690.1\|2172406_2172721_+	hypothetical protein	NA	NA	NA	NA
WP_173391363.1\|2172849_2172999_-	hypothetical protein	NA	NA	NA	NA
WP_015474448.1\|2173081_2173225_-	hypothetical protein	NA	NA	NA	NA
WP_015474449.1\|2173255_2173525_-	hypothetical protein	A0A2P0ZLA9	Lactobacillus_phage	7.4e-17	49.4
WP_041815998.1\|2173536_2174331_-	phage antirepressor KilAC domain-containing protein	Q38330	Lactococcus_phage	1.6e-67	52.1
WP_173391370.1\|2174343_2174535_-	transcriptional regulator	NA	NA	NA	NA
WP_015474452.1\|2174798_2175113_+	helix-turn-helix transcriptional regulator	Q9T1J3	Lactobacillus_phage	1.2e-13	44.3
WP_015474453.1\|2175115_2175535_+	ImmA/IrrE family metallo-endopeptidase	D6PSS8	Lactobacillus_phage	3.5e-21	38.8
2175451:2175467	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_020821

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NC_020819

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection