CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NC_021213	Streptococcus suis TL13, complete sequence	1 crisprs	csa3,cas3,WYL,DEDDh	0	0	7	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_021213_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_021213_1

1674207-1674306

Orphan

Consensus_repeat	Method
GGGAAAGAACTCGACCATTCATAGAAGAGT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_021213_1

>merge|NC_021213|1|1674207-1674306|CRISPRCasFinder
GGGAAAGAACTCGACCATTCATAGAAGAGTCCGTCAACAAGTCCTAGTTTTAAGTTGTTGAGCTGGGAGTGGGAAAGAACTCGACCATCCATAGAAGAGT

>NC_021213|1|1|1674207-1674306|CRISPRCasFinder
GGGAAAGAACTCGACCATTCATAGAAGAGT	CCGTCAACAAGTCCTAGTTTTAAGTTGTTGAGCTGGGAGT
GGGAAAGAACTCGACCATCCATAGAAGAGT

Protein	Signature genes	Signature genes Name	Protein_function
NC_021213.1\|WP_015647353.1\|1667222_1668464_+\|D-alanyl-D-alanine-carboxypeptidase	unknown	unknown	gnl\|CDD\|224600
NC_021213.1\|WP_014638617.1\|1663844_1664843_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|223521
NC_021213.1\|WP_015647357.1\|1672062_1673325_-\|Fe-S-cluster-assembly-protein-SufD	unknown	unknown	gnl\|CDD\|223791
NC_021213.1\|WP_015647354.1\|1668598_1670014_-\|Fe-S-cluster-assembly-protein-SufB	unknown	unknown	gnl\|CDD\|131035
NC_021213.1\|WP_041179406.1\|1665219_1667010_-\|oligopeptide-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173875
NC_021213.1\|WP_029188296.1\|1683976_1684453_-\|acetolactate-synthase-small-subunit	unknown	unknown	gnl\|CDD\|183365
NC_021213.1\|WP_002938145.1\|1662900_1663842_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224048
NC_021213.1\|WP_015647356.1\|1670835_1672059_-\|cysteine-desulfurase	unknown	unknown	gnl\|CDD\|131034
NC_021213.1\|WP_002942264.1\|1680366_1681269_-\|SPFH-domain-containing-protein	unknown	unknown	gnl\|CDD\|259805
NC_021213.1\|WP_002942259.1\|1682822_1683845_-\|ketol-acid-reductoisomerase	unknown	unknown	gnl\|CDD\|235491
NC_021213.1\|WP_002938165.1\|1673341_1674115_-\|Fe-S-cluster-assembly-ATPase-SufC	unknown	unknown	gnl\|CDD\|223473
NC_021213.1\|WP_015647360.1\|1677646_1679212_+\|ABC-transporter-substrate-binding-protein/permease	unknown	unknown	gnl\|CDD\|270345
NC_021213.1\|WP_015647351.1\|1661942_1662899_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223674
NC_021213.1\|WP_012775335.1\|1679204_1679948_+\|amino-acid-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224051
NC_021213.1\|WP_002938168.1\|1674664_1675837_-\|undecaprenyl/decaprenyl-phosphate-alpha-N-acetylglucosaminyl-1-phosphate-transferase	unknown	unknown	gnl\|CDD\|133463
NC_021213.1\|WP_015647355.1\|1670408_1670849_-\|SUF-system-NifU-family-Fe-S-cluster-assembly-protein	unknown	unknown	gnl\|CDD\|273918
NC_021213.1\|WP_009910800.1\|1680071_1680281_-\|hypothetical-protein	unknown	unknown	unknown
NC_021213.1\|WP_002938171.1\|1675833_1676556_-\|adaptor-protein-MecA	unknown	unknown	gnl\|CDD\|235030
NC_021213.1\|WP_015647359.1\|1676683_1677520_-\|undecaprenyl-diphosphate-phosphatase	unknown	unknown	gnl\|CDD\|234712
NC_021213.1\|WP_002937416.1\|1681278_1682529_-\|threonine-ammonia-lyase-IlvA	unknown	unknown	gnl\|CDD\|236318

Protein	Function_ID	Function_description	E-value
NC_021213.1\|WP_015647353.1\|1667222_1668464_+\|D-alanyl-D-alanine-carboxypeptidase	gnl\|CDD\|224600	COG1686, DacC, D-alanyl-D-alanine carboxypeptidase [Cell envelope biogenesis, outer membrane].	9.62695e-92
NC_021213.1\|WP_014638617.1\|1663844_1664843_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|223521	COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	3.95109e-159
NC_021213.1\|WP_015647357.1\|1672062_1673325_-\|Fe-S-cluster-assembly-protein-SufD	gnl\|CDD\|223791	COG0719, SufB, Cysteine desulfurase activator SufB [Posttranslational modification, protein turnover, chaperones].	2.05563e-123
NC_021213.1\|WP_015647354.1\|1668598_1670014_-\|Fe-S-cluster-assembly-protein-SufB	gnl\|CDD\|131035	TIGR01980, UPF0051_protein_slr0074, FeS assembly protein SufB. This protein, SufB, forms a cytosolic complex SufBCD. This complex enhances the cysteine desulfurase of SufSE. The system, together with SufA, is believed to act in iron-sulfur cluster formation during oxidative stress. Note that SufC belongs to the family of ABC transporter ATP binding proteins, so this protein, encoded by an adjacent gene, has often been annotated as a transporter component. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other].	0
NC_021213.1\|WP_041179406.1\|1665219_1667010_-\|oligopeptide-ABC-transporter-substrate-binding-protein	gnl\|CDD\|173875	cd08510, PBP2_Lactococcal_OppA_like, The substrate binding component of an ABC-type lactococcal OppA-like transport system contains. This family represents the substrate binding domain of an ATP-binding cassette (ABC)-type oligopeptide import system from Lactococcus lactis and other gram-positive bacteria, as well as its closet homologs from gram-negative bacteria. Oligopeptide-binding protein (OppA) from Lactococcus lactis can bind peptides of length from 4 to at least 35 residues without sequence preference. The oligopeptide import system OppABCDEF is consisting of five subunits: two homologous integral membrane proteins OppB and OppF that form the translocation pore; two homologous nucleotide-binding domains OppD and OppF that drive the transport process through binding and hydrolysis of ATP; and the substrate-binding protein or receptor OppA that determines the substrate specificity of the transport system. The dipeptide (DppA) and oligopeptide (OppA) binding proteins differ in several ways. The DppA binds dipeptides and some tripeptides and also is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	0
NC_021213.1\|WP_029188296.1\|1683976_1684453_-\|acetolactate-synthase-small-subunit	gnl\|CDD\|183365	PRK11895, ilvH, acetolactate synthase 3 regulatory subunit; Reviewed.	4.77936e-73
NC_021213.1\|WP_002938145.1\|1662900_1663842_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224048	COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only].	5.21239e-119
NC_021213.1\|WP_015647356.1\|1670835_1672059_-\|cysteine-desulfurase	gnl\|CDD\|131034	TIGR01979, Probable_cysteine_desulfurase, cysteine desulfurases, SufSfamily. This model represents a subfamily of NifS-related cysteine desulfurases involved in FeS cluster formation needed for nitrogen fixation among other vital functions. Many cysteine desulfurases are also active as selenocysteine lyase and/or cysteine sulfinate desulfinase. This subfamily is associated with the six-gene SUF system described in E. coli and Erwinia as an FeS cluster formation system during oxidative stress. The active site Cys is this subfamily resembles GHHC with one or both His conserved. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other].	0
NC_021213.1\|WP_002942264.1\|1680366_1681269_-\|SPFH-domain-containing-protein	gnl\|CDD\|259805	cd03407, SPFH_like_u4, Uncharacterized family; SPFH (stomatin, prohibitin, flotillin, and HflK/C) superfamily. This model summarizes an uncharacterized family of proteins similar to stomatin, prohibitin, flotillin, HflK/C (SPFH) and podocin. The conserved domain common to the SPFH superfamily has also been referred to as the Band 7 domain. Many superfamily members are associated with lipid rafts. Individual proteins of the SPFH superfamily may cluster to form membrane microdomains which may in turn recruit multiprotein complexes. Microdomains formed from flotillin proteins may in addition be dynamic units with their own regulatory functions. Flotillins have been implicated in signal transduction, vesicle trafficking, cytoskeleton rearrangement and are known to interact with a variety of proteins. Stomatin interacts with and regulates members of the degenerin/epithelia Na+ channel family in mechanosensory cells of Caenorhabditis elegans and vertebrate neurons and participates in trafficking of Glut1 glucose transporters. Prohibitin may act as a chaperone for the stabilization of mitochondrial proteins. Prokaryotic HflK/C plays a role in the decision between lysogenic and lytic cycle growth during lambda phage infection. Flotillins have been implicated in the progression of prion disease, in the pathogenesis of neurodegenerative diseases such as Parkinson's and Alzheimer's disease and, in cancer invasion and metastasis. Mutations in the podocin gene give rise to autosomal recessive steroid resistant nephritic syndrome.	3.7824e-128
NC_021213.1\|WP_002942259.1\|1682822_1683845_-\|ketol-acid-reductoisomerase	gnl\|CDD\|235491	PRK05479, PRK05479, ketol-acid reductoisomerase; Provisional.	0
NC_021213.1\|WP_002938165.1\|1673341_1674115_-\|Fe-S-cluster-assembly-ATPase-SufC	gnl\|CDD\|223473	COG0396, sufC, Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones].	2.74827e-148
NC_021213.1\|WP_015647360.1\|1677646_1679212_+\|ABC-transporter-substrate-binding-protein/permease	gnl\|CDD\|270345	cd13627, PBP2_AA_binding_like_2, Substrate-binding domain of putative amino acid-binding protein; the type 2 periplasmic-binding protein fold. This putative amino acid-binding protein belongs to the type 2 periplasmic-binding fold protein (PBP2) superfamily, whose members are involved in chemotaxis and uptake of nutrients and other small molecules from the extracellular space as a primary receptor. PBP2 typically comprises of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two receptor cytoplasmically-located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	2.13638e-90
NC_021213.1\|WP_015647351.1\|1661942_1662899_-\|ABC-transporter-permease	gnl\|CDD\|223674	COG0601, DppB, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	1.93788e-112
NC_021213.1\|WP_012775335.1\|1679204_1679948_+\|amino-acid-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224051	COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism].	7.30548e-147
NC_021213.1\|WP_002938168.1\|1674664_1675837_-\|undecaprenyl/decaprenyl-phosphate-alpha-N-acetylglucosaminyl-1-phosphate-transferase	gnl\|CDD\|133463	cd06853, GT_WecA_like, This subfamily contains Escherichia coli WecA, Bacillus subtilis TagO and related proteins. WecA is an UDP-N-acetylglucosamine (GlcNAc):undecaprenyl-phosphate (Und-P) GlcNAc-1-phosphate transferase that catalyzes the formation of a phosphodiester bond between a membrane-associated undecaprenyl-phosphate molecule and N-acetylglucosamine 1-phosphate, which is usually donated by a soluble UDP-N-acetylglucosamine precursor. WecA participates in the biosynthesis of O antigen LPS in many enteric bacteria and is also involved in the biosynthesis of enterobacterial common antigen. A conserved short sequence motif and a conserved arginine at a cytosolic loop of this integral membrane protein were shown to be critical in recognition of substrate UDP-N-acetylglucosamine.	6.5291e-81
NC_021213.1\|WP_015647355.1\|1670408_1670849_-\|SUF-system-NifU-family-Fe-S-cluster-assembly-protein	gnl\|CDD\|273918	TIGR01994, Iron-sulfur_cluster_assembly_scaffold_protein_IscU, SUF system FeS assembly protein, NifU family. Three iron-sulfur cluster assembly systems are known so far. ISC is broadly distributed while NIF tends to be associated with nitrogenase in nitrogen-fixing bacteria. The most recently described is SUF, believed to be important to maintain the function during aerobic stress of enzymes with labile Fe-S clusters. It is fairly widely distributed. This family represents one of two different proteins proposed to act as a scaffold on which the Fe-S cluster is built and from which it is transferred. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other].	1.09225e-67
NC_021213.1\|WP_002938171.1\|1675833_1676556_-\|adaptor-protein-MecA	gnl\|CDD\|235030	PRK02315, PRK02315, adaptor protein MecA.	9.87046e-83
NC_021213.1\|WP_015647359.1\|1676683_1677520_-\|undecaprenyl-diphosphate-phosphatase	gnl\|CDD\|234712	PRK00281, PRK00281, undecaprenyl-diphosphate phosphatase.	2.29948e-101
NC_021213.1\|WP_002937416.1\|1681278_1682529_-\|threonine-ammonia-lyase-IlvA	gnl\|CDD\|236318	PRK08639, PRK08639, threonine dehydratase; Validated.	0

>NC_021213.1|WP_002938165.1|1673341_1674115_-|Fe-S-cluster-assembly-ATPase-SufC
MSVLEIKDLHVEIEGKEILKGVNLTLKTGEIAAIMGPNGTGKSTLSAAIMGNPSYEVTQGEILFDGVNILELEVDERARMGLFLAMQYPSEIPGITNAEFLRAAMNAGKEDEDKISVRDFITKLDEKMELLNMKEEMAERYLNEGFSGGEKKRNEILQLLMLEPTFALLDEIDSGLDIDALKVVSKGINAMRGEGFGAMIITHYQRLLNYITPDVVHVMMEGRVVLSGGPELAQRLEKEGYVQVAAELGIDYKEDDI
>NC_021213.1|WP_015647357.1|1672062_1673325_-|Fe-S-cluster-assembly-protein-SufD
MTKEKIQEFSALQAEPTWLTDLRLKGFDKIAELDLPVIERVKFHRWNLGDGSLATNDEIGAVPDFTAIGDNPMLVQVGSQTVLEQLPVDLVEKGVVFTDFASAMDVIPDVLEKYLGAAVAYDEHKLAAYNTAYFNATAVLYVPDNVEIDQPVEALFYQDSTSPVAFNKRVLIIAGKNAKLNYLERFESLGDGAATTSANIVVEVIALAGSQIKFAAIDRLGKHLDTYLNRRGYLGNDATIDWAIGLLNEGNVVADLDSELKGNGSHANLKVVGLSSGRQVQGVDTRVTNYGHNSVGHILQHGVILESGTLTFNGIGHIVRGAKGADAQQESRVLMLSDKARSDANPILLIDENEVTAGHAASIGQVDPEDMYYLMSRGLDRATAERLVVRGFLGAVITEIPVKEVRDQLIAVIEEKLIKR
>NC_021213.1|WP_015647356.1|1670835_1672059_-|cysteine-desulfurase
MDLERIRKDFSILDQVVNDEPLVYLDNAATTQKPQQVLDVLADYYQKDNANVHRGVHTLSERATARYEAARQKVADFIQAKSSKEILFTRGTTTSLNWVAQFAKEILQPDQEVIISVQEHHSNIIPWQQACQQTGAKLRYVSLKDGELDMDHLRSLLSSKTKFVSLAHVSNVLGSVAPIGEIAELVHQVGAYLVVDGAQSVPHMAVNVQELDVDFFAFSGHKMLGPTGIGVLYGKEELLNRMSPVEFGGEMIDFVYEQSATWKELPWKFEAGTPNIAGSIGLGAAVDYLMEIGMDAIQAHEAELVDYVFPKLQAIPGLTIYGSQDLSKRTGVIAFNLDDLHPHDVATALDYEGVAVRAGHHCAQPLLRYLQVPATVRASFYIYNTKADCDKLVEAIIKTKEFFNGPI
>NC_021213.1|WP_015647355.1|1670408_1670849_-|SUF-system-NifU-family-Fe-S-cluster-assembly-protein
MALSRLDSLYMAVVSEHSKSPRHRGSLDGVEKLELHNPTCGDVIELSVKIEKDVITDIAFDGVGCTISTASASMMTEAVLGKEISQIQELAEIFSQMVQGQEDPRQKELGDASLLAGVAKFPQRIKCATLPWNALKKALERSESAE
>NC_021213.1|WP_015647354.1|1668598_1670014_-|Fe-S-cluster-assembly-protein-SufB
MSEERIEPTPIDLGEYKFGFHDENVELVASTGKGLNEEVIREMSRIKGEPEWMLEFRLKSYETFKKMPMQTWGADLSELDFDDIVYYQKPSDKPARSWDDVPDKIKETFERIGIPEAERAYLAGASAQYESEVVYHNMKEEYDKHGIIFTDTDTALKEHPELFKKYFGKLVPPSDNKLAALNSAVWSGGTFIYVPKGVKLDIPLQTYFRINNEGTGQFERTLIIVDEGASVHYVEGCTAPTYSTASLHAAIVEIIAHEGAYMRYTTIQNWSDNVYNLVTKRARAEKNATVEWIDGNLGAKTTMKYPAVYLEGEGARGTMLSIAFANKGQVQDTGAKMIHNAPHTSSSIVSKSIARGGGEVNYRGQVTFAKNSAKSISHIECDTIIMDDISKSDTIPFNEIHNSQVALEHEAKVSKISEEQLYYLMSRGLSESEATEMIVMGFVEPFTKELPMEYAVELNRLIAYEMEGSVG
>NC_021213.1|WP_015647353.1|1667222_1668464_+|D-alanyl-D-alanine-carboxypeptidase
MRKFLLTLTTVIALFFTSTPILAEDFSVATKHAIAVEVSSGKILYEQDAETKASIASISKTLSIYLVYEALAKGEITLDTMVDISDYPYSLTSNTELSNVNLDTRSYSVRDLLNASLITSSNSAIIALAEKIAGSEAAFVDRMKAKVQEWGITDAKIVNVSGLDNTDLGENIYPGSSPEDVNMFSALDVAIIARRLILDYPQVLDITSLNAYDFGGYTYYSTNQMLSDGTHARGGVDGLKTGTSNSAGSSFLATTQQAGMRIITVVLNATDGLTSPENRFVATNDLMNYVYSNFSLVTLVKKGEAFEDSKINVFNGEKETSPVVAAADLTVVQRNQTDNVPTATFTTDIKEIDAPLKAGTLVGKLQLKDQDLIGKGYISEQASVDMIIPSDMKEASWPFSWWNQFVRYVNEKL
>NC_021213.1|WP_041179406.1|1665219_1667010_-|oligopeptide-ABC-transporter-substrate-binding-protein
MKKTTKLFALAGVTLLSASVLAACGSKQSGAAKQELSFPAEVKQDGTAVSDAQLKYAFVSPTTSSGLLIDELTENTTDSTFGGMVDISMFGYDGDRKLDDSGLAKAEFDVKGKKITVSLTGKDYKWSDGEPFTINDYIFTIKSMASKDYTGIRFDDKFLNIEGMQEFVDGKASDISGIKKVDDYTVELTVKEMSPSMMYAGGDVPAYIQPEHIYKDIPVADWEKSEYSRTAKLVGMGPWKIKEIVNGESITYVPNEYFFKGTKPKTSSLKIDIVSPDTIVSEMKAGNYDIADMPVDQLDSYKKASNLNIVGSLDSAYEYISFNFGKYDEAAGKNVMDENAKMNDVKLRQAIAYAIDTKTAGESLYNGLYHPAKSLIISFFGDIHDSELEGYSYNPEKAKKLLDEAGYKDVDGDGIREGKDGKAFKITFAARKRTEANEALVQQYIAWWKEVGLNVELYTGRTVEGKSFYNSVQANDAAIDMYAGGWSTGYDPNPSGLWGPIAAFNMSRFVSDENTKLLEAISSTESFDDKKNVENYKAWQKYAYEQAFAIPTFESESIVALNKRVKNYDTNYGSASGKGIALENIELTADKGVVAE
>NC_021213.1|WP_014638617.1|1663844_1664843_-|ABC-transporter-ATP-binding-protein
MATEKPLLDIKDLHVGFRIGDDYFDAVDGVDISLQKNEILAIVGESGCGKSTLATTIMGLHNPLNTKITGSIQYNDMELIGMDEAKYNTVRGNDIGMIFQDPLASLNPLMTIGAQIDEAMFYHTDLDANARTERVLELLAQVGIPNPKRTFKQYPHELSGGMRQRIIIAMALSCKPPIIIADEPTTALDVTIQAQILDLLNDIQAETGSGIILITHDLGVVAETADRVAVMYGGQFVEVAPVEELFTNPKHPYTRSLLKSNPQSGSEGGDLHVIEGIVPPITKMVRKGCRFAPRIPWIGAEAHEENPSMHEVGPNHFVRCTCHETFYFEGEA
>NC_021213.1|WP_002938145.1|1662900_1663842_-|ABC-transporter-ATP-binding-protein
MGFIEVKDLKVHYPIRSGFFNRVTDHVYAVDGVNIEFEEGKTYGLVGESGSGKSTIGKAIIGLERATSGQIIYEGQNVTNKSRGKKGNFNRDVQMIFQDSLSSFNPKKRILDIIAEPIRNFDRLSPDEEKKKVLQLLDTIGLNEEALIKYPHEFSGGQRQRIGVARALASNPRLIIADEPVSALDLSVQAQVLNYMKRIQDEFKLSYLFISHDLGVVQHMCDELFIMYRGRFVETGNKNDIYNNPQHIYTKRLLSAIPTIDPLNRLKNKEKRLAAEKEYQEMQGQYYDENGRVYDLRSFSETHQVALPEGGQN
>NC_021213.1|WP_015647351.1|1661942_1662899_-|ABC-transporter-permease
MWKTVLRRLLMMIPQIIILSVIAFFVAKMMPGDPFTGLIDPNIDPAIIEQKRIAAGYYDPIPVQYFRWVGNLLQGDFGQSVIFKQPVVDVIMQRLNNTIGLSLLTMVLTYLIALPLGMIAGRYQNSLADKIIGVYNFLTFSTPTFVFAILMLWMFGFSLGWFPTRGSISGGVEGFAATLSRLHHMILPAITMAILSTTVTIQYLRTGIIDAKSQDYVRTARAKGVPERVVYNRHIFRNSILPIASFLGYELTGLIGGSIFIENIFTYPGIGQLFFNSISSRDYSVILALLLIFGMGTLLGTLISDIIMSIVDPRIRVK
>NC_021213.1|WP_002938168.1|1674664_1675837_-|undecaprenyl/decaprenyl-phosphate-alpha-N-acetylglucosaminyl-1-phosphate-transferase
MIPFALKYIMVIITTMVISAIATPLVRFMSLRVGAVDNPNARRINKVPMPSAGGLAIFVAFTISVLWFLPGIVTRVNYHGTYLHYIWPLVLASSIIVLTGFIDDVKELKPAPKMFGILAAATIIWIFTEFRFDSFKIPFGGPFLQFPVWLSFLLTVLWIVSITNAVNLIDGLDGLVSGVSIISLTTMGIVSYFFLHDSNIFLTLTIFVLVAAIVGFLPYNYNPAIIYLGDTGALFIGFMIGVLSLQGLKNSTAVAVVTPMIILGVPITDTVVAIIRRKLSGQKIYEADKMHLHHRLLSLGLTHRGTVLVIYTISFLFSLTSLLLNVSSRIGGILLLVTMGLGIEILCELIGIFGINRTPLLNLLRFIGNSSYRQEKIAKYKKCCEEKKRK
>NC_021213.1|WP_002938171.1|1675833_1676556_-|adaptor-protein-MecA
MKVKQISDSTLKITIKLDDLEERGMELSDFLIPQEKTEEFFYTVLDELDLPMTFRESGMLSFRVTPKPDRVDIFVTKSDLDQSLNFDEFTDLSELGDVASMTPDEFFKSLEQTVREKSAPDATAVRHLEEVEQEEEADEEEQERYIYYILEFPTIEDLFTFVGTVDYPVEESELYKMDGHYYLTVLINVENRSKQYPGYILSRMLEFTNDTKLTRPALQEHGTLMLPLAAIEELRKVPTV
>NC_021213.1|WP_015647359.1|1676683_1677520_-|undecaprenyl-diphosphate-phosphatase
MLLELLKAIFLGIIEGVTEWLPVSSTGHLILVQEFVKLNQSKNFLEMFNIVIQLGAILAVMTIYFKKLNPFQPGKTKRDIQLTWQLWAKVVIACIPSILIAVPLDNWFEAHFNFMVPIAIALIVYGIAFIWIENRNSGVEPQVTDLAKMSYKTALLIGCFQVLSIVPGTSRSGATILGAIILGTSRSVAADFTFFLGIPTMFGYSGLKAVKYFLDGNSLNMEQVWILLVASVTAYLVSLVVIRFLTDFVKKHDFTVFGYYRIILGAILLVYAFITFLF
>NC_021213.1|WP_015647360.1|1677646_1679212_+|ABC-transporter-substrate-binding-protein/permease
MKRKLSIFLLTLIAVFSVTTGVRADEYLRVGMEAAYAPFNWTQEDDSNGAVPIEGTNQFANGYDVQVAKKIAASMDKELLVVKTKWEGLVPALTSGKIDMIIAGMSPTEERKKEIAFSDSYYTSIPTLVVRSDSQYANATSLADFADAKITAQQGVYLYDLIDQIEGANKQTAMGDFSQIRQALESGIIDAYVSERPEGRTAEAANKAFKMVELADSFATNAEDVTIAVGMRKDDERIAQVNEVLATISEEEQIALMDDMIENQPVEEASEGETPSFFAQVWNIVVNNWQQLLRGTGMTLLISILGTIIGTAIGLLIGVFRTAPKAANKALAIGQKVLGWIINIYIEIFRGTPMIVQSMVIYYGTAQAFGLNLDRTLAAIFIVSINTGAYMSEIVRGGIFAVDKGQFEAATALGFTHNQTMRKIVLPQVIRNILPATGNEFVINIKDTSVLNVISVVELYFSGNTVATQTYQYFQTFTVIAIIYFILTFTVTRILRAVEKHFDTDTYTTGANQMQVEVPHD
>NC_021213.1|WP_012775335.1|1679204_1679948_+|amino-acid-ABC-transporter-ATP-binding-protein
MTKNVILEIKNLKKSYGQNQVLKDISISVEKGEVISIIGSSGSGKSTFLRSINLLETPTEGQILYHGQDVLAKGYDLTTYREKLGMVFQSFNLFNNLNVLENAIVAQTTVLKRDRAEAEKIAKENLNKVGMTEQYWQAKPSQLSGGQKQRVAIARALSVDPEVILFDEPTSALDPEMVGEVLKTMQDLAKSGLTMLIVTHEMEFARDVSDRVIFMDKGVIAEEGSPQQIFENPQEERTREFLQRFLG
>NC_021213.1|WP_009910800.1|1680071_1680281_-|hypothetical-protein
MTSYEKVAAVVGWVREKKITGYRISKETNAREMSVIALAQGRAKIDNISFATALGLIDFYDKNHKKFEN
>NC_021213.1|WP_002942264.1|1680366_1681269_-|SPFH-domain-containing-protein
MVLGPIVFIGSFLFFVLIALILIASGLYVVKQQTVAIIERFGKYQKTSTSGINFKIPFGVDVIAARIQLRMLQSEIVVETKTQDNVFVTMNVATQYRVNENNVTDAYYKLMHPEAQIKSYIEDALRSSVPKLTLDELFEKKDEIALEVQKQVAEEMSTYGYVIVKTLITKVEPDAEVKQSMNEINAAQRKRVAAQELAEADKIKIVTAAEAEAEKDRLHGVGIAQQRKAIVDGLADSIRELKESNVSLSEEQIMSILLTNQYLDTLNNFAQGGNQTIFLPGNPEGVEDIRTQILSSLRAK
>NC_021213.1|WP_002937416.1|1681278_1682529_-|threonine-ammonia-lyase-IlvA
MITAKNVEQAYSVLKRVVVRTPLDYSRYLSEKYGATIYLKRENEQRVRSFKIRGAYYAISQLTDDEKSRGVVCASAGNHAQGVAYTCQEMQIPATIFMPITTPQQKIGQVKFFGGDYVEIRLVGDTFDESAKAAQDYTQESGKTFIDPFDDENVQAGQGTVAYEILEEAEEQTISFDQILVPIGGGGLVAGVSAYLKEHAPEIKIVGVEASGARSMKAAFDKGRPVKLDQIDKFADGIAVQKVGKSTYEVARKYVDRLIGVDEGWISGTILDLYSKLGIVAEPAGAATIAALEVVKDQIKGQTICCIISGGNNDINRMPEMEERALIYEGIKHYFVVNFPQRPGALREFVNDILGPNDDITRFEYIKRANKGTGPVLIGIALGDKTDYTQFISRLEEFDPQYINLHENDSLYKMLV
>NC_021213.1|WP_002942259.1|1682822_1683845_-|ketol-acid-reductoisomerase
MTVTMQYEKDVTVAALDGKRIAVIGYGSQGHAHAQNLRDTGHDVIIGVRAGKSFDKAKEDGFETFEVAEAAKQADVIMILAPDEIQADLYNDEIAPNLEAGNALGFAHGFNVHFEFIKVPADVDVFMCAPKGPGHLVRRTFEEGFGVPALYAVYQDATGNAKHIAMDWAKGVGSARVGLLETTFKEETEEDLFGEQAVLCGGLTALMQAGFEVLTEAGYAPELAYFEVLHEMKLIVDLVYEGGFKKMRQSISNTAEFGDYVSGPRVITDQVKENMKAVLADIQSGKFANDFVNDYKAGRPRMEAYRKEAENLEIEKVGAELRKAMPFVGRNDDDAFKIYN
>NC_021213.1|WP_029188296.1|1683976_1684453_-|acetolactate-synthase-small-subunit
MRRMLTAKLRNSSGVLNRFTGVLSRRQINIESISVGPTEVDGISRVTVIVDVASHDEVEQIIKQLNRLIDVVRVRDLTDIPHLEREVILVKISAPPTKRAEILVIIQPFRANVVDVAPHSITIQMTGDGDKIDALLRVIQPYGIKNIARTGATGFSRD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

131333 : 138720

Streptococcus_phage(77.78%)

protease

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015646277.1\|131333_132008_-\|protease	Clp protease ClpP	Q9EYD3	Enterobacteria_phage	1.2e-20	34.5
WP_015646278.1\|131997_132489_-	hypothetical protein	NA	NA	NA	NA
WP_041179361.1\|132501_133017_-	hypothetical protein	NA	NA	NA	NA
WP_015646280.1\|133164_133332_-	hypothetical protein	NA	NA	NA	NA
WP_015646281.1\|133375_133834_-	hypothetical protein	A0A1P8VVT5	Streptococcus_phage	4.5e-30	46.8
WP_015646282.1\|133837_134299_-	hypothetical protein	A0A1X9I5V5	Streptococcus_phage	1.5e-25	46.4
WP_015646283.1\|134295_135135_-	ATP-binding protein	A0A1X9I6C4	Streptococcus_phage	5.4e-66	48.7
WP_015646284.1\|135146_135998_-	phage replisome organizer N-terminal domain-containing protein	J7KBV5	Streptococcus_phage	3.4e-84	67.9
WP_015646285.1\|135987_136266_-	hypothetical protein	A0A1X9I5U9	Streptococcus_phage	4.8e-27	64.0
WP_041179362.1\|136258_136591_-	hypothetical protein	A0A1X9I5Z6	Streptococcus_phage	8.8e-28	65.6
WP_015646286.1\|136613_136781_-	hypothetical protein	NA	NA	NA	NA
WP_015646287.1\|136994_137423_-	hypothetical protein	A0A1X9I5T7	Streptococcus_phage	3.6e-58	78.2
WP_015646288.1\|137856_138087_-	hypothetical protein	NA	NA	NA	NA
WP_015646289.1\|138099_138720_-	Rha family transcriptional regulator	R9QNB1	Lactococcus_phage	3.4e-25	37.3

DBSCAN-SWA_2

580903 : 605533

Streptococcus_phage(85.71%)

integrase

attL 570520:570535|attR 605913:605928

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
570520:570535	attL	NA	NA	NA	NA
WP_015646592.1\|580903_581731_+	DNA-formamidopyrimidine glycosylase	G3MA33	Bacillus_virus	2.7e-25	33.5
WP_015646593.1\|581723_582326_+	dephospho-CoA kinase	NA	NA	NA	NA
WP_014637644.1\|582312_583518_+	multidrug efflux MFS transporter	NA	NA	NA	NA
WP_012775228.1\|583517_583667_+	50S ribosomal protein L33	NA	NA	NA	NA
WP_002935768.1\|583713_583947_+	preprotein translocase subunit SecG	NA	NA	NA	NA
WP_014637646.1\|584378_586748_+	ribonuclease R	Q0GXV6	Lactococcus_phage	3.0e-93	40.8
WP_014637647.1\|586750_587218_+	SsrA-binding protein SmpB	W5RAM5	Staphylococcus_phage	4.7e-43	55.7
WP_000420680.1\|587666_587981_+	YdcP family protein	A0A1S5SF38	Streptococcus_phage	1.7e-52	97.1
WP_000985016.1\|587996_588383_+	YdcP family protein	A0A1S5SF96	Streptococcus_phage	7.3e-58	90.6
WP_015646594.1\|588422_589817_+	DNA translocase FtsK	A0A1S5SFB5	Streptococcus_phage	4.6e-243	92.3
WP_015646595.1\|589822_590260_+	hypothetical protein	NA	NA	NA	NA
WP_078102635.1\|590288_590402_+	conjugal transfer protein	NA	NA	NA	NA
WP_015646596.1\|590436_591642_+	replication initiation factor domain-containing protein	A0A1S5SEX3	Streptococcus_phage	2.0e-226	97.3
WP_001009056.1\|591684_591906_+	hypothetical protein	A0A1S5SEY0	Streptococcus_phage	4.3e-31	100.0
WP_002345010.1\|592024_592522_+	antirestriction protein ArdA	A0A1S5SF25	Streptococcus_phage	1.3e-88	97.6
WP_000723888.1\|592608_593001_+	conjugal transfer protein	A0A1S5SEX7	Streptococcus_phage	3.2e-69	100.0
WP_000331160.1\|592984_595432_+	ATP-binding protein	A0A1S5SF64	Streptococcus_phage	0.0e+00	100.0
WP_041179380.1\|595434_597612_+	membrane protein	A0A1S5SF30	Streptococcus_phage	0.0e+00	99.9
WP_006150747.1\|597608_598490_+	bifunctional lysozyme/C40 family peptidase	A0A1S5SEZ8	Streptococcus_phage	8.9e-160	88.0
WP_015646598.1\|598486_599422_+	conjugal transfer protein	A0A1S5SF22	Streptococcus_phage	1.6e-167	97.7
WP_001791010.1\|599666_599783_+	tetracycline resistance determinant leader peptide	NA	NA	NA	NA
WP_015646599.1\|599798_601718_+	tetracycline resistance ribosomal protection protein Tet(M)	A0A1S5SF82	Streptococcus_phage	0.0e+00	96.9
WP_000336323.1\|601836_602004_+	cysteine-rich KTR domain-containing protein	D0R0F6	Streptococcus_phage	1.6e-14	68.0
WP_001227347.1\|602063_602417_-	helix-turn-helix domain-containing protein	A0A1S5SFA6	Streptococcus_phage	1.3e-58	100.0
WP_000804885.1\|602921_603344_+	sigma-70 family RNA polymerase sigma factor	A0A1S5SEW0	Streptococcus_phage	2.5e-72	100.0
WP_000857133.1\|603340_603571_+	helix-turn-helix domain-containing protein	A0A1S5SEX1	Streptococcus_phage	2.7e-36	100.0
WP_000814512.1\|604030_604234_+	excisionase	A0A1S5SF07	Streptococcus_phage	2.0e-30	97.0
WP_002835202.1\|604315_605533_+\|integrase	tyrosine-type recombinase/integrase	A0A1S5SEW7	Streptococcus_phage	3.0e-230	98.5
605913:605928	attR	NA	NA	NA	NA

DBSCAN-SWA_3

1131712 : 1147842

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012775042.1\|1131712_1132540_+	exodeoxyribonuclease III	M1PSC0	Streptococcus_phage	2.9e-152	100.0
WP_011922204.1\|1132831_1133731_+	cation transporter	M1Q1N9	Streptococcus_phage	5.1e-163	99.7
WP_002935368.1\|1133747_1134101_-	arsenate reductase family protein	M1PLC0	Streptococcus_phage	1.9e-60	100.0
WP_015646950.1\|1134084_1134591_-	methylated-DNA--[protein]-cysteine S-methyltransferase	M1PFU9	Streptococcus_phage	3.7e-94	98.8
WP_014638089.1\|1134593_1135775_-	phosphoglycerate dehydrogenase	M1NSB9	Streptococcus_phage	9.2e-221	100.0
WP_015646951.1\|1136148_1136706_-	hypothetical protein	M1PSC3	Streptococcus_phage	7.7e-93	98.4
WP_015646952.1\|1136705_1137797_-	3-phosphoserine/phosphohydroxythreonine transaminase	M1Q1P2	Streptococcus_phage	7.0e-207	99.7
WP_015646954.1\|1138637_1139501_-	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	6.2e-158	99.3
WP_002935361.1\|1139502_1139820_-	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	3.1e-54	100.0
WP_015646955.1\|1139839_1140724_-	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	1.5e-154	99.0
WP_015646956.1\|1140720_1141359_-	dTMP kinase	M1PSC7	Streptococcus_phage	4.1e-114	99.1
WP_015646957.1\|1141533_1142400_+	YitT family protein	M1Q1P6	Streptococcus_phage	1.0e-152	99.3
WP_015646958.1\|1142436_1143708_-	toxic anion resistance protein	M1PLC8	Streptococcus_phage	2.2e-212	99.8
WP_015646959.1\|1143713_1144541_-	hypothetical protein	M1PFV6	Streptococcus_phage	2.3e-133	98.5
WP_015646960.1\|1144634_1145291_-	CBS domain-containing protein	M1NSC5	Streptococcus_phage	3.5e-113	99.1
WP_041179393.1\|1145604_1147842_-	DNA internalization-related competence protein ComEC/Rec2	M1PSD2	Streptococcus_phage	5.3e-100	97.8

DBSCAN-SWA_4

1229145 : 1240119

Streptococcus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015647026.1\|1229145_1229835_-	Tyrosine-protein kinase modulator CpsB	A0A1X9I5E1	Streptococcus_phage	8.3e-97	81.7
WP_015647027.1\|1229852_1231298_-	LCP family protein	A0A1X9I5X1	Streptococcus_phage	7.4e-212	91.7
WP_024389086.1\|1231391_1232141_-	peroxide stress protein YaaA	A0A1X9I5I0	Streptococcus_phage	2.7e-117	98.6
WP_015647029.1\|1232263_1233520_+	PLP-dependent aminotransferase family protein	A0A1X9I5H2	Streptococcus_phage	1.8e-235	99.0
WP_015647030.1\|1233622_1234474_-	DegV family protein	A0A1X9I5J4	Streptococcus_phage	9.5e-151	97.9
WP_011922106.1\|1234600_1235005_+	TetR/AcrR family transcriptional regulator	A0A1X9I6A2	Streptococcus_phage	3.2e-64	99.3
WP_015647031.1\|1235027_1235813_-	pyrroline-5-carboxylate reductase	A0A1X9I6T5	Streptococcus_phage	8.5e-130	95.0
WP_015647032.1\|1235822_1237061_-	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	2.3e-214	96.4
WP_187288150.1\|1238826_1240119_-\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	3.0e-217	95.5

DBSCAN-SWA_5

1290966 : 1297236

Streptococcus_phage(71.43%)

transposase,integrase

attL 1282259:1282273|attR 1297406:1297420

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1282259:1282273	attL	NA	NA	NA	NA
WP_029694535.1\|1290966_1291251_-	hypothetical protein	A1EAB4	Streptococcus_phage	6.5e-48	94.6
WP_015647064.1\|1291463_1292417_-\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	2.1e-34	33.7
WP_079266797.1\|1292781_1293237_+	DUF4393 domain-containing protein	E9LUL1	Lactobacillus_phage	2.1e-16	39.5
WP_024390285.1\|1293541_1293835_+	hypothetical protein	NA	NA	NA	NA
WP_015647067.1\|1293831_1293990_-	hypothetical protein	NA	NA	NA	NA
WP_015647069.1\|1294454_1295225_+	helix-turn-helix transcriptional regulator	M1PKS2	Streptococcus_phage	1.0e-135	94.9
WP_024390283.1\|1295288_1295705_+	hypothetical protein	NA	NA	NA	NA
WP_024390282.1\|1295803_1296058_+	hypothetical protein	M1PF81	Streptococcus_phage	4.5e-24	55.8
WP_079266798.1\|1296177_1296342_+	Arm DNA-binding domain-containing protein	M1Q1T0	Streptococcus_phage	1.8e-21	96.3
WP_015647072.1\|1296522_1297236_+\|integrase	site-specific integrase	M1IRD4	Streptococcus_phage	3.7e-63	85.2
1297406:1297420	attR	NA	NA	NA	NA

DBSCAN-SWA_6

1338629 : 1355113

Streptococcus_phage(93.75%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002935693.1\|1338629_1338815_+	hypothetical protein	W6LMT3	Streptococcus_phage	2.3e-17	68.9
WP_015647108.1\|1338842_1339490_-	HAD family hydrolase	NA	NA	NA	NA
WP_015647110.1\|1340447_1340657_-	hypothetical protein	A0A1X9I6N3	Streptococcus_phage	9.7e-33	94.2
WP_015647111.1\|1340770_1341223_-	type II toxin-antitoxin system HicB family antitoxin	A0A1X9I727	Streptococcus_phage	1.4e-79	94.7
WP_015647112.1\|1341262_1341445_-	type II toxin-antitoxin system HicA family toxin	A0A1X9I5W4	Streptococcus_phage	9.1e-27	96.7
WP_079266802.1\|1341930_1342095_-	hypothetical protein	B3GW08	Streptococcus_phage	3.2e-07	61.4
WP_015647113.1\|1342184_1342598_-	hypothetical protein	K4JTJ9	Streptococcus_phage	4.4e-29	51.6
WP_024414029.1\|1342615_1342927_-	hypothetical protein	NA	NA	NA	NA
WP_015647114.1\|1342934_1343363_-	hypothetical protein	NA	NA	NA	NA
WP_015647115.1\|1343542_1344142_-	hypothetical protein	NA	NA	NA	NA
WP_105105015.1\|1344223_1344385_-	DUF2292 domain-containing protein	NA	NA	NA	NA
WP_015647117.1\|1344742_1345588_-	ATP-binding protein	A0A1X9I6C4	Streptococcus_phage	5.9e-153	97.9
WP_024414030.1\|1345603_1346398_-	DnaD domain protein	A0A1X9I617	Streptococcus_phage	8.3e-149	99.2
WP_015647119.1\|1346411_1346627_-	hypothetical protein	A0A1X9I5W7	Streptococcus_phage	1.7e-32	98.6
WP_162841001.1\|1346631_1346790_-	hypothetical protein	A0A1X9I5Z1	Streptococcus_phage	4.9e-21	88.5
WP_015647120.1\|1346800_1347067_-	hypothetical protein	A0A1X9I6M4	Streptococcus_phage	1.0e-39	95.5
WP_105105027.1\|1347076_1347262_-	hypothetical protein	A0A1X9I5T6	Streptococcus_phage	1.1e-11	57.8
WP_015647122.1\|1347266_1347560_-	hypothetical protein	A0A1X9I5W5	Streptococcus_phage	3.7e-38	90.0
WP_024414032.1\|1347833_1348040_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_015647123.1\|1348158_1349007_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_187288151.1\|1349658_1351011_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	2.6e-65	51.8
WP_002935704.1\|1351848_1353156_-	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	8.3e-247	100.0
WP_024387228.1\|1353305_1353758_+	DUF1694 domain-containing protein	NA	NA	NA	NA
WP_024414034.1\|1353767_1353995_-	hypothetical protein	NA	NA	NA	NA
WP_015647128.1\|1353985_1355113_-	glycerate kinase	W6LM47	Streptococcus_phage	3.7e-86	57.7

DBSCAN-SWA_7

1993817 : 2009637

Streptococcus_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024414273.1\|1993817_1994282_-\|transposase	IS200/IS605 family transposase	A0A1P8BMC0	Lactococcus_phage	8.3e-16	35.2
WP_024411893.1\|1994876_1995431_-	LysM peptidoglycan-binding domain-containing protein	A0A096XT26	Enterococcus_phage	7.8e-29	48.3
WP_015647573.1\|1995562_1996357_-	energy-coupling factor transporter transmembrane protein EcfT	NA	NA	NA	NA
WP_002938195.1\|1996349_1997192_-	energy-coupling factor transporter ATPase	A0A2H4PQG7	Staphylococcus_phage	8.3e-14	28.0
WP_015647574.1\|1997167_1998004_-	energy-coupling factor transporter ATPase	G9BWD6	Planktothrix_phage	7.4e-23	33.3
WP_014736596.1\|1998000_1998540_-	CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase	NA	NA	NA	NA
WP_015647575.1\|1998559_1999414_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_015647576.1\|1999495_2000779_-	insulinase family protein	A0A2H4UVM3	Bodo_saltans_virus	4.8e-05	26.5
WP_014638852.1\|2000775_2002029_-	insulinase family protein	A0A1X9I714	Streptococcus_phage	7.7e-234	99.8
WP_041179419.1\|2002478_2002799_-	DUF1492 domain-containing protein	NA	NA	NA	NA
WP_041179420.1\|2002830_2003250_-	hypothetical protein	NA	NA	NA	NA
WP_015647578.1\|2003386_2003788_-	hypothetical protein	A0A1X9I622	Streptococcus_phage	1.9e-48	73.4
WP_015647579.1\|2003889_2004339_-	hypothetical protein	NA	NA	NA	NA
WP_015647580.1\|2004770_2006012_-	AAA family ATPase	A0A097BY39	Enterococcus_phage	2.9e-23	26.2
WP_015647581.1\|2006144_2006426_-	hypothetical protein	A0A1X9I5U9	Streptococcus_phage	5.7e-36	81.7
WP_015647582.1\|2006415_2006754_-	hypothetical protein	A0A1X9I5Z6	Streptococcus_phage	3.1e-44	91.3
WP_002936164.1\|2006750_2006900_-	hypothetical protein	A0A1X9I6A8	Streptococcus_phage	6.9e-17	89.6
WP_041179421.1\|2006886_2007102_-	hypothetical protein	NA	NA	NA	NA
WP_015647583.1\|2007314_2007743_-	hypothetical protein	A0A1X9I5T7	Streptococcus_phage	3.9e-68	87.3
WP_015647584.1\|2008055_2008682_-	Rha family transcriptional regulator	A0A192Y918	Salmonella_phage	5.7e-12	29.7
WP_015647585.1\|2008694_2008895_-	transcriptional regulator	NA	NA	NA	NA
WP_024407928.1\|2009103_2009637_+	helix-turn-helix transcriptional regulator	A0A1P8VVN6	Streptococcus_phage	4.4e-13	45.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_021213

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection