CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number
NC_021234	Lactobacillus plantarum subsp. plantarum P-8 plasmid LBPp4, complete sequence	0 crisprs	NA	0	0	3
NC_021228	Lactobacillus plantarum subsp. plantarum P-8 plasmid LBPp6, complete sequence	0 crisprs	NA	0	0	0
NZ_CP010527	Lactobacillus plantarum subsp. plantarum P-8 plasmid LBPp7, complete sequence	0 crisprs	NA	0	0	0
NC_021225	Lactobacillus plantarum subsp. plantarum P-8 plasmid LBPp2, complete sequence	0 crisprs	NA	0	0	0
NC_021233	Lactobacillus plantarum subsp. plantarum P-8 plasmid LBPp1, complete sequence	0 crisprs	NA	0	0	0
NC_021226	Lactobacillus plantarum subsp. plantarum P-8 plasmid LBPp3, complete sequence	0 crisprs	NA	0	0	0
NC_021227	Lactobacillus plantarum subsp. plantarum P-8 plasmid LBPp5, complete sequence	0 crisprs	NA	0	0	0
NC_021224	Lactobacillus plantarum subsp. plantarum P-8, complete sequence	2 crisprs	csa3,DinG,cas3,DEDDh	1	2	8

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 5225

Staphylococcus_phage(100.0%)

transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_128383811.1\|1134_1922_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_015640271.1\|4049_5225_+\|transposase	IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	1.8e-27	29.2

DBSCAN-SWA_2

11587 : 14028

unidentified_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_041142930.1\|11587_12517_-\|transposase	IS30 family transposase	H7BW47	unidentified_phage	1.3e-23	33.7
WP_041142931.1\|12890_13226_-	DUF5388 domain-containing protein	NA	NA	NA	NA
WP_021730693.1\|13218_14028_-	AAA family ATPase	F0PIG8	Enterococcus_phage	1.6e-51	43.8

DBSCAN-SWA_3

20006 : 30033

Staphylococcus_phage(50.0%)

holin,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_041142936.1\|20006_22142_+	type IA DNA topoisomerase	A0A1X9I6W8	Streptococcus_phage	7.3e-107	46.2
WP_015639658.1\|22263_22479_+	hypothetical protein	NA	NA	NA	NA
WP_015639659.1\|22482_23607_+\|transposase	transposase	NA	NA	NA	NA
WP_021353390.1\|23764_23854_-\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_041142937.1\|24040_25240_-	restriction endonuclease subunit S	A0A2H4PQP5	Staphylococcus_phage	3.7e-23	26.6
WP_015639661.1\|25229_26852_-	type I restriction-modification system subunit M	A0A2H4PQP4	Staphylococcus_phage	1.4e-126	49.7
WP_015639662.1\|26865_30033_-	type I restriction endonuclease subunit R	A0A220A398	Liberibacter_phage	3.1e-21	22.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NC_021224

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_021224_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_021224_1

346707-347168

Orphan

Consensus_repeat	Method
AAGTCNNANAAGAANAAN	CRT

12 spacers

The CRISPR arrays of NC_021224_1

>merge|NC_021224|1|346707-347168|CRT
AAGGCGCATAAGAAGAAGGCCGCTAAGAAACATAAGAAGTCGCACAAGAAGTCACACAAGAAGAAAGCGGCCAAGAAACATAAGAAGTCGCACAAGAAGAAAGCGGCCAGGAAACATAAGAAGCCGCACAAGAAGAAGTCTTCTAAGAAGCATGGCAAGTCGCACAAGAAAAAATCTTCGAAGAAGCACGGCAAGTCCAATAAGAAAAAGTCTTCCAAGAAACACGGCAAGTCGCACAAGAAGAAGTCTTCTAAGAAGCACGGCAAGTCCAATAAGAAAAAGTCTTCCAAGAAACATGGCAAGTCCAGTAAGAAGAAGTCTTCCAAGAAACATGGCAAGTCGCACAAGAAGAAATCTTCCAAGAAGCACGGCAAGTCCAATAAGAAGAAATCTTCCAAGAAGCATGGTAAATCCAGTAAGAAGAAATCATCTAAGAAGCACGGCAAGTCTAACAAGAAAAAA

>NC_021224|1|1|346707-347168|CRT
AAGGCGCATAAGAAGAAG	GCCGCTAAGAAACATAAG
AAGTCGCACAAGAAGTCA	CACAAGAAGAAAGCGGCCAAGAAACATAAG
AAGTCGCACAAGAAGAAA	GCGGCCAGGAAACATAAG
AAGCCGCACAAGAAGAAG	TCTTCTAAGAAGCATGGC
AAGTCGCACAAGAAAAAA	TCTTCGAAGAAGCACGGC
AAGTCCAATAAGAAAAAG	TCTTCCAAGAAACACGGC
AAGTCGCACAAGAAGAAG	TCTTCTAAGAAGCACGGC
AAGTCCAATAAGAAAAAG	TCTTCCAAGAAACATGGC
AAGTCCAGTAAGAAGAAG	TCTTCCAAGAAACATGGC
AAGTCGCACAAGAAGAAA	TCTTCCAAGAAGCACGGC
AAGTCCAATAAGAAGAAA	TCTTCCAAGAAGCATGGT
AAATCCAGTAAGAAGAAA	TCATCTAAGAAGCACGGC
AAGTCTAACAAGAAAAAA

Protein	Signature genes	Signature genes Name	Protein_function
NC_021224.2\|WP_003641941.1\|336938_337910_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224050
NC_021224.2\|WP_003643811.1\|351309_351468_-\|two-peptide-bacteriocin-plantaricin-EF-subunit-PlnF	unknown	unknown	unknown
NC_021224.2\|WP_003641945.1\|343160_343883_+\|aquaporin-family-protein	unknown	unknown	gnl\|CDD\|223653
NC_021224.2\|WP_003646473.1\|354090_355467_+\|HlyD-family-secretion-protein	unknown	unknown	gnl\|CDD\|273387
NC_021224.2\|WP_003646470.1\|350437_351211_-\|CPBP-family-intramembrane-metalloprotease	unknown	unknown	gnl\|CDD\|376806
NC_021224.2\|WP_015639929.1\|335411_336938_+\|ABC-transporter-permease/substrate-binding-protein	unknown	unknown	gnl\|CDD\|270328
NC_021224.2\|WP_015639937.1\|348928_350104_-\|IS256-family-transposase	unknown	unknown	gnl\|CDD\|307151
NC_021224.2\|WP_003646476.1\|357068_357749_+\|CPBP-family-intramembrane-metalloprotease	unknown	unknown	gnl\|CDD\|376806
NC_021224.2\|WP_003646475.1\|356313_356982_+\|CPBP-family-intramembrane-metalloprotease	unknown	unknown	gnl\|CDD\|376806
NC_021224.2\|WP_003643768.1\|332926_333838_+\|oxidoreductase	unknown	unknown	gnl\|CDD\|180448
NC_021224.2\|WP_015639939.1\|355556_356246_+\|CPBP-family-intramembrane-metalloprotease	unknown	unknown	gnl\|CDD\|376806
NC_021224.2\|WP_003646444.1\|337987_339319_+\|NAD(P)/FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|224169
NC_021224.2\|WP_003646448.1\|348265_348499_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379738
NC_021224.2\|WP_041142659.1\|357842_358529_+\|CPBP-family-intramembrane-metalloprotease	unknown	unknown	gnl\|CDD\|376806
NC_021224.2\|WP_003643773.1\|339784_341302_+\|glycerol-kinase-GlpK	unknown	unknown	gnl\|CDD\|234594
NC_021224.2\|WP_015639934.1\|344077_346426_+\|MucBP-domain-containing-protein	unknown	unknown	gnl\|CDD\|377660
NC_021224.2\|WP_003646442.1\|334727_335174_-\|ribonuclease-H	unknown	unknown	gnl\|CDD\|178927
NC_021224.2\|WP_003646441.1\|331869_332790_-\|ribonucleoside-hydrolase-RihC	unknown	unknown	gnl\|CDD\|182713
NC_021224.2\|WP_015639932.1\|341316_343146_+\|type-1-glycerol-3-phosphate-oxidase	unknown	unknown	gnl\|CDD\|380303
NC_021224.2\|WP_003646472.1\|351924_354075_+\|peptide-cleavage/export-ABC-transporter	unknown	unknown	gnl\|CDD\|130261

Protein	Function_ID	Function_description	E-value
NC_021224.2\|WP_003641941.1\|336938_337910_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224050	COG1125, OpuBA, ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism].	1.46616e-132
NC_021224.2\|WP_003641945.1\|343160_343883_+\|aquaporin-family-protein	gnl\|CDD\|223653	COG0580, GlpF, Glycerol uptake facilitator and related permeases (Major Intrinsic Protein Family) [Carbohydrate transport and metabolism].	7.59237e-82
NC_021224.2\|WP_003646473.1\|354090_355467_+\|HlyD-family-secretion-protein	gnl\|CDD\|273387	TIGR01000, Mesentericin_Y105_secretion_protein_MesE, bacteriocin secretion accessory protein. This family represents an accessory protein that works with the bacteriocin maturation and ABC transport secretion protein described by TIGR01193. [Transport and binding proteins, Other].	0
NC_021224.2\|WP_003646470.1\|350437_351211_-\|CPBP-family-intramembrane-metalloprotease	gnl\|CDD\|376806	pfam02517, Abi, CAAX protease self-immunity. Members of this family are probably proteases (after a isoprenyl group is attached to the Cys residue in the C-terminal CAAX motif of a protein to attach it to the membrane, the AAX tripeptide being removed by one of the CAAX prenyl proteases). The family contains the CAAX prenyl protease. The proteins contain a highly conserved Glu-Glu motif at the amino end of the alignment. The alignment also contains two histidine residues that may be involved in zinc binding. While they are involved in membrane anchoring of proteins in eukaryotes, little is known about their function in prokaryotes. In some known bacteriocin loci, Abi genes have been found downstream of bacteriocin structural genes where they are probably involved in self-immunity. Investigation of the bacteriocin-like loci in the Gram positive bacteria locus from Lactobacillus sakei 23K confirmed that the bacteriocin-like genes (sak23Kalphabeta) exhibited antimicrobial activity when expressed in a heterologous host and that the associated Abi gene (sak23Ki) conferred immunity against the cognate bacteriocin. Interestingly, the immunity genes from three similar systems conferred a high degree of cross-immunity against each other's bacteriocins, suggesting the recognition of a common receptor. Site-directed mutagenesis demonstrated that the conserved motifs constituting the putative proteolytic active site of the Abi proteins are essential for the immunity function of Sak23Ki - thus a new concept in self-immunity.	8.33506e-10
NC_021224.2\|WP_015639929.1\|335411_336938_+\|ABC-transporter-permease/substrate-binding-protein	gnl\|CDD\|270328	cd13610, PBP2_ChoS, Substrate-binding domain ChoS of an osmoregulated ABC-type transporter and related proteins; type 2 periplasmic-binding protein fold. Osmoprotectant binding lipoprotein ChoS of Lactococcus lactis is predicted to be involved in uptake of compatible solutes such as choline and glycine betaine, but the relative substrate preference is not known. To counteract the efflux of water, microorganisms accumulate the compatible solutes for a sustained adjustment to high osmolarity surroundings. ChoS belongs to the type 2 periplasmic binding fold protein superfamily (PBP2). The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	9.19184e-154
NC_021224.2\|WP_015639937.1\|348928_350104_-\|IS256-family-transposase	gnl\|CDD\|307151	pfam00872, Transposase_mut, Transposase, Mutator family.	4.2946e-108
NC_021224.2\|WP_003646476.1\|357068_357749_+\|CPBP-family-intramembrane-metalloprotease	gnl\|CDD\|376806	pfam02517, Abi, CAAX protease self-immunity. Members of this family are probably proteases (after a isoprenyl group is attached to the Cys residue in the C-terminal CAAX motif of a protein to attach it to the membrane, the AAX tripeptide being removed by one of the CAAX prenyl proteases). The family contains the CAAX prenyl protease. The proteins contain a highly conserved Glu-Glu motif at the amino end of the alignment. The alignment also contains two histidine residues that may be involved in zinc binding. While they are involved in membrane anchoring of proteins in eukaryotes, little is known about their function in prokaryotes. In some known bacteriocin loci, Abi genes have been found downstream of bacteriocin structural genes where they are probably involved in self-immunity. Investigation of the bacteriocin-like loci in the Gram positive bacteria locus from Lactobacillus sakei 23K confirmed that the bacteriocin-like genes (sak23Kalphabeta) exhibited antimicrobial activity when expressed in a heterologous host and that the associated Abi gene (sak23Ki) conferred immunity against the cognate bacteriocin. Interestingly, the immunity genes from three similar systems conferred a high degree of cross-immunity against each other's bacteriocins, suggesting the recognition of a common receptor. Site-directed mutagenesis demonstrated that the conserved motifs constituting the putative proteolytic active site of the Abi proteins are essential for the immunity function of Sak23Ki - thus a new concept in self-immunity.	2.199e-07
NC_021224.2\|WP_003646475.1\|356313_356982_+\|CPBP-family-intramembrane-metalloprotease	gnl\|CDD\|376806	pfam02517, Abi, CAAX protease self-immunity. Members of this family are probably proteases (after a isoprenyl group is attached to the Cys residue in the C-terminal CAAX motif of a protein to attach it to the membrane, the AAX tripeptide being removed by one of the CAAX prenyl proteases). The family contains the CAAX prenyl protease. The proteins contain a highly conserved Glu-Glu motif at the amino end of the alignment. The alignment also contains two histidine residues that may be involved in zinc binding. While they are involved in membrane anchoring of proteins in eukaryotes, little is known about their function in prokaryotes. In some known bacteriocin loci, Abi genes have been found downstream of bacteriocin structural genes where they are probably involved in self-immunity. Investigation of the bacteriocin-like loci in the Gram positive bacteria locus from Lactobacillus sakei 23K confirmed that the bacteriocin-like genes (sak23Kalphabeta) exhibited antimicrobial activity when expressed in a heterologous host and that the associated Abi gene (sak23Ki) conferred immunity against the cognate bacteriocin. Interestingly, the immunity genes from three similar systems conferred a high degree of cross-immunity against each other's bacteriocins, suggesting the recognition of a common receptor. Site-directed mutagenesis demonstrated that the conserved motifs constituting the putative proteolytic active site of the Abi proteins are essential for the immunity function of Sak23Ki - thus a new concept in self-immunity.	1.37399e-12
NC_021224.2\|WP_003643768.1\|332926_333838_+\|oxidoreductase	gnl\|CDD\|180448	PRK06182, PRK06182, short chain dehydrogenase; Validated.	4.43747e-163
NC_021224.2\|WP_015639939.1\|355556_356246_+\|CPBP-family-intramembrane-metalloprotease	gnl\|CDD\|376806	pfam02517, Abi, CAAX protease self-immunity. Members of this family are probably proteases (after a isoprenyl group is attached to the Cys residue in the C-terminal CAAX motif of a protein to attach it to the membrane, the AAX tripeptide being removed by one of the CAAX prenyl proteases). The family contains the CAAX prenyl protease. The proteins contain a highly conserved Glu-Glu motif at the amino end of the alignment. The alignment also contains two histidine residues that may be involved in zinc binding. While they are involved in membrane anchoring of proteins in eukaryotes, little is known about their function in prokaryotes. In some known bacteriocin loci, Abi genes have been found downstream of bacteriocin structural genes where they are probably involved in self-immunity. Investigation of the bacteriocin-like loci in the Gram positive bacteria locus from Lactobacillus sakei 23K confirmed that the bacteriocin-like genes (sak23Kalphabeta) exhibited antimicrobial activity when expressed in a heterologous host and that the associated Abi gene (sak23Ki) conferred immunity against the cognate bacteriocin. Interestingly, the immunity genes from three similar systems conferred a high degree of cross-immunity against each other's bacteriocins, suggesting the recognition of a common receptor. Site-directed mutagenesis demonstrated that the conserved motifs constituting the putative proteolytic active site of the Abi proteins are essential for the immunity function of Sak23Ki - thus a new concept in self-immunity.	2.75346e-10
NC_021224.2\|WP_003646444.1\|337987_339319_+\|NAD(P)/FAD-dependent-oxidoreductase	gnl\|CDD\|224169	COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion].	9.71858e-123
NC_021224.2\|WP_003646448.1\|348265_348499_+\|hypothetical-protein	gnl\|CDD\|379738	pfam15603, Imm74, Immunity protein 74. A predicted immunity protein with an alpha+beta fold. Proteins containing this domain are present in bacterial polymorphic toxin systems as an immediate gene neighbor of the toxin gene, which usually contains toxin domains of the Tox-ARC family. This domain is also found in heterogeneous poly-immunity loci.	2.43472e-10
NC_021224.2\|WP_041142659.1\|357842_358529_+\|CPBP-family-intramembrane-metalloprotease	gnl\|CDD\|376806	pfam02517, Abi, CAAX protease self-immunity. Members of this family are probably proteases (after a isoprenyl group is attached to the Cys residue in the C-terminal CAAX motif of a protein to attach it to the membrane, the AAX tripeptide being removed by one of the CAAX prenyl proteases). The family contains the CAAX prenyl protease. The proteins contain a highly conserved Glu-Glu motif at the amino end of the alignment. The alignment also contains two histidine residues that may be involved in zinc binding. While they are involved in membrane anchoring of proteins in eukaryotes, little is known about their function in prokaryotes. In some known bacteriocin loci, Abi genes have been found downstream of bacteriocin structural genes where they are probably involved in self-immunity. Investigation of the bacteriocin-like loci in the Gram positive bacteria locus from Lactobacillus sakei 23K confirmed that the bacteriocin-like genes (sak23Kalphabeta) exhibited antimicrobial activity when expressed in a heterologous host and that the associated Abi gene (sak23Ki) conferred immunity against the cognate bacteriocin. Interestingly, the immunity genes from three similar systems conferred a high degree of cross-immunity against each other's bacteriocins, suggesting the recognition of a common receptor. Site-directed mutagenesis demonstrated that the conserved motifs constituting the putative proteolytic active site of the Abi proteins are essential for the immunity function of Sak23Ki - thus a new concept in self-immunity.	6.97696e-09
NC_021224.2\|WP_003643773.1\|339784_341302_+\|glycerol-kinase-GlpK	gnl\|CDD\|234594	PRK00047, glpK, glycerol kinase GlpK.	0
NC_021224.2\|WP_015639934.1\|344077_346426_+\|MucBP-domain-containing-protein	gnl\|CDD\|377660	pfam06458, MucBP, MucBP domain. The MucBP (MUCin-Binding Protein) domain is found in a wide variety of bacterial proteins, in several repeats. The domain is found in bacterial peptidoglycan bound proteins and is often found in conjunction with pfam00746 and pfam00560.	6.67113e-10
NC_021224.2\|WP_003646442.1\|334727_335174_-\|ribonuclease-H	gnl\|CDD\|178927	PRK00203, rnhA, ribonuclease H; Reviewed.	0.00017599
NC_021224.2\|WP_003646441.1\|331869_332790_-\|ribonucleoside-hydrolase-RihC	gnl\|CDD\|182713	PRK10768, PRK10768, ribonucleoside hydrolase RihC; Provisional.	0
NC_021224.2\|WP_015639932.1\|341316_343146_+\|type-1-glycerol-3-phosphate-oxidase	gnl\|CDD\|380303	NF033461, glycerol3P_ox_1, type 1 glycerol-3-phosphate oxidase. Glycerol-3-phosphate oxidase, also called alpha-glycerophosphate oxidase (GlpO), is an FAD-dependent enzyme related to the glycerol-3-phosphate dehydrogenase GlpD. Notably, GlpO releases hydrogen peroxide, which can contribute to virulence.	0
NC_021224.2\|WP_003646472.1\|351924_354075_+\|peptide-cleavage/export-ABC-transporter	gnl\|CDD\|130261	TIGR01193, transport/processing_ATP-binding_protein, ABC-type bacteriocin transporter. This model describes ABC-type bacteriocin transporter. The amino terminal domain (pfam03412) processes the N-terminal leader peptide from the bacteriocin while C-terminal domains resemble ABC transporter membrane protein and ATP-binding cassette domain. In general, bacteriocins are agents which are responsible for killing or inhibiting the closely related species or even different strains of the same species. Bacteriocins are usually encoded by bacterial plasmids. Bacteriocins are named after the species and hence in literature one encounters various names e.g., leucocin from Leuconostic geldium; pedicocin from Pedicoccus acidilactici; sakacin from Lactobacillus sake etc. [Protein fate, Protein and peptide secretion and trafficking, Protein fate, Protein modification and repair, Transport and binding proteins, Other].	0

>NC_021224.2|WP_015639934.1|344077_346426_+|MucBP-domain-containing-protein
MTDSTDKVAPDETVKVGYGKAYDVTKQVKTITGYKRNATLDEHTRGTASKTTKEAVMYYDPLPYNIHVNYLLTDGQKLDELDVTGLYGDTYTTEATDFEDLYTVDTDRLPTNAQGTVTEKPTTVNYYYQPTTGQWVDVGNQSSVLVRQDTKHNVRSVSQIYANDSGFTVKYNQDAAQVAIAASDTNGTQDNSLVFDYNSKYTFELSKNETVTFKVDDQGQVTATRVLGAEQTVTTFDKSGQLKTVTTVTNANGTKSQQTNTVDGLKSMVTGEQYDLGLLNGLKVTAQKEINPSQAATTESKTTTDTSQSGSNQSTSTTATDQTETNESTAGSSTNATNASSSVDASSANSQGDTEATSQSGTSASADSKTDSSAASSTSQTTDGETTNTDDTTTGTTTDSGLGFKSPFTEDQNTSSALGSAQTSSSLNSDTSAAVQALIAEPNSTPVVLGEDASFEEGVPVNDPVFSNDEGVSPNNNPSSAATPLAQATNTRARLTQNGKLLYEGTLQADQGEQNLYVSPDTTVEVDGGADGDGFYLDTYDGDKGMAYTLGSGYAWAAENNDVTAAPASSATTSSESAASESSTNSSDSSRTASSAADHSTSSASISDASQSSHSTSSSENSRLESSSSSSTTGDSADADKQAAARSSQTQSNSVNGSSQAVGSSTVTSQSSVPTKANTKQASSTPTTKANRATVVAATSSTAPRQSRATTASASVPSVTSASAAAASRAKQRSAFKKQHPILNQILPKTNSAVATWLVWLGVGLLILTVAITMVIKKRGRD
>NC_021224.2|WP_003641945.1|343160_343883_+|aquaporin-family-protein
MMKDPLALQLLGEFLGTFILILLGDGVVAGVTLNKSKAQNAGWVAITLGWGFAVTMGVYASSFMSPAHLNPAVSLGMAVAGKFPWAYVIPYSAAQIAGGVIGGLVVWLHYYPHWQATKDAGAILGIFATGPGIRRYFWNFISEVIGTFVLVFGLLAFTKGQFTAGLNPIVVGILIIAIGLSLGGTTGYAINPARDLGPRIAHAVLPIANKGTSDWAYSWVPIAGPLVGGALGALLFNVLP
>NC_021224.2|WP_015639932.1|341316_343146_+|type-1-glycerol-3-phosphate-oxidase
MAFSATTRQQNIERLQNETLDLLVIGGGITGAGVAIQSTAMNMKTGLIDMQDFAEGTSSRSTKLVHGGIRYLKTFDVGVVADTVKERAVVQGIAPHIPKPDPMLLPIYDETGATFDLFSVKVAMDLYDKLAEVKDPKFTNYTLSREEVLQREPQLNPKHLVGGGVYLDFRNNDARLVIENIKKAHENGGIMASHVKATGLLHDDDGRINGITAEDLLTGASFEIHARIVINTTGPWSDKIRKMDHTEKYQSQMRPTKGVHLVVDAEKLPVPQPTYFDSGDQDGRMIFVVPRENKTYFGTTDTDYHGDLKHPTVTQEDVDYLLEIVNRRFPTAKITLDDIEASWAGLRPLIAANGSSDYNGGNSGKISDKSFKEVIKVVDQFESQEASREDVESVLNDLETSLAEDKLSPSAVSRGSSLTSSPDGLLTLAGGKITDYRKMAAGAMALIAKILADKYDAHFNEINSKNLPVSGGDIDPHNVDATIAFYAKQGTDNGLTNDEALRIANMYGSNAARVFSLIGKVEPTHGLSLAETISLRYALDEEMTLTPVDYLLRRTNHLLFMRDTLDGLKDGVIATMADYLGWDAATVKAQTELLNQTIAESDLTALKQG
>NC_021224.2|WP_003643773.1|339784_341302_+|glycerol-kinase-GlpK
MTDKYIMAIDEGTTSTRAIIFDHAGHKVADSQREFPQYFPQPGWVEHNANEIWNAVLSTIANAFIESGIKPAQISGIGITNQRETTIVWDKQTGLPIYNAIVWQSRQTAPIAEKLVKDGYGDLIHQHTGLVTDAYFSATKIRWILDHVKGAQERAEKGELLFGTIDTWLLWKLTGGATHVTDYSNASRTMLFNIHDLKWDDQILQLLNIPAAMLPEVRTNSEVYGKTKDYHFFGSEVPISGMAGDQQAALFGQLAFEPGTVKNTYGTGAFIVMNTGEKPQLSDNNLLTTIGYGINGKVYYALEGSIFVAGSAIQWLRDGIRLVESAPDSERAARESHNENEVYVVPAFTGLGAPYWDSEARGSVFGLTRGTTREDFIKATLQALAYQTRDVVETMKKDSGIEIPVLKVDGGAARNDWLMQFQADILDTQIMRAANLETTALGAAFLAGLSVGYWQDLEELKASYKPGTSFDPEMGPAERTNLYEGWQAAVKATQVFKHTPYHAGK
>NC_021224.2|WP_003646444.1|337987_339319_+|NAD(P)/FAD-dependent-oxidoreductase
MAEQYDVVVIGGGPAGNAMASGLKAQGKTVLIVEADLWGGTCPNRGCDPKKILLSAVEARQAAQHLQGQGLIGAPKIDWPALMAHKRGYTDGINDGTLNGLTGQDIATLHGQAHFQSDNQLAVGDRVVSATDYVIATGQRPAILPITGHEYFKTSTDFLDLDQMPKRVTFVGGGYVGFELATIANAAGADVHVIHHNDRPLKAFDADLVKDLMAAMTADGITFDLNTDVQAITKTATGLQLTADNFELTTDLVISSAGRIPNADQLGLANVGVTFDRHGIQVNDHLQTANPHIYAIGDVSDTPVPKLTPVAGFEARYLVGELTHPGAAIKYPVVPTQVFAAPKLAQVGISAAVATEHPDEYRVNTLDMTKWFTYYRFGAQQAQAKVVVAKASGQVVGATLLSDVADEMINYFTLLIEKHVTLPDLQRLVLAYPTPASDLQYLY
>NC_021224.2|WP_003641941.1|336938_337910_+|ABC-transporter-ATP-binding-protein
MTTAIEFQHVQKDFNGQTVIPDLNLTIDQGELFVLVGTSGSGKTTSLKMINCLEPLTAGKILVNGTDTTTIPVRSLRWQMGYVLQQIALFPTMTVAQNIAVIPEMKGTAKKEINQTIDELLAEVGLDPKEYRDRMPSELSGGEQQRIGILRAIAAQPDIVLMDEPFSALDPISRQQLQDLVLRLHARYHNTIVFVTHDMNEALKLGDRIGVMQHGQLIQVDTPAALAQHPVNDFVRNFFGASRAKNVYDVYVGRVGLIQGYLTEEPSVASGRIQSLDVQATLRTAFTALTDHDYVAVTEENRVVGYLDRQRIVAYLSQHEEVS
>NC_021224.2|WP_015639929.1|335411_336938_+|ABC-transporter-permease/substrate-binding-protein
MQTLIQTFMDRRGDLLTALWQHLGISLASLVIAMVIAIPLAIWVVRRPRWAEGLLQLTSVLQTIPSLALLGLLIPLVGIGTVPAVIALVIYALLPIFQNTYLGISEIDASIEEAADAFGMSRMRKLFKVELPIALPQIIAGIRTALVLIIGTATLAALIGAGGLGTFIMLGIDRNDTSLLLIGAISSALLAILLSALVRWFQTAKPRHALIVFVGILALLGGGGAYSVYANRVETIRIAGKLGSEPEILINMYKQLIEAEDEHVHVTLKPNFGKTTFLFSALKNNQVDIYPEFTGSVLETLVKGNNPAGQTANQTYQLAKQRLAKQEQMTYLKPMQYNNTYALAVTKKFQQEHHLKTISDLTQVESILKPGMTLEFIDRNDGLKGIKKTYGLDVTAKSMEPALRYEAISKGKINLVDAYATDSELRQYHLALLKDNKHFFPTYQGAPLMKTNFANKHPKVVKALNKLAGKISETDMQEMNYEVNVKKQSASTVAHRYLVKHGLLKEGR
>NC_021224.2|WP_003646442.1|334727_335174_-|ribonuclease-H
MATIHLYLASTNHQSTNITATTPAAWVVILRYADHQKALNDGGYGHTETSLALSALTTALATLKRHDLPVHVHTTTEQVAAVISEQRYLSWRQNNWDVPEADQPDLPQWQTLIPIIEEFPNLTITYHPVDDPAMTTATTTLTAVMTKL
>NC_021224.2|WP_003643768.1|332926_333838_+|oxidoreductase
MSQPRVILITGASSGIGKATALKLQAQGNIVYGAARRIEKMTDLAAAGVHVLKVDVTDEATLIAAVKTIQVEQGRIDVLINNAGYGSYGSLEDVPVAEGEYQFKVNVFGVMRLTQLVLPLMRAQHRGRIINVSSIGGKIYQPLSAWYMGTKHAIEGMSDSLRMEVAPFGIDVVIVEPGGIKTEWAGIAEKKLLAVSGETAYHEQAVKVGAMLSLFDQFASNPGVIAKLMVRAVNDVKPKTRYHAGMGAGVSLTARQWLSDRQFDRMMNSAVNGAAKLSKVTRRKDRRTGSRHYRHGKIPADNN
>NC_021224.2|WP_003646441.1|331869_332790_-|ribonucleoside-hydrolase-RihC
MSTKIIMDTDPGIDDAAAITFALNHPDLDLQLITTVAGNVTVDKTTLNALKLTRFFNSDVPVAGGAAQPLIKPFEDAVRIHGVSGMPGYDFPTDLAEPLPETAVEALRDYIMAAEQPITLVPTGAYTNIALLFKTYPEVMPHIKEIVAMGGALGKGNMTSAAEFNVFTDPHAAEIMYQSGVPITMVGLDVTMKALLTRESIEQLPTLGKTGEMLHALFGHYNDRNQTGVAMHDVNTLFYLLHPEAFTTEKMWIDVQTEGPANGETVGDIRGAYHDGKTNATVCVDIDAAAFNKWFLETVAAIDQPK
>NC_021224.2|WP_003646448.1|348265_348499_+|hypothetical-protein
MKITGSSSHVKFDLENEYAVKAEGEMLVGGQFVVFKDSMKNWEPPHEDEKLSEAEVQEIIQQVKQNTNENTVQISFE
>NC_021224.2|WP_015639937.1|348928_350104_-|IS256-family-transposase
MNELTTEIIAALAQKQDLDEVFRHHLEIAINQLLQTELAEFLGYERYSYAGINTGNNRNGSYERSFDTKYGQLNLTIPRDRNGRFENHTLPAYGRHSDNLETTVIQLSTKGITTAEIAELIEKMYGAHYSKATVSNMTKAVNEQVQAFQQRRLASQYAAIFLDATYLPLKRDTVQKEAVHIAIGIRPDGTKEVLNYQVAPTESTGIWTELLGTLIKQGVKDVLLFVADGLVGLDEGLNRHFPKAKRQRCLVHVGRNLMNKVRVKDRKAVISDFKQVHRAANREAAELKLNEFANNWHQTYPKLIKDLLKMPNLLTFMDFPPAIRQSLYSTNLIENFNKHLKRTTHHKEQFPTEDSLDRFLVSQFNVYNEKSLKRIHRGFQGLQDTLEASFI
>NC_021224.2|WP_003646470.1|350437_351211_-|CPBP-family-intramembrane-metalloprotease
MPLIKVIITAIYYLIVLFLMNPLTDIMGIKDGPFQFILTESIILIAIIILNRRYVKQPIHWLPVNIMSILKKNSLPLSLAIIFLLIFFRNHMYQFLISLLLSLIVAITEEYAFRGMIFRTLLALNLKKFATLQATIASMMTASLIFAAMHLVNLLSQPVWSVLCQVLYVIGLGILLAAIYLKTGSLLAAISVHWLIDFSSFYSQGIDPTQSPINGPMEALLKGLFLNILFIGIATFILSSKHWKLLSILNIEDKIDE
>NC_021224.2|WP_003643811.1|351309_351468_-|two-peptide-bacteriocin-plantaricin-EF-subunit-PlnF
MKKFLVLRDRELNAISGGVFHAYSARGVRNNYKSAVGPADWVISAVRGFIHG
>NC_021224.2|WP_003646472.1|351924_354075_+|peptide-cleavage/export-ABC-transporter
MHWRNYVAQVDEMDCGVAALAMILKNYGSTTSLAYLRNIAKTSLEGTTALGLVKTAEKLGFETKAIQADMSLFDVQDLPLPFIVHVTKNGDLQHFYVVVKTSKTHVVIADPDPTVAVISMSKERFESEWSGVALFFAPKSEYKPVKQDKGSLWGFIPSLLKQRRLVINIVLAAVLITIISICGSYFLQAVIDTYIPNNMHSTLAVVAIGLIVFYTFQAIFTYAQNFLLAVLGQRLSIEIILGYIRHVFELPMSFFATRRTGEIVSRFTDASKIIDALASTIVSLFLDVSIVIIMGAILVIQNMTLFWITLLSLPIYAVVILAFNKSFERLNQKEMESNAILSSAIIEDLHGIETVKALNGETERYQKIDSEFVDYLRKSLAYLKADTLQQALKLFIQLVLEVVVLWVGANLVIHNQLSVGELMTYNALLAYFVNPLQNIINLQTKLQSAKVANNRLNEVYLVASEFEASRPIHNESQLNGDIKLQGVSYRYGYGENVLDDVNLTIRQHDKVAIVGMSGSGKSTLVKLLIDFYQPNSGDVILNGFNVKNIDKHTLRTHINYIPQEPYIFSATIEENLRLGNRSGITEKDIAKACQLALIDTDINKMVMQYQTKLDENGNTLSGGQRQRLTIARALLSPAQVLIFDESTSGLDAITEKQLIDNLVAMTDKTIIFIAHRLSIAKRTNHIIVLHDGRVAEEGTHAALLNEHGYYYDLINS
>NC_021224.2|WP_003646473.1|354090_355467_+|HlyD-family-secretion-protein
MRKDLLESGEFYGIRFQNFSTLLIIPVTLLLMGTILFSLVAKREIVINGTGTVQPTGTVPVIQATVNSAIKKNYLVEGARVKKGQNLLVYTNVFNRNKLREDNVSKRQLQRQVTALDHFKDGINTDSDVFPTTDEFGYRELLQSYLKQRQIYLTENQMLAAKSSAASTKKATLTKTAQQVVSNTKTNLDAYQALYNAVANGSKYANSAKYGSVFNEYVAKSKEANNANDKKEVKSATLADIQQQIDTLQDSLSSAKVQLEELQGFDDTKYSVETNNTKLAMLKNDQLSEVAEKRMKAEQDLRTVKADIDSLTTQSKSYTIKATKTGVLHVADNYRGAKYVSSGAEIAKILPIIKQQRRVNVKLYISTADISSVKVKQAIRFKVTRNVPKPIILDGVVTKIGVSPVEESKATFYEVTAAVPITADQAQLLRYGMIGQTAIITGKVTWFDYYKDKVLDNN
>NC_021224.2|WP_015639939.1|355556_356246_+|CPBP-family-intramembrane-metalloprotease
MAHSNKQFIINLVIASLISLALVSFSMAPAYLFLIKNNWFMITIGFVIYALEAWGLYWLYWHTARIRHYQVATLKSRVNIAQLGTVIIAMLTMVVLIIVDLKLSAMLNIPETSNSRSLAWMLGEAPLPMIVSVVIFSPICEELIFRGIFFSYALTNQYNHRNYQMIAVVINSLIFASVHVDANWEPWIYYTLMGGILGTTYLLAKRDIRMNILVHMGTNLAVFALAAMS
>NC_021224.2|WP_003646475.1|356313_356982_+|CPBP-family-intramembrane-metalloprotease
MVARLIRVFGYVLAGLGLFIFIQLPVLADGYWNWWGERPQQINVGYHWGALVVLTVGVAVVLVRCYHHYFEMPVLLGYFSWSMMGLTALVAVVVVVIQMGISGLLVSPTETQNDEIMALIHSPLGLLTLVCTNIVSPVLEELLFRGIVQNTLRRYLPVLGAIMLTNAVFALGHGYQLASTVGIFITGCGFSWLVLKTKQLSTAMGCHILVNWLVTLINMMWG
>NC_021224.2|WP_003646476.1|357068_357749_+|CPBP-family-intramembrane-metalloprotease
MVHQNVKFIGRLLLASLLAAIVMGLSTAPIDILTLKYNWITVAIFLVVYLFAIYLFYRIYLESVTNNHFKITKIVAKPSARQLVITVLAMVVMLILAAVQVKFVSDAVYPIAENVADLQALSQRSPILMALALGVFAPICEELIIRGNFFSYALAERFDQPRYQLVTVIVNGVLFGLLRGGFSWVQLSYYTVMGLVLAATYILSGRDIRVNSVVHVTANLGLMLMA
>NC_021224.2|WP_041142659.1|357842_358529_+|CPBP-family-intramembrane-metalloprotease
MLQKNLRFIGNLLIVSVLSVIIVNISSLPVYIYLITANWFTLLVSFSLYAVIIVFLYNIYKTTAELRQFDFRPWRTRLNKRALLFMMIGAVIIVALAFGYAKLTAVWRITESGNERSLDLLLRKNPVAMTLDAVIFGPIAEELSFRGFFFSYVLSDQYLDREYQAATIVINGLLFGYLHSGNSLVPLAYYTLFGMVLGTIYLLSKHDIRVNSVTHMLANLGILWLVPS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_021224_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_021224_2

2625985-2626115

Orphan

Consensus_repeat	Method
CAACCGAGCCCGGCACCTCAACC	CRISPRCasFinder

2 spacers

The CRISPR arrays of NC_021224_2

>merge|NC_021224|2|2625985-2626115|CRISPRCasFinder
CAGCCGACACCAGCACCTCAGCCTGAACCAACGCTGCAACCGAGTCCTACACCTCAACCGAGCCCGGCACCTCAACCAAACCCAGCGCCACAACCAAACCCGGCGCCGCAACCGAGCCCGGCACCTCAACC

>NC_021224|2|1|2625985-2626115|CRISPRCasFinder
CAGCCGACACCAGCACCTCAGCC	TGAACCAACGCTGCAACCGAGTCCTACACCT
CAACCGAGCCCGGCACCTCAACC	AAACCCAGCGCCACAACCAAACCCGGCGCCG
CAACCGAGCCCGGCACCTCAACC

Protein	Signature genes	Signature genes Name	Protein_function
NC_021224.2\|WP_086989537.1\|2610869_2611645_-\|IS5-like-element-ISLpl3-family-transposase	unknown	unknown	gnl\|CDD\|379129
NC_021224.2\|WP_003645359.1\|2620876_2622358_+\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|180854
NC_021224.2\|WP_015380951.1\|2613935_2614598_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NC_021224.2\|WP_003645357.1\|2628010_2629444_-\|6-phospho-beta-glucosidase	unknown	unknown	gnl\|CDD\|181973
NC_021224.2\|WP_003645363.1\|2614594_2616382_+\|elongation-factor-4	unknown	unknown	gnl\|CDD\|235462
NC_021224.2\|WP_003587210.1\|2626640_2627108_+\|DNA-starvation/stationary-phase-protection-protein	unknown	unknown	gnl\|CDD\|153102
NC_021224.2\|WP_003645361.1\|2618818_2619643_-\|NAD(+)-diphosphatase	unknown	unknown	gnl\|CDD\|234699
NC_021224.2\|WP_003643417.1\|2630884_2631382_-\|hypothetical-protein	unknown	unknown	unknown
NC_021224.2\|WP_015640988.1\|2632771_2634037_+\|DUF805-domain-containing-protein	unknown	unknown	gnl\|CDD\|377540
NC_021224.2\|WP_003643416.1\|2629504_2630863_-\|PTS-cellobiose-transporter-subunit-IIC	unknown	unknown	gnl\|CDD\|181976
NC_021224.2\|WP_015640979.1\|2610131_2610698_-\|DUF1211-domain-containing-protein	unknown	unknown	gnl\|CDD\|226078
NC_021224.2\|WP_041142820.1\|2619797_2620706_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223656
NC_021224.2\|WP_015640981.1\|2616915_2618517_-\|cation:proton-antiporter	unknown	unknown	gnl\|CDD\|223104
NC_021224.2\|WP_003643422.1\|2634349_2634625_-\|DUF3781-domain-containing-protein	unknown	unknown	gnl\|CDD\|378895
NC_021224.2\|WP_003645351.1\|2634733_2635321_+\|glutamine-amidotransferase	unknown	unknown	gnl\|CDD\|153234
NC_021224.2\|WP_041142822.1\|2627205_2627931_-\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225099
NC_021224.2\|WP_003645369.1\|2608252_2608819_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NC_021224.2\|WP_041142823.1\|2631985_2632354_+\|YxeA-family-protein	unknown	unknown	gnl\|CDD\|377665
NC_021224.2\|WP_003645350.1\|2635699_2635960_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224647
NC_021224.2\|WP_003642344.1\|2608945_2609983_+\|aldehyde-reductase	unknown	unknown	gnl\|CDD\|187538

Protein	Function_ID	Function_description	E-value
NC_021224.2\|WP_086989537.1\|2610869_2611645_-\|IS5-like-element-ISLpl3-family-transposase	gnl\|CDD\|379129	pfam13340, DUF4096, Putative transposase of IS4/5 family (DUF4096).	1.14622e-32
NC_021224.2\|WP_003645359.1\|2620876_2622358_+\|FAD-dependent-oxidoreductase	gnl\|CDD\|180854	PRK07121, PRK07121, FAD-binding protein.	2.33843e-65
NC_021224.2\|WP_015380951.1\|2613935_2614598_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	5.47313e-12
NC_021224.2\|WP_003645357.1\|2628010_2629444_-\|6-phospho-beta-glucosidase	gnl\|CDD\|181973	PRK09589, celA, 6-phospho-beta-glucosidase; Reviewed.	0
NC_021224.2\|WP_003645363.1\|2614594_2616382_+\|elongation-factor-4	gnl\|CDD\|235462	PRK05433, PRK05433, GTP-binding protein LepA; Provisional.	0
NC_021224.2\|WP_003587210.1\|2626640_2627108_+\|DNA-starvation/stationary-phase-protection-protein	gnl\|CDD\|153102	cd01043, DPS, DPS protein, ferritin-like diiron-binding domain. DPS (DNA Protecting protein under Starved conditions) domain is a member of a broad superfamily of ferritin-like diiron-carboxylate proteins. Some DPS proteins nonspecifically bind DNA, protecting it from cleavage caused by reactive oxygen species such as the hydroxyl radicals produced during oxidation of Fe(II) by hydrogen peroxide. These proteins assemble into dodecameric structures, some form DPS-DNA co-crystalline complexes, and possess iron and H2O2 detoxification capabilities. Expression of DPS is induced by oxidative or nutritional stress, including metal ion starvation. Members of the DPS family are homopolymers formed by 12 four-helix bundle subunits that assemble with 23 symmetry into a hollow shell. The DPS ferroxidase site is unusual in that it is not located in a four-helix bundle as in ferritin, but is shared by 2-fold symmetry-related subunits providing the iron ligands. Many DPS sequences (e.g., E. coli) display an N-terminal extension of variable length that contains two or three positively charged lysine residues that extends into the solvent and is thought to play an important role in the stabilization of the complex with DNA. DPS Listeria Flp, Bacillus anthracis Dlp-1 and Dlp-2, and Helicobacter pylori HP-NAP which lack the N-terminal extension, do not bind DNA. DPS proteins from Helicobacter pylori, Treponema pallidum, and Borrelia burgdorferi are highly immunogenic.	5.65789e-47
NC_021224.2\|WP_003645361.1\|2618818_2619643_-\|NAD(+)-diphosphatase	gnl\|CDD\|234699	PRK00241, nudC, NAD(+) diphosphatase.	2.21998e-55
NC_021224.2\|WP_015640988.1\|2632771_2634037_+\|DUF805-domain-containing-protein	gnl\|CDD\|377540	pfam05656, DUF805, Protein of unknown function (DUF805). This family consists of several bacterial proteins of unknown function.	1.29749e-24
NC_021224.2\|WP_003643416.1\|2629504_2630863_-\|PTS-cellobiose-transporter-subunit-IIC	gnl\|CDD\|181976	PRK09592, celD, PTS cellobiose transporter subunit IIC.	0
NC_021224.2\|WP_015640979.1\|2610131_2610698_-\|DUF1211-domain-containing-protein	gnl\|CDD\|226078	COG3548, COG3548, Predicted integral membrane protein [Function unknown].	6.30859e-29
NC_021224.2\|WP_041142820.1\|2619797_2620706_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|223656	COG0583, LysR, Transcriptional regulator [Transcription].	2.53308e-30
NC_021224.2\|WP_015640981.1\|2616915_2618517_-\|cation:proton-antiporter	gnl\|CDD\|223104	COG0025, NhaP, NhaP-type Na+/H+ and K+/H+ antiporters [Inorganic ion transport and metabolism].	5.5706e-41
NC_021224.2\|WP_003643422.1\|2634349_2634625_-\|DUF3781-domain-containing-protein	gnl\|CDD\|378895	pfam12636, DUF3781, Protein of unknown function (DUF3781). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria and archaea. Proteins in this family are typically between 82 and 98 amino acids in length. There are two conserved sequence motifs: GKNWY and ITA.	2.535e-18
NC_021224.2\|WP_003645351.1\|2634733_2635321_+\|glutamine-amidotransferase	gnl\|CDD\|153234	cd03140, GATase1_PfpI_3, Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus. Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus. PfpI is an ATP-independent intracellular proteases which may hydrolyze small peptides to provide a nutritional source. Only Cys of the catalytic triad typical of GATase1 domains is conserved in this group. This Cys residue is found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow.	4.61662e-73
NC_021224.2\|WP_041142822.1\|2627205_2627931_-\|GntR-family-transcriptional-regulator	gnl\|CDD\|225099	COG2188, PhnF, Transcriptional regulators [Transcription].	9.60352e-40
NC_021224.2\|WP_003645369.1\|2608252_2608819_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	2.749e-05
NC_021224.2\|WP_041142823.1\|2631985_2632354_+\|YxeA-family-protein	gnl\|CDD\|377665	pfam06486, DUF1093, Protein of unknown function (DUF1093). This family consists of several hypothetical bacterial proteins of unknown function.	3.84968e-23
NC_021224.2\|WP_003645350.1\|2635699_2635960_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|224647	COG1733, COG1733, Predicted transcriptional regulators [Transcription].	1.10317e-21
NC_021224.2\|WP_003642344.1\|2608945_2609983_+\|aldehyde-reductase	gnl\|CDD\|187538	cd05227, AR_SDR_e, aldehyde reductase, extended (e) SDRs. This subgroup contains aldehyde reductase of the extended SDR-type and related proteins. Aldehyde reductase I (aka carbonyl reductase) is an NADP-binding SDR; it has an NADP-binding motif consensus that is slightly different from the canonical SDR form and lacks the Asn of the extended SDR active site tetrad. Aldehyde reductase I catalyzes the NADP-dependent reduction of ethyl 4-chloro-3-oxobutanoate to ethyl (R)-4-chloro-3-hydroxybutanoate. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	7.62333e-95

>NC_021224.2|WP_003645359.1|2620876_2622358_+|FAD-dependent-oxidoreductase
MTLAKHDSYDIVVVGTGAAGTAASLEAAQHGASVLLLEKGRHTGGSSNYTEGLFAIDSYLQKAQNINVSATDVLKEEVDYSKYRADSRIWRRYLDDSANTVQWLKDQGVEYEGVQAMGAGEATWHIYKGMGQAVLHDALQPQAQKLGVELLTSTTATTLHQATDGAITGVTIQSAATNETQVINTAAVILATGGYLNNPDMMKKLTHYDTHRLIPVSSGKGTGDGLRLAWQAGAQQYGTGMAMLFGGYLKDPSEPSFKYMASQMETAAGQQPLLWLNEHGERFVDEAVVYNFSYAGNALYTQNQVFSILDQGVINKMAQDGNFMGLGVYVRRGEKMTKLQAEIDAAVAANKPFIFKADTIEALATKMHLPVDQVTHSIQTYNQYCDNGQDDDFGKNPEYLVKVSQGPFYGFELNVGAFCTMGGLKVTTNNEVLDTTGQPITGLYAAGSDAAGLTGDTYGPNMPGTCVGYAFYSGRNSGRHAAQYTHQQSIVSH
>NC_021224.2|WP_041142820.1|2619797_2620706_-|LysR-family-transcriptional-regulator
MDLDRLQTFLKVVQYGSFQQVAAREYRSQRTVSKQMTQLENELKVTLFDRGQNRIQLTPQGRLFWASAQDIVNNYMTALTELRQFNVPTDQILRVGYFSAFEQRLLLPALYDLKQQHSELQLVVRQGSNEHLAQQVADGSLDLALSINYGRPAVTPESQLTAVPIYHNQMVIGVRRLNPLSRLSQLPPSALATLPILYYSPESSTFLLESFLASDPFIQNYEQIRRVPSAEQMHLLVALNQALAFYPAGLVPTEHDEQVAYLPITDAAQQGYDIVALLKSNRSRPLIAKLVQRLKANAKSDE
>NC_021224.2|WP_003645361.1|2618818_2619643_-|NAD(+)-diphosphatase
MFQDIQPHVLKNQNDQQRAPRSGDYILIGRQQQVLLMNGTLPKYEDIDADYAFSPDQYQYLLAVDQAAFFWVDVDAVANDNYTVGTTQGFRDLTPAWLAFSSATAAHLAWWYDTKRFCGHCGQPLHPGATERSLVCAACGQTIYPTIMPAIIVGVTNGDKILMTKFLSGYNHFSLISGYTEIGETFEDTVRREVFEEVGLEVHNIRYFGSQPWAPSHSLLAGYFADLNENVAIELETDELSKAQWFQRDQIPHNDTNTSLTWTMIEAFRHHQEK
>NC_021224.2|WP_015640981.1|2616915_2618517_-|cation:proton-antiporter
MALLISTGVLVVAAMVSIVINRRWLPRLSVNYVSMFIGAGIAVIPFLNGLIEKFNSDIFIGLIVAPLLYFEGQNTRLNLVGRHVREIVSLTVGMVILCAVMAGLGTSLLAGVGLPLAFILAAISTPTDATATESVTMGRVLPQREQTSLKLESLFNDASGIILLNMAILWYVNGYINYSQTLWDFVYAAGGGIAFGGLVSGLIVYIRQLMLRSKLNFINNTYNNGTPLKVIYLMTPFVLYFGAEALGVSGIIAVVFAGLVHNAEGERSALANPQLASDIYQLIGLLSDILNSVVFIVLGIMLLRTALDHSVSYNGSLIWIVIGVILYVANLLARYGYVRLIHHVSNREAWVFALGGIHGAVTFALAFTVAETQVKTTDFNLVLMSESLLIILSLLVPTIVFRWLLPKIKTDTDGAAKMAVIREQMIEAGVYDLWQMPISQEFKAAVTFDLRSQNGHTTVRQFISEWRRMVQHPEYTADEMRELMVIYRQVFQTERDYLQRQYDATHAISEDLFNRLYHEITMAEMVVLEYGVK
>NC_021224.2|WP_003645363.1|2614594_2616382_+|elongation-factor-4
MKQSHIRNFAIIAHIDHGKSTLADQIMALTQTVSAREQHAQLLDNMTVEQAHGVTVKARTVRNYYQADDGQEYEYNLIDTPGHVDFNYEVAKSLAATEGAILLVDATQGVQAQTIANYRIAKQRQLTLIPVLNKVDLPSADIDAALAQLRDLDSAFTPEQVLQISAKTGQGVPAVLEAIKQRLPAPQGDLHQPLKALVFDSLYDPYQGVIAYVRLIDGQLKSQQSLRLMQGQQDFNGKAIGVFAPQMHPQESLSAGDVGYVVTGIKDPRKVRVGDTLTSVATPTQWPLAGYQPAKSMVFAGLYPKNNDYPALKEAVQKLNLNDPSFTYVEERSEALGVGFRCGFLGTFHLQIIRERLHDEYGVDVLTTAPNVTYHVTLTNGQQMIVNNPVQFPAFSLIKEVTEPFMKAEITMPADNLNAVLKLAEQHKGTLIDLANSGDLIVASLKIPLSEIAYHFFSELKSVSHGFASLSTAFMANEVSDLVKVEVDINYAPVDALTFIVHREDAPNMTQQLVANLKTTVPRQLYPTPVQARVEGKVIARVDVPPLRKNAAVNGEQHSTSKKAALLRRQSANKRRASKNTIKLPQSVFNAILSL
>NC_021224.2|WP_015380951.1|2613935_2614598_+|TetR/AcrR-family-transcriptional-regulator
MANIYTPSQKAAKRQAIMTAAINLFAHRSYPEITMQQIAEAVGSSKGATFRYFTTKEDLFMTILLEDYQQYFTQLTTDLAQQPPLSADDFIAWMTTQTRQLIEEHSVLIRLNAIRGPILEGKANMQETITQREALYRASQRLGQQLVIQTDHLLDQSQFSHLFIIQSGIISGLMNMAALTSFNHHKLSVDYPDFEIRLIPEAQQQIRYYLTQYLKEFSHK
>NC_021224.2|WP_086989537.1|2610869_2611645_-|IS5-like-element-ISLpl3-family-transposase
MTTPKRYELEDAQWDRIKGYFPPYRTGRPSSLDNRTALNAILWLMRSGAPWRDLPERYGSWKTVYSRFRAWVSSGLFEQVFLELIDDPDMENLSLDSTIVRAHQKATGGKKNAECMVENQAIGLSRGGRTTKIHALVDGLGNPLGFRLTGGQVHDSQVASELLEGFDISQSNIIADKAYGTAKLRQYIEDKAGVYTIPPKENTKDKWTCDYHVYCERHLIENFFNQLKNFRRIATRYDKLAHVYLATVYIASICILLK
>NC_021224.2|WP_015640979.1|2610131_2610698_-|DUF1211-domain-containing-protein
MNKARLEAFTDAIIAIVLTLLVLDLPRPQTPSVRALFAEWQSIYVYIITFTLLISIWLNHHDLFVQVKKIDRVVFWANSFWLLCQSFIPFMASWITKFPHSKWPAVFYILTGFVWMLAYQLLVAAVRRLNPHIHRMSSPALSVVFGGFLVVLTVALINPDVGLFLIPVHAFVSVILATKRKWHLRKYF
>NC_021224.2|WP_003642344.1|2608945_2609983_+|aldehyde-reductase
MQKQLVVVTGGSGFIAIHIIRQLLQQGYAVRTTVRSLAKAPVIKEMLTNGGITDLSALEIVVADLAHDEHWSEAMAGATYAIDVASPTPKLNFKNKAEMIRPAVDGVRRVLTASRDAGVKRVVLTSAYGAIFAGHKNRTTPYTEADWSDLNWKAIHPYQESKTRAELAAWDFINHEGRGLELTTVNPVAVMGPVLSAKYSHSNIQIQQFLEGQVKAVPNVDSGYVDVRDVASLHLLAMTAPQANGERFLATTGETLSMLDVANVLRQAFPAFASQLPTKTIPNAAVKLAAKARPELRMVASLVGTYAETSNHKAQTLLDWHPRPAAESIIATAQSMIDLGIVTKP
>NC_021224.2|WP_003645369.1|2608252_2608819_-|TetR/AcrR-family-transcriptional-regulator
MAATNHAQAIKKDSQTYLTTALLQLLRTHDLDTITVTQVVKRAGVSRMAFYRNFTTLEDLLDAYFAPAIAARFQDVLQHVPANQKLLAMGQFFSDFAPTLRLAEQRGFENIIQQLFNANMTNYYQTTMANGTLTAVQLKYWTRFMSAGVYAIWREWLLGGQLEPLTMIHELLATLQTATMQALTQAQK
>NC_021224.2|WP_003587210.1|2626640_2627108_+|DNA-starvation/stationary-phase-protection-protein
MKYTKTKAVLNQLVADLSQMSMIIHQTHWYMRGPNFLKLHPLMDEFMEEIDSQLDVISERLIALDGSPYSTLKEMAENTKIQDWPGEWDKTTPERLAHLVDGYRYLEDLYQHGIEVSDVEKDFSTQDIFIGLKTAIEKKIWMIQAELGSAPEIDE
>NC_021224.2|WP_041142822.1|2627205_2627931_-|GntR-family-transcriptional-regulator
MAHLDIGQLVQRILADIQVGKLADGQRKLPAEPVLMERYQVTRYTLRQALKQLSNMGYTYQMHGIGTFVRQQQTNNSIALQHDGGLSEAAARAGLKLATKKAVMAMTTVADAEFLPEAGHLKDNEELIDIRRFRELDGQPYLMEHSYYIKAIVDTIPEEALYGSLFNYFEQQRDVNIGFIDQLLMSEPLPEIAREFMNLANGAPSLVVKDETYLTTGKMLAFSKQYYDYRRARLFMVKKIR
>NC_021224.2|WP_003645357.1|2628010_2629444_-|6-phospho-beta-glucosidase
MSKLPNGFLWGGAVAAHQFEGGWNKGGKGLSIADVMTAGSNTQAREITDGLVPGKNYPNHEAIDFYDHFHEDVQLFADLGLKCFRTSIAWTRIFPNGDENEPNEAGLKFYDDLFDDLLAHGIEPVITLSHFEMPYHLVKEYGGWRNREMIRFFVKFARVVLERYRNKVKYWMTFNEINNQTGLNEWGLFTNSGIKITADEDAEKLMYQAAHYETVASALVVKMGHEINPEFKIGCMMAMGPTYPATPAPQDVMKAERTMQAGYWLADIQCKGKYPNWLKRYFERHHFALDITEADLNILAVGTVDYIGFSYYASHVTKTTDNEPDDYMTPGQNPEVKNPALERSDWGWEIDPVGLRYALNWFSDRYDLPLFIVENGLGAFDKKDADGKIHDDYRIDYLRKHIEQMELAVDVDGVQLMGYTPWGFIDLVSAGTGQMDKRYGLIYVDKNDAGVGTLKREKKLSFDWFKKVIATNGADLS
>NC_021224.2|WP_003643416.1|2629504_2630863_-|PTS-cellobiose-transporter-subunit-IIC
MDDTNNKMFQFLNNHLMGPMGKLAQFRIVRAVMAAGMATIPFTIVGSMFLIVSVLPQSFPALAGFFAVSFDKITPLYMLANTATMGILSLYFCLVFGYEYTKIQAQEEKIEVNPLNGALISMMAFFMCLPELVFKDGAMTLINVFNKNAKIIDGWEMGGGVTRLGTTGIFTAIIMSIIAVKIYATCVKRNWTIKMPETVPAGVARSFTALIPTALIALTVIVINGLLILMGTDIYKIVAIPFGFVTNLTNTWIGLLVVYFIMHALWLVGIHGATIVTSFLTPIVLSNMVSNAKGANIPFAGEFNNCFVTIGGSGATLGMVVFIAFFAKSAQLGALGKASIVPAFFNINEPILFGMPVVYNPYTAIPFFLAPMSSMSVAYFAIKFHMVNPPIAQVAWPTPVGLSGFLGSGGDWRAAVLAVVCALIAFVIWFPFIKFYDNKLFVQEQSGTVQAD
>NC_021224.2|WP_003643417.1|2630884_2631382_-|hypothetical-protein
MSPLKNGSNEATANRRALSLTSMYFNRFLVFRYVTAIFFFVNLYWAIVLFGFGSGIGLLPSILLIGTAVVMVEQIGKFWKHTNRLTFTRWFYWVQLFINLSVGLSLVFGKLKVFYPFLNEASLPWVLSVLGFGILVSAFLEYRVFLIEHDKDRYIKHIRQFAASI
>NC_021224.2|WP_041142823.1|2631985_2632354_+|YxeA-family-protein
MKKAGILGLIITIIVLVPVGLGFNWYYSNYGTKTYYTQITTKGERKTGKDDSGKPYVYYHYSQPGYSDNGVKKELTFDSVLPRSLKMHAYLKVGYNDKRQQVINWEKVDRKDIPQAALNRIN
>NC_021224.2|WP_015640988.1|2632771_2634037_+|DUF805-domain-containing-protein
MSETKYCINCGKAIPTNATFCSFCGATQDKVASTEDQNTITSEQHNTPNQPEHVNMWTALKLGMRQTFTWSQRITRPQYWWLYLDLVLISLVLTIVLGIRAYSYPAFILSPLHVSVLQTVLLLIFSALMVWTSVMQFTASARRLHDSNRSAHYLWFYLLPLVGPILIIVFLCQRSEPAGKRFDRLASQPKPWTHKWWTWCLLVLLTLGYAALINITARDTAMDAALTTTSKSATTNSDDSYSDSDSEESSDSTDSDSDSESDSDSITIGDDDIDIADQKAYSTSFTDSSWAKSTFKIDKVTVYKTDGTYTSGSGNDKKDFNGVVKVHMSIHAGQDISAYPTQAKLSTNDGQQVEADMDSDDFDGDLNSGTDSDGNVYFVLSKLSSVKDITSIRLKWDASYDTDDYDDDNAYKTFDTTLNLN
>NC_021224.2|WP_003643422.1|2634349_2634625_-|DUF3781-domain-containing-protein
MSKQSVILELIRTHICYTPRVFQRINKKLAVNLSEVEIKDLVNHILIQPDEIKRCGKNYYIRSRKARVELTVNAGNYRLITASKYTEVDGF
>NC_021224.2|WP_003645351.1|2634733_2635321_+|glutamine-amidotransferase
MKTALFLMLDQYADWEASYLASQLNQSTDWQVKTTSTTPLVTSIGGFTTKVDYQLDCLPTIDLLILIGGNSWNINNSLLYSLVQQHLNASKPVGAICGAVDYLAQNGFLTGYQHTGNSLAMWHNYPNYQNSADFHEQQVISDKNLVTANGTAALAFTAAVLQLIHFQSSEELTRTIDLYRLGFYQYCQKYGNPFG
>NC_021224.2|WP_003645350.1|2635699_2635960_-|helix-turn-helix-transcriptional-regulator
MNESVSDENFLDCPFASVQKVVRGKWSMVILYFLSQRVLRFGELNRKVYPPVSPKVEYSLTPLGEKFLPVLKALENFAVDYQDYQA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NC_021224_1	1.1\|346725\|18\|NC_021224\|CRT	346725-346742	18	NC_021224.2	2810993-2811010	2	0.889

1. spacer 1.1|346725|18|NC_021224|CRT matches to position: 2810993-2811010, mismatch: 2, identity: 0.889

gccgctaagaaacataag	CRISPR spacer
gccgctaaggaacatcag	Protospacer
*********.***** **

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_021224_2	2.2\|2626062\|31\|NC_021224\|CRISPRCasFinder	2626062-2626092	31	NZ_CP034567	Vibrio parahaemolyticus strain D3112 plasmid p1, complete sequence	30785-30815	6	0.806
NC_021224_2	2.2\|2626062\|31\|NC_021224\|CRISPRCasFinder	2626062-2626092	31	NZ_CP033143	Vibrio parahaemolyticus strain 160807 plasmid pVPWZ1, complete sequence	85109-85139	6	0.806
NC_021224_2	2.2\|2626062\|31\|NC_021224\|CRISPRCasFinder	2626062-2626092	31	NZ_CP034300	Vibrio parahaemolyticus strain 20160303005-1 plasmid pVPSD2016-1, complete sequence	82262-82292	6	0.806
NC_021224_2	2.2\|2626062\|31\|NC_021224\|CRISPRCasFinder	2626062-2626092	31	NZ_CP033139	Vibrio owensii strain 1700302 plasmid pVOWZ1, complete sequence	19890-19920	6	0.806
NC_021224_1	1.2\|346761\|30\|NC_021224\|CRT	346761-346790	30	NZ_CP006988	Rhizobium sp. IE4771 plasmid pRetIE4771b, complete sequence	31047-31076	7	0.767
NC_021224_1	1.2\|346761\|30\|NC_021224\|CRT	346761-346790	30	NC_042345	Phage Salvo, complete genome	4721-4750	8	0.733
NC_021224_2	2.2\|2626062\|31\|NC_021224\|CRISPRCasFinder	2626062-2626092	31	NZ_CP040452	Halomonas sp. PA16-9 plasmid p_unnamed1, complete sequence	1245593-1245623	8	0.742

1. spacer 2.2|2626062|31|NC_021224|CRISPRCasFinder matches to NZ_CP034567 (Vibrio parahaemolyticus strain D3112 plasmid p1, complete sequence) position: , mismatch: 6, identity: 0.806

aaacccagcgccacaaccaaacccggcgccg	CRISPR spacer
catcaaagcgccactaccaaacgcggcgccg	Protospacer
 * *  ******** ******* ********

2. spacer 2.2|2626062|31|NC_021224|CRISPRCasFinder matches to NZ_CP033143 (Vibrio parahaemolyticus strain 160807 plasmid pVPWZ1, complete sequence) position: , mismatch: 6, identity: 0.806

aaacccagcgccacaaccaaacccggcgccg	CRISPR spacer
catcaaagcgccactaccaaacgcggcgccg	Protospacer
 * *  ******** ******* ********

3. spacer 2.2|2626062|31|NC_021224|CRISPRCasFinder matches to NZ_CP034300 (Vibrio parahaemolyticus strain 20160303005-1 plasmid pVPSD2016-1, complete sequence) position: , mismatch: 6, identity: 0.806

aaacccagcgccacaaccaaacccggcgccg	CRISPR spacer
catcaaagcgccactaccaaacgcggcgccg	Protospacer
 * *  ******** ******* ********

4. spacer 2.2|2626062|31|NC_021224|CRISPRCasFinder matches to NZ_CP033139 (Vibrio owensii strain 1700302 plasmid pVOWZ1, complete sequence) position: , mismatch: 6, identity: 0.806

aaacccagcgccacaaccaaacccggcgccg	CRISPR spacer
catcaaagcgccactaccaaacgcggcgccg	Protospacer
 * *  ******** ******* ********

5. spacer 1.2|346761|30|NC_021224|CRT matches to NZ_CP006988 (Rhizobium sp. IE4771 plasmid pRetIE4771b, complete sequence) position: , mismatch: 7, identity: 0.767

cacaagaagaaagcggccaagaaacataag	CRISPR spacer
cacaagaataaagccgccaagaagctccgg	Protospacer
******** ***** ********.* . .*

6. spacer 1.2|346761|30|NC_021224|CRT matches to NC_042345 (Phage Salvo, complete genome) position: , mismatch: 8, identity: 0.733

cacaagaagaaagcggccaagaaacataag	CRISPR spacer
ccggggaagtaagcggacaagaaacatact	Protospacer
*  ..**** ****** ***********

7. spacer 2.2|2626062|31|NC_021224|CRISPRCasFinder matches to NZ_CP040452 (Halomonas sp. PA16-9 plasmid p_unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

aaacccagcgccacaaccaaacccggcgccg	CRISPR spacer
ccgctgagcgacacaaccaaaccctgcgcct	Protospacer
  .*. **** ************* *****

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

300591 : 356246

unidentified_phage(28.57%)

bacteriocin,transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015639911.1\|300591_301521_+\|transposase	IS30-like element ISLpl1 family transposase	H7BW61	unidentified_phage	8.5e-20	31.8
WP_041142848.1\|301633_303001_-	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_003641904.1\|303426_304290_+	class II fructose-1,6-bisphosphate aldolase	NA	NA	NA	NA
WP_003646426.1\|304582_305899_-	MFS transporter	NA	NA	NA	NA
WP_003646427.1\|306068_306971_-	SPFH/Band 7/PHB domain protein	NA	NA	NA	NA
WP_003641907.1\|306983_307184_-	hypothetical protein	NA	NA	NA	NA
WP_015639914.1\|307866_309279_+	C69 family dipeptidase	NA	NA	NA	NA
WP_003641910.1\|309344_309590_+	hypothetical protein	NA	NA	NA	NA
WP_041142657.1\|309718_310282_+	biotin transporter BioY	NA	NA	NA	NA
WP_003646429.1\|310319_311291_+	biotin--[acetyl-CoA-carboxylase] ligase	NA	NA	NA	NA
WP_003646430.1\|311287_311608_+	hypothetical protein	NA	NA	NA	NA
WP_003646431.1\|311761_312937_+	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
WP_003646432.1\|313112_314279_-	hypothetical protein	NA	NA	NA	NA
WP_003646433.1\|314873_315689_+	ABC transporter permease	NA	NA	NA	NA
WP_003641921.1\|315701_316793_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	7.2e-18	29.7
WP_003643757.1\|317171_317444_+	hypothetical protein	NA	NA	NA	NA
WP_003646434.1\|317670_318213_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_015639920.1\|318209_319655_+	MFS transporter	NA	NA	NA	NA
WP_003643760.1\|319984_321301_-	ammonium transporter	H8ZJB2	Ostreococcus_tauri_virus	1.1e-33	29.6
WP_015639922.1\|321582_322512_-\|transposase	IS30 family transposase	H7BW61	unidentified_phage	3.8e-20	32.6
WP_003646436.1\|322843_323803_+	L-lactate dehydrogenase	NA	NA	NA	NA
WP_003641927.1\|323905_324175_+	hypothetical protein	NA	NA	NA	NA
WP_003646437.1\|325160_325829_+	ribose 5-phosphate isomerase A	NA	NA	NA	NA
WP_015639924.1\|325986_327492_+	multicopper oxidase domain-containing protein	NA	NA	NA	NA
WP_003643763.1\|327756_328125_+	DUF1304 domain-containing protein	NA	NA	NA	NA
WP_003641932.1\|328237_328747_-	YbhB/YbcL family Raf kinase inhibitor-like protein	NA	NA	NA	NA
WP_015639925.1\|328777_329974_-	DUF2075 domain-containing protein	NA	NA	NA	NA
WP_003646440.1\|330083_330554_+	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_003641935.1\|330572_331028_+	hypothetical protein	NA	NA	NA	NA
WP_015639927.1\|331131_331704_+	acetyl-CoA carboxylase biotin carboxyl carrier protein subunit	NA	NA	NA	NA
WP_003646441.1\|331869_332790_-	ribonucleoside hydrolase RihC	NA	NA	NA	NA
WP_003643768.1\|332926_333838_+	oxidoreductase	NA	NA	NA	NA
WP_003646442.1\|334727_335174_-	ribonuclease H	NA	NA	NA	NA
WP_015639929.1\|335411_336938_+	ABC transporter permease/substrate-binding protein	NA	NA	NA	NA
WP_003641941.1\|336938_337910_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.7e-23	31.7
WP_003646444.1\|337987_339319_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_003643773.1\|339784_341302_+	glycerol kinase GlpK	NA	NA	NA	NA
WP_015639932.1\|341316_343146_+	type 1 glycerol-3-phosphate oxidase	NA	NA	NA	NA
WP_003641945.1\|343160_343883_+	aquaporin family protein	M1HWZ0	Paramecium_bursaria_Chlorella_virus	3.2e-30	31.9
WP_015639934.1\|344077_346426_+	MucBP domain-containing protein	NA	NA	NA	NA
WP_041142658.1\|346427_348260_+	extracellular protein, lysine-rich	NA	NA	NA	NA
WP_003646448.1\|348265_348499_+	hypothetical protein	NA	NA	NA	NA
WP_015639937.1\|348928_350104_-\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_003646470.1\|350437_351211_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003643811.1\|351309_351468_-\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnF	NA	NA	NA	NA
WP_003646472.1\|351924_354075_+	peptide cleavage/export ABC transporter	W8CYL7	Bacillus_phage	6.1e-45	27.9
WP_003646473.1\|354090_355467_+	HlyD family secretion protein	NA	NA	NA	NA
WP_015639939.1\|355556_356246_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA

DBSCAN-SWA_2

541302 : 549927

Streptococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015640011.1\|541302_543000_+	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	1.3e-55	37.3
WP_015640012.1\|543021_543330_+	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_003637790.1\|543345_543945_+	recombination protein RecR	NA	NA	NA	NA
WP_003640957.1\|543959_544211_+	YaaL family protein	NA	NA	NA	NA
WP_003644908.1\|544609_545275_+	dTMP kinase	M1PSC7	Streptococcus_phage	1.4e-53	52.7
WP_003640965.1\|545271_545601_+	cyclic-di-AMP receptor	NA	NA	NA	NA
WP_003640966.1\|545617_546637_+	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	2.1e-32	33.5
WP_003640967.1\|546661_547009_+	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	2.4e-12	33.3
WP_003643942.1\|547107_548004_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	9.9e-82	55.7
WP_041142670.1\|548007_548793_+	acyl-ACP thioesterase	NA	NA	NA	NA
WP_003643943.1\|548931_549927_+	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	5.9e-51	38.2

DBSCAN-SWA_3

749006 : 777815

unidentified_phage(28.57%)

integrase,transposase,protease

attL 775608:775629|attR 778379:778400

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001748085.1\|749006_750182_+\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_003645770.1\|750602_751286_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003645769.1\|751505_751850_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_003645768.1\|752005_752713_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_015640093.1\|752721_753597_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	2.8e-20	28.9
WP_015640094.1\|753673_754972_-	MFS transporter	NA	NA	NA	NA
WP_015640096.1\|757401_758331_+\|transposase	IS30 family transposase	H7BW61	unidentified_phage	1.7e-20	33.2
WP_015640098.1\|759278_759662_+	MORN motif-containing protein	NA	NA	NA	NA
WP_003645763.1\|759651_761499_+	acetyltransferase	A0A1R3Y5Q6	Salmonella_virus	5.8e-20	23.7
WP_003641172.1\|761739_761994_+	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
WP_003644045.1\|762005_762551_+	alkaline shock response membrane anchor protein AmaP	NA	NA	NA	NA
WP_003641174.1\|762563_762746_+	hypothetical protein	NA	NA	NA	NA
WP_003644046.1\|762760_763183_+	Asp23/Gls24 family envelope stress response protein	NA	NA	NA	NA
WP_003641176.1\|763243_763684_+	Asp23/Gls24 family envelope stress response protein	NA	NA	NA	NA
WP_016511031.1\|763887_764688_+	fumarylacetoacetate hydrolase family protein	NA	NA	NA	NA
WP_041142679.1\|764819_765830_+	DUF4767 domain-containing protein	NA	NA	NA	NA
WP_003644050.1\|766629_767202_+	hypothetical protein	NA	NA	NA	NA
WP_003645758.1\|767383_769918_+	M1 family metallopeptidase	A0A0P0IY26	Acinetobacter_phage	3.5e-68	27.4
WP_015639922.1\|770642_771572_-\|transposase	IS30 family transposase	H7BW61	unidentified_phage	3.8e-20	32.6
WP_015640108.1\|775555_776746_+	restriction endonuclease subunit S	A0A2H4PQP5	Staphylococcus_phage	8.1e-15	27.5
775608:775629	attL	NA	NA	NA	NA
WP_015379944.1\|776897_777815_+\|integrase	site-specific integrase	A8ATM2	Listeria_phage	2.7e-74	44.7
WP_015379944.1\|776897_777815_+\|integrase	site-specific integrase	A8ATM2	Listeria_phage	2.7e-74	44.7
778379:778400	attR	NA	NA	NA	NA

DBSCAN-SWA_4

1144276 : 1154114

Lactobacillus_phage(87.5%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015640258.1\|1144276_1145506_+	hypothetical protein	A0A2P0ZL72	Lactobacillus_phage	2.7e-215	97.7
WP_015640259.1\|1145596_1146568_-	Nisin resistance protein	A0A2P0ZL68	Lactobacillus_phage	2.0e-181	98.8
WP_003645222.1\|1146753_1147701_-	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	1.7e-177	99.7
WP_003643097.1\|1148044_1148659_+	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	6.3e-112	100.0
WP_015380220.1\|1148661_1151100_+	flavocytochrome c	A0A2P0ZL82	Lactobacillus_phage	0.0e+00	99.5
WP_003643095.1\|1151187_1151748_+	hypothetical protein	A0A2P0ZL75	Lactobacillus_phage	2.7e-101	100.0
WP_003643094.1\|1151818_1152259_-	nucleoside 2-deoxyribosyltransferase	A0A2P0ZL88	Lactobacillus_phage	8.0e-77	99.3
WP_015380221.1\|1152354_1152492_+	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_003645220.1\|1153118_1154114_+	glycosyltransferase family 2 protein	S5FKN0	Shigella_phage	3.1e-52	38.8

DBSCAN-SWA_5

1650569 : 1736475

Lactobacillus_phage(77.55%)

protease,tRNA,terminase,tail,integrase,capsid,portal,head

attL 1676115:1676132|attR 1743406:1743423

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645968.1\|1650569_1651493_-\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA
WP_003645967.1\|1651977_1652499_-	shikimate kinase	NA	NA	NA	NA
WP_041142729.1\|1652501_1653599_-	prephenate dehydrogenase	NA	NA	NA	NA
WP_015640474.1\|1653601_1654864_-	3-phosphoshikimate 1-carboxyvinyltransferase	NA	NA	NA	NA
WP_003645964.1\|1654877_1655405_-	amino acid biosynthesis protein	NA	NA	NA	NA
WP_003640721.1\|1655413_1656583_-	chorismate synthase	NA	NA	NA	NA
WP_041142730.1\|1656575_1658030_-	MFS transporter	NA	NA	NA	NA
WP_003640723.1\|1658678_1659032_-	30S ribosome-binding factor RbfA	NA	NA	NA	NA
WP_003645962.1\|1659054_1661631_-	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	9.6e-21	23.3
WP_041142731.1\|1661645_1661951_-	ribosomal L7Ae/L30e/S12e/Gadd45 family protein	NA	NA	NA	NA
WP_003640726.1\|1661940_1662240_-	YlxR family protein	NA	NA	NA	NA
WP_003640727.1\|1662284_1663502_-	transcription termination/antitermination protein NusA	NA	NA	NA	NA
WP_003640728.1\|1663522_1663999_-	ribosome maturation factor RimP	NA	NA	NA	NA
WP_015640478.1\|1664294_1668608_-	PolC-type DNA polymerase III	A0A1X9SH08	Bradyrhizobium_phage	1.0e-14	34.0
WP_003640732.1\|1669101_1670811_-\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
WP_003640733.1\|1670850_1672128_-\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
WP_003640734.1\|1672165_1672951_-	phosphatidate cytidylyltransferase	NA	NA	NA	NA
WP_003640735.1\|1672966_1673746_-	isoprenyl transferase	R9W0U9	Flavobacterium_phage	1.1e-23	43.1
WP_003640736.1\|1673865_1674429_-	ribosome recycling factor	NA	NA	NA	NA
WP_003640737.1\|1674430_1675153_-	UMP kinase	NA	NA	NA	NA
WP_003644498.1\|1675352_1676231_-	elongation factor Ts	NA	NA	NA	NA
1676115:1676132	attL	NA	NA	NA	NA
WP_003640739.1\|1676333_1677137_-	30S ribosomal protein S2	NA	NA	NA	NA
WP_003640740.1\|1677361_1678084_+	HAD family hydrolase	NA	NA	NA	NA
WP_003640741.1\|1678373_1679372_-	D-2-hydroxyacid dehydrogenase	M1HKI4	Acanthocystis_turfacea_Chlorella_virus	2.3e-47	34.9
WP_003645628.1\|1679456_1679762_-	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_003645629.1\|1679745_1680504_-\|tRNA	tRNA1(Val) (adenine(37)-N6)-methyltransferase	NA	NA	NA	NA
WP_003645630.1\|1680615_1681251_+	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_003640745.1\|1681307_1681544_-	YneF family protein	NA	NA	NA	NA
WP_003644501.1\|1681641_1681881_-	DUF896 domain-containing protein	NA	NA	NA	NA
WP_003640747.1\|1682032_1682665_+	transcriptional repressor LexA	A0A1B2APZ1	Phage_Wrath	2.3e-16	56.2
WP_089197934.1\|1682754_1682985_-	DNA alkylation repair protein	NA	NA	NA	NA
WP_003645631.1\|1683288_1683918_+	hypothetical protein	NA	NA	NA	NA
WP_015380455.1\|1683967_1685137_-	hydroxymethylglutaryl-CoA synthase	NA	NA	NA	NA
WP_003645633.1\|1685172_1685565_-	hypothetical protein	NA	NA	NA	NA
WP_015640487.1\|1685728_1686121_+	hypothetical protein	NA	NA	NA	NA
WP_003645635.1\|1686566_1687508_+	glycosyltransferase family 2 protein	V9QJB1	Oenococcus_phage	3.1e-78	48.7
WP_003645636.1\|1688207_1688780_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_080316528.1\|1688931_1690116_-	LCP family protein	NA	NA	NA	NA
WP_003645638.1\|1690096_1690888_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.5e-30	36.8
WP_015640489.1\|1690906_1692649_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_003645640.1\|1693127_1694339_-	FtsW/RodA/SpoVE family cell cycle protein	NA	NA	NA	NA
WP_015640490.1\|1695127_1695505_-	hypothetical protein	A0A2K9VCG4	Lactobacillus_phage	3.7e-14	61.2
WP_015640491.1\|1695515_1695779_-	hemolysin XhlA family protein	E9LUR9	Lactobacillus_phage	7.4e-38	98.9
WP_015640492.1\|1695778_1696939_-	LysM peptidoglycan-binding domain-containing protein	E9LUR8	Lactobacillus_phage	1.0e-192	86.7
WP_015640493.1\|1696951_1697212_-	hypothetical protein	A0A0A1ENR9	Lactobacillus_phage	6.5e-18	84.2
WP_041142732.1\|1697208_1698306_-	collagen-like protein	A0A2P0ZLF6	Lactobacillus_phage	2.2e-59	88.5
WP_003641410.1\|1698289_1698451_-	hypothetical protein	A0A2P0ZLG1	Lactobacillus_phage	4.7e-19	96.2
WP_015640495.1\|1698466_1698709_-	hypothetical protein	A0A1S5RCP9	Lactobacillus_phage	1.2e-34	93.8
WP_015640497.1\|1700797_1703155_-\|tail	phage tail protein	E9LUR3	Lactobacillus_phage	0.0e+00	89.9
WP_015640498.1\|1703218_1704988_-\|tail	phage tail family protein	E9LUR2	Lactobacillus_phage	0.0e+00	89.1
WP_015640499.1\|1705060_1709956_-	C40 family peptidase	A0A2P0ZLG0	Lactobacillus_phage	0.0e+00	61.5
WP_015640500.1\|1709987_1710173_-	hypothetical protein	NA	NA	NA	NA
WP_015640501.1\|1710217_1710592_-\|tail	phage tail assembly chaperone	A0A2P0ZLH4	Lactobacillus_phage	4.6e-57	94.4
WP_041142733.1\|1710667_1711324_-\|tail	phage tail protein	A0A2P0ZLH1	Lactobacillus_phage	1.4e-101	86.4
WP_015640503.1\|1711339_1711720_-	DUF806 family protein	A0A2P0ZLF4	Lactobacillus_phage	3.2e-58	88.9
WP_015640504.1\|1711719_1712127_-	HK97 gp10 family phage protein	A0A2P0ZLE6	Lactobacillus_phage	6.5e-65	93.2
WP_041142734.1\|1712129_1712477_-\|head	phage head closure protein	A0A2P0ZLF0	Lactobacillus_phage	1.2e-43	72.2
WP_041142735.1\|1712466_1712799_-\|head,tail	phage gp6-like head-tail connector protein	E9LUQ4	Lactobacillus_phage	1.7e-47	89.8
WP_015640507.1\|1712871_1714092_-\|capsid	phage major capsid protein	E9LUQ3	Lactobacillus_phage	2.2e-201	89.3
WP_041142736.1\|1714091_1714847_-\|protease	Clp protease ClpP	E9LUQ2	Lactobacillus_phage	8.8e-124	92.8
WP_015640509.1\|1714824_1716018_-\|portal	phage portal protein	E9LUQ1	Lactobacillus_phage	1.2e-223	98.5
WP_041142737.1\|1716020_1716215_-	DUF1056 family protein	E9LUQ0	Lactobacillus_phage	2.8e-26	93.8
WP_015640511.1\|1716204_1718103_-\|terminase	terminase large subunit	E9LUP9	Lactobacillus_phage	0.0e+00	96.0
WP_015640512.1\|1718105_1718564_-\|terminase	phage terminase small subunit P27 family	E9LUP8	Lactobacillus_phage	8.0e-80	96.7
WP_041142738.1\|1718733_1718994_-	hypothetical protein	NA	NA	NA	NA
WP_134987746.1\|1718999_1719470_-	HNH endonuclease	E9LUP7	Lactobacillus_phage	8.2e-80	91.6
WP_041142740.1\|1719480_1719633_-	hypothetical protein	NA	NA	NA	NA
WP_015640516.1\|1720048_1720474_-	RinA family phage transcriptional regulator	E9LUP5	Lactobacillus_phage	3.2e-67	87.9
WP_041142741.1\|1720454_1720625_-	hypothetical protein	E9LUP4	Lactobacillus_phage	8.5e-19	91.1
WP_015640518.1\|1720627_1721029_-	hypothetical protein	E9LUP3	Lactobacillus_phage	3.2e-56	76.7
WP_131067371.1\|1721025_1721433_-	hypothetical protein	A0A2P0ZKS9	Lactobacillus_phage	7.8e-10	36.9
WP_015640520.1\|1721447_1721597_-	hypothetical protein	NA	NA	NA	NA
WP_041142742.1\|1721639_1722647_-	DNA cytosine methyltransferase	A0A1I9KKE7	Lactobacillus_phage	1.2e-144	68.0
WP_015640522.1\|1722661_1722871_-	hypothetical protein	NA	NA	NA	NA
WP_015640523.1\|1722970_1723351_-	hypothetical protein	NA	NA	NA	NA
WP_015640524.1\|1723347_1723848_-	hypothetical protein	O03915	Lactobacillus_phage	2.0e-55	64.2
WP_015640525.1\|1723983_1724769_-	ATP-binding protein	E9LUN6	Lactobacillus_phage	2.1e-144	98.5
WP_015640526.1\|1724768_1725575_-	hypothetical protein	A0A0S2MYA8	Enterococcus_phage	2.3e-45	36.9
WP_041142744.1\|1725624_1726317_-	hypothetical protein	E9LUU3	Lactobacillus_phage	8.9e-131	97.8
WP_015640528.1\|1726363_1727023_-	DUF669 domain-containing protein	E9LUU2	Lactobacillus_phage	3.5e-76	80.8
WP_041142745.1\|1727025_1727688_-	AAA family ATPase	E9LUU1	Lactobacillus_phage	1.2e-116	95.5
WP_015640530.1\|1727688_1728549_-	DUF1351 domain-containing protein	A0A0P0IV40	Lactobacillus_phage	2.4e-37	34.4
WP_015640531.1\|1728548_1728695_-	hypothetical protein	E9LUT9	Lactobacillus_phage	1.5e-16	91.5
WP_173424401.1\|1728697_1728862_-	hypothetical protein	E9LUT8	Lactobacillus_phage	7.2e-15	85.1
WP_015640532.1\|1729077_1729332_-	hypothetical protein	NA	NA	NA	NA
WP_041142746.1\|1729474_1729735_-	hypothetical protein	NA	NA	NA	NA
WP_164878070.1\|1730413_1730578_-	hypothetical protein	NA	NA	NA	NA
WP_041142747.1\|1730591_1731299_-	Rha family transcriptional regulator	D2IYT0	Enterococcus_phage	1.2e-63	58.5
WP_041142748.1\|1731356_1731734_+	hypothetical protein	NA	NA	NA	NA
WP_027821294.1\|1732004_1732220_-	helix-turn-helix transcriptional regulator	A0A2H4JBV7	uncultured_Caudovirales_phage	5.9e-17	71.0
WP_015640539.1\|1732412_1733084_+	LexA family transcriptional regulator	D7RWL5	Brochothrix_phage	3.8e-46	47.6
WP_041142749.1\|1733208_1733784_+	hypothetical protein	NA	NA	NA	NA
WP_003641358.1\|1733789_1733990_+	hypothetical protein	E9LUS6	Lactobacillus_phage	4.9e-26	100.0
WP_003641356.1\|1734829_1735144_+	hypothetical protein	NA	NA	NA	NA
WP_041142750.1\|1735311_1736475_+\|integrase	site-specific integrase	B4XYR4	Lactobacillus_phage	1.6e-55	36.2
1743406:1743423	attR	NA	NA	NA	NA

DBSCAN-SWA_6

2006734 : 2101427

Lactobacillus_phage(34.88%)

plate,terminase,tail,integrase,capsid,portal,transposase,head

attL 2070034:2070055|attR 2084157:2084178

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015640658.1\|2006734_2007910_-\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_003645418.1\|2008207_2008381_+	hypothetical protein	NA	NA	NA	NA
WP_003639227.1\|2008698_2009328_-	uracil phosphoribosyltransferase	NA	NA	NA	NA
WP_003641436.1\|2009407_2010646_-	serine hydroxymethyltransferase	A0A219Y950	Aeromonas_phage	1.4e-94	50.6
WP_003645419.1\|2010704_2011724_-	threonylcarbamoyl-AMP synthase	A0A291ATS8	Pandoravirus	9.3e-52	41.5
WP_003645420.1\|2012014_2012881_-	peptide chain release factor N(5)-glutamine methyltransferase	NA	NA	NA	NA
WP_003641433.1\|2012873_2013956_-	peptide chain release factor 1	NA	NA	NA	NA
WP_003644660.1\|2013969_2014548_-	thymidine kinase	A0A249XZX5	Enterococcus_phage	7.3e-46	49.7
WP_003645421.1\|2014809_2016156_+	Mur ligase family protein	NA	NA	NA	NA
WP_003645422.1\|2016158_2016881_+	cobyric acid synthase	NA	NA	NA	NA
WP_015640662.1\|2017141_2018107_-	mannose-6-phosphate isomerase, class I	NA	NA	NA	NA
WP_003645424.1\|2018183_2019203_-	serine hydrolase	A0A249XPW4	Mycobacterium_phage	5.3e-07	24.2
WP_003641426.1\|2019373_2019559_-	hypothetical protein	NA	NA	NA	NA
WP_003641425.1\|2019810_2020839_-	branched-chain amino acid aminotransferase	NA	NA	NA	NA
WP_003641424.1\|2020970_2021333_+	hypothetical protein	NA	NA	NA	NA
WP_003645426.1\|2021548_2022520_-	hypothetical protein	NA	NA	NA	NA
WP_003641422.1\|2022534_2024424_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	9.4e-58	32.1
WP_041142768.1\|2024423_2026154_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	5.8e-46	27.4
WP_003641420.1\|2026377_2026770_-	YxeA family protein	NA	NA	NA	NA
WP_003645429.1\|2026992_2027838_+	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_041142769.1\|2028321_2029332_-	Abi family protein	A0A0H4U080	Erysipelothrix_phage	3.3e-25	26.3
WP_015640668.1\|2030216_2030603_-	hypothetical protein	A0A2H4PBB2	Lactobacillus_phage	2.2e-14	83.7
WP_015640669.1\|2030613_2030877_-	hemolysin XhlA family protein	E9LUR9	Lactobacillus_phage	3.4e-35	92.0
WP_041142770.1\|2030876_2032082_-	LysM peptidoglycan-binding domain-containing protein	E9LUR8	Lactobacillus_phage	1.4e-192	85.8
WP_015640671.1\|2032170_2032344_-	XkdX family protein	NA	NA	NA	NA
WP_015640672.1\|2032343_2032703_-	hypothetical protein	NA	NA	NA	NA
WP_015640674.1\|2034284_2034413_-	XkdX family protein	NA	NA	NA	NA
WP_015640675.1\|2034504_2034867_-	DUF2977 domain-containing protein	NA	NA	NA	NA
WP_015640676.1\|2034866_2035604_-	hypothetical protein	NA	NA	NA	NA
WP_015640677.1\|2035609_2036224_-\|plate	phage baseplate upper protein	A0A1J0MFQ3	Staphylococcus_phage	1.6e-46	49.3
WP_015640678.1\|2036238_2037231_-	SGNH/GDSL hydrolase family protein	I6TFU2	Staphylococcus_virus	6.1e-40	39.3
WP_015640679.1\|2037235_2039098_-\|tail	phage tail protein	A0A1X9IGI5	Lactococcus_phage	9.3e-50	32.6
WP_015640680.1\|2039097_2039835_-	hypothetical protein	A0A1S5SA63	Streptococcus_phage	1.8e-41	37.0
WP_015640682.1\|2044141_2044378_-	hypothetical protein	NA	NA	NA	NA
WP_015640683.1\|2044470_2044959_-	hypothetical protein	NA	NA	NA	NA
WP_041142771.1\|2044976_2045537_-	hypothetical protein	NA	NA	NA	NA
WP_080316530.1\|2045548_2045935_-	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_015640686.1\|2045936_2046491_-	hypothetical protein	NA	NA	NA	NA
WP_041142872.1\|2046480_2046804_-	hypothetical protein	NA	NA	NA	NA
WP_015640688.1\|2046808_2047174_-\|head,tail	phage head-tail connector protein	NA	NA	NA	NA
WP_015640689.1\|2047188_2048241_-	hypothetical protein	A0A0S0N2Q7	Pseudomonas_phage	1.2e-33	30.5
WP_015640690.1\|2048257_2048905_-	DUF4355 domain-containing protein	NA	NA	NA	NA
WP_015640691.1\|2049011_2049956_-\|capsid	minor capsid protein	NA	NA	NA	NA
WP_080316531.1\|2049958_2051626_-\|portal	phage portal protein	D2IZF6	Enterococcus_phage	8.3e-66	32.6
WP_015640693.1\|2051615_2052914_-\|terminase	PBSX family phage terminase large subunit	B7T0C6	Staphylococcus_virus	3.7e-114	50.1
WP_041142772.1\|2053117_2053627_-\|terminase	terminase small subunit	O03926	Lactobacillus_phage	1.3e-46	61.9
WP_041142773.1\|2053687_2053987_-	ImmA/IrrE family metallo-endopeptidase	A0A1Q1PVT7	Staphylococcus_phage	2.8e-09	36.0
WP_041142774.1\|2054119_2054320_-	hypothetical protein	E9LUP6	Lactobacillus_phage	1.1e-06	56.0
WP_041142775.1\|2054386_2054761_-	phage associated protein	Q6SE87	Lactobacillus_prophage	1.4e-26	48.4
WP_041142776.1\|2054738_2055797_-	hypothetical protein	Q6SE88	Lactobacillus_prophage	6.4e-72	41.6
WP_129363737.1\|2056816_2057284_-	hypothetical protein	B4XYT9	Lactobacillus_phage	4.1e-15	39.2
WP_015640702.1\|2057583_2058009_-	hypothetical protein	A0A2K9VC36	Lactobacillus_phage	2.7e-13	36.8
WP_015640703.1\|2057992_2058190_-	hypothetical protein	NA	NA	NA	NA
WP_015640704.1\|2058182_2058563_-	hypothetical protein	NA	NA	NA	NA
WP_015640705.1\|2058559_2059078_-	hypothetical protein	O03915	Lactobacillus_phage	4.1e-40	55.3
WP_033611991.1\|2059074_2059362_-	hypothetical protein	NA	NA	NA	NA
WP_041142777.1\|2059358_2060267_-	DnaD domain protein	NA	NA	NA	NA
WP_015640708.1\|2060346_2061312_-	hypothetical protein	A6M982	Geobacillus_virus	1.2e-64	54.5
WP_041142778.1\|2061323_2061857_-	host-nuclease inhibitor Gam family protein	E9LUU0	Lactobacillus_phage	4.7e-55	58.9
WP_015640712.1\|2062355_2062868_-	helix-turn-helix transcriptional regulator	D6PST4	Lactobacillus_phage	1.8e-27	43.5
WP_011101775.1\|2062935_2063241_-	DUF771 domain-containing protein	NA	NA	NA	NA
WP_016511200.1\|2063252_2063423_-	hypothetical protein	NA	NA	NA	NA
WP_016511201.1\|2063435_2063666_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_016511202.1\|2063838_2064201_+	helix-turn-helix domain-containing protein	A0A0U4KKM4	Exiguobacterium_phage	2.6e-09	32.0
WP_015640714.1\|2064212_2064626_+	ImmA/IrrE family metallo-endopeptidase	A0A0M4RD70	Bacillus_phage	2.6e-05	31.3
WP_041142780.1\|2064656_2066153_+	TerB N-terminal domain-containing protein	NA	NA	NA	NA
WP_015640716.1\|2066407_2067127_+	hypothetical protein	NA	NA	NA	NA
WP_080316532.1\|2067399_2067576_+	hypothetical protein	A0A2P0ZL93	Lactobacillus_phage	2.6e-10	51.7
WP_015640717.1\|2068048_2069170_+\|integrase	site-specific integrase	D6PSS4	Lactobacillus_phage	1.3e-46	32.4
WP_003642774.1\|2069520_2069727_-	hypothetical protein	NA	NA	NA	NA
2070034:2070055	attL	NA	NA	NA	NA
WP_016527219.1\|2070146_2070452_-	hypothetical protein	NA	NA	NA	NA
WP_041142782.1\|2070534_2070906_-	hypothetical protein	NA	NA	NA	NA
WP_015640719.1\|2071087_2071357_-\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
WP_015640720.1\|2071496_2073023_-\|capsid	phage major capsid protein	B8R651	Lactobacillus_phage	1.2e-42	26.2
WP_041142783.1\|2073019_2074120_-\|portal	phage portal protein	A0A2H4J9Q5	uncultured_Caudovirales_phage	5.1e-48	34.6
WP_015640723.1\|2074274_2075978_-\|terminase	terminase large subunit	A0A2H4JBN3	uncultured_Caudovirales_phage	2.7e-120	40.5
WP_015640724.1\|2075974_2076448_-\|terminase	phage terminase small subunit P27 family	NA	NA	NA	NA
WP_015640725.1\|2077237_2077456_+	hypothetical protein	NA	NA	NA	NA
WP_041142784.1\|2077511_2077901_-	HNH endonuclease	A0A1J0MFT4	Staphylococcus_phage	3.0e-19	44.7
WP_041142875.1\|2077893_2078232_-\|head	phage head closure protein	A0A2P0ZLF0	Lactobacillus_phage	5.1e-07	33.7
WP_015640728.1\|2078218_2078503_-	hypothetical protein	NA	NA	NA	NA
WP_003645297.1\|2078527_2078947_-	hypothetical protein	NA	NA	NA	NA
WP_015640730.1\|2079090_2080485_-	helicase	Q4ZD27	Staphylococcus_phage	4.6e-70	35.8
WP_015640731.1\|2080484_2081285_-	bifunctional DNA primase/polymerase	NA	NA	NA	NA
WP_015640732.1\|2081281_2081500_-	hypothetical protein	NA	NA	NA	NA
WP_015640734.1\|2081781_2081961_-	helix-turn-helix domain-containing protein	E9LUT5	Lactobacillus_phage	4.3e-21	87.9
WP_003643618.1\|2082109_2082754_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_041142786.1\|2082832_2083990_+\|integrase	site-specific integrase	Q938N9	Temperate_phage	6.6e-54	34.8
WP_003642773.1\|2084469_2084703_+	hypothetical protein	NA	NA	NA	NA
2084157:2084178	attR	NA	NA	NA	NA
WP_003642772.1\|2084727_2085000_+	hypothetical protein	NA	NA	NA	NA
WP_003642771.1\|2085048_2085534_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_003642770.1\|2085588_2087565_-	hypothetical protein	NA	NA	NA	NA
WP_041142787.1\|2087664_2090805_-	MucBP domain-containing protein	NA	NA	NA	NA
WP_015640740.1\|2091494_2091638_-	hypothetical protein	NA	NA	NA	NA
WP_003646621.1\|2092572_2094336_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	6.9e-95	40.5
WP_015640741.1\|2095903_2097898_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	7.2e-32	41.3
WP_003646619.1\|2098302_2098494_-	hypothetical protein	NA	NA	NA	NA
WP_003642759.1\|2098919_2100272_-	glucose-6-phosphate isomerase	NA	NA	NA	NA
WP_015640743.1\|2100497_2101427_+\|transposase	IS30-like element ISLpl1 family transposase	H7BW61	unidentified_phage	1.1e-19	29.9

DBSCAN-SWA_7

2275520 : 2284031

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645867.1\|2275520_2276099_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.3e-21	33.9
WP_003645866.1\|2276091_2277117_-	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	2.7e-59	41.0
WP_041142795.1\|2277113_2278568_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	3.3e-50	34.0
WP_003645864.1\|2278552_2280772_-	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	4.5e-144	39.3
WP_011101895.1\|2280764_2281445_-	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_003642588.1\|2281444_2281699_-	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_003642587.1\|2281700_2282432_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	M4SM18	Cyanophage	1.6e-37	37.3
WP_015380738.1\|2282434_2283565_-	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_003645861.1\|2283548_2284031_-	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	2.3e-16	41.0

DBSCAN-SWA_8

2942671 : 3014382

unidentified_phage(37.5%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015641123.1\|2942671_2943601_-\|transposase	IS30-like element ISLpl1 family transposase	H7BW61	unidentified_phage	8.5e-20	29.9
WP_001748085.1\|2944384_2945560_-\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_003646199.1\|2946077_2946893_-	sugar-phosphatase	NA	NA	NA	NA
WP_003646200.1\|2946965_2948963_-	transketolase	NA	NA	NA	NA
WP_003646201.1\|2948992_2949646_-	fructose-6-phosphate aldolase	R9TM64	Synechococcus_phage	3.3e-50	49.3
WP_003642902.1\|2949712_2951083_-	PTS ascorbate transporter subunit IIC	NA	NA	NA	NA
WP_003642903.1\|2951106_2951403_-	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_003646203.1\|2951415_2951874_-	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_003642905.1\|2952044_2954096_+	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_003646204.1\|2954235_2954859_-	HAD family hydrolase	NA	NA	NA	NA
WP_003643576.1\|2954963_2956022_-	zinc-binding dehydrogenase	NA	NA	NA	NA
WP_003642908.1\|2956102_2957374_-	PTS galactitol transporter subunit IIC	NA	NA	NA	NA
WP_003642909.1\|2957408_2957705_-	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_003642910.1\|2957739_2958210_-	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_003646205.1\|2958536_2959304_+	DeoR/GlpR transcriptional regulator	NA	NA	NA	NA
WP_041142843.1\|2959470_2961861_+	phosphoketolase family protein	NA	NA	NA	NA
WP_003646207.1\|2962018_2962840_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_003646208.1\|2962888_2963296_-	YueI family protein	NA	NA	NA	NA
WP_003646210.1\|2964154_2964991_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_003646211.1\|2965168_2966677_-	sodium:solute symporter	A0A219Y9P9	Aeromonas_phage	1.5e-18	25.3
WP_003646212.1\|2966673_2967870_-	cation:proton antiporter	NA	NA	NA	NA
WP_003646213.1\|2967884_2968616_-	sugar phosphate isomerase/epimerase	NA	NA	NA	NA
WP_041142844.1\|2968821_2969685_-	ROK family protein	NA	NA	NA	NA
WP_003646215.1\|2969957_2970836_+	N-acetylneuraminate lyase	NA	NA	NA	NA
WP_015641133.1\|2970869_2971556_+	N-acetylmannosamine-6-phosphate 2-epimerase	NA	NA	NA	NA
WP_003646217.1\|2971694_2972900_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_015473476.1\|2973172_2974102_-\|transposase	IS30-like element ISLpl1 family transposase	H7BW61	unidentified_phage	8.5e-20	29.9
WP_003642922.1\|2974413_2974785_+	hypothetical protein	NA	NA	NA	NA
WP_003646218.1\|2976474_2977023_-	folate family ECF transporter S component	NA	NA	NA	NA
WP_003643582.1\|2977368_2977614_-	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
WP_003646219.1\|2977959_2979414_+	catalase	A0A2K9L572	Tupanvirus	5.1e-104	46.7
WP_003642927.1\|2979571_2980009_-	transcriptional regulator Spx	NA	NA	NA	NA
WP_003646220.1\|2980364_2981108_-	response regulator transcription factor	NA	NA	NA	NA
WP_003642929.1\|2981100_2982363_-	GHKL domain-containing protein	NA	NA	NA	NA
WP_003643585.1\|2982372_2982501_-	cyclic lactone autoinducer peptide	NA	NA	NA	NA
WP_015641137.1\|2982481_2983078_-	accessory gene regulator AgrB	NA	NA	NA	NA
WP_015641138.1\|2983445_2985560_-\|protease	ATP-dependent Clp protease ATP-binding subunit	K4FB40	Cronobacter_phage	3.1e-118	38.9
WP_003642932.1\|2985950_2986184_-	hypothetical protein	NA	NA	NA	NA
WP_015379577.1\|2987947_2989702_-	pyruvate oxidase	NA	NA	NA	NA
WP_003642935.1\|2989783_2990209_-	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_003646223.1\|2990381_2992193_-	pyruvate oxidase	NA	NA	NA	NA
WP_003641596.1\|2992563_2992941_-	PTS glucitol/sorbitol transporter subunit IIA	NA	NA	NA	NA
WP_003646224.1\|2992968_2993988_-	PTS glucitol/sorbitol transporter subunit IIB	NA	NA	NA	NA
WP_003641598.1\|2994011_2994563_-	PTS glucitol/sorbitol transporter subunit IIC	NA	NA	NA	NA
WP_003641599.1\|2994567_2995074_-	transcriptional regulator GutM	NA	NA	NA	NA
WP_015641142.1\|2995073_2996939_-	HTH domain-containing protein	NA	NA	NA	NA
WP_003646226.1\|2996972_2997776_-	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	1.0e-08	28.1
WP_003641602.1\|2998080_2998965_-	GRP family sugar transporter	NA	NA	NA	NA
WP_015641145.1\|2998994_2999390_-	D-ribose pyranase	NA	NA	NA	NA
WP_003646227.1\|2999392_3000313_-	ribokinase	NA	NA	NA	NA
WP_003643604.1\|3000416_3001415_-	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_015641147.1\|3001820_3002036_-	hypothetical protein	NA	NA	NA	NA
WP_015641148.1\|3002288_3004349_-	hypothetical protein	NA	NA	NA	NA
WP_129556420.1\|3007163_3007938_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_003643605.1\|3008978_3011582_-	bifunctional acetaldehyde-CoA/alcohol dehydrogenase	NA	NA	NA	NA
WP_003641607.1\|3011870_3012332_-	universal stress protein	NA	NA	NA	NA
WP_003641608.1\|3012522_3013068_-	PadR family transcriptional regulator	NA	NA	NA	NA
WP_015641155.1\|3013452_3014382_+\|transposase	IS30-like element ISLpl1 family transposase	H7BW61	unidentified_phage	1.1e-19	29.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_021234

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NC_021224

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection