CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
NC_021494	Lactobacillus reuteri I5007, complete sequence	1 crisprs	csa3,cas14j,cas3,DinG,DEDDh	13
NC_021496	Lactobacillus reuteri I5007 plasmid pLRI02, complete sequence	0 crisprs	NA	1
NC_021495	Lactobacillus reuteri I5007 plasmid pLRI03, complete sequence	0 crisprs	csa3	1
NC_021498	Lactobacillus reuteri I5007 plasmid pLRI06, complete sequence	0 crisprs	NA	0
NC_021504	Lactobacillus reuteri I5007 plasmid pLRI04, complete sequence	0 crisprs	NA	0
NC_021503	Lactobacillus reuteri I5007 plasmid pLRI01, complete sequence	0 crisprs	RT,csa3	0
NC_021497	Lactobacillus reuteri I5007 plasmid pLRI05, complete sequence	0 crisprs	NA	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_021494_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_021494_1

868686-868801

TypeV

Consensus_repeat	Method
AATACTTCTACAAGTGAATCAACAACTAGTAC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_021494_1

>merge|NC_021494|1|868686-868801|CRISPRCasFinder
AGTACATCGACTAGTCAATCGAATACTTCTACAAGTGAATCAACAACTAGTACCTCAAATGTTAGTTCTGGTTCAACATCAAGTAGTACCTCAACCAGCGAATCAAATACTTCTAC

>NC_021494|1|1|868686-868801|CRISPRCasFinder
AGTACATCGACTAGTCAATCGAATACTTCTAC	AAGTGAATCAACAACTAGTACCTCAAATGTTAGTTCTGGTTCAACATCAAGT
AGTACCTCAACCAGCGAATCAAATACTTCTAC

Protein	Signature genes	Signature genes Name	Protein_function
NC_021494.1\|WP_016496756.1\|878922_879498_-\|sigma-70-family-RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|274357
NC_021494.1\|WP_016496747.1\|862672_865021_+\|accessory-Sec-system-translocase-SecA2	unknown	unknown	gnl\|CDD\|163426
NC_021494.1\|WP_003675575.1\|866566_867892_+\|accessory-Sec-system-glycosylation-chaperone-GtfB	unknown	unknown	gnl\|CDD\|274351
NC_021494.1\|WP_016496742.1\|854710_855643_-\|hypothetical-protein	unknown	unknown	unknown
NC_021494.1\|WP_016496743.1\|855719_855944_+\|LPXTG-cell-wall-anchor-domain-containing-protein	unknown	unknown	unknown
NC_021494.1\|WP_155258982.1\|870843_871533_-\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|366760
NC_021494.1\|WP_016496755.1\|878676_878913_-\|hypothetical-protein	unknown	unknown	unknown
NC_021494.1\|WP_041821653.1\|878131_878644_+\|hypothetical-protein	unknown	unknown	unknown
NC_021494.1\|WP_003663508.1\|876264_876450_+\|4-oxalocrotonate-tautomerase	unknown	unknown	gnl\|CDD\|235013
NC_021494.1\|WP_003675585.1\|858768_860280_+\|accessory-Sec-system-protein-Asp1	unknown	unknown	gnl\|CDD\|274740
NC_021494.1\|WP_003675586.1\|857575_858766_+\|accessory-Sec-system-protein-translocase-subunit-SecY2	unknown	unknown	gnl\|CDD\|131966
NC_021494.1\|WP_016496748.1\|867884_868082_+\|hypothetical-protein	unknown	unknown	unknown
NC_021494.1\|WP_003675577.1\|865035_866574_+\|accessory-Sec-system-glycosyltransferase-GtfA	unknown	unknown	gnl\|CDD\|131964
NC_021494.1\|WP_003675581.1\|861781_862669_+\|accessory-Sec-system-protein-Asp3	unknown	unknown	gnl\|CDD\|379726
NC_021494.1\|WP_016496753.1\|876584_878087_+\|glycerol-kinase-GlpK	unknown	unknown	gnl\|CDD\|234594
NC_021494.1\|WP_016496746.1\|860291_861779_+\|accessory-Sec-system-protein-Asp2	unknown	unknown	gnl\|CDD\|274739
NC_021494.1\|WP_003667025.1\|872810_874214_-\|C69-family-dipeptidase	unknown	unknown	gnl\|CDD\|335383
NC_021494.1\|WP_080637864.1\|869021_870725_+\|LPXTG-cell-wall-anchor-domain-containing-protein	unknown	unknown	gnl\|CDD\|380149
NC_021494.1\|WP_003676754.1\|874352_876182_+\|monovalent-cation:proton-antiporter-family-protein	unknown	unknown	gnl\|CDD\|366411
NC_021494.1\|WP_016496752.1\|871471_872692_-\|IS21-family-transposase	unknown	unknown	gnl\|CDD\|226950

Protein	Function_ID	Function_description	E-value
NC_021494.1\|WP_016496756.1\|878922_879498_-\|sigma-70-family-RNA-polymerase-sigma-factor	gnl\|CDD\|274357	TIGR02937, RNA_polymerase_sigma_factor, RNA polymerase sigma factor, sigma-70 family. This model encompasses all varieties of the sigma-70 type sigma factors including the ECF subfamily. A number of sigma factors have names with a different number than 70 (i.e. sigma-38), but in fact, all except for the Sigma-54 family (TIGR02395) are included within this family. Several Pfam models hit segments of these sequences including Sigma-70 region 2 (pfam04542) and Sigma-70, region 4 (pfam04545), but not always above their respective trusted cutoffs.	2.58404e-05
NC_021494.1\|WP_016496747.1\|862672_865021_+\|accessory-Sec-system-translocase-SecA2	gnl\|CDD\|163426	TIGR03714, Protein_translocase_subunit_SecA_2, accessory Sec system translocase SecA2. Members of this protein family are homologous to SecA and part of the accessory Sec system. This system, including both five core proteins for export and a variable number of proteins for glycosylation, operates in certain Gram-positive pathogens for the maturation and delivery of serine-rich glycoproteins such as the cell surface glycoprotein GspB in Streptococcus gordonii. [Protein fate, Protein and peptide secretion and trafficking].	0
NC_021494.1\|WP_003675575.1\|866566_867892_+\|accessory-Sec-system-glycosylation-chaperone-GtfB	gnl\|CDD\|274351	TIGR02919, conserved_hypothetical_protein, accessory Sec system glycosyltransferase GtfB. Members of this protein family are found only in Gram-positive bacteria of the Firmicutes lineage, including several species of Staphylococcus, Streptococcus, and Lactobacillus. [Protein fate, Protein modification and repair].	7.02235e-171
NC_021494.1\|WP_155258982.1\|870843_871533_-\|ATP-binding-protein	gnl\|CDD\|366760	pfam01695, IstB_IS21, IstB-like ATP binding protein. This protein contains an ATP/GTP binding P-loop motif. It is found associated with IS21 family insertion sequences. The function of this protein is unknown, but it may perform a transposase function.	5.70283e-66
NC_021494.1\|WP_003676754.1\|874352_876182_+\|monovalent-cation:proton-antiporter-family-protein	gnl\|CDD\|366411	pfam00999, Na_H_Exchanger, Sodium/hydrogen exchanger family. Na/H antiporters are key transporters in maintaining the pH of actively metabolising cells. The molecular mechanisms of antiport are unclear. These antiporters contain 10-12 transmembrane regions (M) at the amino-terminus and a large cytoplasmic region at the carboxyl terminus. The transmembrane regions M3-M12 share identity with other members of the family. The M6 and M7 regions are highly conserved. Thus, this is thought to be the region that is involved in the transport of sodium and hydrogen ions. The cytoplasmic region has little similarity throughout the family.	5.29561e-47
NC_021494.1\|WP_003663508.1\|876264_876450_+\|4-oxalocrotonate-tautomerase	gnl\|CDD\|235013	PRK02220, PRK02220, 4-oxalocrotonate tautomerase; Provisional.	5.59469e-28
NC_021494.1\|WP_003675585.1\|858768_860280_+\|accessory-Sec-system-protein-Asp1	gnl\|CDD\|274740	TIGR03713, acc_sec_asp1, accessory Sec system protein Asp1. This protein is designated Asp1 because, along with SecY2, SecA2, and other proteins it is part of the accessory secretory protein system. The system is involved in the export of serine-rich glycoproteins important for virulence in a number of Gram-positive species, including Streptococcus gordonii and Staphylococcus aureus. This protein family is assigned to transport rather than glycosylation function, but the specific molecular role is unknown. [Protein fate, Protein and peptide secretion and trafficking, Cellular processes, Pathogenesis].	7.75815e-102
NC_021494.1\|WP_003675586.1\|857575_858766_+\|accessory-Sec-system-protein-translocase-subunit-SecY2	gnl\|CDD\|131966	TIGR02920, preprotein_translocase_SecY_family_protein, accessory Sec system translocase SecY2. Members of this family are restricted to the Firmicutes lineage (low-GC Gram-positive bacteria) and appear to be paralogous to, and much more divergent than, the preprotein translocase SecY. Members include the SecY2 protein of the accessory Sec system in Streptococcus gordonii, involved in export of the highly glycosylated platelet-binding protein GspB. [Protein fate, Protein and peptide secretion and trafficking].	1.42199e-71
NC_021494.1\|WP_003675577.1\|865035_866574_+\|accessory-Sec-system-glycosyltransferase-GtfA	gnl\|CDD\|131964	TIGR02918, lipopolysaccharide_biosynthesis_protein, accessory Sec system glycosylation protein GtfA. Members of this protein family are found only in Gram-positive bacteria of the Firmicutes lineage, including several species of Staphylococcus, Streptococcus, and Lactobacillus. Members are associated with glycosylation of serine-rich glycoproteins exported by the accessory Sec system. [Protein fate, Protein modification and repair].	0
NC_021494.1\|WP_003675581.1\|861781_862669_+\|accessory-Sec-system-protein-Asp3	gnl\|CDD\|379726	pfam15432, Sec-ASP3, Accessory Sec secretory system ASP3. Sec-ASP3 is family of bacterial proteins involved in the Sec secretory system. The family forms part of the accessory SecA2/SecY2 system specifically required to export GspB, a serine-rich repeat cell-wall glycoprotein adhesin encoded upstream in the same operon.	1.34717e-37
NC_021494.1\|WP_016496753.1\|876584_878087_+\|glycerol-kinase-GlpK	gnl\|CDD\|234594	PRK00047, glpK, glycerol kinase GlpK.	0
NC_021494.1\|WP_016496746.1\|860291_861779_+\|accessory-Sec-system-protein-Asp2	gnl\|CDD\|274739	TIGR03712, acc_sec_asp2, accessory Sec system protein Asp2. This protein is designated Asp2 because, along with SecY2, SecA2, and other proteins it is part of the accessory secretory protein system. The system is involved in the export of serine-rich glycoproteins important for virulence in a number of Gram-positive species, including Streptococcus gordonii and Staphylococcus aureus. This protein family is assigned to transport rather than glycosylation function, but the specific molecular role is unknown. [Protein fate, Protein and peptide secretion and trafficking, Cellular processes, Pathogenesis].	1.15923e-145
NC_021494.1\|WP_003667025.1\|872810_874214_-\|C69-family-dipeptidase	gnl\|CDD\|335383	pfam03577, Peptidase_C69, Peptidase family C69.	1.43893e-158
NC_021494.1\|WP_080637864.1\|869021_870725_+\|LPXTG-cell-wall-anchor-domain-containing-protein	gnl\|CDD\|380149	NF012181, MSCRAMM_SdrD, MSCRAMM family adhesin SdrD. Features of this protein family include a YSIRK-type signal peptide at the N-terminus and a variable-length C-terminal region of Ser-Asp (SD) repeats followed by an LPXTG motif for surface immobilization by sortase.	1.08726e-13
NC_021494.1\|WP_016496752.1\|871471_872692_-\|IS21-family-transposase	gnl\|CDD\|226950	COG4584, COG4584, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	1.87571e-36

>NC_021494.1|WP_016496748.1|867884_868082_+|hypothetical-protein
MNKKEDHDQPQSLIQQDALKRLEKVEEEKRQPYKKKKEPINFRSVLMTLLLILVVGMMLIGYFIR
>NC_021494.1|WP_003675575.1|866566_867892_+|accessory-Sec-system-glycosylation-chaperone-GtfB
MLNLFDNFDQASFDFLRSQRTAQIKIPTVVINDDGFLPPEVESPIKYWGNYNVNKKPLYFDHLSLPRYWRILSTAAQGHIYDLDKKRADIIYQATDNTRQVKEVRWLNNNGKVSWIDHYNRYGYRFAQTYYRNEQPAWRKYYDKKNRVFLEWNLIAGDFFLDVDGGYHFPSLIELVKYYLQTRHFKLDHIFYNTLNQGLSVSLNLPADGSDTLFWHEPLSGDELPGNMKFLMENSTRTKHIIFQRYTDWQRIGANLKNNHVDFGFLGTIYPHPRANQLRPQALILTNSDEIVELSTLIKNLPNIKFHIAAVTEMSGKLLAYQQYENVELYPNVSSARVKQLIADCDIYLDINRQNEILDAVRGAFEQNMLIVGFDETLHEPQFVTPQNMFKVNEAQKMSKHIMAALLKPALMKELIDTQRQLASEVSVQDYQRMIGALQSE
>NC_021494.1|WP_003675577.1|865035_866574_+|accessory-Sec-system-glycosyltransferase-GtfA
MTVYNINLGIGWASSGVEYAQSYRAQAFRNLNISAKFVFSDLILGNNIADLTANLGFNADQIIWLYNFFTDIKIAPSTFLLDTFVEQNHLEQRNFSLLPNNGTKELQYKSEEEKLTIVPRYNNREKQTIDQVTYIFNNRLIKRDFYSYTKYATEYYSGEEKDNQVIFREFYNENGTIAYTQHLDGDGHELFEFPDQNYYSKTDLYREMLRKFNFKADDIIILDRMDEDKQLVNGQLIFEHHLPAKLVIPVHADHYDKHYTNDHQVLWNNFYEYQFMHYQDVAAYVVATDRQRDLLASQQKHFNHAKPQINTIPVGSLEHLVKPKGTRKKHSLITASRLANEKHIDWVIEATVAAHKIVSDLTLDIYGEGGERSRLQNLITKNNADSYIKLMGQHDLKDVYQKYETYIAGSTSEGFGLSLMEAVGSGLSMIGFDVPYGNQTFIVDQQNGYLLPYTEDWSNSRKEQLLADAIVKNFTEADLTSFHEKSYSLAESYLTKNVAKQWQQLIGELQHA
>NC_021494.1|WP_016496747.1|862672_865021_+|accessory-Sec-system-translocase-SecA2
MTYPNFRLQKVKHTLAKVNALTAEMRGMSDEELKHQTVLLKKELANGKTVDDILPRAFATIREADYRILGMFPYDVQVMGAIVLNQGNIAEMKTGEGKTLTATMPLYLNALTGKGAMLLTPNGYLAQRDKEQLQPVYEWLGLTVSLGFTNSDQKPLPQVKREWYNSDIVYTTASSLAFDYLFNNLATRIDDQYLRPFNYVIIDEVDAILLDEATSPFVVSSTPMVQSNLYRLTDDFIHTLQPEIDYKLNEDRTAVWLTLHGIRQAQRFFRITDLFTNRYREVYRHIILALRAHFIMENGHDYLVSEGKVVLLDEANGRLKRGVKVSTGLHQAIEAKEQVDLTPNQQVAASITFPSLFGLFNKIAGMSGTVKSDEQEFFEVYKMRVIQIPTRKKVIRRDYPEQIYLTTRQKLIHALDETIELHKAGRPVLLVAGSVENSEIISELLLDQGIPHNVLNAFNVAREADIVKDAGQRGAVTVATNMAGRGTDIKLGAGVKELGGLAVIGTEMLPTRVKLQLAGRAGRQGDPGSSKFYISLEDSYLAKNSTKRFKNYYRQLQKKKTDKQLRSPRLKMSIAMLNDRVAANQQMARSNVNKNEIALKIQRKYLYDRRDQLMRTAHLETEVGKWLSRGISLYLDKKVKWNALELRHLMNQHFTYDVVDLPDNLELDHKKIQKYLEQFCQKELEQKAKVLINSEQLNQFYRSALLNALDSSWTDQMAYLSKLSVIVQPWTTAQRNPKFMYQEKAYQAFEKMFDTVAKKVVDNLMLSTIRLNKDNNLIVHFN
>NC_021494.1|WP_003675581.1|861781_862669_+|accessory-Sec-system-protein-Asp3
MQQFINQGYWESSNAYSAGSDIKINSDYSVLFHNSLMAPGKVIMSWNSVNSYQATKLVPQLPILRNNHKYRLSVNAKAAPIYSLIIRLTFFDAQEHEIDHVEFQQRSIEFVYPPEAVQYRLELINNGLTDLTFQRFEICDADLPVSVHEDVWFHEPINEDVKGKLNLLLIADNKRVRKTYPDLKKYEDYKMQPISVAWQSSADVVAILKQWLISNRIYDANVISTNPKLDQVVLELKMELSTINAVVTNQTDPQSQIADVIYPLLPPTTWSSPVLVNPDWPIIFSVIQEINSKEG
>NC_021494.1|WP_016496746.1|860291_861779_+|accessory-Sec-system-protein-Asp2
MNVLQLGAQNWADKYKIPNEITWNYNTYPQAGIKRFDLVIITEGVQLEDNLWSKLQWQVPPYCVLYSPFAERDLNEAGLNFIKCQEARQIVEEPQELINQLPIRFFQGQSGIRFAPTKLLLNDPVGTFVDGGHLTLKIEADEWTNLGSYQQNVYIDPQRLLKFSLEYSQKSNIKVRLRVFVRPNGGDGNSKDQYLLDFSRNNEEQELPIGLEDAPRFASVSVEVLGKGKLTLGTLHARWSRRDYGEFLAGGKRLIAPVNGEDIPYYFNPGDLRPPLHVYFSGARGLEGFEAYPLFRRNHTPALLFTDPRLAMGQFYTGEAIESQIKDTIIVTLKKLGFDRQQLVLNGISMGTYPAIKLGAQLSPYAINVAKPTVNLGQVALRARLERPDEFDTIFDIDRQLVASLTSEQLEQLDMDFWNLMNQNDLTKTRIYVGYMKNDDYDNLAMKKMQENSAIQSAQLFVSKGFPGRHNDNRAVVQWFVSRLTEINNAFGRGE
>NC_021494.1|WP_003675585.1|858768_860280_+|accessory-Sec-system-protein-Asp1
MDYLVPAWHELLEGWSYTIPKLEFDDAVSHIKVFQTNQKPFSLIITDYQPQLSTKLNQLTISPTQIFSTFDYLQGVHHVDSQIIDYRDFNWPTGAYYNFTNFRVIVMVKENPYAKVTFDTQGKILWVDYLEKDKISRRLLLDSRGFVSREELFENGQPYQYIYYDEQGYWRFKHDVKSDRVEINKRFSELTDYLHYEHLNDLLEEIITKYVLSKFDINQDNLIVTLDDQAVIDQKNYLPYQPIFSLSRWHRYHESLDELKSQELNLVADNNETKNNIKKQSNIDATIIPLFQSRFNLGHSQRSDQEQIGLFIESMTKDEVDKVLELLYQRLLKSPDAIALTVMSYSTEKLQQAQQALENLKQTHQGEFILASEEQNEVEEILTKQIGIPKLTIDTKRISTPAEAGRQLDSLRILIDWGNQLDEFLQISAISTGIPQIYRQPNSQIKNYQNGLICPQISDINKGLNYYLGNLKHWNEALIYNVQLMNQLSAAELQKKWEKVLTK
>NC_021494.1|WP_003675586.1|857575_858766_+|accessory-Sec-system-protein-translocase-subunit-SecY2
MTQKIQLNNLLKRLGATFFILIIYILGCTISLPLVNISTTFRRVLANSSLGIMSFMSGGNLQRLSLFSVGLNPLMISMMIIQLLTMMRLFYFDTFSIKQTMRIQQWLTLIFAIIQSLALTLMLNLTTNLLTSLAVTLMLTAGSLFVVWLGNMNTRFGIGGTITIILFNIISGTLPNLLSSIGKIVGQSYGILWLALIVLASFGLLIFWISFNRAYYPIKMVDTMMSSHDKPIILPLGLNMGAMMTYMVGMSLLMIPTLLANILGPQSLFANPYFEIVLSGILAFALFYFFTFVQFDPKEQAKTMLHNNNYIIGIRPGEPTKKYLQHLVIHVSFFGALLNTIQLSFGLLGSRILGNFAGLAILPMNIIMIVMFMQGIKDQLLMLLFPLRYARLIKDE
>NC_021494.1|WP_016496743.1|855719_855944_+|LPXTG-cell-wall-anchor-domain-containing-protein
MNNGNGLKTTNISESGNQTIMNLNETNSVNSQKPSQQNEKLPQTGNEKHSTAKLLSLISLEAILLLLISKKKKG
>NC_021494.1|WP_016496742.1|854710_855643_-|hypothetical-protein
MLPLSEDELLILLKLSLSDSLAFPLELIDIEVLLLKLREVEADSLELNDINSLILIDIDCELLKLSLIETELLKLSLIETELLRLSLIETELLKLSLIETELLRLSLIETELLKLSLIETELLRLSLIETELLRLSLIETELLRLSLIETELLKLSLIETELLKLSLIETELLKLSLIETELLKLSLALTEAEVLSLALTEAEVDSLALNDVEALSLALTEAEILSLALTEAEVLSLALTEAEVDSLALTEADVLSLALNDVEALSLALTEVEVLSLALTEADVLSLALTEAEVLSLVLTEANVLFARAY
>NC_021494.1|WP_080637864.1|869021_870725_+|LPXTG-cell-wall-anchor-domain-containing-protein
MSTSTASQAQSSTSTSTSTTNDLTASQTVAKARALTLRLFAALNTTANTYGTPIISSDGLSVTYYGKGTDSVSNNPIYYIVKVTNNLNGTVSFTITYTLKDPITGEISAGPSSRSDVYHFGNSIYAKTATFNMGSGYSNGTLTSVVTLDANGNTVYNMTSGVHLYNTSGNSYDFYDLDAQGQGLTYQNINSSTRYNNYGKNKVISEQITVTFNYNESSSNLNYTIAPYVSYTSGLNEGNYFTNSVSGTEPSKSNSTSVSQSTSKQQSTSASRSTSNSQSVSTSKQVSQSNSQSISASQAASTSLSQSASKSASVSASESTSASVSASESTSASVSASESTSASLSSGESASSSASASASISSSLSTSASVSASISGSNSTSDSPINPQPDNPSTSISDSESMSISTSESISVSASGSTSISDSGSTSLSASDSTSTSISGSSSNGSESTSGSQSPVTPFPDNSGSTSMSTNDSGNDSISLSLSITNSTNTSSLENTSASVTDKHMTVDLTAQNSVENGNANKPSQQNKKLPQTGNASQTTAELLGLMSLEAVLLLLIAKKKKHNEDK
>NC_021494.1|WP_155258982.1|870843_871533_-|ATP-binding-protein
MKKLTSICLIISVFTIGLENRMNQYQKLVDKEITYQQQKSLKRRIKRARFPIIKLLSDFDYQFQPSINQQQIAEFATMSFLDNQENIVFIGSPGVGKTHLSIGLGIEACRQDVRTLFINCHELILRLKAAQGKQHLERVMRRYERYDLLIIDELGYLPISAEEAKLLFQLINGRYERKSTIITTNVPLSSWGAVLHSTATAEAILDRLVYHSHVIKIKGKSYRLASVNS
>NC_021494.1|WP_016496752.1|871471_872692_-|IS21-family-transposase
MRKDVYERMRYFVAEKIKPNYSAIARQYGVDPRTVKTAYLRAQNGETIVRNQRKRRSKLDGFQDIIKDKYTAGCSARAIYDFIVEKGFTGKYTIVKDYCRHFRKAQTKKATIRVEHTMGLSAQVDWKEQVTMTDQNGVPHTFSIFLYVLPYSKFKFLKLTLDQKQDTLFKCLFEAFKATGGIPKEIWFDNMSTVVDHKLSDFHHHRFNERFLSFSHDAGFHPIACRPFRPQTKGCVEALARTMGRLKPYDGEFSTINDLNDIVDRLAKRLNHEKSQSNNQKPVELWTKEKEHFRSLNHDLVRYFHSDQTRKVSRDSMIRFQNHQYSVSPNYIGKEVEIKLTPDDKTIHIFYQGIEIQKHDLTNKQFNYDLHDKHAILKSDLMVDKTDEEINQYMLNNLSIYDRIGE
>NC_021494.1|WP_003667025.1|872810_874214_-|C69-family-dipeptidase
MGNKLTACTSILIGKDASIDGTIMIGRNEDAKAAWPKHMVVHQRGEMPNHFISKDTRLELDLPEESARYTATPEWTDKDGLFEEDGINEYDVAMSATESAYSNALVLGYDPLVENGLNEEAMITVVLPYVKTAREGVQRLGNLIAKYGTGETNGVLFADNDEAWYFETGAGHYWVAQRIPDDSYAVVANQLAIQEIDFNDSANFMFHPGIQEFVEKHDLNPDPSTFNFRKIFGTADRSDAIYSEPRVWAGHQMFSPRQATDETPESTELPFIMKPDHKLSIFDAQNYLSNHYEGTEFDPLGHGEHAHKYRPISLAKTQESHILQMNRPGANIHWLAMGVAAESTYVPFFNGITDTPAPYKRGKLPAQLNSAYWIFKHTSVLVDSHLHDFLPLLRDVQKERNAAAIKMIAETDRRLPSLKGEARAIFLTRQSDDYATDTLNAYKKLSLELITKMTDYCELNFNTDENL
>NC_021494.1|WP_003676754.1|874352_876182_+|monovalent-cation:proton-antiporter-family-protein
MQQLSLLIVMLAALIIPIIMARFKVSSIPTAIAEIITGIILGKSFLNIVNPNWTLNMMSSMGVIMLMFLSGMEINFDLFRKTPGKKRDSKSPVVMASQAFGLIIAAALIIAIVISRLGLFKDVLLATIIFSTVALGVVIATLKEKDILQKPVGQTILLTAVLGEVVPMLALTFYASINGGNARRLWLIVLLFLAAFILLRRFKQPYVWFNKISKSTTQLDVRLAFFLIFALVTIAETVGAENILGAFLAGMVMKLLQPSETTEDRLNSIGYGFLIPFFFIMTGDRLDLKNLFANHQALALIPILVIGFILAKLPTMIIYRRRFKLRNSFAGSFLVATTITLVLPTLEVARNLHAITQAQSAAFTLAAVIVCIIAPIAFNSTYKLEKADLIKQKVNFIGTNTLTVPISQQLYKNWYDVRMVTDNENNFKIYNSQVKHLEYMPKLDAESLEQGGYFDCDIIVVGFLNDHKSARLAQIAKEHGVKRVIASQNNPRLDPKDVSALREKGIEIFNSFNVQSSVLRALIESPLILRMLTDTEAGLYEATLLNSRYSGRELHTLPFVNKITISRIFRNRKPIDPHGDTVLEYGDHILFTGDRQAAEEVRENLQGRK
>NC_021494.1|WP_003663508.1|876264_876450_+|4-oxalocrotonate-tautomerase
MPLVHIDLIEGRTDEQLKALVKDVTAAISKDANVPAERVHIVLNEMRKDRYSVAGKMVSDK
>NC_021494.1|WP_016496753.1|876584_878087_+|glycerol-kinase-GlpK
MSEQQYIMAIDQGTTSSRAIIFDHDGNKVAISQQEFPQYFPQPGWVEHDPLEIWDSVQSVISNVMIKSQIKPYKIAAIGITNQRETTVIWDRHTGKPIYNAIVWQSKQTSDIAEQLIKDGYKEMIHQKTGLVIDSYFAATKIKWILDHVPGAREKAAKGDLMFGTIDTWLLWNLSGRRVHATDVTNASRTMLFNIHTLDWDQDILDLLGIPQSLLPEVKPSSAIYGYTGDYHFYGVQIPIAGIAGDQQAALFGQAAYDKGSIKNTYGTGAFIVMNTGLEPTLSDNGLLTTIAYGLDGQIHYALEGSIFVAGSAVQWLRDGLKMFNKASESEQMAVDAKTTGGVYVVPAFTGLGAPYWDQEVRGAMFGLTRGTERGHIIRATLEAIAYQTKDVVDTMVKDTQLPLTALTVNGGASRNNFMMQFQADILQTPIKRAAMEETTALGAAFLAGLAVDFWEDQDELRKLSRIGDQFDPQMDSQKAADLYRGWQRAIAAAQFYGRN
>NC_021494.1|WP_041821653.1|878131_878644_+|hypothetical-protein
MREMKMKTPVQMTDDLARFIKENREDAAYPHESLYVDLLEQWKVLSRYQLAYADKESKRLYNAYWNSMARWYEVFNNERDNLLEPTALPSDELMDFYAGLIEDLMDHVLSLVPPSPHSTIIKLTDFRVLLSNELQKITQLDLGIQGPIDFAMIMDYWKMLGESFDREKIK
>NC_021494.1|WP_016496755.1|878676_878913_-|hypothetical-protein
MEKHEIDRQAKWLHIKYDGEDRDDECVNELSIYQNADESELQMLVSNIDFDNISHDNTFALTKEDAKVLIDYLQKWIN
>NC_021494.1|WP_016496756.1|878922_879498_-|sigma-70-family-RNA-polymerase-sigma-factor
MNYKKISDGLTFLMNDKRITIVYGVLKSLGVSPRRDDYDDFVQDASIIFAQAYADFLQEKEEVENERDLMYFAYQRMWWRLLDRLRRQQLENFLFNYTLDSEEDDHDYGKTMVDHSATAPFAHLENSDFLNYLYHHCPRVQQRYLIAKLNHHLSDRQIADEYRVSRAAVSQWRRGVITRAHQLRAKMKGEF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

19221 : 72365

Bacillus_phage(33.33%)

transposase,protease

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016496345.1\|19221_20442_-\|transposase	IS21 family transposase	A0A059NT83	Lactococcus_phage	4.2e-83	43.3
WP_016496347.1\|21062_21497_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_016496348.1\|21584_23306_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.4e-113	44.6
WP_003675551.1\|23650_24358_+	response regulator transcription factor	W8CYM9	Bacillus_phage	4.3e-40	39.6
WP_041821547.1\|24371_26237_+	cell wall metabolism sensor histidine kinase WalK	W8CYF6	Bacillus_phage	5.5e-34	34.7
WP_016496350.1\|26214_27510_+	hypothetical protein	NA	NA	NA	NA
WP_016496351.1\|27522_28365_+	two-component system regulatory protein YycI	NA	NA	NA	NA
WP_016496352.1\|28382_29189_+	MBL fold metallo-hydrolase	A0A2H4J3R0	uncultured_Caudovirales_phage	6.4e-32	31.6
WP_016496353.1\|29292_30573_+	trypsin-like peptidase domain-containing protein	A0A1B1IT49	uncultured_Mediterranean_phage	2.8e-21	29.6
WP_003669518.1\|30664_31174_+	phosphatidylglycerophosphatase A	A0A291I9Q0	Lactobacillus_phage	8.2e-41	51.9
WP_016496354.1\|31481_32456_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_011953354.1\|32924_33404_+	23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH	NA	NA	NA	NA
WP_035170446.1\|33546_33765_+	hypothetical protein	NA	NA	NA	NA
WP_019251837.1\|33832_34375_+	NAD(P)H-dependent oxidoreductase	NA	NA	NA	NA
WP_016496357.1\|34593_35766_+	iron-containing alcohol dehydrogenase	NA	NA	NA	NA
WP_003665279.1\|36009_36873_+	sugar transporter	NA	NA	NA	NA
WP_016496358.1\|36987_37764_-	VOC family protein	NA	NA	NA	NA
WP_016496359.1\|37765_38578_-	NAD(P)-binding domain-containing protein	A0A1X9I6T5	Streptococcus_phage	1.1e-20	33.0
WP_016496361.1\|39074_40034_+\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_016496362.1\|40166_41249_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_016496363.1\|41250_41949_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.0e-37	38.4
WP_016496364.1\|41935_43171_+	ABC transporter permease	NA	NA	NA	NA
WP_016496365.1\|43310_43970_+	hypothetical protein	NA	NA	NA	NA
WP_003668074.1\|44034_45003_-\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_041821552.1\|45235_46630_+	L,D-transpeptidase family protein	NA	NA	NA	NA
WP_051111508.1\|46919_47435_+	hypothetical protein	NA	NA	NA	NA
WP_016496368.1\|47455_48406_-\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_016496369.1\|48402_48543_-	hypothetical protein	NA	NA	NA	NA
WP_003669548.1\|48550_48979_-	OsmC family protein	NA	NA	NA	NA
WP_016496370.1\|49046_50042_-	D-2-hydroxyacid dehydrogenase	M1HKI4	Acanthocystis_turfacea_Chlorella_virus	6.5e-34	31.1
WP_016496371.1\|50043_51231_-	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_003670244.1\|51736_51958_+	hypothetical protein	NA	NA	NA	NA
WP_016496372.1\|52075_54313_+\|protease	ATP-dependent Clp protease ATP-binding subunit	H6X3M6	Enterobacteria_phage	8.4e-122	39.4
WP_003675510.1\|55226_58121_+	hypothetical protein	NA	NA	NA	NA
WP_079375840.1\|58205_58832_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_016496373.1\|58929_60393_+	cardiolipin synthase	NA	NA	NA	NA
WP_016496374.1\|60507_64290_+	PD-(D/E)XK nuclease family protein	NA	NA	NA	NA
WP_016496375.1\|64289_68468_+	helicase-exonuclease AddAB subunit AddA	A7KV33	Bacillus_phage	1.2e-17	24.2
WP_003675501.1\|68468_69404_+	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_016496376.1\|69467_70646_+	acetyl-CoA C-acetyltransferase	NA	NA	NA	NA
WP_013924000.1\|70946_72365_+\|transposase	ISLre2-like element ISLre2 family transposase	NA	NA	NA	NA

DBSCAN-SWA_2

117101 : 232479

101

unidentified_phage(13.33%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016496393.1\|117101_118232_+\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	2.7e-36	31.9
WP_003668074.1\|118866_119835_-\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_003675442.1\|120117_120369_+	hypothetical protein	NA	NA	NA	NA
WP_003675440.1\|120465_121146_+	response regulator transcription factor	W8CYM9	Bacillus_phage	2.5e-29	33.8
WP_016496396.1\|121142_122474_+	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	3.4e-22	27.3
WP_016496397.1\|122578_123229_+	PepSY domain-containing protein	NA	NA	NA	NA
WP_003669426.1\|125389_125710_-	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_003675433.1\|125835_126429_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_003675432.1\|126578_127259_+	hypothetical protein	NA	NA	NA	NA
WP_003675431.1\|127260_128235_+	hypothetical protein	NA	NA	NA	NA
WP_003675430.1\|128468_129341_+	aldo/keto reductase	A0A2H4PQR8	Staphylococcus_phage	2.1e-52	40.2
WP_003675429.1\|129443_129929_+	NAD(P)H-dependent oxidoreductase	NA	NA	NA	NA
WP_003675428.1\|129987_130857_-	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	7.0e-08	31.0
WP_016496401.1\|130973_131504_+	acetyltransferase	NA	NA	NA	NA
WP_003665145.1\|131512_131716_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_003675425.1\|131716_132577_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_016496402.1\|132683_133223_+	phenolic acid decarboxylase	NA	NA	NA	NA
WP_003675423.1\|133265_133796_+	PadR family transcriptional regulator	NA	NA	NA	NA
WP_035161721.1\|133798_134398_+	NAD(P)H-binding protein	NA	NA	NA	NA
WP_003670156.1\|134497_135499_+	DUF1002 domain-containing protein	NA	NA	NA	NA
WP_003675421.1\|135557_136547_-	asparaginase	NA	NA	NA	NA
WP_003675420.1\|137618_138497_+	aldo/keto reductase	A0A2H4PQR8	Staphylococcus_phage	8.0e-52	40.9
WP_016496405.1\|138597_139176_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_016496408.1\|140408_141053_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_003669411.1\|141158_141530_+	hypothetical protein	NA	NA	NA	NA
WP_003669410.1\|141631_142303_+	type 1 glutamine amidotransferase	NA	NA	NA	NA
WP_016496409.1\|142375_143176_-	EAL domain-containing protein	NA	NA	NA	NA
WP_016496411.1\|143586_144510_+\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	5.1e-33	31.7
WP_003668074.1\|145075_146044_-\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_003675410.1\|146744_147425_+	EAL domain-containing protein	NA	NA	NA	NA
WP_003675409.1\|147493_148792_-\|tRNA	asparagine--tRNA ligase	A0A2P1EMB4	Moumouvirus	1.3e-55	31.5
WP_016496414.1\|148811_149822_-	aspartate--ammonia ligase	A0A1C9C5F0	Heterosigma_akashiwo_virus	5.5e-65	43.4
WP_016496415.1\|150198_150759_-	folate family ECF transporter S component	NA	NA	NA	NA
WP_016496416.1\|150981_153513_-	M1 family metallopeptidase	A0A0P0IY26	Acinetobacter_phage	2.4e-64	25.2
WP_003675401.1\|153659_154301_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_003675399.1\|154517_155840_+	C1 family peptidase	R4TV59	Phaeocystis_globosa_virus	1.5e-65	31.0
WP_003675396.1\|155989_157165_+	MFS transporter	NA	NA	NA	NA
WP_016496417.1\|157176_158490_+	hypothetical protein	NA	NA	NA	NA
WP_016496420.1\|159000_159603_-	nitroreductase family protein	NA	NA	NA	NA
WP_016496421.1\|159700_160012_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_003675390.1\|160139_160796_+	NAD(P)H-binding protein	NA	NA	NA	NA
WP_016496422.1\|160976_161414_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_003669379.1\|161542_161776_+	cytochrome b5	NA	NA	NA	NA
WP_016496423.1\|161947_162916_+\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_003665104.1\|162990_163209_+	cytochrome b5	NA	NA	NA	NA
WP_003675383.1\|163221_163467_+	cytochrome b5	NA	NA	NA	NA
WP_016496424.1\|163524_164661_-	5-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase	A0A218MNE0	uncultured_virus	6.0e-84	45.5
WP_003675378.1\|165421_166378_+	ketopantoate reductase family protein	NA	NA	NA	NA
WP_080637861.1\|166562_167957_-	amino acid permease	NA	NA	NA	NA
WP_143456168.1\|168269_169925_+	MFS transporter	A0A1V0QG10	Shearwaterpox_virus	4.3e-06	33.8
WP_142499017.1\|171232_172084_+\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	9.2e-13	28.1
WP_011953599.1\|172157_173963_-\|tRNA	threonine--tRNA ligase	A0A2K9L6B6	Tupanvirus	7.8e-86	32.1
WP_016496430.1\|174291_174975_-	hypothetical protein	NA	NA	NA	NA
WP_171945898.1\|175240_176881_-	Nramp family divalent metal transporter	NA	NA	NA	NA
WP_003665087.1\|177405_178416_+	zinc-dependent alcohol dehydrogenase family protein	NA	NA	NA	NA
WP_003675363.1\|178677_179190_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_003675361.1\|179200_180259_+	ABC transporter permease	NA	NA	NA	NA
WP_016496431.1\|180276_180963_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.5e-32	38.0
WP_016496432.1\|181061_183044_+	ABC transporter ATP-binding protein/permease	G9BWD6	Planktothrix_phage	1.9e-32	40.7
WP_003675355.1\|183273_183510_+	hypothetical protein	NA	NA	NA	NA
WP_003675352.1\|183612_183930_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_016496434.1\|184093_185791_-	LysM peptidoglycan-binding domain-containing protein	A0A0A7NU10	Lactobacillus_phage	1.2e-24	44.3
WP_003675348.1\|186218_187163_+	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	4.4e-16	26.5
WP_003675345.1\|187294_187480_-	hypothetical protein	NA	NA	NA	NA
WP_003675343.1\|187705_188326_+	hypothetical protein	NA	NA	NA	NA
WP_003675341.1\|188327_189524_+	MFS transporter	A0A2H4PQR6	Staphylococcus_phage	3.4e-53	34.8
WP_003675339.1\|189845_191123_+\|tRNA	histidine--tRNA ligase	NA	NA	NA	NA
WP_016496435.1\|191244_191739_-	hypothetical protein	NA	NA	NA	NA
WP_016496436.1\|191842_192481_-	NAD(P)H-hydrate epimerase	NA	NA	NA	NA
WP_003675334.1\|192678_194064_-	L,D-transpeptidase	NA	NA	NA	NA
WP_016496437.1\|194256_195675_+\|transposase	ISLre2-like element ISLre2 family transposase	NA	NA	NA	NA
WP_003669331.1\|196197_196854_+	L,D-transpeptidase	NA	NA	NA	NA
WP_016496438.1\|197052_197634_-	hypothetical protein	NA	NA	NA	NA
WP_016496439.1\|197704_198916_+	D-alanyl-D-alanine carboxypeptidase	NA	NA	NA	NA
WP_003675325.1\|198983_199838_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_003675324.1\|200001_201123_-	glycerol dehydrogenase	NA	NA	NA	NA
WP_016496440.1\|201278_203408_-	LTA synthase family protein	W6LM83	Streptococcus_phage	1.6e-159	45.7
WP_016496441.1\|203533_203797_-	hypothetical protein	NA	NA	NA	NA
WP_003675320.1\|203928_204582_+	phosphoglycerate mutase family protein	NA	NA	NA	NA
WP_041821568.1\|204801_205401_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_123835781.1\|205337_206243_+\|transposase	IS3 family transposase	A0A0C5AEA5	Paenibacillus_phage	7.8e-18	29.9
WP_003675317.1\|208004_209414_-	Na+/H+ antiporter NhaC	NA	NA	NA	NA
WP_016496446.1\|209725_211054_-	purine permease	Q9KX94	Enterobacteria_phage	3.5e-35	30.8
WP_016496447.1\|211422_212856_+	C69 family dipeptidase	NA	NA	NA	NA
WP_016496448.1\|213006_214527_+\|transposase	IS1182 family transposase	A0ZS58	Staphylococcus_virus	1.0e-94	39.1
WP_016496449.1\|214838_215756_-	magnesium transporter CorA family protein	NA	NA	NA	NA
WP_016496450.1\|215902_216823_+	RluA family pseudouridine synthase	NA	NA	NA	NA
WP_003665044.1\|216841_217597_+	TerC family protein	S5MAL1	Bacillus_phage	2.4e-41	41.8
WP_003675303.1\|217598_217916_+	thioredoxin	A0A1X9I9P5	Staphylococcus_phage	2.7e-18	37.8
WP_003675301.1\|217984_219307_-	MATE family efflux transporter	NA	NA	NA	NA
WP_016496451.1\|219661_223162_+	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_003675296.1\|223220_223553_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_016496452.1\|223597_224161_-	TMEM165/GDT1 family protein	NA	NA	NA	NA
WP_016496453.1\|224226_224991_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	5.9e-11	25.4
WP_003675292.1\|224983_225883_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_003675290.1\|225879_226875_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_016496454.1\|227248_228274_-	C40 family peptidase	A0A1J0GW44	Streptomyces_phage	4.2e-12	44.9
WP_016496411.1\|228650_229574_+\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	5.1e-33	31.7
WP_051111511.1\|229715_229961_+	hypothetical protein	NA	NA	NA	NA
WP_016496455.1\|229953_231084_-\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	4.6e-36	31.9
WP_003668074.1\|231510_232479_+\|transposase	IS30 family transposase	NA	NA	NA	NA

DBSCAN-SWA_3

255235 : 286969

unidentified_phage(27.27%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013923736.1\|255235_256366_-\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	7.1e-37	32.1
WP_016496423.1\|257040_258009_+\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_016496466.1\|257994_258948_-	cysteine synthase A	A0A1X9I5K7	Streptococcus_phage	4.4e-112	65.1
WP_016496467.1\|258953_259781_-	homoserine O-succinyltransferase	NA	NA	NA	NA
WP_016496361.1\|259926_260886_+\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_016496469.1\|261091_263020_-	FtsX-like permease family protein	NA	NA	NA	NA
WP_016496470.1\|263019_263775_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.5e-27	34.5
WP_016496471.1\|263887_264868_-	sensor histidine kinase	NA	NA	NA	NA
WP_041821577.1\|264860_265460_-	response regulator transcription factor	W8CYM9	Bacillus_phage	1.5e-17	35.3
WP_003675240.1\|265539_266382_+	aldo/keto reductase	A0A2H4PQR8	Staphylococcus_phage	8.7e-56	41.3
WP_003675238.1\|266575_267328_-	nicotinamide mononucleotide transporter	A0A2H4PB74	Lactobacillus_phage	4.7e-93	70.2
WP_016496473.1\|267578_268076_-	transcription elongation factor GreA	NA	NA	NA	NA
WP_003675234.1\|268182_269304_+	hypothetical protein	NA	NA	NA	NA
WP_016496474.1\|269326_269653_+	hypothetical protein	NA	NA	NA	NA
WP_003664967.1\|269709_269934_-	hypothetical protein	NA	NA	NA	NA
WP_016496475.1\|269947_270454_-	YbhB/YbcL family Raf kinase inhibitor-like protein	NA	NA	NA	NA
WP_016496476.1\|270489_271272_-	tyrosine-protein phosphatase	NA	NA	NA	NA
WP_003675226.1\|271301_272270_-	SGNH/GDSL hydrolase family protein	A0A2H4PRU1	Lactococcus_phage	5.9e-32	31.9
WP_003675223.1\|272464_273643_+	galactokinase	NA	NA	NA	NA
WP_003675221.1\|273669_275121_+	UDP-glucose--hexose-1-phosphate uridylyltransferase	NA	NA	NA	NA
WP_003675220.1\|275158_276151_+	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	2.4e-12	23.9
WP_003675218.1\|276220_276832_-	DedA family protein	NA	NA	NA	NA
WP_016496477.1\|277081_278395_+	cation:dicarboxylase symporter family transporter	NA	NA	NA	NA
WP_016496411.1\|278552_279476_+\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	5.1e-33	31.7
WP_003669853.1\|279508_279979_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_003669854.1\|280183_280648_+	universal stress protein	NA	NA	NA	NA
WP_016496478.1\|280726_281101_+	low temperature requirement protein A	NA	NA	NA	NA
WP_072575277.1\|281113_281737_+	low temperature requirement protein A	NA	NA	NA	NA
WP_041816996.1\|281826_282225_+\|transposase	IS200/IS605 family transposase	A0A286QN76	Streptococcus_phage	1.1e-45	62.1
WP_003675214.1\|283870_285823_-	MFS transporter	NA	NA	NA	NA
WP_016496481.1\|286045_286969_-\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	3.9e-33	31.7

DBSCAN-SWA_4

385079 : 438459

unidentified_phage(18.18%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016497145.1\|385079_386045_-\|transposase	IS30 family transposase	H7BW47	unidentified_phage	1.9e-14	30.7
WP_016496526.1\|386447_387062_+	hypothetical protein	NA	NA	NA	NA
WP_003664767.1\|388169_388646_+	S-ribosylhomocysteine lyase	NA	NA	NA	NA
WP_003675003.1\|388761_389625_+	metal ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003675000.1\|391861_393043_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_003664757.1\|393299_393857_+	elongation factor P	NA	NA	NA	NA
WP_016496533.1\|394206_395163_+\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_016496534.1\|395185_395896_-	response regulator transcription factor	W8CYM9	Bacillus_phage	7.7e-13	37.2
WP_041821599.1\|396021_396894_+	phosphate ABC transporter substrate-binding protein	E3SII0	Synechococcus_phage	1.3e-09	25.9
WP_003674993.1\|396898_397798_+	phosphate ABC transporter permease subunit PstC	NA	NA	NA	NA
WP_016496536.1\|397797_398679_+	phosphate ABC transporter permease PstA	NA	NA	NA	NA
WP_016496537.1\|398689_399445_+	phosphate ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.8e-15	29.6
WP_016496538.1\|399455_400160_+	phosphate signaling complex protein PhoU	NA	NA	NA	NA
WP_016496539.1\|401331_402195_+	efflux RND transporter permease subunit	NA	NA	NA	NA
WP_013923866.1\|403512_404688_+\|transposase	transposase	A0A0P0ICY9	Lactobacillus_phage	2.7e-119	55.7
WP_016496544.1\|405509_406649_+	glycoside hydrolase	NA	NA	NA	NA
WP_041821602.1\|406645_407410_-	NADPH-dependent oxidoreductase	NA	NA	NA	NA
WP_016496411.1\|407433_408357_-\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	5.1e-33	31.7
WP_016496546.1\|408557_410330_-	oleate hydratase	NA	NA	NA	NA
WP_016496547.1\|410484_411828_+	potassium uptake protein	NA	NA	NA	NA
WP_016496548.1\|411820_412489_+	TrkA family potassium uptake protein	NA	NA	NA	NA
WP_016496549.1\|412506_413052_+	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_016496550.1\|413309_414614_-	Nramp family divalent metal transporter	NA	NA	NA	NA
WP_016496551.1\|414616_415549_-	ferrochelatase	NA	NA	NA	NA
WP_016496552.1\|415856_416771_+	cysteine synthase family protein	A0A1X9I5K7	Streptococcus_phage	8.8e-62	41.8
WP_016496554.1\|417587_418616_-	putative sulfate exporter family transporter	NA	NA	NA	NA
WP_016496555.1\|418795_419512_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_016496556.1\|419719_421189_-	ABC-F type ribosomal protection protein	A0A2I4R674	Erysipelothrix_phage	1.2e-23	24.9
WP_013924000.1\|421505_422924_-\|transposase	ISLre2-like element ISLre2 family transposase	NA	NA	NA	NA
WP_016496557.1\|423012_423975_-	Dyp-type peroxidase	S4VXK8	Pandoravirus	7.7e-16	27.5
WP_016496558.1\|424109_425627_+	YfcC family protein	NA	NA	NA	NA
WP_016496559.1\|425639_426974_+	Sapep family Mn(2+)-dependent dipeptidase	NA	NA	NA	NA
WP_016496560.1\|427271_428489_+	MFS transporter	NA	NA	NA	NA
WP_003668877.1\|428515_429973_+	sucrose phosphorylase	NA	NA	NA	NA
WP_016496561.1\|430124_430922_-	serine hydrolase	NA	NA	NA	NA
WP_003674953.1\|432198_433443_+	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	1.1e-11	25.6
WP_003668870.1\|433798_434239_+	hypothetical protein	NA	NA	NA	NA
WP_003674951.1\|434315_435353_-	galactose mutarotase	NA	NA	NA	NA
WP_003674949.1\|435470_435698_+	hypothetical protein	NA	NA	NA	NA
WP_016496565.1\|435720_437118_-	DUF2252 domain-containing protein	NA	NA	NA	NA
WP_016496566.1\|437298_438459_-\|transposase	transposase	Q5ULQ4	Lactobacillus_virus	3.9e-147	66.7

DBSCAN-SWA_5

628680 : 644091

Enterococcus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016496652.1\|628680_629655_+	glycosyltransferase family 2 protein	A8CG95	Salmonella_phage	1.2e-53	38.9
WP_016496654.1\|629794_630853_+	DUF2029 domain-containing protein	NA	NA	NA	NA
WP_016496655.1\|630963_633285_+	glucosaminidase domain-containing protein	A0A249Y0X5	Enterococcus_phage	1.5e-33	39.8
WP_016496656.1\|633431_634301_+	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	4.1e-101	59.7
WP_016496657.1\|634314_634896_+	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	1.3e-37	45.1
WP_016496658.1\|634907_635948_+	dTDP-glucose 4,6-dehydratase	H9NC62	Sphingomonas_phage	2.1e-51	37.1
WP_016496659.1\|636094_636934_+	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	1.4e-34	40.1
WP_016496660.1\|637005_639627_+	KxYKxGKxW signal peptide domain-containing protein	A0A249XUP0	Enterococcus_phage	2.1e-07	33.1
WP_003674728.1\|639698_640817_+	AI-2E family transporter	NA	NA	NA	NA
WP_016496661.1\|640857_642327_-	LCP family protein	NA	NA	NA	NA
WP_003668625.1\|642513_644091_+	peptide chain release factor 3	A0A1B0RXH7	Streptococcus_phage	6.3e-31	26.1

DBSCAN-SWA_6

834208 : 966755

Lactococcus_phage(20.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016496732.1\|834208_835585_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	6.0e-38	34.8
WP_016496733.1\|835652_836633_-	polyprenyl synthetase family protein	NA	NA	NA	NA
WP_016496734.1\|836713_837613_+	prenyltransferase	NA	NA	NA	NA
WP_003675609.1\|837648_838350_-	bifunctional demethylmenaquinone methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol methylase UbiE	A0A1X9I6N4	Streptococcus_phage	1.0e-04	33.3
WP_003675607.1\|838370_839606_-	MFS transporter	NA	NA	NA	NA
WP_003675605.1\|839724_840603_+	metallophosphoesterase family protein	NA	NA	NA	NA
WP_003667006.1\|840748_841018_+	30S ribosomal protein S14	NA	NA	NA	NA
WP_003675603.1\|841249_841714_+	hypothetical protein	NA	NA	NA	NA
WP_003675601.1\|841713_841941_+	hypothetical protein	NA	NA	NA	NA
WP_003675599.1\|842011_842674_+	serine dehydratase	NA	NA	NA	NA
WP_003675597.1\|842683_843565_+	L-serine ammonia-lyase, iron-sulfur-dependent, subunit alpha	NA	NA	NA	NA
WP_003675595.1\|843665_844229_+	peroxiredoxin	NA	NA	NA	NA
WP_003675593.1\|844242_845910_+	FAD-dependent oxidoreductase	G3MA85	Bacillus_virus	1.0e-55	37.5
WP_016496742.1\|854710_855643_-	hypothetical protein	NA	NA	NA	NA
WP_016496743.1\|855719_855944_+	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_003675586.1\|857575_858766_+	accessory Sec system protein translocase subunit SecY2	NA	NA	NA	NA
WP_003675585.1\|858768_860280_+	accessory Sec system protein Asp1	NA	NA	NA	NA
WP_016496746.1\|860291_861779_+	accessory Sec system protein Asp2	NA	NA	NA	NA
WP_003675581.1\|861781_862669_+	accessory Sec system protein Asp3	NA	NA	NA	NA
WP_016496747.1\|862672_865021_+	accessory Sec system translocase SecA2	NA	NA	NA	NA
WP_003675577.1\|865035_866574_+	accessory Sec system glycosyltransferase GtfA	NA	NA	NA	NA
WP_003675575.1\|866566_867892_+	accessory Sec system glycosylation chaperone GtfB	NA	NA	NA	NA
WP_016496748.1\|867884_868082_+	hypothetical protein	NA	NA	NA	NA
WP_016496749.1\|868337_868886_+	serine-rich glycoprotein adhesin	NA	NA	NA	NA
WP_080637864.1\|869021_870725_+	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_155258982.1\|870843_871533_-	ATP-binding protein	A0A059NT77	Lactococcus_phage	2.9e-49	50.0
WP_016496752.1\|871471_872692_-\|transposase	IS21 family transposase	A0A059NT83	Lactococcus_phage	1.2e-85	44.3
WP_003667025.1\|872810_874214_-	C69 family dipeptidase	NA	NA	NA	NA
WP_003676754.1\|874352_876182_+	monovalent cation:proton antiporter family protein	NA	NA	NA	NA
WP_003663508.1\|876264_876450_+	4-oxalocrotonate tautomerase	NA	NA	NA	NA
WP_016496753.1\|876584_878087_+	glycerol kinase GlpK	NA	NA	NA	NA
WP_041821653.1\|878131_878644_+	hypothetical protein	NA	NA	NA	NA
WP_016496755.1\|878676_878913_-	hypothetical protein	NA	NA	NA	NA
WP_016496756.1\|878922_879498_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_143454404.1\|879735_879933_+	hypothetical protein	NA	NA	NA	NA
WP_035167654.1\|880054_880453_+\|transposase	IS200/IS605 family transposase	A0A286QN76	Streptococcus_phage	3.9e-46	62.9
WP_016496758.1\|880452_881628_+\|transposase	transposase	A0A0P0ICY9	Lactobacillus_phage	1.9e-117	55.4
WP_016496760.1\|882601_883597_+	LCP family protein	NA	NA	NA	NA
WP_016496761.1\|883617_884496_+	exopolysaccharide biosynthesis protein	NA	NA	NA	NA
WP_016496762.1\|884508_885252_+	CpsD/CapB family tyrosine-protein kinase	NA	NA	NA	NA
WP_016496763.1\|885271_886201_+	GDP-mannose 4,6-dehydratase	A0A1V0SKV4	Klosneuvirus	7.4e-48	37.1
WP_016496764.1\|886217_886874_+	sugar transferase	NA	NA	NA	NA
WP_016496765.1\|886873_887650_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_041821656.1\|887794_888700_+	glycosyltransferase	NA	NA	NA	NA
WP_155258983.1\|888783_889821_+	hypothetical protein	NA	NA	NA	NA
WP_016496768.1\|889820_890777_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_016496769.1\|890766_891756_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_016496770.1\|891752_892808_+	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_016496771.1\|892800_894318_+	glycosyltransferase	A0A1V0SAH6	Catovirus	2.3e-14	36.4
WP_172635289.1\|894271_894823_+	polysaccharide pyruvyl transferase family protein	NA	NA	NA	NA
WP_016496773.1\|894897_896412_+	oligosaccharide flippase family protein	NA	NA	NA	NA
WP_016496774.1\|896512_897481_+\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_016496775.1\|897539_898283_+	glycosyl transferase	A0A2K9L2U7	Tupanvirus	1.2e-08	26.7
WP_041821659.1\|898439_899489_+	dTDP-glucose 4,6-dehydratase	H9NC62	Sphingomonas_phage	3.3e-52	35.5
WP_013923981.1\|900059_900248_+	hypothetical protein	NA	NA	NA	NA
WP_003668340.1\|900237_900594_+	IS66 family insertion sequence element accessory protein TnpB	S5WJH4	Leptospira_phage	6.1e-11	44.6
WP_016496777.1\|900664_902209_+\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	8.0e-31	26.5
WP_016496778.1\|902281_903775_-\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	1.2e-34	27.6
WP_041821568.1\|904036_904636_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_123835781.1\|904572_905478_+\|transposase	IS3 family transposase	A0A0C5AEA5	Paenibacillus_phage	7.8e-18	29.9
WP_003671670.1\|905617_906376_-	ATP-binding protein	A0A059NT77	Lactococcus_phage	1.9e-62	48.2
WP_013923983.1\|906380_907592_-\|transposase	IS21 family transposase	A0A059NT83	Lactococcus_phage	8.3e-92	45.9
WP_016496779.1\|907652_907997_-	IS66 family insertion sequence element accessory protein TnpB	S5WJH4	Leptospira_phage	2.1e-08	40.6
WP_016496780.1\|907986_908175_-	hypothetical protein	NA	NA	NA	NA
WP_016496786.1\|911460_912462_+	glycosyl hydrolase 53 family protein	NA	NA	NA	NA
WP_016496787.1\|912510_913326_+	hypothetical protein	NA	NA	NA	NA
WP_016496411.1\|913456_914380_-\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	5.1e-33	31.7
WP_013923736.1\|914753_915884_+\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	7.1e-37	32.1
WP_016496790.1\|917175_918399_+\|transposase	IS21 family transposase	A0A059NT83	Lactococcus_phage	3.0e-89	44.7
WP_016496791.1\|918400_919138_+	ATP-binding protein	A0A059NT77	Lactococcus_phage	1.9e-51	45.4
WP_016496792.1\|919464_920742_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.8e-34	29.7
WP_155258984.1\|920977_926353_+	KxYKxGKxW signal peptide domain-containing protein	NA	NA	NA	NA
WP_016496794.1\|927016_927949_+	homocysteine S-methyltransferase	NA	NA	NA	NA
WP_016496795.1\|927941_929345_+	amino acid permease	NA	NA	NA	NA
WP_016496796.1\|929423_929681_+	hypothetical protein	NA	NA	NA	NA
WP_041816984.1\|930079_930478_+\|transposase	IS200/IS605 family transposase	A0A286QN76	Streptococcus_phage	3.0e-46	62.9
WP_016496797.1\|930477_931653_+\|transposase	transposase	A0A0P0ICY9	Lactobacillus_phage	5.9e-119	55.7
WP_003672329.1\|932014_932257_-	hypothetical protein	NA	NA	NA	NA
WP_016496799.1\|932438_934289_+	LPXTG-motif cell wall anchor domain protein	NA	NA	NA	NA
WP_016496800.1\|934353_937839_+	DEAD/DEAH box helicase	A0A0P0YMN2	Yellowstone_lake_phycodnavirus	6.6e-41	28.0
WP_003676694.1\|937934_938711_+	hypothetical protein	NA	NA	NA	NA
WP_016496801.1\|938863_939754_+	glycoside hydrolase family 25	A0A0A1ERA5	Lactobacillus_phage	2.7e-95	54.2
WP_003676691.1\|939906_941025_+	exonuclease SbcCD subunit D	A0A059T8H2	Listeria_phage	1.1e-10	24.8
WP_016496802.1\|941026_944128_+	SMC family ATPase	NA	NA	NA	NA
WP_003676686.1\|945709_946165_+	hypothetical protein	NA	NA	NA	NA
WP_016496805.1\|946193_946685_+	hypothetical protein	NA	NA	NA	NA
WP_003673967.1\|952314_952476_+	hypothetical protein	NA	NA	NA	NA
WP_016496806.1\|952530_953172_-	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_016496807.1\|953313_955620_+	DUF4968 domain-containing protein	NA	NA	NA	NA
WP_003673974.1\|955777_957037_+	chloride channel protein	NA	NA	NA	NA
WP_016496808.1\|957221_957869_-	thiamine phosphate synthase	NA	NA	NA	NA
WP_003673976.1\|957865_958684_-	bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase	NA	NA	NA	NA
WP_016496809.1\|958676_959486_-	hydroxyethylthiazole kinase	NA	NA	NA	NA
WP_003673979.1\|959765_960071_+	hypothetical protein	NA	NA	NA	NA
WP_016496811.1\|961322_962453_-\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	1.8e-35	31.6
WP_003673983.1\|962733_963171_-	hypothetical protein	NA	NA	NA	NA
WP_003673985.1\|963186_964146_-	hypothetical protein	NA	NA	NA	NA
WP_016496812.1\|964279_965299_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_016496813.1\|965378_966755_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	2.1e-38	35.2

DBSCAN-SWA_7

1005020 : 1062050

Streptococcus_phage(17.65%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016496411.1\|1005020_1005944_+\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	5.1e-33	31.7
WP_003674045.1\|1008378_1008732_-	hypothetical protein	NA	NA	NA	NA
WP_003674047.1\|1008865_1009513_-	DsbA family oxidoreductase	NA	NA	NA	NA
WP_003674050.1\|1010448_1010721_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_003674052.1\|1010720_1011086_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_003674054.1\|1011638_1012001_+	LapA family protein	NA	NA	NA	NA
WP_016496837.1\|1012021_1012858_+	HAD family phosphatase	NA	NA	NA	NA
WP_003674056.1\|1012902_1013385_-	nucleoside 2-deoxyribosyltransferase	A0A0A7DMT2	Lactobacillus_phage	8.2e-59	65.6
WP_003674057.1\|1013460_1013616_-	hypothetical protein	NA	NA	NA	NA
WP_003674059.1\|1013617_1014481_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_003674061.1\|1014556_1015195_-	DUF421 domain-containing protein	NA	NA	NA	NA
WP_003674063.1\|1015204_1015648_-	DUF3290 family protein	NA	NA	NA	NA
WP_041821675.1\|1015764_1016052_+	DUF454 family protein	NA	NA	NA	NA
WP_016496838.1\|1016161_1017448_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	7.8e-48	31.3
WP_003674065.1\|1017594_1019919_-	hypothetical protein	NA	NA	NA	NA
WP_003674068.1\|1020097_1020952_-	DNA/RNA non-specific endonuclease	NA	NA	NA	NA
WP_016496839.1\|1021061_1022453_-	amino acid permease	NA	NA	NA	NA
WP_003674070.1\|1022738_1023644_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_003674072.1\|1023683_1025459_-	1-deoxy-D-xylulose-5-phosphate synthase	NA	NA	NA	NA
WP_003674073.1\|1025626_1026877_+	DUF2075 domain-containing protein	NA	NA	NA	NA
WP_003663794.1\|1026879_1027572_+	TVP38/TMEM64 family protein	NA	NA	NA	NA
WP_003674075.1\|1027635_1030149_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	1.3e-131	31.9
WP_003663797.1\|1030164_1030503_-	CrcB family protein	A0A2H4PQR0	Staphylococcus_phage	4.2e-09	34.2
WP_003674077.1\|1030495_1030873_-	CrcB family protein	NA	NA	NA	NA
WP_003663799.1\|1030980_1031373_+	VOC family protein	NA	NA	NA	NA
WP_003674078.1\|1031424_1032237_-	YdcF family protein	NA	NA	NA	NA
WP_003674079.1\|1032240_1033974_-	AarF/ABC1/UbiB kinase family protein	C7U092	Ostreococcus_tauri_virus	5.6e-33	26.1
WP_003674080.1\|1034114_1035476_+	HlyC/CorC family transporter	NA	NA	NA	NA
WP_003666232.1\|1035535_1035964_-	CopY/TcrY family copper transport repressor	NA	NA	NA	NA
WP_003674082.1\|1036118_1037507_+	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
WP_003674084.1\|1037555_1038011_-	DUF441 domain-containing protein	NA	NA	NA	NA
WP_171945887.1\|1038082_1038547_-	cupin domain-containing protein	NA	NA	NA	NA
WP_003674088.1\|1038596_1039073_-	flavodoxin	NA	NA	NA	NA
WP_003674090.1\|1039115_1040000_+	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	1.5e-05	28.9
WP_003674091.1\|1040045_1040936_+	aldo/keto reductase	A0A2H4PQR8	Staphylococcus_phage	8.3e-57	42.7
WP_003666221.1\|1041073_1041340_+	ACT domain-containing protein	NA	NA	NA	NA
WP_016496842.1\|1041364_1042708_+	PFL family protein	NA	NA	NA	NA
WP_016496843.1\|1042761_1043286_-	GNAT family N-acetyltransferase	M1PSC3	Streptococcus_phage	8.8e-14	31.6
WP_016496844.1\|1043445_1044291_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_016496845.1\|1044264_1045113_-	glycosyltransferase family 8 protein	NA	NA	NA	NA
WP_016496846.1\|1045354_1046605_-\|transposase	transposase	A0A288TXV8	Enterococcus_phage	1.2e-56	38.1
WP_016496847.1\|1046679_1047129_+\|transposase	IS200/IS605 family transposase	A0A0P0IQC6	Lactobacillus_phage	1.2e-30	50.0
WP_016496848.1\|1047210_1047870_+	HD domain-containing protein	S4W232	Pandoravirus	2.2e-06	26.3
WP_016496849.1\|1048071_1048716_-	hypothetical protein	NA	NA	NA	NA
WP_016496850.1\|1048712_1049591_-	DegV family protein	A0A0N9SI50	Staphylococcus_phage	6.0e-15	37.4
WP_016496851.1\|1049807_1051490_+	fibronectin/fibrinogen-binding protein	M1I5P2	Paramecium_bursaria_Chlorella_virus	1.2e-08	38.0
WP_016496852.1\|1051537_1054015_-	ATP-grasp domain-containing protein	NA	NA	NA	NA
WP_016496853.1\|1054011_1055097_-	carbamoyl phosphate synthase small subunit	NA	NA	NA	NA
WP_016496854.1\|1055173_1056085_-	RluA family pseudouridine synthase	A0A2H4UV25	Bodo_saltans_virus	3.2e-11	28.7
WP_016496855.1\|1056088_1056535_-	signal peptidase II	NA	NA	NA	NA
WP_003667861.1\|1056535_1056943_-	hypothetical protein	NA	NA	NA	NA
WP_016496856.1\|1056967_1057363_+	ribonuclease HI family protein	NA	NA	NA	NA
WP_016496857.1\|1057545_1058700_-	class I SAM-dependent RNA methyltransferase	NA	NA	NA	NA
WP_016496620.1\|1059324_1060248_+\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	1.0e-33	32.8
WP_016496859.1\|1060724_1062050_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.6e-48	30.7

DBSCAN-SWA_8

1157095 : 1165160

Staphylococcus_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003674232.1\|1157095_1157938_-	DegV family protein	A0A0N9SI50	Staphylococcus_phage	6.1e-17	34.1
WP_003666062.1\|1158116_1158761_+	hemolysin III family protein	NA	NA	NA	NA
WP_003674233.1\|1158749_1159238_-	dihydrofolate reductase	A0A1B2IBQ4	Erwinia_phage	7.4e-23	40.8
WP_016496906.1\|1159253_1160216_-	thymidylate synthase	A0A0N9SH48	Staphylococcus_phage	5.6e-115	60.9
WP_016496907.1\|1160234_1162145_-	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	1.8e-56	30.4
WP_016496908.1\|1162146_1163358_-\|tRNA	CCA tRNA nucleotidyltransferase	H7BUW3	unidentified_phage	9.0e-46	49.5
WP_003674239.1\|1163483_1164749_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_003666054.1\|1164884_1165160_-	HU family DNA-binding protein	A0A0H3UZA0	Geobacillus_virus	2.6e-25	68.5

DBSCAN-SWA_9

1210407 : 1276910

Streptococcus_phage(11.11%)

transposase,protease,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003665822.1\|1210407_1210845_-\|tRNA	D-tyrosyl-tRNA(Tyr) deacylase	NA	NA	NA	NA
WP_016496925.1\|1210855_1213093_-	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	J9Q7H7	Salmonella_phage	1.8e-07	32.1
WP_003674298.1\|1213111_1213447_-	hypothetical protein	NA	NA	NA	NA
WP_016496926.1\|1213525_1214266_-	16S rRNA (uracil(1498)-N(3))-methyltransferase	NA	NA	NA	NA
WP_016496927.1\|1214266_1215226_-	50S ribosomal protein L11 methyltransferase	NA	NA	NA	NA
WP_016496928.1\|1215303_1215609_-	hypothetical protein	NA	NA	NA	NA
WP_003668154.1\|1215805_1215985_+	hypothetical protein	NA	NA	NA	NA
WP_003674305.1\|1216092_1217052_+	L-lactate dehydrogenase	NA	NA	NA	NA
WP_003674306.1\|1217135_1217312_-	hypothetical protein	NA	NA	NA	NA
WP_003674308.1\|1217387_1218464_-	Ldh family oxidoreductase	NA	NA	NA	NA
WP_016496929.1\|1218536_1219952_-	C69 family dipeptidase	NA	NA	NA	NA
WP_003665812.1\|1220445_1222281_-	elongation factor 4	E4ZFJ7	Streptococcus_phage	2.5e-23	25.9
WP_003665811.1\|1222411_1223563_-	molecular chaperone DnaJ	E3T4P7	Cafeteria_roenbergensis_virus	2.3e-30	32.4
WP_003674311.1\|1223691_1225557_-	molecular chaperone DnaK	A0A2P1EIW2	Megavirus	1.1e-135	46.6
WP_003674313.1\|1225581_1226154_-	nucleotide exchange factor GrpE	NA	NA	NA	NA
WP_003674314.1\|1226166_1227219_-	heat-inducible transcriptional repressor HrcA	NA	NA	NA	NA
WP_003674316.1\|1227339_1227711_+	hypothetical protein	NA	NA	NA	NA
WP_016496411.1\|1228072_1228996_-\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	5.1e-33	31.7
WP_016496932.1\|1230482_1231430_-	riboflavin biosynthesis protein RibF	NA	NA	NA	NA
WP_003674319.1\|1231442_1232348_-\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA
WP_003665800.1\|1232541_1232901_-	30S ribosome-binding factor RbfA	NA	NA	NA	NA
WP_003674321.1\|1232920_1235179_-	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	3.9e-18	24.8
WP_003665798.1\|1235192_1235504_-	ribosomal L7Ae/L30e/S12e/Gadd45 family protein	NA	NA	NA	NA
WP_003668183.1\|1235490_1235793_-	YlxR family protein	NA	NA	NA	NA
WP_003674322.1\|1235821_1237009_-	transcription termination/antitermination protein NusA	NA	NA	NA	NA
WP_003674323.1\|1237029_1237503_-	ribosome maturation factor RimP	NA	NA	NA	NA
WP_003674324.1\|1237636_1241968_-	PolC-type DNA polymerase III	Q8W6C3	Saccharomonospora_phage	1.6e-28	23.4
WP_003674325.1\|1242043_1243777_-\|tRNA	proline--tRNA ligase	A0A2K9L6B6	Tupanvirus	1.1e-07	22.0
WP_003674327.1\|1243806_1245081_-\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
WP_016496933.1\|1245103_1245889_-	phosphatidate cytidylyltransferase	NA	NA	NA	NA
WP_041821870.1\|1245908_1246688_-	isoprenyl transferase	R9W0U9	Flavobacterium_phage	5.8e-22	42.5
WP_003666863.1\|1246895_1247459_-	ribosome recycling factor	NA	NA	NA	NA
WP_003666862.1\|1247463_1248186_-	UMP kinase	NA	NA	NA	NA
WP_003666861.1\|1248267_1249143_-	elongation factor Ts	NA	NA	NA	NA
WP_003666860.1\|1249241_1250030_-	30S ribosomal protein S2	NA	NA	NA	NA
WP_003674330.1\|1250192_1251185_-	D-2-hydroxyacid dehydrogenase	M1I4S0	Paramecium_bursaria_Chlorella_virus	2.7e-40	31.6
WP_003668197.1\|1251186_1251477_-	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_003674331.1\|1251466_1252222_-\|tRNA	tRNA1(Val) (adenine(37)-N6)-methyltransferase	NA	NA	NA	NA
WP_041821721.1\|1252316_1252955_+	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_003666855.1\|1252998_1253226_-	YneF family protein	NA	NA	NA	NA
WP_003674333.1\|1253299_1253551_-	DUF896 domain-containing protein	NA	NA	NA	NA
WP_003674334.1\|1253679_1254306_+	transcriptional repressor LexA	A0A1B2APZ1	Phage_Wrath	4.3e-15	50.7
WP_003674335.1\|1254349_1255507_-	hydroxymethylglutaryl-CoA synthase	NA	NA	NA	NA
WP_003674336.1\|1255532_1256201_-	viroplasmin family protein	C1KFJ1	Lactobacillus_virus	3.5e-31	33.9
WP_003674337.1\|1256567_1257182_-	DUF308 domain-containing protein	NA	NA	NA	NA
WP_003674338.1\|1257293_1257812_-	adenine phosphoribosyltransferase	A0A1X9I6E2	Streptococcus_phage	9.9e-10	32.1
WP_003674340.1\|1257828_1260156_-	single-stranded-DNA-specific exonuclease RecJ	A7KV88	Bacillus_phage	3.2e-76	32.2
WP_003674342.1\|1260289_1261123_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_003674343.1\|1261139_1262069_-	ribonuclease Z	NA	NA	NA	NA
WP_003674345.1\|1262101_1263418_-	GTPase ObgE	NA	NA	NA	NA
WP_003674347.1\|1263483_1265295_-	excinuclease ABC subunit UvrC	NA	NA	NA	NA
WP_016496936.1\|1265438_1265576_+	hypothetical protein	NA	NA	NA	NA
WP_003674350.1\|1265779_1266079_-	nucleoside triphosphate pyrophosphohydrolase family protein	A0A1S7FYY8	Listeria_phage	5.0e-22	49.0
WP_003668240.1\|1266080_1266671_-	YihA family ribosome biogenesis GTP-binding protein	NA	NA	NA	NA
WP_003674352.1\|1266688_1267939_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	1.4e-137	59.2
WP_016496937.1\|1268116_1269427_-	trigger factor	NA	NA	NA	NA
WP_013924000.1\|1270401_1271820_+\|transposase	ISLre2-like element ISLre2 family transposase	NA	NA	NA	NA
WP_016496423.1\|1273341_1274310_+\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_003671670.1\|1275309_1276068_+	ATP-binding protein	A0A059NT77	Lactococcus_phage	1.9e-62	48.2
WP_041821884.1\|1276133_1276910_+\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	5.6e-33	37.1

DBSCAN-SWA_10

1521404 : 1611248

Streptococcus_phage(25.93%)

terminase,head,protease,tRNA,portal,transposase,integrase,tail,holin,capsid

attL 1527890:1527949|attR 1577454:1577534

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003676182.1\|1521404_1521986_+\|protease	matrixin family metalloprotease	NA	NA	NA	NA
WP_016497024.1\|1522069_1522972_+	EamA family transporter	NA	NA	NA	NA
WP_003676187.1\|1523154_1524087_-	carbamate kinase	NA	NA	NA	NA
WP_003666512.1\|1524103_1525111_-	ornithine carbamoyltransferase	NA	NA	NA	NA
WP_003676189.1\|1525364_1526204_+	DNA-binding domain-containing protein	NA	NA	NA	NA
WP_016497025.1\|1526316_1527825_-	xylulokinase	NA	NA	NA	NA
1527890:1527949	attL	NA	NA	NA	NA
WP_003676211.1\|1529421_1530780_-	glucose-6-phosphate isomerase	NA	NA	NA	NA
WP_016497028.1\|1530960_1531575_+	sugar O-acetyltransferase	NA	NA	NA	NA
WP_003676215.1\|1531642_1532503_-	sugar transporter	NA	NA	NA	NA
WP_016497029.1\|1532671_1534159_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	5.2e-35	32.9
WP_003676219.1\|1534158_1534878_-	response regulator transcription factor	NA	NA	NA	NA
WP_016497030.1\|1535120_1536236_-\|integrase	site-specific integrase	A0A2P0ZL94	Lactobacillus_phage	5.8e-39	31.5
WP_016497031.1\|1536564_1537197_-	helix-turn-helix transcriptional regulator	A0A1W6JQE6	Staphylococcus_phage	4.2e-10	38.1
WP_016497032.1\|1537368_1537638_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_016497033.1\|1537744_1537930_+	hypothetical protein	NA	NA	NA	NA
WP_016497034.1\|1538040_1538391_+	hypothetical protein	NA	NA	NA	NA
WP_016497035.1\|1538435_1538945_+	hypothetical protein	NA	NA	NA	NA
WP_016497036.1\|1538948_1540523_+	prophage P3 protein 8, DNA primase/helicase	A0A1P8VVM0	Streptococcus_phage	2.0e-69	34.8
WP_016497037.1\|1540642_1540894_+	hypothetical protein	NA	NA	NA	NA
WP_016497038.1\|1540896_1541061_+	hypothetical protein	NA	NA	NA	NA
WP_016497039.1\|1541060_1541411_+\|head	phage head closure protein	A0A0M7RFE1	Lactobacillus_phage	3.4e-06	40.8
WP_041821741.1\|1541458_1541893_+	HNH endonuclease	A0A2H4J3B4	uncultured_Caudovirales_phage	5.4e-17	40.6
WP_016497040.1\|1542428_1542917_+\|terminase	phage terminase small subunit P27 family	A0A0D4DCN9	Staphylococcus_phage	5.8e-12	33.6
WP_016497041.1\|1542913_1544614_+\|terminase	terminase large subunit	E9LUI0	Lactobacillus_phage	1.1e-116	41.4
WP_016497042.1\|1544633_1545767_+\|portal	phage portal protein	A0A2H4JA65	uncultured_Caudovirales_phage	1.3e-54	37.0
WP_041821921.1\|1545738_1547301_+\|capsid	phage major capsid protein	B8R651	Lactobacillus_phage	7.3e-48	27.2
WP_016497044.1\|1547636_1547933_+\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
WP_016497045.1\|1548260_1548665_+	prophage protein 20	NA	NA	NA	NA
WP_003668074.1\|1548776_1549745_-\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_003666472.1\|1550473_1551085_-	LysM peptidoglycan-binding domain-containing protein	A0A288TY55	Enterococcus_phage	6.6e-29	53.6
WP_003666471.1\|1551407_1552214_-	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_003666470.1\|1552206_1552674_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_016497046.1\|1552684_1554550_-	acetyltransferase	NA	NA	NA	NA
WP_003666468.1\|1554611_1554923_-	hypothetical protein	NA	NA	NA	NA
WP_016496423.1\|1555151_1556120_-\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_016497047.1\|1556262_1558083_-	glutamine--fructose-6-phosphate transaminase (isomerizing)	Q76DQ7	Chlorella_virus	1.1e-90	36.8
WP_003676226.1\|1558291_1559647_-	phosphoglucosamine mutase	A0A127AWJ1	Bacillus_phage	2.3e-18	23.5
WP_003676227.1\|1559674_1560568_-	hypothetical protein	NA	NA	NA	NA
WP_003667494.1\|1560551_1561415_-	TIGR00159 family protein	NA	NA	NA	NA
WP_016497049.1\|1561561_1562917_-	L-fucose:H+ symporter permease	NA	NA	NA	NA
WP_003676229.1\|1562936_1563332_-	D-ribose pyranase	NA	NA	NA	NA
WP_016497050.1\|1563343_1564267_-	ribokinase	NA	NA	NA	NA
WP_016497051.1\|1564598_1565495_-	UDP-N-acetylmuramate dehydrogenase	NA	NA	NA	NA
WP_003667489.1\|1565619_1566159_+	3'-5' exonuclease	A0A1S5SFA9	Streptococcus_phage	1.9e-24	40.9
WP_003676235.1\|1566170_1566593_+	PAS domain-containing protein	NA	NA	NA	NA
WP_003676236.1\|1566625_1567135_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_003676239.1\|1567134_1567593_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE	NA	NA	NA	NA
WP_016497052.1\|1567712_1568687_-	phosphate acetyltransferase	NA	NA	NA	NA
WP_003676241.1\|1568747_1569437_-	uracil-DNA glycosylase	A0A0B5IW78	Pandoravirus	2.2e-44	44.3
WP_003667483.1\|1569587_1570172_+	hypothetical protein	NA	NA	NA	NA
WP_003666449.1\|1570228_1570702_-	SsrA-binding protein SmpB	W5RAM5	Staphylococcus_phage	4.0e-42	54.8
WP_003676243.1\|1570719_1573125_-	ribonuclease R	Q0GXV6	Lactococcus_phage	7.7e-89	38.3
WP_003676244.1\|1573111_1573888_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_003667480.1\|1573966_1574206_-	preprotein translocase subunit SecG	NA	NA	NA	NA
WP_003676246.1\|1574272_1575823_-	ClC family H(+)/Cl(-) exchange transporter	NA	NA	NA	NA
WP_003666444.1\|1575940_1577323_-	amino acid permease	NA	NA	NA	NA
WP_016497053.1\|1577543_1578830_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.9e-47	31.1
1577454:1577534	attR	NA	NA	NA	NA
WP_003666443.1\|1579039_1580362_-	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	8.9e-172	69.9
WP_003667474.1\|1580452_1581202_-	triose-phosphate isomerase	NA	NA	NA	NA
WP_003666439.1\|1581317_1582523_-	phosphoglycerate kinase	NA	NA	NA	NA
WP_003666436.1\|1582613_1583621_-	type I glyceraldehyde-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_003666435.1\|1584123_1584717_-	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	8.0e-56	54.3
WP_016497054.1\|1584909_1586265_-	MFS transporter	NA	NA	NA	NA
WP_003676247.1\|1587175_1588117_-	DNA-binding protein WhiA	Q7AWZ3	Streptococcus_phage	1.6e-50	38.1
WP_003676248.1\|1588135_1589122_-	uridine diphosphate-N-acetylglucosamine-binding protein YvcK	A1IMD5	Streptococcus_phage	5.5e-94	54.2
WP_035162073.1\|1589137_1590031_-	RNase adapter RapZ	A0A0R8VB27	Thermobifida_phage	2.0e-10	29.4
WP_003676250.1\|1590117_1591449_-	amino acid permease	NA	NA	NA	NA
WP_003676251.1\|1591717_1594582_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	1.1e-310	56.1
WP_016497056.1\|1594597_1596613_-	excinuclease ABC subunit UvrB	NA	NA	NA	NA
WP_003666419.1\|1596834_1597107_-	hypothetical protein	NA	NA	NA	NA
WP_003666416.1\|1597212_1597851_-	HD domain-containing protein	NA	NA	NA	NA
WP_016497057.1\|1598015_1599740_-	phospho-sugar mutase	A0A1X9I671	Streptococcus_phage	6.5e-199	59.8
WP_003676255.1\|1599829_1600336_-	acyl-CoA thioesterase	NA	NA	NA	NA
WP_003676256.1\|1600381_1601263_-	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003676257.1\|1601521_1602691_-	ArgE/DapE family deacylase	NA	NA	NA	NA
WP_016497058.1\|1602784_1603717_-	thioredoxin-disulfide reductase	G3MA85	Bacillus_virus	9.0e-86	52.1
WP_016497059.1\|1603976_1604780_+	(Fe-S)-binding protein	NA	NA	NA	NA
WP_003676262.1\|1604780_1606268_+	iron-sulfur cluster-binding protein	NA	NA	NA	NA
WP_016497060.1\|1606260_1606995_+	lactate utilization protein C	NA	NA	NA	NA
WP_003676267.1\|1607065_1607980_-	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	4.4e-69	46.4
WP_003666397.1\|1608044_1609061_-	NAD(P)H-dependent glycerol-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_003676269.1\|1609086_1609914_-	prolipoprotein diacylglyceryl transferase	NA	NA	NA	NA
WP_016497061.1\|1609914_1610877_-	HPr kinase/phosphorylase	NA	NA	NA	NA
WP_003670462.1\|1610891_1611248_-\|holin	phage holin family protein	NA	NA	NA	NA

DBSCAN-SWA_11

1632600 : 1640374

Streptococcus_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_080637870.1\|1632600_1633401_-	carbon-nitrogen family hydrolase	M1H2P4	Paramecium_bursaria_Chlorella_virus	6.2e-11	24.3
WP_016497070.1\|1633977_1634766_+	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	2.6e-38	36.9
WP_016497071.1\|1634777_1636022_+	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	2.3e-105	51.3
WP_016497072.1\|1636039_1636813_+	pyrroline-5-carboxylate reductase	A0A1X9I6T5	Streptococcus_phage	1.6e-32	37.3
WP_016497073.1\|1636919_1637951_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	5.9e-62	39.3
WP_003666354.1\|1637969_1638524_-	ribosomal protein S18-alanine N-acetyltransferase	NA	NA	NA	NA
WP_016497075.1\|1638507_1639233_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA
WP_016497076.1\|1639378_1640374_-	UDP-glucose 4-epimerase GalE	A0A1V0SG19	Hokovirus	5.7e-46	36.2

DBSCAN-SWA_12

1672308 : 1736638

Bacillus_virus(11.76%)

transposase,protease,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003675935.1\|1672308_1673721_-\|tRNA	cysteine--tRNA ligase	M1PG92	Moumouvirus	8.9e-53	30.9
WP_003675937.1\|1674094_1675246_-	PIN/TRAM domain-containing protein	NA	NA	NA	NA
WP_003675938.1\|1675264_1676638_-	DNA repair protein RadA	NA	NA	NA	NA
WP_003675940.1\|1676663_1677200_-	hypothetical protein	J9PV85	Bacillus_phage	2.8e-39	49.1
WP_003675942.1\|1677338_1677635_+	N-acetyltransferase	NA	NA	NA	NA
WP_003666281.1\|1677646_1678330_+	ribose-5-phosphate isomerase RpiA	NA	NA	NA	NA
WP_016497087.1\|1678358_1679699_+	C1 family peptidase	R4TV59	Phaeocystis_globosa_virus	1.4e-71	32.8
WP_003675946.1\|1679806_1680598_-	extracellular solute-binding protein	NA	NA	NA	NA
WP_003675947.1\|1680613_1681363_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.6e-24	36.5
WP_003675949.1\|1681368_1682070_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_016497088.1\|1682096_1683239_-	PLP-dependent transferase	A0A0B5JD48	Pandoravirus	1.8e-19	26.4
WP_016497089.1\|1683516_1684383_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_003667318.1\|1684357_1685107_-	2,3-bisphosphoglycerate-dependent phosphoglycerate mutase	NA	NA	NA	NA
WP_003675955.1\|1685237_1687007_+	hypothetical protein	NA	NA	NA	NA
WP_016497090.1\|1687104_1688064_-	beta-galactosidase small subunit	NA	NA	NA	NA
WP_003675959.1\|1688047_1689934_-	beta-galactosidase	L0N6M2	Herpes_simplex_virus	3.4e-92	33.5
WP_003675961.1\|1690237_1690690_-	SprT family protein	NA	NA	NA	NA
WP_016497091.1\|1690682_1692860_-	RNA-binding transcriptional accessory protein	NA	NA	NA	NA
WP_016497092.1\|1692931_1693759_-	ammonia-dependent NAD(+) synthetase	G3MA24	Bacillus_virus	4.7e-78	54.7
WP_016497093.1\|1693771_1695238_-	nicotinate phosphoribosyltransferase	G3MA18	Bacillus_virus	7.4e-111	45.0
WP_003666262.1\|1695299_1696001_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_003666260.1\|1696155_1696875_-	amino acid racemase	NA	NA	NA	NA
WP_041821766.1\|1696908_1698558_-	aspartate:alanine antiporter	NA	NA	NA	NA
WP_003675971.1\|1698648_1700049_-	MFS transporter	NA	NA	NA	NA
WP_016497095.1\|1700166_1700811_-	hypothetical protein	NA	NA	NA	NA
WP_003675973.1\|1701169_1702000_-	metallophosphoesterase	NA	NA	NA	NA
WP_016497096.1\|1702059_1703559_-	peptide MFS transporter	A0A0P0IY73	Acinetobacter_phage	1.2e-68	34.1
WP_172381020.1\|1703771_1704473_-	DUF3642 domain-containing protein	NA	NA	NA	NA
WP_035162004.1\|1706152_1706482_-	hypothetical protein	NA	NA	NA	NA
WP_016497100.1\|1706594_1706963_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_003675988.1\|1707252_1707753_-	thiol peroxidase	NA	NA	NA	NA
WP_003675989.1\|1708163_1709345_+\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	2.9e-25	26.6
WP_003674676.1\|1715382_1716795_+	aryl-sulfate sulfotransferase	NA	NA	NA	NA
WP_003676198.1\|1717199_1717937_-	ATP-binding protein	A0A059NT77	Lactococcus_phage	3.0e-52	45.8
WP_016496790.1\|1717938_1719162_-\|transposase	IS21 family transposase	A0A059NT83	Lactococcus_phage	3.0e-89	44.7
WP_016497102.1\|1719590_1720769_-\|transposase	IS66 family transposase	NA	NA	NA	NA
WP_016497103.1\|1720876_1722055_+\|transposase	IS256 family transposase	A0A220NQR7	Corynebacterium_phage	2.9e-33	26.1
WP_016497106.1\|1722551_1722908_-	IS66 family insertion sequence element accessory protein TnpB	S5WJH4	Leptospira_phage	5.6e-12	47.7
WP_016497107.1\|1722897_1723086_-	hypothetical protein	NA	NA	NA	NA
WP_016497108.1\|1723323_1727112_-	YSIRK-type signal peptide-containing protein	NA	NA	NA	NA
WP_016497110.1\|1727753_1728713_-	beta-galactosidase small subunit	NA	NA	NA	NA
WP_155258986.1\|1728994_1729261_-	hypothetical protein	NA	NA	NA	NA
WP_016497113.1\|1729335_1730466_-\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	3.2e-37	32.1
WP_016497114.1\|1730868_1732395_-\|tRNA	lysine--tRNA ligase	A0A2K9KZX5	Tupanvirus	3.4e-90	41.9
WP_003674674.1\|1732415_1733417_-\|tRNA	tRNA dihydrouridine synthase DusB	NA	NA	NA	NA
WP_003674673.1\|1733524_1734445_-	Hsp33 family molecular chaperone HslO	NA	NA	NA	NA
WP_016497115.1\|1734535_1736638_-\|protease	ATP-dependent zinc metalloprotease FtsH	H8ZJI5	Ostreococcus_tauri_virus	4.6e-106	48.4

DBSCAN-SWA_13

1792839 : 1853011

unidentified_phage(25.0%)

transposase,integrase,protease,tRNA

attL 1842488:1842504|attR 1853401:1853417

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003674580.1\|1792839_1794867_-\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	1.0e-89	36.2
WP_003674578.1\|1794944_1795793_-	DUF72 domain-containing protein	A0A1V0CNL1	Kaumoebavirus	2.5e-10	31.1
WP_016497131.1\|1796242_1796941_-	NAD-dependent protein deacylase	NA	NA	NA	NA
WP_003674570.1\|1796946_1797906_-	hypothetical protein	NA	NA	NA	NA
WP_016497132.1\|1797898_1799161_-	hydroxymethylglutaryl-CoA reductase, degradative	NA	NA	NA	NA
WP_003667177.1\|1799153_1800095_-	Ppx/GppA family phosphatase	NA	NA	NA	NA
WP_016497133.1\|1800238_1801261_-\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_016497134.1\|1801538_1802498_+	site-specific DNA-methyltransferase	A0A1W6JJW1	Lactococcus_phage	2.2e-18	28.1
WP_016497135.1\|1802548_1802992_-	nucleoside-diphosphate kinase	D2E8E1	Anguillid_herpesvirus	8.4e-26	44.4
WP_016497136.1\|1803079_1805398_-	AAA family ATPase	NA	NA	NA	NA
WP_016497137.1\|1805410_1806580_-	cation:proton antiporter	NA	NA	NA	NA
WP_016497138.1\|1806862_1808224_-	aspartate aminotransferase family protein	NA	NA	NA	NA
WP_016497139.1\|1808186_1809659_-	amino acid permease	NA	NA	NA	NA
WP_016497140.1\|1809956_1810598_+	endonuclease III	NA	NA	NA	NA
WP_016497141.1\|1810609_1810900_+	FMN-binding protein	NA	NA	NA	NA
WP_016497142.1\|1810987_1812184_-	tetracycline resistance MFS efflux pump	A0A2H4UVM2	Bodo_saltans_virus	1.2e-05	20.2
WP_016497143.1\|1812566_1813490_-\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	6.7e-33	31.7
WP_016497145.1\|1814653_1815619_+\|transposase	IS30 family transposase	H7BW47	unidentified_phage	1.9e-14	30.7
WP_003674547.1\|1815986_1816919_-	L-lactate dehydrogenase	NA	NA	NA	NA
WP_003671339.1\|1817441_1818293_+	MetQ/NlpA family ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_016497147.1\|1818305_1819370_+	methionine ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	7.7e-17	27.5
WP_003665503.1\|1819362_1820052_+	ABC transporter permease	NA	NA	NA	NA
WP_016497148.1\|1820070_1821216_+	ArgE/DapE family deacylase	NA	NA	NA	NA
WP_016497149.1\|1821674_1823012_+	ClC family H(+)/Cl(-) exchange transporter	NA	NA	NA	NA
WP_003674537.1\|1823163_1823592_-	peptide-methionine (R)-S-oxide reductase MsrB	NA	NA	NA	NA
WP_003674534.1\|1823663_1824302_-	ABC transporter permease	NA	NA	NA	NA
WP_003674533.1\|1824294_1825065_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.3e-25	38.0
WP_003674531.1\|1825039_1825705_-	ABC transporter permease	NA	NA	NA	NA
WP_003674529.1\|1825771_1826671_-	glycine/betaine ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_016497150.1\|1826820_1827276_+	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_016497151.1\|1827278_1828133_+	NAD(P)H-binding protein	NA	NA	NA	NA
WP_003674522.1\|1828348_1829539_-	phosphopentomutase	NA	NA	NA	NA
WP_003674520.1\|1829642_1831451_+	cadmium-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	1.3e-69	29.9
WP_016497152.1\|1831908_1832643_-\|protease	matrixin family metalloprotease	NA	NA	NA	NA
WP_003674515.1\|1832718_1833423_-	hypothetical protein	NA	NA	NA	NA
WP_080637876.1\|1833532_1833865_-	hypothetical protein	NA	NA	NA	NA
WP_016497154.1\|1833916_1834840_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	5.1e-33	31.3
WP_016497155.1\|1835198_1836554_+	FAD-dependent oxidoreductase	A0A2K5B2C5	Erysipelothrix_phage	7.6e-126	52.3
WP_003667137.1\|1836680_1836968_-	hypothetical protein	NA	NA	NA	NA
WP_016497156.1\|1837029_1839879_-	DEAD/DEAH box helicase	Q9T1H9	Lactobacillus_phage	1.1e-25	27.9
WP_003674507.1\|1839899_1840400_-	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_016497157.1\|1840399_1841353_-	aldo/keto reductase	NA	NA	NA	NA
WP_003665466.1\|1841628_1842399_-	triose-phosphate isomerase	NA	NA	NA	NA
1842488:1842504	attL	NA	NA	NA	NA
WP_016497158.1\|1842530_1842932_+	phosphate-starvation-inducible protein PsiE	NA	NA	NA	NA
WP_016497159.1\|1842943_1843486_+	serine hydrolase family protein	NA	NA	NA	NA
WP_003674500.1\|1845459_1846878_+	sodium:proton antiporter	NA	NA	NA	NA
WP_003674499.1\|1847023_1847257_+	cytochrome b5	NA	NA	NA	NA
WP_003674496.1\|1847322_1847973_-	NAD(P)H-binding protein	NA	NA	NA	NA
WP_003674494.1\|1848051_1848279_-	hypothetical protein	NA	NA	NA	NA
WP_003674492.1\|1848386_1849127_+	SDR family oxidoreductase	W8CYX9	Bacillus_phage	6.0e-08	38.2
WP_016497162.1\|1849290_1850613_-	MHS family MFS transporter	Q6JIH2	Burkholderia_virus	1.5e-38	31.9
WP_003674489.1\|1851334_1851904_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_016497163.1\|1852045_1853011_+\|transposase	IS30 family transposase	H7BW47	unidentified_phage	7.3e-14	30.3
1853401:1853417	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NC_021496

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

2553 : 39932

Lactobacillus_phage(63.33%)

integrase,protease,head,portal,terminase,tail,capsid

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016497205.1\|2553_2805_-	hypothetical protein	A0A2K9VC51	Lactobacillus_phage	5.3e-17	49.4
WP_016497206.1\|2804_2993_-	hypothetical protein	NA	NA	NA	NA
WP_016497207.1\|2989_3301_-	hypothetical protein	NA	NA	NA	NA
WP_016497208.1\|3287_3626_-	VRR-NUC domain-containing protein	A0A0A1ENT6	Lactobacillus_phage	8.9e-52	84.7
WP_155258997.1\|3625_3820_-	hypothetical protein	NA	NA	NA	NA
WP_003717912.1\|3823_4252_-	hypothetical protein	NA	NA	NA	NA
WP_016497210.1\|4568_5870_-	virulence-associated E family protein	A0A0A1EL11	Lactobacillus_phage	8.3e-106	51.1
WP_016497211.1\|5853_6645_-	bifunctional DNA primase/polymerase	U3PBE3	Lactobacillus_phage	1.5e-70	54.9
WP_016497212.1\|6665_7238_-	hypothetical protein	A0A2P0ZLB9	Lactobacillus_phage	1.2e-27	37.6
WP_016497213.1\|7256_7952_-	AAA family ATPase	U3PIS9	Lactobacillus_phage	4.6e-79	62.8
WP_016497214.1\|7945_9346_-	DEAD/DEAH box helicase	U3PFS7	Lactobacillus_phage	6.8e-146	57.7
WP_016497215.1\|9349_9610_-	hypothetical protein	NA	NA	NA	NA
WP_016497216.1\|9633_9903_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_016497217.1\|9913_10402_-	siphovirus Gp157 family protein	A0A2P0ZLB3	Lactobacillus_phage	4.0e-29	41.4
WP_016497218.1\|10398_10590_-	hypothetical protein	NA	NA	NA	NA
WP_016497219.1\|10579_10768_-	hypothetical protein	NA	NA	NA	NA
WP_016497220.1\|10771_10948_-	hypothetical protein	NA	NA	NA	NA
WP_016497221.1\|11087_11327_-	hypothetical protein	Q9T1I6	Lactobacillus_phage	3.4e-05	43.1
WP_016497222.1\|11333_11537_-	helix-turn-helix transcriptional regulator	A0A1S5SDM7	Streptococcus_phage	8.6e-10	53.4
WP_016497223.1\|11783_12209_+	helix-turn-helix transcriptional regulator	Q5YAA4	Bacillus_phage	4.7e-26	48.6
WP_016497224.1\|12222_12669_+	ImmA/IrrE family metallo-endopeptidase	Q5YAA5	Bacillus_phage	6.1e-08	27.3
WP_016497225.1\|12719_13256_+	hypothetical protein	NA	NA	NA	NA
WP_016497226.1\|13416_14529_+\|integrase	site-specific integrase	A0A1S5S8R9	Streptococcus_phage	3.7e-54	35.3
WP_016497227.1\|15106_16549_-	glycosyl hydrolase family 25	Q6SE63	Lactobacillus_prophage	4.8e-30	40.3
WP_155258999.1\|16541_16925_-	hypothetical protein	A0A0A1ELI5	Lactobacillus_phage	4.1e-21	52.2
WP_016497229.1\|16917_17187_-	hypothetical protein	NA	NA	NA	NA
WP_016497230.1\|17201_17672_-	hypothetical protein	NA	NA	NA	NA
WP_016497231.1\|17685_17871_-	hypothetical protein	NA	NA	NA	NA
WP_016497232.1\|17882_18350_-	hypothetical protein	NA	NA	NA	NA
WP_016497233.1\|18362_18614_-	hypothetical protein	NA	NA	NA	NA
WP_016497234.1\|18627_18798_-	hypothetical protein	NA	NA	NA	NA
WP_016497235.1\|18846_22635_-	hypothetical protein	Q6SE68	Lactobacillus_prophage	7.4e-46	24.8
WP_155259000.1\|22636_24511_-\|tail	phage tail protein	E9LUJ4	Lactobacillus_phage	1.2e-33	37.7
WP_041822076.1\|25315_26170_-\|tail	phage tail family protein	A6M962	Geobacillus_virus	1.4e-21	33.6
WP_016497238.1\|26205_30681_-	tape measure protein	E9LUR1	Lactobacillus_phage	1.4e-27	31.7
WP_016497239.1\|30951_31302_-	hypothetical protein	A8YQJ8	Lactobacillus_phage	4.1e-07	35.3
WP_016497240.1\|31409_32042_-	small major structural protein	O64291	Streptococcus_virus	2.4e-18	30.7
WP_016497241.1\|32076_32454_-	DUF806 family protein	A0A2P0ZLF4	Lactobacillus_phage	1.1e-15	36.4
WP_016497242.1\|32450_32888_-	hypothetical protein	A0A2P0VJL9	Streptococcus_phage	3.5e-32	53.2
WP_016497243.1\|32880_33243_-\|head	phage head closure protein	NA	NA	NA	NA
WP_016497244.1\|33232_33583_-\|head,tail	phage gp6-like head-tail connector protein	A0A2I6QQY5	Streptococcus_phage	2.6e-14	43.2
WP_016497245.1\|33596_34775_-\|capsid	phage major capsid protein	Q9T1F6	Lactobacillus_phage	7.3e-125	59.1
WP_016497246.1\|34774_35494_-\|protease	Clp protease ClpP	E9LUQ2	Lactobacillus_phage	3.0e-57	54.6
WP_016497247.1\|35480_36674_-\|portal	phage portal protein	E9LUQ1	Lactobacillus_phage	3.4e-130	58.1
WP_041822066.1\|36690_36870_-	DUF1056 family protein	NA	NA	NA	NA
WP_016497248.1\|36859_38731_-\|terminase	terminase large subunit	E9LUP9	Lactobacillus_phage	1.6e-251	66.8
WP_016497249.1\|38727_39183_-\|terminase	phage terminase small subunit P27 family	A0A286QRF4	Streptococcus_phage	8.0e-48	63.8
WP_041822068.1\|39410_39932_-	HNH endonuclease	E9LUP7	Lactobacillus_phage	2.1e-47	60.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NC_021495

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

563 : 7203

Staphylococcus_phage(28.57%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_172635290.1\|563_1475_-\|transposase	IS3 family transposase	Q716C2	Shigella_phage	5.2e-14	28.2
WP_016497321.1\|1411_2125_-	helix-turn-helix domain-containing protein	A0A0C5AJ29	Paenibacillus_phage	1.1e-30	38.8
WP_016497322.1\|2685_3264_+	recombinase family protein	A0A1J1J8Z4	Escherichia_phage	1.8e-23	33.3
WP_155258994.1\|3396_3942_+	recombinase family protein	A0A0A8WIK3	Clostridium_phage	1.3e-07	29.1
WP_007124974.1\|4308_4926_+	CadD family cadmium resistance transporter	NA	NA	NA	NA
WP_003672749.1\|4942_5293_+	helix-turn-helix transcriptional regulator	E4ZFI8	Streptococcus_phage	7.9e-11	34.0
WP_003669793.1\|5396_5798_-	arsenate reductase (thioredoxin)	A0A2H4PQT9	Staphylococcus_phage	1.8e-27	49.6
WP_016497324.1\|5800_6835_-	ACR3 family arsenite efflux transporter	NA	NA	NA	NA
WP_016497325.1\|6891_7203_-	winged helix-turn-helix transcriptional regulator	A0A2H4PQT4	Staphylococcus_phage	2.6e-21	50.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_021494

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NC_021496

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NC_021495

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection