CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number
NC_021519	Lactobacillus plantarum 16 plasmid Lp16H, complete sequence	0 crisprs	NA	0	0	1
NC_021516	Lactobacillus plantarum 16 plasmid Lp16C, complete sequence	0 crisprs	NA	0	0	0
NC_021518	Lactobacillus plantarum 16 plasmid Lp16F, complete sequence	0 crisprs	NA	0	0	3
NC_021528	Lactobacillus plantarum 16 plasmid Lp16I, complete sequence	0 crisprs	NA	0	0	0
NC_021520	Lactobacillus plantarum 16 plasmid Lp16L, complete sequence	0 crisprs	NA	0	0	0
NC_021525	Lactobacillus plantarum 16 plasmid Lp16B, complete sequence	0 crisprs	NA	0	0	0
NC_021527	Lactobacillus plantarum 16 plasmid Lp16G, complete sequence	0 crisprs	NA	0	0	0
NC_021517	Lactobacillus plantarum 16 plasmid Lp16E, complete sequence	0 crisprs	NA	0	0	4
NC_021514	Lactobacillus plantarum 16, complete sequence	3 crisprs	csa3,DinG,cas3,DEDDh	1	2	6
NC_021515	Lactobacillus plantarum 16 plasmid Lp16A, complete sequence	0 crisprs	RT	0	0	0
NC_021526	Lactobacillus plantarum 16 plasmid Lp16D, complete sequence	0 crisprs	NA	0	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

29 : 59238

Bacillus_phage(25.0%)

transposase,protease,holin

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016526591.1\|29_1205_+\|transposase	IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	1.8e-27	29.2
WP_016526592.1\|1428_2298_+	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	6.6e-99	59.4
WP_003644155.1\|2301_2883_+	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	4.3e-38	45.1
WP_016526593.1\|2892_3921_+	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	5.3e-71	45.1
WP_016526594.1\|3953_4790_+	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	4.2e-34	36.8
WP_016526595.1\|4805_5471_+	sugar transferase	NA	NA	NA	NA
WP_016526596.1\|6044_6815_+	exopolysaccharide biosynthesis protein	NA	NA	NA	NA
WP_016526597.1\|6826_7546_+	CpsD/CapB family tyrosine-protein kinase	NA	NA	NA	NA
WP_041161916.1\|7532_8306_+	tyrosine protein phosphatase	NA	NA	NA	NA
WP_016526599.1\|8360_9029_+	sugar transferase	NA	NA	NA	NA
WP_016526600.1\|9089_10262_+	glycosyltransferase family 1 protein	NA	NA	NA	NA
WP_016526601.1\|10332_11268_+	NAD-dependent epimerase/dehydratase family protein	M1NML0	Moumouvirus	5.9e-21	28.3
WP_016526602.1\|11318_12470_+	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_016526603.1\|12491_13139_+	acyltransferase	NA	NA	NA	NA
WP_016526605.1\|13867_14986_+	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_016526606.1\|15026_16253_+	glycosyltransferase	NA	NA	NA	NA
WP_016526607.1\|16564_17704_+	hypothetical protein	NA	NA	NA	NA
WP_187289259.1\|17723_19145_+	lipopolysaccharide biosynthesis protein	NA	NA	NA	NA
WP_016526609.1\|19169_20336_+	nucleotide sugar dehydrogenase	M1IB49	Acanthocystis_turfacea_Chlorella_virus	9.4e-109	51.8
WP_144061830.1\|21565_22459_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	2.4e-59	45.9
WP_016526613.1\|22434_22695_-\|transposase	transposase	A0A1P8CWP5	Bacillus_phage	8.2e-13	45.3
WP_016526615.1\|23894_25070_-\|transposase	IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	1.6e-26	28.8
WP_016526616.1\|25818_27213_+	MATE family efflux transporter	NA	NA	NA	NA
WP_016526617.1\|27307_28180_+\|transposase	IS30 family transposase	H7BW47	unidentified_phage	7.2e-21	33.0
WP_016526619.1\|28833_29118_+	BRCT domain-containing protein	NA	NA	NA	NA
WP_144061833.1\|29783_32012_+	type IV secretory system conjugative DNA transfer family protein	NA	NA	NA	NA
WP_016526621.1\|32137_32356_+	hypothetical protein	NA	NA	NA	NA
WP_016526622.1\|32356_34168_+	putative LtrC	NA	NA	NA	NA
WP_041161920.1\|34234_34573_+	hypothetical protein	NA	NA	NA	NA
WP_016526624.1\|34650_35034_-	hypothetical protein	NA	NA	NA	NA
WP_016526625.1\|35026_35347_-	hypothetical protein	NA	NA	NA	NA
WP_016526626.1\|35339_36641_-	Y-family DNA polymerase	M1Q231	Streptococcus_phage	4.6e-80	39.1
WP_016526627.1\|36756_37068_+	hypothetical protein	NA	NA	NA	NA
WP_016526628.1\|37312_37537_-	hypothetical protein	NA	NA	NA	NA
WP_016526629.1\|37539_38313_-	ParA family protein	F0PIG8	Enterococcus_phage	4.3e-33	36.6
WP_016526630.1\|39089_40622_+	primase C-terminal domain-containing protein	NA	NA	NA	NA
WP_016526631.1\|40941_43518_+	hypothetical protein	NA	NA	NA	NA
WP_016526632.1\|43782_44166_+	hypothetical protein	NA	NA	NA	NA
WP_016526633.1\|44137_44797_+	hypothetical protein	NA	NA	NA	NA
WP_016526634.1\|44812_46765_+	conjugation-related ATPase	NA	NA	NA	NA
WP_016526635.1\|46767_46974_+	hypothetical protein	NA	NA	NA	NA
WP_016526636.1\|46974_48138_+	CHAP domain-containing protein	A0A0A0RSI6	Bacillus_phage	1.0e-09	34.8
WP_016526637.1\|48150_48780_+	hypothetical protein	NA	NA	NA	NA
WP_016526638.1\|49596_50556_+	DUF3102 domain-containing protein	A0A2H4JAH5	uncultured_Caudovirales_phage	4.8e-34	47.2
WP_041161921.1\|50552_50768_+	hypothetical protein	NA	NA	NA	NA
WP_016526640.1\|50769_50988_+	hypothetical protein	NA	NA	NA	NA
WP_016526641.1\|50984_51284_+	hypothetical protein	NA	NA	NA	NA
WP_016526642.1\|51280_51598_+	hypothetical protein	NA	NA	NA	NA
WP_016526643.1\|51724_52633_+	hypothetical protein	NA	NA	NA	NA
WP_016526644.1\|52918_53215_+	hypothetical protein	NA	NA	NA	NA
WP_016526645.1\|53216_53717_+	hypothetical protein	NA	NA	NA	NA
WP_016526646.1\|53734_54202_+	hypothetical protein	NA	NA	NA	NA
WP_016526647.1\|54173_56363_+	hypothetical protein	NA	NA	NA	NA
WP_016526648.1\|56364_57000_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_016526649.1\|57039_57306_+	hypothetical protein	NA	NA	NA	NA
WP_006293514.1\|57705_57810_+\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_131510832.1\|57862_58759_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	2.7e-39	36.2
WP_016526651.1\|58713_59238_-\|transposase	transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NC_021517

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 3438

Clostridium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003646125.1\|1598_2135_-	hypothetical protein	NA	NA	NA	NA
WP_016527412.1\|2646_3438_+	AAA family ATPase	E2ELL2	Clostridium_phage	4.6e-14	25.7

DBSCAN-SWA_2

10919 : 18886

Bacillus_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_041161890.1\|10919_15671_+	S8 family serine peptidase	A0A1B0T6A2	Bacillus_phage	7.5e-11	28.3
WP_016527428.1\|17710_18886_+\|transposase	IS256-like element IS1310 family transposase	A0A0N9STL0	Staphylococcus_phage	1.8e-27	29.2

DBSCAN-SWA_3

23935 : 32878

Lactobacillus_phage(28.57%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_080131851.1\|23935_24778_-\|transposase	IS3 family transposase	Q6J1X2	Lactobacillus_phage	6.3e-155	98.6
WP_002816285.1\|24831_25083_-\|transposase	IS3 family transposase	Q6J1X3	Lactobacillus_phage	9.2e-38	96.4
WP_003645574.1\|25738_26356_-	recombinase family protein	E5FFF9	Burkholderia_phage	1.8e-18	36.5
WP_016527437.1\|26718_28437_+\|transposase	IS1182 family transposase	A0ZS58	Staphylococcus_virus	1.4e-92	41.0
WP_181186338.1\|28519_29167_-	anaerobic ribonucleoside-triphosphate reductase activating protein	A0A288TZV3	Enterococcus_phage	3.2e-50	54.2
WP_003646551.1\|29211_31635_-	anaerobic ribonucleoside-triphosphate reductase	A0A0C5KKX3	Enterococcus_phage	2.0e-201	50.3
WP_003646115.1\|32191_32878_+\|transposase	IS6 family transposase	A0A0N9RU54	Staphylococcus_phage	9.9e-58	49.6

DBSCAN-SWA_4

36059 : 37951

Enterococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003646149.1\|36059_36986_+	ribonucleotide-diphosphate reductase subunit beta	A0A096XT60	Enterococcus_phage	3.9e-41	33.7
WP_003646148.1\|37000_37951_+	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A096XT60	Enterococcus_phage	5.0e-100	55.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NC_021514

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_021514_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_021514_1

355014-355475

Orphan

Consensus_repeat	Method
AAGTCNNANAAGAANAAN	CRT

12 spacers

The CRISPR arrays of NC_021514_1

>merge|NC_021514|1|355014-355475|CRT
AAGGCGCATAAGAAGAAGGCCGCTAAGAAACATAAGAAGTCGCACAAGAAGTCACACAAGAAGAAAGCGGCCAAGAAACATAAGAAGTCGCACAAGAAGAAAGCGGCCAGGAAACATAAGAAGCCGCACAAGAAGAAGTCTTCTAAGAAGCATGGCAAGTCGCACAAGAAAAAATCTTCGAAGAAGCACGGCAAGTCCAATAAGAAAAAGTCTTCCAAGAAACACGGCAAGTCGCACAAGAAGAAGTCTTCTAAGAAGCACGGCAAGTCCAATAAGAAAAAGTCTTCCAAGAAACATGGCAAGTCCAGTAAGAAGAAGTCTTCCAAGAAACATGGCAAGTCGCACAAGAAGAAATCTTCCAAGAAGCACGGCAAGTCCAATAAGAAGAAATCTTCCAAGAAGCATGGTAAATCCAGTAAGAAGAAATCATCTAAGAAGCACGGCAAGTCTAACAAGAAAAAA

>NC_021514|1|1|355014-355475|CRT
AAGGCGCATAAGAAGAAG	GCCGCTAAGAAACATAAG
AAGTCGCACAAGAAGTCA	CACAAGAAGAAAGCGGCCAAGAAACATAAG
AAGTCGCACAAGAAGAAA	GCGGCCAGGAAACATAAG
AAGCCGCACAAGAAGAAG	TCTTCTAAGAAGCATGGC
AAGTCGCACAAGAAAAAA	TCTTCGAAGAAGCACGGC
AAGTCCAATAAGAAAAAG	TCTTCCAAGAAACACGGC
AAGTCGCACAAGAAGAAG	TCTTCTAAGAAGCACGGC
AAGTCCAATAAGAAAAAG	TCTTCCAAGAAACATGGC
AAGTCCAGTAAGAAGAAG	TCTTCCAAGAAACATGGC
AAGTCGCACAAGAAGAAA	TCTTCCAAGAAGCACGGC
AAGTCCAATAAGAAGAAA	TCTTCCAAGAAGCATGGT
AAATCCAGTAAGAAGAAA	TCATCTAAGAAGCACGGC
AAGTCTAACAAGAAAAAA

Protein	Signature genes	Signature genes Name	Protein_function
NC_021514.1\|WP_003646448.1\|356572_356806_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379738
NC_021514.1\|WP_003643811.1\|363737_363896_-\|two-peptide-bacteriocin-plantaricin-EF-subunit-PlnF	unknown	unknown	unknown
NC_021514.1\|WP_003643774.1\|349623_351453_+\|type-1-glycerol-3-phosphate-oxidase	unknown	unknown	gnl\|CDD\|380303
NC_021514.1\|WP_016526893.1\|358350_358524_+\|hypothetical-protein	unknown	unknown	unknown
NC_021514.1\|WP_003646449.1\|357426_358344_+\|hypothetical-protein	unknown	unknown	unknown
NC_021514.1\|WP_003646450.1\|359069_359612_+\|ankyrin-repeat-domain-containing-protein	unknown	unknown	gnl\|CDD\|293786
NC_021514.1\|WP_016526894.1\|359759_360935_+\|IS256-family-transposase	unknown	unknown	gnl\|CDD\|307151
NC_021514.1\|WP_003641945.1\|351467_352190_+\|aquaporin-family-protein	unknown	unknown	gnl\|CDD\|223653
NC_021514.1\|WP_003641941.1\|345245_346217_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224050
NC_021514.1\|WP_108725669.1\|357186_357303_+\|hypothetical-protein	unknown	unknown	unknown
NC_021514.1\|WP_003646442.1\|343034_343481_-\|ribonuclease-H	unknown	unknown	gnl\|CDD\|178927
NC_021514.1\|WP_003646471.1\|363920_364085_-\|hypothetical-protein	unknown	unknown	unknown
NC_021514.1\|WP_003643773.1\|348091_349609_+\|glycerol-kinase-GlpK	unknown	unknown	gnl\|CDD\|234594
NC_021514.1\|WP_003643768.1\|341233_342145_+\|oxidoreductase	unknown	unknown	gnl\|CDD\|180448
NC_021514.1\|WP_003646444.1\|346294_347626_+\|NAD(P)/FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|224169
NC_021514.1\|WP_016526891.1\|352384_354733_+\|MucBP-domain-containing-protein	unknown	unknown	gnl\|CDD\|377660
NC_021514.1\|WP_003646470.1\|362865_363639_-\|CPBP-family-intramembrane-metalloprotease	unknown	unknown	gnl\|CDD\|376806
NC_021514.1\|WP_016526890.1\|343718_345245_+\|ABC-transporter-permease/substrate-binding-protein	unknown	unknown	gnl\|CDD\|270328
NC_021514.1\|WP_003646441.1\|340176_341097_-\|ribonucleoside-hydrolase-RihC	unknown	unknown	gnl\|CDD\|182713
NC_021514.1\|WP_016526896.1\|361821_362565_+\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|381088

Protein	Function_ID	Function_description	E-value
NC_021514.1\|WP_003646448.1\|356572_356806_+\|hypothetical-protein	gnl\|CDD\|379738	pfam15603, Imm74, Immunity protein 74. A predicted immunity protein with an alpha+beta fold. Proteins containing this domain are present in bacterial polymorphic toxin systems as an immediate gene neighbor of the toxin gene, which usually contains toxin domains of the Tox-ARC family. This domain is also found in heterogeneous poly-immunity loci.	2.43472e-10
NC_021514.1\|WP_003643774.1\|349623_351453_+\|type-1-glycerol-3-phosphate-oxidase	gnl\|CDD\|380303	NF033461, glycerol3P_ox_1, type 1 glycerol-3-phosphate oxidase. Glycerol-3-phosphate oxidase, also called alpha-glycerophosphate oxidase (GlpO), is an FAD-dependent enzyme related to the glycerol-3-phosphate dehydrogenase GlpD. Notably, GlpO releases hydrogen peroxide, which can contribute to virulence.	0
NC_021514.1\|WP_016526894.1\|359759_360935_+\|IS256-family-transposase	gnl\|CDD\|307151	pfam00872, Transposase_mut, Transposase, Mutator family.	6.12313e-110
NC_021514.1\|WP_016526896.1\|361821_362565_+\|response-regulator-transcription-factor	gnl\|CDD\|381088	cd17533, REC_LytTR_AgrA-like, phosphoacceptor receiver (REC) domain of LytTR/AlgR family response regulators similar to AgrA. Members of the LytTR/AlgR family of response regulators contain a REC domain and a unique LytTR DNA-binding output domain that lacks the helix-turn-helix motif and consists mostly of beta-strands. Transcriptional regulators with the LytTR-type output domains are involved in biosynthesis of extracellular polysaccharides, fimbriation, expression of exoproteins, including toxins, and quorum sensing. Included in this AgrA-like group of LytTR/AlgR family response regulators are Staphylococcus aureus accessory gene regulator protein A (AgrA) and Streptococcus pneumoniae response regulator ComE, which are members of two-component regulatory systems. AgrA is a global regulator that controls the synthesis of virulence factors and other exoproteins. ComE is part of the ComD-ComE system that is part of a quorum-sensing signaling pathway that controls the development of competence, a physiological state required for genetic transformation. REC domains function as phosphorylation-mediated switches within response regulators, but some also transfer phosphoryl groups in multistep phosphorelays.	9.44046e-41
NC_021514.1\|WP_003641945.1\|351467_352190_+\|aquaporin-family-protein	gnl\|CDD\|223653	COG0580, GlpF, Glycerol uptake facilitator and related permeases (Major Intrinsic Protein Family) [Carbohydrate transport and metabolism].	7.59237e-82
NC_021514.1\|WP_003641941.1\|345245_346217_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224050	COG1125, OpuBA, ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism].	1.46616e-132
NC_021514.1\|WP_003646450.1\|359069_359612_+\|ankyrin-repeat-domain-containing-protein	gnl\|CDD\|293786	sd00045, ANK, ankyrin repeats. Ankyrin repeats are one of the most abundant repeat motifs, and generally function as scaffolds for protein-protein interactions in processes including cell cycle, transcriptional regulation, signal transduction, vesicular trafficking, and inflammatory response. Although predominantly found in eukaryotic proteins, they are also found in some bacterial and viral proteins. Less is known of their physiological roles in prokaryotes. Some bacterial ANK proteins play key roles in microbial pathogenesis by mimicking or manipulating host function(s). The pathogen Providencia alcalifaciens N-formyltransferase ankyrin repeats function in small molecule binding and allosteric control. Ankyrin-repeat proteins have been associated with a number of human diseases.	6.04348e-09
NC_021514.1\|WP_003646442.1\|343034_343481_-\|ribonuclease-H	gnl\|CDD\|178927	PRK00203, rnhA, ribonuclease H; Reviewed.	0.00017599
NC_021514.1\|WP_003643773.1\|348091_349609_+\|glycerol-kinase-GlpK	gnl\|CDD\|234594	PRK00047, glpK, glycerol kinase GlpK.	0
NC_021514.1\|WP_003643768.1\|341233_342145_+\|oxidoreductase	gnl\|CDD\|180448	PRK06182, PRK06182, short chain dehydrogenase; Validated.	4.43747e-163
NC_021514.1\|WP_003646444.1\|346294_347626_+\|NAD(P)/FAD-dependent-oxidoreductase	gnl\|CDD\|224169	COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion].	9.71858e-123
NC_021514.1\|WP_016526891.1\|352384_354733_+\|MucBP-domain-containing-protein	gnl\|CDD\|377660	pfam06458, MucBP, MucBP domain. The MucBP (MUCin-Binding Protein) domain is found in a wide variety of bacterial proteins, in several repeats. The domain is found in bacterial peptidoglycan bound proteins and is often found in conjunction with pfam00746 and pfam00560.	6.56753e-10
NC_021514.1\|WP_003646470.1\|362865_363639_-\|CPBP-family-intramembrane-metalloprotease	gnl\|CDD\|376806	pfam02517, Abi, CAAX protease self-immunity. Members of this family are probably proteases (after a isoprenyl group is attached to the Cys residue in the C-terminal CAAX motif of a protein to attach it to the membrane, the AAX tripeptide being removed by one of the CAAX prenyl proteases). The family contains the CAAX prenyl protease. The proteins contain a highly conserved Glu-Glu motif at the amino end of the alignment. The alignment also contains two histidine residues that may be involved in zinc binding. While they are involved in membrane anchoring of proteins in eukaryotes, little is known about their function in prokaryotes. In some known bacteriocin loci, Abi genes have been found downstream of bacteriocin structural genes where they are probably involved in self-immunity. Investigation of the bacteriocin-like loci in the Gram positive bacteria locus from Lactobacillus sakei 23K confirmed that the bacteriocin-like genes (sak23Kalphabeta) exhibited antimicrobial activity when expressed in a heterologous host and that the associated Abi gene (sak23Ki) conferred immunity against the cognate bacteriocin. Interestingly, the immunity genes from three similar systems conferred a high degree of cross-immunity against each other's bacteriocins, suggesting the recognition of a common receptor. Site-directed mutagenesis demonstrated that the conserved motifs constituting the putative proteolytic active site of the Abi proteins are essential for the immunity function of Sak23Ki - thus a new concept in self-immunity.	8.33506e-10
NC_021514.1\|WP_016526890.1\|343718_345245_+\|ABC-transporter-permease/substrate-binding-protein	gnl\|CDD\|270328	cd13610, PBP2_ChoS, Substrate-binding domain ChoS of an osmoregulated ABC-type transporter and related proteins; type 2 periplasmic-binding protein fold. Osmoprotectant binding lipoprotein ChoS of Lactococcus lactis is predicted to be involved in uptake of compatible solutes such as choline and glycine betaine, but the relative substrate preference is not known. To counteract the efflux of water, microorganisms accumulate the compatible solutes for a sustained adjustment to high osmolarity surroundings. ChoS belongs to the type 2 periplasmic binding fold protein superfamily (PBP2). The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	8.40582e-155
NC_021514.1\|WP_003646441.1\|340176_341097_-\|ribonucleoside-hydrolase-RihC	gnl\|CDD\|182713	PRK10768, PRK10768, ribonucleoside hydrolase RihC; Provisional.	0

>NC_021514.1|WP_016526891.1|352384_354733_+|MucBP-domain-containing-protein
MTDSTDKVAPDETVKVGYGKAYDVTKQVKTITGYKRNATLDEHTRGTASKTTKEAVMYYDPLPYNIHVNYLLTDGQKLDELDVTGLYGDTYTTEATDFEDLYTVDTDRLPTNAQGTVTEKPTTVNYYYQPTTGQWVDVGNQSSVLVRQDTKHNVRSVSQIYANDSGFTVKYNQDAAQVAIAASDTNGTQDNSLVFDYNSKYTFELSKNETVTFKVDDQGQVTATRVLGAEQTVTTFDKSGQLKTVTTVTNANGTKSQQTNTVDGLKSMVTGEQYDLGLLNGLKVTAQKEINPSQAATTESKTTTDTSQSGSNQSTSTTATDQTETNESTAGSSTNATNASSSVDASSANSQGDTEATSQSGTSASADSKTDSSAASSTSQTTDGETTNTDDTTTGTTTDSGLGFKSPFTEDQNTSSALGSAQTSSSLNSDTSAAVQALIAEPNSTPVVLGEDASFEEGVPVNDPVFSNGEGVSPNNNPSSAATPLAQATNTRARLTQNGKLLYEGTLQADQGEQNLYVSPDTTVEVDGGADGDGFYLDTYDGDKGMAYTLGSGYAWAAENNDVTAAPASSATTSSESAASESSTNSSDSSRTASSAADHSTSSASISDASQSSHSTSSSENSRSESSSSSSTTGDSADADKQAAARSSQTQSNSVNGSSQAVGSSTVTSQSSVPTKANTKQASSTPTTKANRATVVAATSSTAPRQSRATTASASVPSVTSASAAAASRAKQRSAFKKQHPILNQILPKTNSAVATWLVWLGVGLLILTVAITMVIKKRGRD
>NC_021514.1|WP_003641945.1|351467_352190_+|aquaporin-family-protein
MMKDPLALQLLGEFLGTFILILLGDGVVAGVTLNKSKAQNAGWVAITLGWGFAVTMGVYASSFMSPAHLNPAVSLGMAVAGKFPWAYVIPYSAAQIAGGVIGGLVVWLHYYPHWQATKDAGAILGIFATGPGIRRYFWNFISEVIGTFVLVFGLLAFTKGQFTAGLNPIVVGILIIAIGLSLGGTTGYAINPARDLGPRIAHAVLPIANKGTSDWAYSWVPIAGPLVGGALGALLFNVLP
>NC_021514.1|WP_003643774.1|349623_351453_+|type-1-glycerol-3-phosphate-oxidase
MAFSATTRQQNIERLQNETLDLLVIGGGITGAGVAIQSTAMNMKTGLIDMQDFAEGTSSRSTKLVHGGIRYLKTFDVGVVADTVKERAVVQGIAPHIPKPDPMLLPIYDETGATFDLFSVKVAMDLYDKLAEVKDPKFTNYTLSREEVLQREPQLNPKHLVGGGVYLDFRNNDARLVIENIKKAHENGGIMASHVKATGLLHDDDGRINGITAEDLLTGASFEIHARIVINTTGPWSDTIRKMDHTEKYQSQMRPTKGVHLVVDAEKLPVPQPTYFDSGDQDGRMIFVVPRENKTYFGTTDTDYHGDLKHPTVTQEDVDYLLEIVNRRFPTAKITLDDIEASWAGLRPLIAANGSSDYNGGNSGKISDKSFKEVIKVVDQFESQEASREDVESVLNDLETSLAEDKLSPSAVSRGSSLTSSPDGLLTLAGGKITDYRKMAAGAMALIAKILADKYDAHFNEINSKNLPVSGGDIDPHNVDATIAFYAKQGTDNGLTNDEALRIANMYGSNAARVFSLIGKVEPTHGLSLAETISLRYALDEEMTLTPVDYLLRRTNHLLFMRDTLDGLKDGVIATMADYLGWDAATVKAQTELLNQTIAESDLTALKQG
>NC_021514.1|WP_003643773.1|348091_349609_+|glycerol-kinase-GlpK
MTDKYIMAIDEGTTSTRAIIFDHAGHKVADSQREFPQYFPQPGWVEHNANEIWNAVLSTIANAFIESGIKPAQISGIGITNQRETTIVWDKQTGLPIYNAIVWQSRQTAPIAEKLVKDGYGDLIHQHTGLVTDAYFSATKIRWILDHVKGAQERAEKGELLFGTIDTWLLWKLTGGATHVTDYSNASRTMLFNIHDLKWDDQILQLLNIPAAMLPEVRTNSEVYGKTKDYHFFGSEVPISGMAGDQQAALFGQLAFEPGTVKNTYGTGAFIVMNTGEKPQLSDNNLLTTIGYGINGKVYYALEGSIFVAGSAIQWLRDGIRLVESAPDSERAARESHNENEVYVVPAFTGLGAPYWDSEARGSVFGLTRGTTREDFIKATLQALAYQTRDVVETMKKDSGIEIPVLKVDGGAARNDWLMQFQADILDTQIMRAANLETTALGAAFLAGLSVGYWQDLEELKASYKPGTSFDPEMGPAERTNLYEGWQAAVKATQVFKHTPYHAGK
>NC_021514.1|WP_003646444.1|346294_347626_+|NAD(P)/FAD-dependent-oxidoreductase
MAEQYDVVVIGGGPAGNAMASGLKAQGKTVLIVEADLWGGTCPNRGCDPKKILLSAVEARQAAQHLQGQGLIGAPKIDWPALMAHKRGYTDGINDGTLNGLTGQDIATLHGQAHFQSDNQLAVGDRVVSATDYVIATGQRPAILPITGHEYFKTSTDFLDLDQMPKRVTFVGGGYVGFELATIANAAGADVHVIHHNDRPLKAFDADLVKDLMAAMTADGITFDLNTDVQAITKTATGLQLTADNFELTTDLVISSAGRIPNADQLGLANVGVTFDRHGIQVNDHLQTANPHIYAIGDVSDTPVPKLTPVAGFEARYLVGELTHPGAAIKYPVVPTQVFAAPKLAQVGISAAVATEHPDEYRVNTLDMTKWFTYYRFGAQQAQAKVVVAKASGQVVGATLLSDVADEMINYFTLLIEKHVTLPDLQRLVLAYPTPASDLQYLY
>NC_021514.1|WP_003641941.1|345245_346217_+|ABC-transporter-ATP-binding-protein
MTTAIEFQHVQKDFNGQTVIPDLNLTIDQGELFVLVGTSGSGKTTSLKMINCLEPLTAGKILVNGTDTTTIPVRSLRWQMGYVLQQIALFPTMTVAQNIAVIPEMKGTAKKEINQTIDELLAEVGLDPKEYRDRMPSELSGGEQQRIGILRAIAAQPDIVLMDEPFSALDPISRQQLQDLVLRLHARYHNTIVFVTHDMNEALKLGDRIGVMQHGQLIQVDTPAALAQHPVNDFVRNFFGASRAKNVYDVYVGRVGLIQGYLTEEPSVASGRIQSLDVQATLRTAFTALTDHDYVAVTEENRVVGYLDRQRIVAYLSQHEEVS
>NC_021514.1|WP_016526890.1|343718_345245_+|ABC-transporter-permease/substrate-binding-protein
MQTLIQTFIDRRGDLLTALWQHLGISLASLVIAMVIAIPLAIWVVRRPRWAEGLLQLTSVLQTIPSLALLGLLIPLVGIGTVPAVIALVIYALLPIFQNTYLGISEIDASIEEAADAFGMSRMRKLFKVELPIALPQIIAGIRTALVLIIGTATLAALIGAGGLGTFIMLGIDRNDTSLLLIGAISSALLAILLSALVRWFQTAKPRHALIVFVGILALLGGGGAYSVYANRVETITIAGKLGSEPEILINMYKQLIEAEDEHVHVTLKPNFGKTTFLFSALKNNQVDIYPEFTGSVLETLVKGNNPAGQTANQTYQLAKQRLAKQEQMTYLKPMQYNNTYALAVTKKFQQEHHLKTISDLTQVESILKPGMTLEFIDRNDGLKGIKKTYGLDVTAKSMEPALRYEAISKGKINLVDAYATDSELRQYHLALLKDNKHFFPTYQGAPLMKTNFANKHPKVVKALNKLAGKISETDMQEMNYEVNVKKQSASTVAHRYLVKHGLLKEGR
>NC_021514.1|WP_003646442.1|343034_343481_-|ribonuclease-H
MATIHLYLASTNHQSTNITATTPAAWVVILRYADHQKALNDGGYGHTETSLALSALTTALATLKRHDLPVHVHTTTEQVAAVISEQRYLSWRQNNWDVPEADQPDLPQWQTLIPIIEEFPNLTITYHPVDDPAMTTATTTLTAVMTKL
>NC_021514.1|WP_003643768.1|341233_342145_+|oxidoreductase
MSQPRVILITGASSGIGKATALKLQAQGNIVYGAARRIEKMTDLAAAGVHVLKVDVTDEATLIAAVKTIQVEQGRIDVLINNAGYGSYGSLEDVPVAEGEYQFKVNVFGVMRLTQLVLPLMRAQHRGRIINVSSIGGKIYQPLSAWYMGTKHAIEGMSDSLRMEVAPFGIDVVIVEPGGIKTEWAGIAEKKLLAVSGETAYHEQAVKVGAMLSLFDQFASNPGVIAKLMVRAVNDVKPKTRYHAGMGAGVSLTARQWLSDRQFDRMMNSAVNGAAKLSKVTRRKDRRTGSRHYRHGKIPADNN
>NC_021514.1|WP_003646441.1|340176_341097_-|ribonucleoside-hydrolase-RihC
MSTKIIMDTDPGIDDAAAITFALNHPDLDLQLITTVAGNVTVDKTTLNALKLTRFFNSDVPVAGGAAQPLIKPFEDAVRIHGVSGMPGYDFPTDLAEPLPETAVEALRDYIMAAEQPITLVPTGAYTNIALLFKTYPEVMPHIKEIVAMGGALGKGNMTSAAEFNVFTDPHAAEIMYQSGVPITMVGLDVTMKALLTRESIEQLPTLGKTGEMLHALFGHYNDRNQTGVAMHDVNTLFYLLHPEAFTTEKMWIDVQTEGPANGETVGDIRGAYHDGKTNATVCVDIDAAAFNKWFLETVAAIDQPK
>NC_021514.1|WP_003646448.1|356572_356806_+|hypothetical-protein
MKITGSSSHVKFDLENEYAVKAEGEMLVGGQFVVFKDSMKNWEPPHEDEKLSEAEVQEIIQQVKQNTNENTVQISFE
>NC_021514.1|WP_108725669.1|357186_357303_+|hypothetical-protein
MNQGIISCLTDLVRYNDIYTMITGKDAATGYNLVTGTR
>NC_021514.1|WP_003646449.1|357426_358344_+|hypothetical-protein
MTKRLSEQESYFSMSEFLESYYWASRDDDLGSLLGSVTLWSDDGELFDQAIAEDWHAFFSDVSNENHTVFESFQAVKQFVNEYLPDIAATTPVSGSLTYNIRIICEMTESQRNQEPVWQNWVAAVNWITNPNVVPVNESPFLKTGQSLPNPKEKGFRQNQFPIAKVLPAPRPEIPMGPSLEKVDLTQSYYAFVKFLQHYYQVSDDSELGNFLQQNRAISENNEEYRYWKGKFSRCSGNKKLLDILKAFLMVRDYFEIEFPDNALHTHPVRKLSCNLWKAAYLPHSQRIQTEVWQNWLTAVHQVIE
>NC_021514.1|WP_016526893.1|358350_358524_+|hypothetical-protein
MSFDNQLSSQFKDQEDSYNAIILLYDYSYDKEQVVRKIATGENYRINYIGTVIYEDE
>NC_021514.1|WP_003646450.1|359069_359612_+|ankyrin-repeat-domain-containing-protein
MKILNVFDAVRDGTFQDFKNFYEGNINVISGNLDLNLLCMAVTNDKNPEEKLQIIKFLFAEGIDVNYATQKEKRNALHLFYFCVLRPTIEYEMEITNLFIKHGMNVNATDKYNAIPLKYAITINNLPTSDNKEMYQLLLNKGSDYNLKDGFGKSCLDYAKEYSWRNDFLDIVKEYENSKN
>NC_021514.1|WP_016526894.1|359759_360935_+|IS256-family-transposase
MNELTTEIIAALAQKQDLDEVFRHHLEIAINQLLQTELAEFLGYERYSYAGINTGNNRNGSYERSFDTKYGQLNLTIPRDRNGRFENHTLPAYGRHSDNLETTVIQLYTKGITTAEIAELIEKMYGAHYSKATVSNMTKAVNEQVQAFQQRRLASQYAAIFLDATYLPLKRDTVQKEAVHIAIGIRPDGTKEVLNYQVAPTESTGIWTELLGTLIKQGVKDVLLFVADGLVGLDEGLNRHFPKAKRQRCLVHVGRNLMNKVRVKDRKAVISDFKQVHRAANREAAELKLNEFANNWHQTYPKLIKDLLKMPNLLTFMDFPPAIRQSLYSTNLIENFNKHLKRTTHHKEQFPTEDSLDRFLVSQFNVYNEKSLKRIHRGFKGLQGTLEASFI
>NC_021514.1|WP_016526896.1|361821_362565_+|response-regulator-transcription-factor
MFPIYLYEDNAEQRDNYCKTVNNTMMINEFAMELRVATDDQKIILADLNQQQDGLFFLDMEIGEDKQTGLELASRIRATIPLAKIVFITTHDELSFVTLERRIAPLDYILKDQSADLITQRIIKDINVVQNELKKTNSQRKDVFNYKLGTRYFSLALDDVILLSTSKLRPGSVQLHAINKVAEFPGNLNALEEKYPQFFRCDKSSLVNLNHLRSFDYKEKELLLDGEIRCKASFRKSRELNKLLRDN
>NC_021514.1|WP_003646470.1|362865_363639_-|CPBP-family-intramembrane-metalloprotease
MPLIKVIITAIYYLIVLFLMNPLTDIMGIKDGPFQFILTESIILIAIIILNRRYVKQPIHWLPVNIMSILKKNSLPLSLAIIFLLIFFRNHMYQFLISLLLSLIVAITEEYAFRGMIFRTLLALNLKKFATLQATIASMMTASLIFAAMHLVNLLSQPVWSVLCQVLYVIGLGILLAAIYLKTGSLLAAISVHWLIDFSSFYSQGIDPTQSPINGPMEALLKGLFLNILFIGIATFILSSKHWKLLSILNIEDKIDE
>NC_021514.1|WP_003643811.1|363737_363896_-|two-peptide-bacteriocin-plantaricin-EF-subunit-PlnF
MKKFLVLRDRELNAISGGVFHAYSARGVRNNYKSAVGPADWVISAVRGFIHG
>NC_021514.1|WP_003646471.1|363920_364085_-|hypothetical-protein
MLQFEKLQYSRLPQKSLPKYLVVLIGAVITLVKVFDIDEIGSVAGIRGILKSIR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_021514_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_021514_2

2610434-2610519

Orphan

Consensus_repeat	Method
TAAGAAACTTAAAGTGTCTTATT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_021514_2

>merge|NC_021514|2|2610434-2610519|CRISPRCasFinder
TAAGAAACTTAAAGTGTCTTATTCGCATAACTGGTATAATACGCTATATAAAGAAAAAGTCAATAAGAAACTTAAAGTATCTTATT

>NC_021514|2|1|2610434-2610519|CRISPRCasFinder
TAAGAAACTTAAAGTGTCTTATT	CGCATAACTGGTATAATACGCTATATAAAGAAAAAGTCAA
TAAGAAACTTAAAGTATCTTATT

Protein	Signature genes	Signature genes Name	Protein_function
NC_021514.1\|WP_016511874.1\|2614206_2615202_+\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376439
NC_021514.1\|WP_003645366.1\|2607931_2608123_+\|hypothetical-protein	unknown	unknown	unknown
NC_021514.1\|WP_003642355.1\|2617125_2617872_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|226674
NC_021514.1\|WP_016527331.1\|2612422_2613217_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224045
NC_021514.1\|WP_003643392.1\|2602419_2602785_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224647
NC_021514.1\|WP_049816394.1\|2611256_2612138_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|238558
NC_021514.1\|WP_003642344.1\|2604497_2605535_+\|aldehyde-reductase	unknown	unknown	gnl\|CDD\|187538
NC_021514.1\|WP_003642342.1\|2602917_2603646_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|226674
NC_021514.1\|WP_003645367.1\|2606468_2607422_-\|aldo/keto-reductase	unknown	unknown	gnl\|CDD\|381318
NC_021514.1\|WP_003645365.1\|2608369_2608609_-\|hypothetical-protein	unknown	unknown	unknown
NC_021514.1\|WP_015640979.1\|2605683_2606250_-\|DUF1211-domain-containing-protein	unknown	unknown	gnl\|CDD\|226078
NC_021514.1\|WP_003643401.1\|2615445_2615958_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|274100
NC_021514.1\|WP_003645369.1\|2603804_2604371_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NC_021514.1\|WP_016527334.1\|2618653_2619490_+\|SDR-family-NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|212492
NC_021514.1\|WP_016511877.1\|2619500_2619881_+\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133384
NC_021514.1\|WP_003642340.1\|2601851_2602136_+\|DUF1905-domain-containing-protein	unknown	unknown	gnl\|CDD\|378097
NC_021514.1\|WP_003642356.1\|2617888_2618344_-\|acetyltransferase	unknown	unknown	gnl\|CDD\|100047
NC_021514.1\|WP_003643397.1\|2608940_2610419_-\|DHA2-family-efflux-MFS-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|129794
NC_021514.1\|WP_016511875.1\|2615938_2616832_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187572
NC_021514.1\|WP_003643398.1\|2610536_2611136_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228

Protein	Function_ID	Function_description	E-value
NC_021514.1\|WP_003642355.1\|2617125_2617872_-\|SDR-family-oxidoreductase	gnl\|CDD\|226674	COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only].	2.40011e-91
NC_021514.1\|WP_016511877.1\|2619500_2619881_+\|MerR-family-transcriptional-regulator	gnl\|CDD\|133384	cd01109, HTH_YyaN, Helix-Turn-Helix DNA binding domain of the MerR-like transcription regulators YyaN and YraB. Putative helix-turn-helix (HTH) MerR-like transcription regulators of Bacillus subtilis, YyaN and YraB, and related proteins; N-terminal domain. Based on sequence similarity, these proteins are predicted to function as transcription regulators that mediate responses to stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.	1.28343e-18
NC_021514.1\|WP_003642356.1\|2617888_2618344_-\|acetyltransferase	gnl\|CDD\|100047	cd03357, LbH_MAT_GAT, Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates. MAT acetylates maltose and glucose exclusively at the C6 position of the nonreducing end glucosyl moiety. GAT specifically acetylates galactopyranosides. Furthermore, MAT shows higher affinity toward artificial substrates containing an alkyl or hydrophobic chain as well as a glucosyl unit. Active MAT and GAT are homotrimers, with each subunit consisting of an N-terminal alpha-helical region and a C-terminal left-handed parallel alpha-helix (LbH) subdomain with 6 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X).	9.94104e-53
NC_021514.1\|WP_003643392.1\|2602419_2602785_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|224647	COG1733, COG1733, Predicted transcriptional regulators [Transcription].	1.44304e-30
NC_021514.1\|WP_049816394.1\|2611256_2612138_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|238558	cd01138, FeuA, Periplasmic binding protein FeuA. These proteins have predicted to function as initial receptors in ABC transport of metal ions in some eubacterial species. They belong to the TroA superfamily of periplasmic metal binding proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind their ligands in the cleft between these domains.	5.81827e-56
NC_021514.1\|WP_003642344.1\|2604497_2605535_+\|aldehyde-reductase	gnl\|CDD\|187538	cd05227, AR_SDR_e, aldehyde reductase, extended (e) SDRs. This subgroup contains aldehyde reductase of the extended SDR-type and related proteins. Aldehyde reductase I (aka carbonyl reductase) is an NADP-binding SDR; it has an NADP-binding motif consensus that is slightly different from the canonical SDR form and lacks the Asn of the extended SDR active site tetrad. Aldehyde reductase I catalyzes the NADP-dependent reduction of ethyl 4-chloro-3-oxobutanoate to ethyl (R)-4-chloro-3-hydroxybutanoate. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	7.62333e-95
NC_021514.1\|WP_003642342.1\|2602917_2603646_+\|SDR-family-oxidoreductase	gnl\|CDD\|226674	COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only].	1.6523e-89
NC_021514.1\|WP_003645367.1\|2606468_2607422_-\|aldo/keto-reductase	gnl\|CDD\|381318	cd19092, AKR_BsYcsN_EcYdhF-like, Bacillus subtilis YcsN, Escherichia coli YdhF and similar proteins. Bacillus subtilis YcsN and Escherichia coli YdhF are prototypes of this family. They are uncharacterized aldo/keto reductase family oxidoreductases.	1.45542e-130
NC_021514.1\|WP_016511874.1\|2614206_2615202_+\|iron-ABC-transporter-permease	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	3.00121e-78
NC_021514.1\|WP_015640979.1\|2605683_2606250_-\|DUF1211-domain-containing-protein	gnl\|CDD\|226078	COG3548, COG3548, Predicted integral membrane protein [Function unknown].	6.30859e-29
NC_021514.1\|WP_003643401.1\|2615445_2615958_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|274100	TIGR02366, conserved_hypothetical_protein, probable dihydroxyacetone kinase regulator. The seed alignment for this family was built from a set of closely related uncharacterized proteins associated with operons for the type of bacterial dihydroxyacetone kinase that transfers PEP-derived phosphate from a phosphoprotein, as in phosphotransferase system transport, rather than from ATP. Members have a TetR transcriptional regulator domain (pfam00440) at the N-terminus and sequence homology throughout.	3.33884e-08
NC_021514.1\|WP_003645369.1\|2603804_2604371_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	2.749e-05
NC_021514.1\|WP_016527334.1\|2618653_2619490_+\|SDR-family-NAD(P)-dependent-oxidoreductase	gnl\|CDD\|212492	cd05327, retinol-DH_like_SDR_c_like, retinol dehydrogenase (retinol-DH), Light dependent Protochlorophyllide (Pchlide) OxidoReductase (LPOR) and related proteins, classical (c) SDRs. Classical SDR subgroup containing retinol-DHs, LPORs, and related proteins. Retinol is processed by a medium chain alcohol dehydrogenase followed by retinol-DHs. Pchlide reductases act in chlorophyll biosynthesis. There are distinct enzymes that catalyze Pchlide reduction in light or dark conditions. Light-dependent reduction is via an NADP-dependent SDR, LPOR. Proteins in this subfamily share the glycine-rich NAD-binding motif of the classical SDRs, have a partial match to the canonical active site tetrad, but lack the typical active site Ser. This subgroup includes the human proteins: retinol dehydrogenase -12, -13 ,and -14, dehydrogenase/reductase SDR family member (DHRS)-12 , -13 and -X (a DHRS on chromosome X), and WWOX (WW domain-containing oxidoreductase), as well as a Neurospora crassa SDR encoded by the blue light inducible bli-4 gene. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	9.04005e-57
NC_021514.1\|WP_003642340.1\|2601851_2602136_+\|DUF1905-domain-containing-protein	gnl\|CDD\|378097	pfam08922, DUF1905, Domain of unknown function (DUF1905). This domain is found in a set of hypothetical bacterial proteins.	1.07383e-22
NC_021514.1\|WP_003643398.1\|2610536_2611136_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	4.95133e-09
NC_021514.1\|WP_016527331.1\|2612422_2613217_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224045	COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism].	1.35948e-113
NC_021514.1\|WP_016511875.1\|2615938_2616832_-\|SDR-family-oxidoreductase	gnl\|CDD\|187572	cd05262, SDR_a7, atypical (a) SDRs, subgroup 7. This subgroup contains atypical SDRs of unknown function. Members of this subgroup have a glycine-rich NAD(P)-binding motif consensus that matches the extended SDRs, TGXXGXXG, but lacks the characteristic active site residues of the SDRs. This subgroup has basic residues (HXXXR) in place of the active site motif YXXXK, these may have a catalytic role. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	1.02953e-129
NC_021514.1\|WP_003643397.1\|2608940_2610419_-\|DHA2-family-efflux-MFS-transporter-permease-subunit	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	3.12844e-72

>NC_021514.1|WP_003643397.1|2608940_2610419_-|DHA2-family-efflux-MFS-transporter-permease-subunit
MQAKAKISKATMTIAWVVVFGAMAPLLDSTMINIAINNLVTSFHSSVTTVQWAVTGYLLATGVAVPFSSWLLNRFDGKAVFVAGEILFGLGSIFAAVAPNIQLLIIARLVQGFAGGLIMPLLTTLLVQTAGAAVMGQMMATVGLPMILGPLIGPVIGGIIIKFASWHWIFWINVPVVLISIALILWKMPNYPAQNRTAKMDFIGILLLIVSSSAIIYSLVNAAHTDRFNNATSIEMLILGAIALISYVVWAAWQKERAVVPLHLFKFASFDGAGLGLFIAGTVLNGAMLLLPLYFQNVRGMSVINAALALLPQGAGMLVSRTLTGRLTDQIGAKYVVLGSVVITFVGTLPFYWFGQQTSYWILALVLFVRGIGAGGILMPLMADAYTGMQPGQVPAATIGTRIIQNIGSAFGSALITTIVTAYSTHQVNVFERHLKAGTYHVDAAHLQVFTTSHLQAIRLAAFQQGFLVIAIAAIVIILPTLLLTNKLKAAK
>NC_021514.1|WP_003645365.1|2608369_2608609_-|hypothetical-protein
MKKVYLRYQKQVDSFININKIMLMLEFVLLFVVKGSIDRYNQLPYDWFAYLTTLIHYFLGTFTFFGIILVIECVWNKLK
>NC_021514.1|WP_003645366.1|2607931_2608123_+|hypothetical-protein
MAAFSEKQLKKAPVTDQEFEKVVAVAKPDVQGIHSVCQQLVISFIAEERFLAVFGDGTCHPSN
>NC_021514.1|WP_003645367.1|2606468_2607422_-|aldo/keto-reductase
MKTIQIGASQLKASAVALGIMRMVRLDTDAAANVLETVHDRGVNFIDSADIYGNGDSERIFGQALKQSSLKREDFFIQSKGGIVLDPEKSSGELVFGQRYDFSKQHLIATVDKILQRIQLDYLDSFLLHRPDPLMDPAEVAAAFDELQAAGKVRHFGVSNFNPMQVEMLQAAVSQKLMINQLQFGVMHTGPIQFGLHTNMQDTASLNHDGEIIEYSRLHHMTIQAWSPYQYGMFAGTFIDNPKFPELNAKLQELADQYHVTKNAIATAWILRHPANMQVILGSMNPQHLDESIAGTDVTLTRQEWYDVYFAAGNDLP
>NC_021514.1|WP_015640979.1|2605683_2606250_-|DUF1211-domain-containing-protein
MNKARLEAFTDAIIAIVLTLLVLDLPRPQTPSVRALFAEWQSIYVYIITFTLLISIWLNHHDLFVQVKKIDRVVFWANSFWLLCQSFIPFMASWITKFPHSKWPAVFYILTGFVWMLAYQLLVAAVRRLNPHIHRMSSPALSVVFGGFLVVLTVALINPDVGLFLIPVHAFVSVILATKRKWHLRKYF
>NC_021514.1|WP_003642344.1|2604497_2605535_+|aldehyde-reductase
MQKQLVVVTGGSGFIAIHIIRQLLQQGYAVRTTVRSLAKAPVIKEMLTNGGITDLSALEIVVADLAHDEHWSEAMAGATYAIDVASPTPKLNFKNKAEMIRPAVDGVRRVLTASRDAGVKRVVLTSAYGAIFAGHKNRTTPYTEADWSDLNWKAIHPYQESKTRAELAAWDFINHEGRGLELTTVNPVAVMGPVLSAKYSHSNIQIQQFLEGQVKAVPNVDSGYVDVRDVASLHLLAMTAPQANGERFLATTGETLSMLDVANVLRQAFPAFASQLPTKTIPNAAVKLAAKARPELRMVASLVGTYAETSNHKAQTLLDWHPRPAAESIIATAQSMIDLGIVTKP
>NC_021514.1|WP_003645369.1|2603804_2604371_-|TetR/AcrR-family-transcriptional-regulator
MAATNHAQAIKKDSQTYLTTALLQLLRTHDLDTITVTQVVKRAGVSRMAFYRNFTTLEDLLDAYFAPAIAARFQDVLQHVPANQKLLAMGQFFSDFAPTLRLAEQRGFENIIQQLFNANMTNYYQTTMANGTLTAVQLKYWTRFMSAGVYAIWREWLLGGQLEPLTMIHELLATLQTATMQALTQAQK
>NC_021514.1|WP_003642342.1|2602917_2603646_+|SDR-family-oxidoreductase
MKPLVVITGASSGFGAEIAKLFAADNYPLLLLGRRQAKLAALSANFENAMIDTVDVTNYHQFETAVRKAEAKYGKTDLLVNNAGLMLLGNVQNQDPQEWQTMLNTNVMGVLNGTQIVLNDMRDREHGTILNMSSLAGKKTFVNHAAYVASKFGVHGLSETLREENAPKNVRVMLVAPGAAETELLTHVTSKSALSDYEAWKASMGGLTLDPKHVAATVKFMYDMPQNVNIREVDIAATAQDA
>NC_021514.1|WP_003643392.1|2602419_2602785_-|helix-turn-helix-transcriptional-regulator
MLKERVTAQPRYRNEFDATMQLIRGKWKIMILFELAEVKVSRFADLQHHIQAVSHKTLASQLKKLEQDELIERHDFKTAQPHVEYRLTAKGQSLIPILDAICTWGDQHVDPALIERSLCDE
>NC_021514.1|WP_003642340.1|2601851_2602136_+|DUF1905-domain-containing-protein
MKTYQFDAPIQAATIGKGGAYVACPFDIRDLFGKGRVKVHATFDEVPYNGSIVNMGVKNLDGSICYILGIRKDIRAKLHKSIGDVVAVTVTAID
>NC_021514.1|WP_003643398.1|2610536_2611136_+|TetR/AcrR-family-transcriptional-regulator
MTKTRRRGAELENAIYQAARDILNQDGLEQLTFANVAEQAGTSKPVIYRRWRSPLELAIAAIQDQIITENHGQLDEVSLTGQTLSEDLFQVLKRFTVSINTFNQALVITWFHHLDQQANPEVKDLLNAVKKIDAHAIERVCQRAQQRGELRTGTLSCDLQLMPFDWLRYRAFANEPITDATLHLLVDDLLVPAYQHALG
>NC_021514.1|WP_049816394.1|2611256_2612138_-|ABC-transporter-substrate-binding-protein
MGSLLLGACGAKQPTSTTVTRTDYLKHKVKVPKHPKRIVASYLEDDLVALGIKPVVQWSVKNGSGTQAYLKEQLKGVPLIDYSLPYEAVTKAKPDLILIGTSSAVANGKYAQYNKIAPTYVVKNGTTVTWRQTFLDVAKVVNRQAKAKKVLAKYDEQVQTTRQALKKSGQHKVAVLWVTNNTAYMVNDNSASGALLYQDLQLGEPSLVKQVSKSATADWSAVSLEKLAKLDADDIFLVNSQKSASLFKDPLWKNIKAVKNNHLYQYGDSSSWQYSGPIAYSQMIDMVKTDLLK
>NC_021514.1|WP_016527331.1|2612422_2613217_+|ABC-transporter-ATP-binding-protein
MNTIEAQNISIGYGDKVIVDQLSITIPHGQITTLIGPNGSGKSTLIRAIAHLLPPTTGVILLDHQNIQQIKSKTFAKKIAVLPQTNQTANDLTVEELVSFGRLPYRRPLNGLTTTDHQKIEWALTQASLQDLRQRPLSTLSGGQRQRAWIAMAVAQDTDTIILDEPTTYLDLTHQLEVMQLVKKLNEQAHRTIIMALHDLNHAARISDQLIALKDGHVLAHGPVSTVMTAANLKKIFNIDATLVDYHGTPLILTYNGCQEVAPA
>NC_021514.1|WP_016511874.1|2614206_2615202_+|iron-ABC-transporter-permease
MSPNRRLIIWSLLLTASMLGLAILNLSTGTMTISWPALLGILTSRGNATDMLVLVNFRLPRIVLAIMVGWALALSGNVLQTVTNNPMADPSLLGINNGAGLAVMLLIIGAGTNASLTLSLPIVALAGAWLSTALIFLLANQRQRGISSKRLLLVGVALSGCFSALMVLMTLKLSPDNYQFVMNWLAGSLWGTDWSYIGWALPWLAVGSGILFIQLPVLDAFTLGTTTAQTLGINLKRQQLGLISMAAMLAGVSVAISGGISFIGLITPNLARRIVGSRQRYQLPLAGLLGSTLLLAADTLGKLITTTTELPAGVLVALIGAPYFIYLLVRG
>NC_021514.1|WP_003643401.1|2615445_2615958_+|TetR/AcrR-family-transcriptional-regulator
MANQRNQRMQATILLAYENLLSDKPFRKITVQDISDAALVHRSTFYKHFQDQYDLLEALFEQKRQQSKLTIDQIFTHPFETLNSFGNARFQETLRHQFNDDAFRDAFLNYLIHLCKDTVDDDQRLVRFLAVGRIKGLTLWITVGNAPYNIFTDTATLDNIFSNPLNTVNY
>NC_021514.1|WP_016511875.1|2615938_2616832_-|SDR-family-oxidoreductase
MKVFITGGTGFVGSAVVQELVANGFEVVGLARSETSAQKLISWGAQPVRGSLTSLSTLATAAAQADAIIHLGFNNDFRHFFQAGAMDRRAIETMGRAISGTNKPLVVTYGTTGIRKHVETEHEVADTGLLKWLTPRKSEIVARQLMAQNINAFVIRLSPAVHGAGDMGFTRTVIERAKKSHRAEYFGLGTHAWSAVHRLDAAHLFYLVTMYGLEHPTTNERVFNAVAEESITTAAIARTISRKLNVPLKAKYNPLSFGDTAMLYLINCPTSSQLTRQILGWVPVQPDLLTDISSSRY
>NC_021514.1|WP_003642355.1|2617125_2617872_-|SDR-family-oxidoreductase
MSIKGKVVVITGASSGIGAATAKLLAAKGAKVVLGARREERLQALSQAIGDNAVYQVTDVTDRQQVRALIDLAVSKFGRVDVLYNNAGTMPQGNLSDREYDKWQMMLNVNIMGVLNGIGEVLPIMQKQHDGLIIATDSVAGHVVYPASAVYNGTKYAVRAIMEGLRQEEKEHGIRSTIVSPGAVRTELVNTIGNTQIQAGISELMNADDRQGLALNPEDIANAVLFAIDQPKHVAISEVLVRPAQQEV
>NC_021514.1|WP_003642356.1|2617888_2618344_-|acetyltransferase
MNVTREPSEIRERLAEITGQTIDISVEIRVPLWTDYGRNLKIGKRVFINDNVQITDLGGIELADDVLIGPGAMLLSVNHPLDPAKRHAVEVQPIHIERNAWIGAGAKVLAGVTVGENAVVGAGAVVTKSVPANTVVAGVPAKVIKTIEQVD
>NC_021514.1|WP_016527334.1|2618653_2619490_+|SDR-family-NAD(P)-dependent-oxidoreductase
MQSKLAVIIGGTSGVGKHTAIDLANQNYHVIIVGSRADKGRQAQADISQATGNQAVQLALADLSTKTGVQQFAHQLASMTDHIDILLNSIGVMLPERHLSADGYDLNLVLNYLTHFWTIQALLPLLKHSDQARILLVGALPFVINHAKVSLPDFDAPATSKYNAMTVTAQATAARVLLTLALSERLTATNVTINIFHPGYVPDSNFGAGGSWVSRLAGRILGESFSRKNSPIGAWLATAPELTHTSGHFYDDRLRQVPLSKQYTRSKANDLWRLSSQY
>NC_021514.1|WP_016511877.1|2619500_2619881_+|MerR-family-transcriptional-regulator
MLTFKIPEQQHYFTTKEVTTITGMTKDALRYYEHLGILPDVQRNQYNYRQYSHKNLETLQLIKIFRDLDLDLSLLTPAHLALDGQAKVVAFKQYQQVIRDRIRHLEAIDQLLATKIDYFEHQSIDT

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_021514_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_021514_3

2643496-2643626

Orphan

Consensus_repeat	Method
CAACCGAGCCCGGCACCTCAACC	CRISPRCasFinder

2 spacers

The CRISPR arrays of NC_021514_3

>merge|NC_021514|3|2643496-2643626|CRISPRCasFinder
CAGCCGACACCAGCACCTCAGCCTGAACCAACGCTGCAACCGAGTCCTACACCTCAACCGAGCCCGGCACCTCAACCAAACCCAGCGCCACAACCAAACCCGGCGCCGCAACCGAGCCCGGCACCTCAACC

>NC_021514|3|2|2643496-2643626|CRISPRCasFinder
CAGCCGACACCAGCACCTCAGCC	TGAACCAACGCTGCAACCGAGTCCTACACCT
CAACCGAGCCCGGCACCTCAACC	AAACCCAGCGCCACAACCAAACCCGGCGCCG
CAACCGAGCCCGGCACCTCAACC

Protein	Signature genes	Signature genes Name	Protein_function
NC_021514.1\|WP_016511879.1\|2626505_2627552_-\|DUF916-and-DUF3324-domain-containing-protein	unknown	unknown	gnl\|CDD\|371730
NC_021514.1\|WP_003642361.1\|2627625_2628198_-\|WxL-domain-containing-protein	unknown	unknown	gnl\|CDD\|372694
NC_021514.1\|WP_016527340.1\|2645521_2646955_-\|6-phospho-beta-glucosidase	unknown	unknown	gnl\|CDD\|181973
NC_021514.1\|WP_016527337.1\|2632105_2633893_+\|elongation-factor-4	unknown	unknown	gnl\|CDD\|235462
NC_021514.1\|WP_003645361.1\|2636329_2637154_-\|NAD(+)-diphosphatase	unknown	unknown	gnl\|CDD\|234699
NC_021514.1\|WP_003643416.1\|2647015_2648374_-\|PTS-cellobiose-transporter-subunit-IIC	unknown	unknown	gnl\|CDD\|181976
NC_021514.1\|WP_003587210.1\|2644151_2644619_+\|DNA-starvation/stationary-phase-protection-protein	unknown	unknown	gnl\|CDD\|153102
NC_021514.1\|WP_016527338.1\|2637308_2638217_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223656
NC_021514.1\|WP_003643417.1\|2648395_2648893_-\|hypothetical-protein	unknown	unknown	unknown
NC_021514.1\|WP_003645359.1\|2638387_2639869_+\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|180854
NC_021514.1\|WP_016527335.1\|2619978_2626110_-\|KxYKxGKxW-signal-peptide-domain-containing-protein	unknown	unknown	gnl\|CDD\|375451
NC_021514.1\|WP_015380951.1\|2631446_2632109_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NC_021514.1\|WP_003643422.1\|2652953_2653229_-\|DUF3781-domain-containing-protein	unknown	unknown	gnl\|CDD\|378895
NC_021514.1\|WP_003645352.1\|2651369_2652641_+\|DUF805-domain-containing-protein	unknown	unknown	gnl\|CDD\|377540
NC_021514.1\|WP_003643420.1\|2650583_2650952_+\|YxeA-family-protein	unknown	unknown	gnl\|CDD\|377665
NC_021514.1\|WP_003643414.1\|2644716_2645442_-\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225099
NC_021514.1\|WP_003643419.1\|2650092_2650461_+\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133384
NC_021514.1\|WP_015640981.1\|2634426_2636028_-\|cation:proton-antiporter	unknown	unknown	gnl\|CDD\|223104
NC_021514.1\|WP_003645353.1\|2649617_2650004_-\|carboxymuconolactone-decarboxylase-family-protein	unknown	unknown	gnl\|CDD\|223672
NC_021514.1\|WP_016527336.1\|2628250_2630503_-\|BspA-family-leucine-rich-repeat-surface-protein	unknown	unknown	gnl\|CDD\|308794

Protein	Function_ID	Function_description	E-value
NC_021514.1\|WP_016511879.1\|2626505_2627552_-\|DUF916-and-DUF3324-domain-containing-protein	gnl\|CDD\|371730	pfam11797, DUF3324, Protein of unknown function C-terminal (DUF3324). This family consists of several hypothetical bacterial proteins of unknown function.	1.06748e-44
NC_021514.1\|WP_003642361.1\|2627625_2628198_-\|WxL-domain-containing-protein	gnl\|CDD\|372694	pfam13731, WxL, WxL domain surface cell wall-binding. The WxL motif appears in two or three copies in these bacterial proteins and confers a cell surface localization function. It seems likely that this region is the cell wall-binding domain of gram-positive bacteria, and may interact with the peptidoglycan.	1.07332e-14
NC_021514.1\|WP_016527340.1\|2645521_2646955_-\|6-phospho-beta-glucosidase	gnl\|CDD\|181973	PRK09589, celA, 6-phospho-beta-glucosidase; Reviewed.	0
NC_021514.1\|WP_016527337.1\|2632105_2633893_+\|elongation-factor-4	gnl\|CDD\|235462	PRK05433, PRK05433, GTP-binding protein LepA; Provisional.	0
NC_021514.1\|WP_003645361.1\|2636329_2637154_-\|NAD(+)-diphosphatase	gnl\|CDD\|234699	PRK00241, nudC, NAD(+) diphosphatase.	2.21998e-55
NC_021514.1\|WP_003643416.1\|2647015_2648374_-\|PTS-cellobiose-transporter-subunit-IIC	gnl\|CDD\|181976	PRK09592, celD, PTS cellobiose transporter subunit IIC.	0
NC_021514.1\|WP_003587210.1\|2644151_2644619_+\|DNA-starvation/stationary-phase-protection-protein	gnl\|CDD\|153102	cd01043, DPS, DPS protein, ferritin-like diiron-binding domain. DPS (DNA Protecting protein under Starved conditions) domain is a member of a broad superfamily of ferritin-like diiron-carboxylate proteins. Some DPS proteins nonspecifically bind DNA, protecting it from cleavage caused by reactive oxygen species such as the hydroxyl radicals produced during oxidation of Fe(II) by hydrogen peroxide. These proteins assemble into dodecameric structures, some form DPS-DNA co-crystalline complexes, and possess iron and H2O2 detoxification capabilities. Expression of DPS is induced by oxidative or nutritional stress, including metal ion starvation. Members of the DPS family are homopolymers formed by 12 four-helix bundle subunits that assemble with 23 symmetry into a hollow shell. The DPS ferroxidase site is unusual in that it is not located in a four-helix bundle as in ferritin, but is shared by 2-fold symmetry-related subunits providing the iron ligands. Many DPS sequences (e.g., E. coli) display an N-terminal extension of variable length that contains two or three positively charged lysine residues that extends into the solvent and is thought to play an important role in the stabilization of the complex with DNA. DPS Listeria Flp, Bacillus anthracis Dlp-1 and Dlp-2, and Helicobacter pylori HP-NAP which lack the N-terminal extension, do not bind DNA. DPS proteins from Helicobacter pylori, Treponema pallidum, and Borrelia burgdorferi are highly immunogenic.	5.65789e-47
NC_021514.1\|WP_016527338.1\|2637308_2638217_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|223656	COG0583, LysR, Transcriptional regulator [Transcription].	1.1517e-30
NC_021514.1\|WP_003645359.1\|2638387_2639869_+\|FAD-dependent-oxidoreductase	gnl\|CDD\|180854	PRK07121, PRK07121, FAD-binding protein.	2.33843e-65
NC_021514.1\|WP_016527335.1\|2619978_2626110_-\|KxYKxGKxW-signal-peptide-domain-containing-protein	gnl\|CDD\|375451	pfam17966, Mub_B2, Mub B2-like domain. This entry corresponds to the Mub B2 domain. This domain is related to the Mub B1 domain pfam17965. This domain may be involved in mucin binding. This domain is often found associated with the related pfam17965 in bacterial cell surface proteins.	2.06076e-13
NC_021514.1\|WP_015380951.1\|2631446_2632109_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	5.47313e-12
NC_021514.1\|WP_003643422.1\|2652953_2653229_-\|DUF3781-domain-containing-protein	gnl\|CDD\|378895	pfam12636, DUF3781, Protein of unknown function (DUF3781). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria and archaea. Proteins in this family are typically between 82 and 98 amino acids in length. There are two conserved sequence motifs: GKNWY and ITA.	2.535e-18
NC_021514.1\|WP_003645352.1\|2651369_2652641_+\|DUF805-domain-containing-protein	gnl\|CDD\|377540	pfam05656, DUF805, Protein of unknown function (DUF805). This family consists of several bacterial proteins of unknown function.	1.13968e-24
NC_021514.1\|WP_003643420.1\|2650583_2650952_+\|YxeA-family-protein	gnl\|CDD\|377665	pfam06486, DUF1093, Protein of unknown function (DUF1093). This family consists of several hypothetical bacterial proteins of unknown function.	1.35547e-23
NC_021514.1\|WP_003643414.1\|2644716_2645442_-\|GntR-family-transcriptional-regulator	gnl\|CDD\|225099	COG2188, PhnF, Transcriptional regulators [Transcription].	1.07931e-39
NC_021514.1\|WP_003643419.1\|2650092_2650461_+\|MerR-family-transcriptional-regulator	gnl\|CDD\|133384	cd01109, HTH_YyaN, Helix-Turn-Helix DNA binding domain of the MerR-like transcription regulators YyaN and YraB. Putative helix-turn-helix (HTH) MerR-like transcription regulators of Bacillus subtilis, YyaN and YraB, and related proteins; N-terminal domain. Based on sequence similarity, these proteins are predicted to function as transcription regulators that mediate responses to stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.	4.63028e-41
NC_021514.1\|WP_015640981.1\|2634426_2636028_-\|cation:proton-antiporter	gnl\|CDD\|223104	COG0025, NhaP, NhaP-type Na+/H+ and K+/H+ antiporters [Inorganic ion transport and metabolism].	5.5706e-41
NC_021514.1\|WP_003645353.1\|2649617_2650004_-\|carboxymuconolactone-decarboxylase-family-protein	gnl\|CDD\|223672	COG0599, COG0599, Uncharacterized homolog of gamma-carboxymuconolactone decarboxylase subunit [Function unknown].	7.60413e-22
NC_021514.1\|WP_016527336.1\|2628250_2630503_-\|BspA-family-leucine-rich-repeat-surface-protein	gnl\|CDD\|308794	pfam03382, DUF285, Mycoplasma protein of unknown function, DUF285. This region appears distantly related to leucine rich repeats.	1.7678e-23

>NC_021514.1|WP_003645359.1|2638387_2639869_+|FAD-dependent-oxidoreductase
MTLAKHDSYDIVVVGTGAAGTAASLEAAQHGASVLLLEKGRHTGGSSNYTEGLFAIDSYLQKAQNINVSATDVLKEEVDYSKYRADSRIWRRYLDDSANTVQWLKDQGVEYEGVQAMGAGEATWHIYKGMGQAVLHDALQPQAQKLGVELLTSTTATTLHQATDGAITGVTIQSAATNETQVINTAAVILATGGYLNNPDMMKKLTHYDTHRLIPVSSGKGTGDGLRLAWQAGAQQYGTGMAMLFGGYLKDPSEPSFKYMASQMETAAGQQPLLWLNEHGERFVDEAVVYNFSYAGNALYTQNQVFSILDQGVINKMAQDGNFMGLGVYVRRGEKMTKLQAEIDAAVAANKPFIFKADTIEALATKMHLPVDQVTHSIQTYNQYCDNGQDDDFGKNPEYLVKVSQGPFYGFELNVGAFCTMGGLKVTTNNEVLDTTGQPITGLYAAGSDAAGLTGDTYGPNMPGTCVGYAFYSGRNSGRHAAQYTHQQSIVSH
>NC_021514.1|WP_016527338.1|2637308_2638217_-|LysR-family-transcriptional-regulator
MDLDRLQTFLKVVQYGSFQQVAAREYRSQRTVSKQMTQLENELKVTLFDRGQNRIQLTPQGRLFWASAQDIVNNYMTALTELRQFNVPTDQILRVGYFSAFEQRLLLPALYDLKQQHSELQLVVRQGSNEHLAQQVADGSLDLALSINYGRPAVTPESQLTAVPIYHNQMVIGVSRLNPLSRLSQLPPSALATLPILYYSPESSTFLLESFLASDPSIQNYEQIRRVPSAEQMHLLVALNQALAFYPAGLVPTEHDEQVAYLPITDAAQQGYDIVALLKSNRSRPLIAKLVQRLKANAKSDE
>NC_021514.1|WP_003645361.1|2636329_2637154_-|NAD(+)-diphosphatase
MFQDIQPHVLKNQNDQQRAPRSGDYILIGRQQQVLLMNGTLPKYEDIDADYAFSPDQYQYLLAVDQAAFFWVDVDAVANDNYTVGTTQGFRDLTPAWLAFSSATAAHLAWWYDTKRFCGHCGQPLHPGATERSLVCAACGQTIYPTIMPAIIVGVTNGDKILMTKFLSGYNHFSLISGYTEIGETFEDTVRREVFEEVGLEVHNIRYFGSQPWAPSHSLLAGYFADLNENVAIELETDELSKAQWFQRDQIPHNDTNTSLTWTMIEAFRHHQEK
>NC_021514.1|WP_015640981.1|2634426_2636028_-|cation:proton-antiporter
MALLISTGVLVVAAMVSIVINRRWLPRLSVNYVSMFIGAGIAVIPFLNGLIEKFNSDIFIGLIVAPLLYFEGQNTRLNLVGRHVREIVSLTVGMVILCAVMAGLGTSLLAGVGLPLAFILAAISTPTDATATESVTMGRVLPQREQTSLKLESLFNDASGIILLNMAILWYVNGYINYSQTLWDFVYAAGGGIAFGGLVSGLIVYIRQLMLRSKLNFINNTYNNGTPLKVIYLMTPFVLYFGAEALGVSGIIAVVFAGLVHNAEGERSALANPQLASDIYQLIGLLSDILNSVVFIVLGIMLLRTALDHSVSYNGSLIWIVIGVILYVANLLARYGYVRLIHHVSNREAWVFALGGIHGAVTFALAFTVAETQVKTTDFNLVLMSESLLIILSLLVPTIVFRWLLPKIKTDTDGAAKMAVIREQMIEAGVYDLWQMPISQEFKAAVTFDLRSQNGHTTVRQFISEWRRMVQHPEYTADEMRELMVIYRQVFQTERDYLQRQYDATHAISEDLFNRLYHEITMAEMVVLEYGVK
>NC_021514.1|WP_016527337.1|2632105_2633893_+|elongation-factor-4
MKQSHIRNFAIIAHIDHGKSTLADQIMALTQTVSAREQHAQLLDNMTVEQAHGVTVKARTVRNYYQADDGQEYEYNLIDTPGHVDFNYEVAKSLAATEGAILLVDATQGVQAQTIANYRIAKQRQLTLIPVLNKVDLPSADIDAALAQLRDLDSAFTPEQVLQISAKTGQGVPAVLEAIKQRLPAPQGDLHQPLKALVFDSLYDPYQGVIAYVRLIDGQLKSQQSLRLMQGQQDFNGKAIGVFAPQMHPQESLSAGDVGYVVTGIKDPRKVRVGDTLTSVATPTQWPLAGYQPAKSMVFAGLYPKNNDYPALKEAVQKLNLNDPSFTYVEERSEALGVGFRCGFLGTFHLQIIRERLHDEYGVDVLTTAPNVTYHVTLTNGQQMIVNNPAQFPAFSLIKEVTEPFMKAEITMPADNLNAVLKLAEQHKGTLIDLANSGDLIVASLKIPLSEIAYHFFSELKSVSHGFASLSTAFMANEVSDLVKVEVDINYAPVDALTFIVHREDAPNMTQQLVANLKTTVPRQLYPTPVQARVEGKVIARVDVPPLRKNAAVNGEQHSTSKKAALLRRQSANKRRASKNTIKLPQSVFNAILSL
>NC_021514.1|WP_015380951.1|2631446_2632109_+|TetR/AcrR-family-transcriptional-regulator
MANIYTPSQKAAKRQAIMTAAINLFAHRSYPEITMQQIAEAVGSSKGATFRYFTTKEDLFMTILLEDYQQYFTQLTTDLAQQPPLSADDFIAWMTTQTRQLIEEHSVLIRLNAIRGPILEGKANMQETITQREALYRASQRLGQQLVIQTDHLLDQSQFSHLFIIQSGIISGLMNMAALTSFNHHKLSVDYPDFEIRLIPEAQQQIRYYLTQYLKEFSHK
>NC_021514.1|WP_016527336.1|2628250_2630503_-|BspA-family-leucine-rich-repeat-surface-protein
MRRICKVLMVIISIILGSSAPLNMAIPPLLALAAPDTSSSSTMSSSAISKVTDTNVMAVSADVTSTTDTSDTSSSDSTSATSTTTGNDTTETADTAVESGTVGTVAWTIDDAGVLTLSGGSFADLTGKRSPWYDYASLITNIKITDEITVTTASNYGFLFASLANVAIVTGLNKLLMSGVTSTESMFYRDSKLTSVDFGQTDFSTVTTMESMFEGCSVLTKVNTTNWDVSHVKSFKRTFYMCGKLTMLDVSNWDVTQVTNLDSTFFGCSSLPELDVSRWNTVNVTTLSDTFYNCSSVKIINVSGWDTARVTDMSATFMDCSLVTELNVSGWDTAKVTSMFRMFYDCKNIIQLDVSGWITSQVTSLGSIFQNCSKVVTLDVGTWDTSKVMDMSFLFGGCSSLTTLNLEKWDTGSVTTLYSTFYNCSGLTSLLVDTWDTSKVTNCFWTFGGCSSLTTLNLRSWDLQSATASYGNFFNGSKKLQHLTLGPDFTFHNDKTMYLEEPSKKLPYNGTWQRNNNDPTYTSAELMTNYDGATMAGTYNWVKTSGTVLVKYVDGDGVEIADEETSSGTSGDAYQTTAKTIDGYTLHATPTNATGTYDASTITVTYVYDGNLFFNSSPTMLDFGSHTISGTTETYAPTLDKTLAVQNNGQISSTWNLTAELDSSGFVGANTGKMLLATLYYQTDDGKMTLSPGVAVQVYSQTTTDHKSVDISEHWSSNLGLLLEVPNGAAMADTYQGTISWRLNNTVANN
>NC_021514.1|WP_003642361.1|2627625_2628198_-|WxL-domain-containing-protein
MKKFVLGLMISAGLLGATTVVANADTTGSSTGDVTFTGGTLSMSVDATHLAFGSNTISSSDATLATSSTPTVTVSDLRGTSAGWTLTVAQGQQFNTALNGTGSSLINAALTVAGTESDSAVTNGSTTLTPGTTSAAGAAGTVASAKNGTGNGASTVTFSDSKLAVPGKTTKLATGYTTTLTWNLNDTPGN
>NC_021514.1|WP_016511879.1|2626505_2627552_-|DUF916-and-DUF3324-domain-containing-protein
MQKRLRLSLGMLLAVVASLLMMGQVASADQGVGFEITPVQSSSQVDKRLSYFDLKLKPRQTQTVAVKIHNTASAPITINIGIAKATTNINGVVEYKHTNNRSANLPYDISKLVTTDEPQVKLAKGQVKTVKFQIKMPAQSYQGILAGGITFLKKATATDTKKAVAVNNQYAYTEAVILHGSKDLTTNQLTMNKITVKQLNGRNAINFPLVNHTAAYLNKVQTNIKIYHRGGSQVVYHQKLANGQMAPNSIYKLPLQTGEKALAAGKYTAVVKVTSKKQHWQFKQNFVITKGQADTLNKTAVLKQGPNWWLYIGIGLLLLLLIILVIWYIRRKQKKIKSLEKQLAEKDK
>NC_021514.1|WP_016527335.1|2619978_2626110_-|KxYKxGKxW-signal-peptide-domain-containing-protein
MQKRRLQRARLTEKRAYKMYKKGRLWLVAGLSTFTLETGLVQLQAMADTTSTPVSQVEKTTDHANSSATLTTKVATNTNDTANADTKSSNSSSVHATTNNSSGAATASDDRAKTSVAEHTLSSATDGTKTTDSSTTDLTDSTTSHSSSVATANVSATSAAQTARTVNGTTNSAVSPNKVTASAAATEIESDSVKTKEITKTTGTAKAVSLAVTDTSMSQIKLRSARAAVATVATISSTTKMYDGVAGTPDRYTVTLADGIKAPTDWAVTKDPNVYTDIDLSDFDKNQFGRGIGTYPIAFSEFGLSKLAEANDSLDITAANVVTGTLTIEQAPVHSAAITIGSTSIDYGDSKPSSYQITVTNGYFDKYNAPSTWTLVDSTSSGVIKTTYTIASDSGDIAVPTATEAGTYVLALSAQGLAALQQANPNYEFTADSIVNGQLVIAAHDIITMGATTVLVNKTTSTVQVAVNSRAVSVPGDWEVYYNDKLTDSIVYKVPVSYTTYSTAVDTSTVGKYTITLTDAAMATLAQLNSSTVFNNTNVDDGVVLVKESNAVTISPSNYGAKASVNNNVTAASIQNARDKGINLLYGQGLYLVLPLLNVAQSEMTVDNLTEYVIIPAGFKVATTGNGDTVQVATDPVGALTAAIETMMTKNNVTYQGLAVTQLTDYNGRQTFKVHLDQTAAYSNGLFETMVYTLLPTIAVQSSGVTSGLIGNQVSSPDSAVIYVTDDPNENNGSYSLKDQNYPNIDKVAKALGVADAVTISSSFTDYLYTYTLKAAEADDIYMLQAPDGSSLGIIVVSGNVGTTYVPSRELQTITSSGNDYYYLNPDSIPRTRTYDSPDQRTYTLTYQRYVTTTTDTAAKITIAPASKVYDNNVTTDPSRYTVYLPTEYTVPSDWTADSAATAVDGTTAYQVSTDYLNTTAIDQNVGTYAVTLNSAGMAALAAANPDFLIAGDVNVGGTLTITQRPVTITLPDTILWANGQEQNITPVITGVVAGQSLDYTLTSGLTDPDTTTITATLTNATANSNYKLTNSPSGQLTVGAVAVVYQYGYRDKAGTLHVVTTANGTATHGTDVTAKGYLSYTTSDTTAAHAKTGYTLQPESTGYQADGTLADIGGQVVYTYLANTEKIAVVYVDQDKNSVILYQVPLSGSFGTHTNYTTAQDIAAYEKLGYVLASDEVPAQLEFDQDTEQTYYVYLKHGTITATVDQPGNVAVSDLMKTSQRTIHYVYADNTPTDLADVLQTVTYTRTATVDAVDRTVLSYGNWTTTVNSYPAIESPTITGYTADQTTIAAAVPASMGEATEATVRYSANLETIRVQFVDGTTDNQVLGYIDLNGKYGDAADYTVTADIAKYSKLGYEPVSSDLPDQLIYNQNAQVYTVTLAHRHVTVSVVHPGQPGQAIDADYPAGPKYPAGTGRDSLQQTVVRTITYQYASGESAAETVNQSVTFNRTATFDMATGKQLTYGDWTVAPGQSALLAAVTSPTITGYQASIAEVEATSVTSHDKSCSIAITYTAKSQTATVAFVDVTSGKTLPTMVVTGAYGTTNSYSPVSQIAAYEQLGYRLVSNNVPTTGITFDQNDVIKSYTVKLAHQMTTVTPTKPGQPGQPVDSAHPEGPKYPAGTGLKDLTTSVQRVITYVYNDGQTAASTVTQTVSFERKAAFDQVTKVVTYTDWRTPESALTGVYAVVESPIIAGYTPNATRVADVTVSAGDTDSRQTVTYQANLETATVTYVDVTTGHRLGTSVTLTGRFGTQADYQPTTMIAQYTQAGYVLMGSDYPATGVTFNQAGVVQKYTVYLAHNKIVITAPDQLTKTITQTVHYQDQAGHTLQADTIRALTFTRSGMKDAVTGVATYRDWAPTGLNFTAVSAPTIAKYHALTATTQAVAITAASADDVQTLTYALDVPTPTKPVKPTKPAKPTKPTTSDDLIKPTTKPITAAKPTQLTEPATVVKDFQATTGNQTPAKSTRTLVSSRIKAVKTAPASAIIKPGSEVTEPAHKAQADTTSRLPQTGETRRSEAAAETLGLTLATLLLGFGGLKRKRHEK
>NC_021514.1|WP_003587210.1|2644151_2644619_+|DNA-starvation/stationary-phase-protection-protein
MKYTKTKAVLNQLVADLSQMSMIIHQTHWYMRGPNFLKLHPLMDEFMEEIDSQLDVISERLIALDGSPYSTLKEMAENTKIQDWPGEWDKTTPERLAHLVDGYRYLEDLYQHGIEVSDVEKDFSTQDIFIGLKTAIEKKIWMIQAELGSAPEIDE
>NC_021514.1|WP_003643414.1|2644716_2645442_-|GntR-family-transcriptional-regulator
MAHLDIGQLVQRILADIQVGKLADGQRKLPAEPVLMERYQVTRYTLRQALKQLSNMGYTYQMHGIGTFVRQQQTNNSIALQHDGGLSEAAARAGLKLATKKAVMAMTTVADAEFLPEAGHLKDNEELIDIRRFRELDGQPYLMEHSYYIKAIVDTIPEEALYGSLFNYFEQQRDVNIGFIDQLLMSEPLPEIAGEFMNLANGAPSLVVKDETYLTTGKMLAFSKQYYDYRRARLFMVKKIR
>NC_021514.1|WP_016527340.1|2645521_2646955_-|6-phospho-beta-glucosidase
MSKLPNGFLWGGAVAAHQFEGGWNKGGKGLSIADVMTAGSNTQAREITDGLVPGKNYPNHEAIDFYDHFHEDVQLFADLGLKCFRTSIAWTRIFPNGDENEPNEAGLKFYDDLFDDLLAHGIEPVITLSYFEMPYHLVKEYGGWRNREMIRFFVKFARVVLERYRNKVKYWMTFNEINNQTGLNEWGLFTNSGIKITADEDAEKLMYQAAHYETVASALVVKMGHEINPEFKIGCMMAMGPTYPATPAPQDVMKAERTMQAGYWLADIQCKGKYPNWLKRYFERHHFALDITEADLNILAVGTVDYIGFSYYASHVTKTTDNEPDDYMTPGQNPEVKNPALERSDWGWEIDPVGLRYALNWFSDRYDLPLFIVENGLGAFDKKDADGKIHDDYRIDYLRKHIEQMELAVDVDGVQLMGYTPWGFIDLVSAGTGQMDKRYGLIYVDKNDAGVGTLKREKKLSFDWFKKVIATNGADLS
>NC_021514.1|WP_003643416.1|2647015_2648374_-|PTS-cellobiose-transporter-subunit-IIC
MDDTNNKMFQFLNNHLMGPMGKLAQFRIVRAVMAAGMATIPFTIVGSMFLIVSVLPQSFPALAGFFAVSFDKITPLYMLANTATMGILSLYFCLVFGYEYTKIQAQEEKIEVNPLNGALISMMAFFMCLPELVFKDGAMTLINVFNKNAKIIDGWEMGGGVTRLGTTGIFTAIIMSIIAVKIYATCVKRNWTIKMPETVPAGVARSFTALIPTALIALTVIVINGLLILMGTDIYKIVAIPFGFVTNLTNTWIGLLVVYFIMHALWLVGIHGATIVTSFLTPIVLSNMVSNAKGANIPFAGEFNNCFVTIGGSGATLGMVVFIAFFAKSAQLGALGKASIVPAFFNINEPILFGMPVVYNPYTAIPFFLAPMSSMSVAYFAIKFHMVNPPIAQVAWPTPVGLSGFLGSGGDWRAAVLAVVCALIAFVIWFPFIKFYDNKLFVQEQSGTVQAD
>NC_021514.1|WP_003643417.1|2648395_2648893_-|hypothetical-protein
MSPLKNGSNEATANRRALSLTSMYFNRFLVFRYVTAIFFFVNLYWAIVLFGFGSGIGLLPSILLIGTAVVMVEQIGKFWKHTNRLTFTRWFYWVQLFINLSVGLSLVFGKLKVFYPFLNEASLPWVLSVLGFGILVSAFLEYRVFLIEHDKDRYIKHIRQFAASI
>NC_021514.1|WP_003645353.1|2649617_2650004_-|carboxymuconolactone-decarboxylase-family-protein
MENKQRLINGKAMLQRVDAEAADHVMASLDRVAPDVAKLILEFAFNDIYTRPGLSLQQRELVTITSLLTQGDTADQLRVHLNGCLNVGLSRTEIVETCIHCIPYVGFPKVLNALTVVKEVFTKKEDLS
>NC_021514.1|WP_003643419.1|2650092_2650461_+|MerR-family-transcriptional-regulator
MQIGEFSRQTDLTIDTLRYYEEVGLLRPTRTAGNHRQYQSKDIDWVNFLKRLKQTGMSIRNMQRYAQLRYIGNQTIPERLILLQKQEAQLNDLMVATQANLDFLHQKMTTYHEMQESDFESH
>NC_021514.1|WP_003643420.1|2650583_2650952_+|YxeA-family-protein
MKKAGILGLIITIIVLVPVGLGFNWYHSNYGTKTYYTQITTKGERKTGKDDSGKPYVYYHYSQPGYSDNGVKKELTFDSVLPRSLKMHAYLKVGYNDKRQQVINWEKVDRKDIPQAALNRIN
>NC_021514.1|WP_003645352.1|2651369_2652641_+|DUF805-domain-containing-protein
MSETKYCINCGKAIPTNATFCSFCGATQDKVASTEDQNTITSEQHNTPNQPEHVNMWTALKLGMRQTFTWSQRITRPQYWWLYLDLVLISLVLTIVLGIRAYSYPAFILSPLHVSVLQTVLLLIFSALMVWTSVMQFTASARRLHDSNRSAHYLWFYLLPLVGPILIIVFLCQRSEPAGKRFDRLASQPKPWTHKWWTWCLLVLLTLGYAALINITARDTAMDAALTTTSKSATTNSDDSYSDSDSEESSDSTDSDSDSESDSDSDSITIGDDDIDIADQKAYSTSFTDSSWAKSTFKIDKVTVYKTDGTYTSGSGNDKKDFNGVVKVHMSIHAGQDISAYPTQAKLSTNDGQQVEADMDSDDFDGDLNSGTDSDGNVYFVLSKLSSVKDITSIRLKWDASYDTDDYDDDNAYKTFDTTLNLN
>NC_021514.1|WP_003643422.1|2652953_2653229_-|DUF3781-domain-containing-protein
MSKQSVILELIRTHICYTPRVFQRINKKLAVNLSEVEIKDLVNHILIQPDEIKRCGKNYYIRSRKARVELTVNAGNYRLITASKYTEVDGF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NC_021514_1	1.1\|355032\|18\|NC_021514\|CRT	355032-355049	18	NC_021514.1	2825366-2825383	2	0.889

1. spacer 1.1|355032|18|NC_021514|CRT matches to position: 2825366-2825383, mismatch: 2, identity: 0.889

gccgctaagaaacataag	CRISPR spacer
gccgctaaggaacatcag	Protospacer
*********.***** **

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_021514_3	3.2\|2643573\|31\|NC_021514\|CRISPRCasFinder	2643573-2643603	31	NZ_CP034567	Vibrio parahaemolyticus strain D3112 plasmid p1, complete sequence	30785-30815	6	0.806
NC_021514_3	3.2\|2643573\|31\|NC_021514\|CRISPRCasFinder	2643573-2643603	31	NZ_CP033143	Vibrio parahaemolyticus strain 160807 plasmid pVPWZ1, complete sequence	85109-85139	6	0.806
NC_021514_3	3.2\|2643573\|31\|NC_021514\|CRISPRCasFinder	2643573-2643603	31	NZ_CP034300	Vibrio parahaemolyticus strain 20160303005-1 plasmid pVPSD2016-1, complete sequence	82262-82292	6	0.806
NC_021514_3	3.2\|2643573\|31\|NC_021514\|CRISPRCasFinder	2643573-2643603	31	NZ_CP033139	Vibrio owensii strain 1700302 plasmid pVOWZ1, complete sequence	19890-19920	6	0.806
NC_021514_1	1.2\|355068\|30\|NC_021514\|CRT	355068-355097	30	NZ_CP006988	Rhizobium sp. IE4771 plasmid pRetIE4771b, complete sequence	31047-31076	7	0.767
NC_021514_1	1.2\|355068\|30\|NC_021514\|CRT	355068-355097	30	NC_042345	Phage Salvo, complete genome	4721-4750	8	0.733
NC_021514_3	3.2\|2643573\|31\|NC_021514\|CRISPRCasFinder	2643573-2643603	31	NZ_CP040452	Halomonas sp. PA16-9 plasmid p_unnamed1, complete sequence	1245593-1245623	8	0.742

1. spacer 3.2|2643573|31|NC_021514|CRISPRCasFinder matches to NZ_CP034567 (Vibrio parahaemolyticus strain D3112 plasmid p1, complete sequence) position: , mismatch: 6, identity: 0.806

aaacccagcgccacaaccaaacccggcgccg	CRISPR spacer
catcaaagcgccactaccaaacgcggcgccg	Protospacer
 * *  ******** ******* ********

2. spacer 3.2|2643573|31|NC_021514|CRISPRCasFinder matches to NZ_CP033143 (Vibrio parahaemolyticus strain 160807 plasmid pVPWZ1, complete sequence) position: , mismatch: 6, identity: 0.806

aaacccagcgccacaaccaaacccggcgccg	CRISPR spacer
catcaaagcgccactaccaaacgcggcgccg	Protospacer
 * *  ******** ******* ********

3. spacer 3.2|2643573|31|NC_021514|CRISPRCasFinder matches to NZ_CP034300 (Vibrio parahaemolyticus strain 20160303005-1 plasmid pVPSD2016-1, complete sequence) position: , mismatch: 6, identity: 0.806

aaacccagcgccacaaccaaacccggcgccg	CRISPR spacer
catcaaagcgccactaccaaacgcggcgccg	Protospacer
 * *  ******** ******* ********

4. spacer 3.2|2643573|31|NC_021514|CRISPRCasFinder matches to NZ_CP033139 (Vibrio owensii strain 1700302 plasmid pVOWZ1, complete sequence) position: , mismatch: 6, identity: 0.806

aaacccagcgccacaaccaaacccggcgccg	CRISPR spacer
catcaaagcgccactaccaaacgcggcgccg	Protospacer
 * *  ******** ******* ********

5. spacer 1.2|355068|30|NC_021514|CRT matches to NZ_CP006988 (Rhizobium sp. IE4771 plasmid pRetIE4771b, complete sequence) position: , mismatch: 7, identity: 0.767

cacaagaagaaagcggccaagaaacataag	CRISPR spacer
cacaagaataaagccgccaagaagctccgg	Protospacer
******** ***** ********.* . .*

6. spacer 1.2|355068|30|NC_021514|CRT matches to NC_042345 (Phage Salvo, complete genome) position: , mismatch: 8, identity: 0.733

cacaagaagaaagcggccaagaaacataag	CRISPR spacer
ccggggaagtaagcggacaagaaacatact	Protospacer
*  ..**** ****** ***********

7. spacer 3.2|2643573|31|NC_021514|CRISPRCasFinder matches to NZ_CP040452 (Halomonas sp. PA16-9 plasmid p_unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

aaacccagcgccacaaccaaacccggcgccg	CRISPR spacer
ccgctgagcgacacaaccaaaccctgcgcct	Protospacer
  .*. **** ************* *****

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

316060 : 428170

106

Bacillus_phage(21.43%)

protease,bacteriocin,tRNA,transposase,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016526887.1\|316060_316990_-\|transposase	IS30-like element ISLpl1 family transposase	H7BW61	unidentified_phage	3.2e-19	29.9
WP_015639914.1\|317219_318632_+	C69 family dipeptidase	NA	NA	NA	NA
WP_003641910.1\|318697_318943_+	hypothetical protein	NA	NA	NA	NA
WP_003643749.1\|319071_319635_+	biotin transporter BioY	NA	NA	NA	NA
WP_003646429.1\|319672_320644_+	biotin--[acetyl-CoA-carboxylase] ligase	NA	NA	NA	NA
WP_003646430.1\|320640_320961_+	hypothetical protein	NA	NA	NA	NA
WP_003646431.1\|321114_322290_+	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
WP_003646432.1\|322465_323632_-	hypothetical protein	NA	NA	NA	NA
WP_003646433.1\|324226_325042_+	ABC transporter permease	NA	NA	NA	NA
WP_003641921.1\|325054_326146_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	7.2e-18	29.7
WP_003643757.1\|326524_326797_+	hypothetical protein	NA	NA	NA	NA
WP_003646434.1\|327023_327566_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_016526888.1\|327562_329008_+	MFS transporter	NA	NA	NA	NA
WP_003643760.1\|329337_330654_-	ammonium transporter	H8ZJB2	Ostreococcus_tauri_virus	1.1e-33	29.6
WP_003646436.1\|331149_332109_+	L-lactate dehydrogenase	NA	NA	NA	NA
WP_003641927.1\|332211_332481_+	hypothetical protein	NA	NA	NA	NA
WP_016526889.1\|332710_333274_-\|protease	matrixin family metalloprotease	NA	NA	NA	NA
WP_003646437.1\|333467_334136_+	ribose 5-phosphate isomerase A	NA	NA	NA	NA
WP_003646438.1\|334293_335799_+	multicopper oxidase domain-containing protein	NA	NA	NA	NA
WP_003643763.1\|336063_336432_+	DUF1304 domain-containing protein	NA	NA	NA	NA
WP_003641932.1\|336544_337054_-	YbhB/YbcL family Raf kinase inhibitor-like protein	NA	NA	NA	NA
WP_003646439.1\|337084_338281_-	DUF2075 domain-containing protein	NA	NA	NA	NA
WP_003646440.1\|338390_338861_+	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_003641935.1\|338879_339335_+	hypothetical protein	NA	NA	NA	NA
WP_003643766.1\|339438_340011_+	acetyl-CoA carboxylase biotin carboxyl carrier protein subunit	NA	NA	NA	NA
WP_003646441.1\|340176_341097_-	ribonucleoside hydrolase RihC	NA	NA	NA	NA
WP_003643768.1\|341233_342145_+	oxidoreductase	NA	NA	NA	NA
WP_003646442.1\|343034_343481_-	ribonuclease H	NA	NA	NA	NA
WP_016526890.1\|343718_345245_+	ABC transporter permease/substrate-binding protein	NA	NA	NA	NA
WP_003641941.1\|345245_346217_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.7e-23	31.7
WP_003646444.1\|346294_347626_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_003643773.1\|348091_349609_+	glycerol kinase GlpK	NA	NA	NA	NA
WP_003643774.1\|349623_351453_+	type 1 glycerol-3-phosphate oxidase	NA	NA	NA	NA
WP_003641945.1\|351467_352190_+	aquaporin family protein	M1HWZ0	Paramecium_bursaria_Chlorella_virus	3.2e-30	31.9
WP_016526891.1\|352384_354733_+	MucBP domain-containing protein	NA	NA	NA	NA
WP_016526892.1\|354734_356567_+	hypothetical protein	NA	NA	NA	NA
WP_003646448.1\|356572_356806_+	hypothetical protein	NA	NA	NA	NA
WP_108725669.1\|357186_357303_+	hypothetical protein	NA	NA	NA	NA
WP_003646449.1\|357426_358344_+	hypothetical protein	NA	NA	NA	NA
WP_016526893.1\|358350_358524_+	hypothetical protein	NA	NA	NA	NA
WP_003646450.1\|359069_359612_+	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_016526894.1\|359759_360935_+\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_016526896.1\|361821_362565_+	response regulator transcription factor	NA	NA	NA	NA
WP_003646470.1\|362865_363639_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003643811.1\|363737_363896_-\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnF	NA	NA	NA	NA
WP_003646471.1\|363920_364085_-	hypothetical protein	NA	NA	NA	NA
WP_016526897.1\|364351_366502_+	peptide cleavage/export ABC transporter	W8CYL7	Bacillus_phage	3.6e-45	27.9
WP_016526898.1\|366517_367894_+	HlyD family secretion protein	NA	NA	NA	NA
WP_131510832.1\|368395_369292_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	2.7e-39	36.2
WP_016526651.1\|369246_369771_-\|transposase	transposase	NA	NA	NA	NA
WP_080131824.1\|369832_370042_-\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_187289257.1\|370227_371202_-	hypothetical protein	NA	NA	NA	NA
WP_016526900.1\|371162_372521_-	hypothetical protein	NA	NA	NA	NA
WP_016526902.1\|373845_374028_+	hypothetical protein	NA	NA	NA	NA
WP_016526903.1\|374060_374240_+	DUF2929 family protein	NA	NA	NA	NA
WP_016526904.1\|374790_375360_+	recombinase family protein	A0A1J1J8Z4	Escherichia_phage	5.4e-33	45.1
WP_016526905.1\|375454_377299_-	MFS transporter	NA	NA	NA	NA
WP_016526906.1\|377463_378039_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_015474752.1\|378316_379102_+	ParA family protein	Q7M293	Enterobacteria_phage	2.4e-07	26.8
WP_015474751.1\|379152_379356_+	hypothetical protein	NA	NA	NA	NA
WP_016526907.1\|380018_381125_+	replication initiator protein A	NA	NA	NA	NA
WP_016526908.1\|381386_381668_+	type II toxin-antitoxin system RelB/DinJ family antitoxin	NA	NA	NA	NA
WP_080131825.1\|381657_381840_+	hypothetical protein	NA	NA	NA	NA
WP_080131826.1\|381849_382164_+	hypothetical protein	NA	NA	NA	NA
WP_016526909.1\|382153_382432_-	hypothetical protein	NA	NA	NA	NA
WP_075168781.1\|382453_382681_-	hypothetical protein	NA	NA	NA	NA
WP_041161853.1\|382932_384993_+	MobA/MobL family protein	NA	NA	NA	NA
WP_049816384.1\|385047_385260_+	DNA topoisomerase III	NA	NA	NA	NA
WP_016526913.1\|385315_386563_+	type IA DNA topoisomerase	A0A1X9I6W8	Streptococcus_phage	7.5e-88	45.5
WP_016526914.1\|386684_386900_+	hypothetical protein	NA	NA	NA	NA
WP_016526915.1\|386903_388028_+	hypothetical protein	NA	NA	NA	NA
WP_041161806.1\|388057_388537_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_016526917.1\|390231_392256_-	MFS transporter	NA	NA	NA	NA
WP_016526918.1\|392340_392829_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_021353390.1\|393183_393273_-\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_016526921.1\|395168_395612_+	hypothetical protein	NA	NA	NA	NA
WP_016526922.1\|395671_396655_+	hypothetical protein	NA	NA	NA	NA
WP_016526924.1\|397509_398568_+	hypothetical protein	NA	NA	NA	NA
WP_016526925.1\|398683_398977_+	hypothetical protein	NA	NA	NA	NA
WP_016526926.1\|399629_399767_+	hypothetical protein	NA	NA	NA	NA
WP_016526927.1\|400410_400947_+	hypothetical protein	NA	NA	NA	NA
WP_016526929.1\|402086_404237_+	peptide cleavage/export ABC transporter	W8CYL7	Bacillus_phage	3.6e-45	27.9
WP_016526930.1\|404252_405629_+	HlyD family secretion protein	NA	NA	NA	NA
WP_003646474.1\|405718_406408_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003646475.1\|406475_407144_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003646476.1\|407230_407911_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003646477.1\|408004_408691_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_101494318.1\|408806_409079_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_003646479.1\|409110_409404_+	HigA family addiction module antidote protein	M9MUN2	Rhodococcus_phage	9.9e-07	48.3
WP_003646480.1\|409693_412003_-	ATP-binding domain-containing protein	NA	NA	NA	NA
WP_003646481.1\|412261_413038_+	carbon-nitrogen family hydrolase	NA	NA	NA	NA
WP_003646482.1\|413477_414494_+\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_003641997.1\|414901_415612_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_003641998.1\|415684_417046_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_003641999.1\|417052_417241_+	hypothetical protein	NA	NA	NA	NA
WP_003646484.1\|417230_417653_+	DUF3284 domain-containing protein	NA	NA	NA	NA
WP_003646485.1\|417786_418005_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
WP_003646486.1\|417991_418357_+	type II toxin-antitoxin system PemK/MazF family toxin	A0A1S5SAB3	Streptococcus_phage	1.8e-21	44.1
WP_003646487.1\|418587_419601_+\|tRNA	tRNA-dihydrouridine synthase family protein	NA	NA	NA	NA
WP_003642008.1\|420042_420960_+	Ppx/GppA family phosphatase	NA	NA	NA	NA
WP_003642009.1\|421005_422280_+	hydroxymethylglutaryl-CoA reductase, degradative	NA	NA	NA	NA
WP_016526931.1\|422272_423247_+	hypothetical protein	NA	NA	NA	NA
WP_003646490.1\|423268_423973_+	NAD-dependent protein deacylase	NA	NA	NA	NA
WP_003642012.1\|423972_424815_+	DUF72 domain-containing protein	NA	NA	NA	NA
WP_003646492.1\|425411_425801_+	NUDIX domain-containing protein	NA	NA	NA	NA
WP_003646493.1\|426118_428170_+\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	2.7e-90	35.8

DBSCAN-SWA_2

590819 : 599443

Streptococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003644909.1\|590819_592517_+	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	3.9e-55	37.0
WP_003640956.1\|592538_592847_+	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_003637790.1\|592862_593462_+	recombination protein RecR	NA	NA	NA	NA
WP_003640957.1\|593476_593728_+	YaaL family protein	NA	NA	NA	NA
WP_003644908.1\|594125_594791_+	dTMP kinase	M1PSC7	Streptococcus_phage	1.4e-53	52.7
WP_003640965.1\|594787_595117_+	cyclic-di-AMP receptor	NA	NA	NA	NA
WP_003640966.1\|595133_596153_+	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	2.1e-32	33.5
WP_003640967.1\|596177_596525_+	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	2.4e-12	33.3
WP_003643942.1\|596623_597520_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	9.9e-82	55.7
WP_003640969.1\|597523_598309_+	acyl-ACP thioesterase	NA	NA	NA	NA
WP_003643943.1\|598447_599443_+	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	5.9e-51	38.2

DBSCAN-SWA_3

791826 : 828440

unidentified_phage(22.22%)

integrase,transposase,protease

attL 823175:823196|attR 826993:827014

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016526887.1\|791826_792756_+\|transposase	IS30-like element ISLpl1 family transposase	H7BW61	unidentified_phage	3.2e-19	29.9
WP_003641157.1\|794366_794885_+	hypothetical protein	NA	NA	NA	NA
WP_041161819.1\|796663_798088_-	hypothetical protein	NA	NA	NA	NA
WP_003641164.1\|798624_798993_-	membrane protein	NA	NA	NA	NA
WP_003641165.1\|799226_799595_-	helix-turn-helix transcriptional regulator	E9LUL4	Lactobacillus_phage	5.9e-17	42.7
WP_003645770.1\|800160_800844_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003645769.1\|801063_801408_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_003645768.1\|801563_802271_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_015640093.1\|802279_803155_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	2.8e-20	28.9
WP_003645765.1\|804799_807301_+	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_003645764.1\|807785_808169_+	hypothetical protein	NA	NA	NA	NA
WP_016526983.1\|808158_810006_+	acetyltransferase	A0A1R3Y5Q6	Salmonella_virus	5.8e-20	23.7
WP_003641172.1\|810246_810501_+	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
WP_003644045.1\|810512_811058_+	alkaline shock response membrane anchor protein AmaP	NA	NA	NA	NA
WP_003641174.1\|811070_811253_+	hypothetical protein	NA	NA	NA	NA
WP_003644046.1\|811267_811690_+	Asp23/Gls24 family envelope stress response protein	NA	NA	NA	NA
WP_016526984.1\|811750_812191_+	Asp23/Gls24 family envelope stress response protein	NA	NA	NA	NA
WP_016526985.1\|812394_813195_+	fumarylacetoacetate hydrolase family protein	NA	NA	NA	NA
WP_003645760.1\|813326_814337_+	DUF4767 domain-containing protein	NA	NA	NA	NA
WP_003644049.1\|814698_815031_+	PTS lactose/cellobiose transporter subunit IIA	NA	NA	NA	NA
WP_003644050.1\|815136_815709_+	hypothetical protein	NA	NA	NA	NA
WP_003645758.1\|815890_818425_+	M1 family metallopeptidase	A0A0P0IY26	Acinetobacter_phage	3.5e-68	27.4
WP_016526986.1\|818652_821526_+	type I restriction endonuclease subunit R	NA	NA	NA	NA
WP_016526987.1\|821539_823126_+	type I restriction-modification system subunit M	A0A2H4PQP4	Staphylococcus_phage	4.2e-176	62.9
WP_016526988.1\|823122_824220_+	restriction endonuclease subunit S	A0A2H4PQP5	Staphylococcus_phage	8.5e-11	27.4
823175:823196	attL	NA	NA	NA	NA
WP_016526887.1\|824314_825244_+\|transposase	IS30-like element ISLpl1 family transposase	H7BW61	unidentified_phage	3.2e-19	29.9
WP_016526989.1\|825511_826429_+\|integrase	site-specific integrase	A8ATM2	Listeria_phage	2.7e-74	44.7
WP_046783358.1\|826439_827027_-	restriction endonuclease subunit S	NA	NA	NA	NA
826993:827014	attR	NA	NA	NA	NA
WP_016526894.1\|827264_828440_-\|transposase	IS256 family transposase	NA	NA	NA	NA

DBSCAN-SWA_4

1196159 : 1205997

Lactobacillus_phage(87.5%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_041161831.1\|1196159_1197389_+	hypothetical protein	A0A2P0ZL72	Lactobacillus_phage	7.9e-215	97.4
WP_015640259.1\|1197479_1198451_-	Nisin resistance protein	A0A2P0ZL68	Lactobacillus_phage	2.0e-181	98.8
WP_003645222.1\|1198636_1199584_-	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	1.7e-177	99.7
WP_003643097.1\|1199927_1200542_+	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	6.3e-112	100.0
WP_015380220.1\|1200544_1202983_+	flavocytochrome c	A0A2P0ZL82	Lactobacillus_phage	0.0e+00	99.5
WP_016527054.1\|1203070_1203631_+	hypothetical protein	A0A2P0ZL75	Lactobacillus_phage	1.3e-100	99.5
WP_003643094.1\|1203701_1204142_-	nucleoside 2-deoxyribosyltransferase	A0A2P0ZL88	Lactobacillus_phage	8.0e-77	99.3
WP_015380221.1\|1204237_1204375_+	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_003645220.1\|1205001_1205997_+	glycosyltransferase family 2 protein	S5FKN0	Shigella_phage	3.1e-52	38.8

DBSCAN-SWA_5

2026598 : 2089266

Lactobacillus_phage(53.66%)

integrase,transposase,portal,tail,head,holin,capsid,terminase

attL 2040370:2040385|attR 2095532:2095547

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645428.1\|2026598_2028329_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	7.6e-46	27.4
WP_003641420.1\|2028552_2028945_-	YxeA family protein	NA	NA	NA	NA
WP_003645429.1\|2029167_2030013_+	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_016527163.1\|2030496_2031507_-	Abi family protein	A0A0H4U080	Erysipelothrix_phage	3.3e-25	26.3
WP_016527164.1\|2031716_2032715_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	2.9e-50	38.9
WP_016527165.1\|2033544_2033922_-\|holin	prophage P2a protein 58, holin	A0A2K9VCG4	Lactobacillus_phage	1.3e-14	62.5
WP_016527166.1\|2033932_2034196_-	hemolysin XhlA family protein	E9LUR9	Lactobacillus_phage	9.4e-33	86.2
WP_016527167.1\|2034195_2035368_-	LysM peptidoglycan-binding domain-containing protein	E9LUR8	Lactobacillus_phage	1.1e-194	86.9
WP_016527168.1\|2035379_2035592_-	hypothetical protein	A0A0A1ENR9	Lactobacillus_phage	3.6e-19	85.2
WP_041161837.1\|2035588_2036794_-	collagen-like protein	A0A2K9VCK7	Lactobacillus_phage	1.5e-40	64.8
WP_016527170.1\|2036806_2037385_-	hypothetical protein	NA	NA	NA	NA
WP_016526887.1\|2037440_2038370_-\|transposase	IS30-like element ISLpl1 family transposase	H7BW61	unidentified_phage	3.2e-19	29.9
WP_016527171.1\|2038411_2039344_-	hypothetical protein	NA	NA	NA	NA
WP_016527172.1\|2039357_2040179_-	collagen-like protein	NA	NA	NA	NA
WP_016527173.1\|2040193_2041234_-	hypothetical protein	E9LUJ9	Lactobacillus_phage	4.4e-25	33.9
2040370:2040385	attL	NA	NA	NA	NA
WP_016527174.1\|2041217_2041628_-	hypothetical protein	NA	NA	NA	NA
WP_016527175.1\|2041628_2041880_-	hypothetical protein	NA	NA	NA	NA
WP_167803126.1\|2041879_2042023_-	hypothetical protein	NA	NA	NA	NA
WP_016527179.1\|2043933_2044830_-\|tail	phage tail family protein	A8ATA8	Listeria_phage	3.2e-16	27.1
WP_016527180.1\|2044839_2048769_-	tape measure protein	E9LUR1	Lactobacillus_phage	3.3e-81	45.6
WP_041161838.1\|2048768_2049005_-	hypothetical protein	NA	NA	NA	NA
WP_016527182.1\|2049097_2049586_-	hypothetical protein	NA	NA	NA	NA
WP_016527183.1\|2049603_2050164_-	hypothetical protein	NA	NA	NA	NA
WP_080131836.1\|2050175_2050562_-	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_016527185.1\|2050563_2051118_-	hypothetical protein	NA	NA	NA	NA
WP_041161865.1\|2051107_2051431_-	hypothetical protein	NA	NA	NA	NA
WP_016527187.1\|2051435_2051801_-\|head,tail	phage head-tail connector protein	A0A1W6JNH7	Staphylococcus_phage	2.3e-05	39.6
WP_016527188.1\|2051815_2052868_-	hypothetical protein	A0A0S0N2Q7	Pseudomonas_phage	2.6e-33	31.0
WP_016527189.1\|2052884_2053532_-	DUF4355 domain-containing protein	NA	NA	NA	NA
WP_016527190.1\|2053638_2054583_-\|capsid	minor capsid protein	NA	NA	NA	NA
WP_041161839.1\|2054585_2056238_-\|portal	phage portal protein	D2IZF6	Enterococcus_phage	2.4e-65	32.9
WP_016527192.1\|2056227_2057514_-\|terminase	PBSX family phage terminase large subunit	A0A2H4IYR5	uncultured_Caudovirales_phage	2.8e-114	50.1
WP_016527193.1\|2057497_2058025_-\|terminase	terminase small subunit	O03926	Lactobacillus_phage	2.5e-48	64.2
WP_016527194.1\|2058065_2058215_-	hypothetical protein	NA	NA	NA	NA
WP_016527195.1\|2058246_2058519_-	hypothetical protein	A0A2D2W301	Escherichia_phage	1.8e-18	50.6
WP_016527196.1\|2058487_2058667_-	hypothetical protein	E9LUP6	Lactobacillus_phage	7.8e-07	52.7
WP_016527197.1\|2059359_2059569_+	KTSC domain-containing protein	NA	NA	NA	NA
WP_143453264.1\|2059565_2059733_-	BC1881 family protein	NA	NA	NA	NA
WP_003642805.1\|2059955_2060417_-	transcriptional regulator	D6PSV8	Lactobacillus_phage	1.1e-39	57.0
WP_016527200.1\|2060640_2060952_-	hypothetical protein	A0A2P0ZLB4	Lactobacillus_phage	4.3e-53	99.0
WP_016527201.1\|2060954_2061329_-	hypothetical protein	NA	NA	NA	NA
WP_016527202.1\|2061325_2061844_-	hypothetical protein	O03915	Lactobacillus_phage	1.3e-54	68.6
WP_016527203.1\|2061848_2062571_-	phage antirepressor KilAC domain-containing protein	Q8SDM9	Staphylococcus_phage	2.1e-50	45.6
WP_016527204.1\|2062567_2062855_-	hypothetical protein	NA	NA	NA	NA
WP_016527205.1\|2062851_2063784_-	DUF4373 domain-containing protein	A0A0P0HRQ2	Lactobacillus_phage	7.4e-56	45.5
WP_016527206.1\|2063871_2064267_-	single-stranded DNA-binding protein	D6PSU2	Lactobacillus_phage	2.5e-45	67.2
WP_016527207.1\|2064263_2064911_-	ERF family protein	D6PSU1	Lactobacillus_phage	1.3e-64	59.5
WP_016527208.1\|2064913_2065426_-	hypothetical protein	NA	NA	NA	NA
WP_167803041.1\|2065676_2065820_-	hypothetical protein	NA	NA	NA	NA
WP_016527210.1\|2065920_2066433_-	helix-turn-helix transcriptional regulator	D6PST4	Lactobacillus_phage	3.0e-27	42.9
WP_016527211.1\|2066500_2066806_-	DUF771 domain-containing protein	NA	NA	NA	NA
WP_049816387.1\|2066817_2067012_-	hypothetical protein	NA	NA	NA	NA
WP_016527213.1\|2067004_2067241_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_003644967.1\|2067390_2067759_+	helix-turn-helix transcriptional regulator	E9LUL4	Lactobacillus_phage	5.7e-20	44.1
WP_003644968.1\|2067770_2068184_+	ImmA/IrrE family metallo-endopeptidase	A0A0M4RD70	Bacillus_phage	3.4e-05	31.3
WP_016527214.1\|2068206_2068998_+	hypothetical protein	NA	NA	NA	NA
WP_016527215.1\|2069007_2069262_+	hypothetical protein	NA	NA	NA	NA
WP_016527216.1\|2069398_2070109_+	hypothetical protein	NA	NA	NA	NA
WP_016511204.1\|2070711_2070888_+	hypothetical protein	A0A2P0ZL93	Lactobacillus_phage	3.9e-11	53.4
WP_016527217.1\|2071084_2072179_+	hypothetical protein	NA	NA	NA	NA
WP_016527218.1\|2072468_2073590_+\|integrase	site-specific integrase	D6PSS4	Lactobacillus_phage	7.6e-47	32.7
WP_003642774.1\|2073940_2074147_-	hypothetical protein	NA	NA	NA	NA
WP_016527219.1\|2074578_2074884_-	hypothetical protein	NA	NA	NA	NA
WP_016527220.1\|2074966_2075338_-	hypothetical protein	NA	NA	NA	NA
WP_016527221.1\|2075519_2075789_-\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
WP_016527222.1\|2075877_2077404_-\|capsid	phage major capsid protein	B8R651	Lactobacillus_phage	5.8e-42	25.9
WP_016527223.1\|2077400_2078501_-\|portal	phage portal protein	A0A2H4J9Q5	uncultured_Caudovirales_phage	7.4e-47	33.7
WP_111443457.1\|2078501_2078717_-	hypothetical protein	NA	NA	NA	NA
WP_016527225.1\|2078655_2080359_-\|terminase	terminase large subunit	A0A2H4JBN3	uncultured_Caudovirales_phage	3.2e-121	40.7
WP_016511396.1\|2080355_2080829_-\|terminase	phage terminase small subunit P27 family	NA	NA	NA	NA
WP_016527226.1\|2081683_2082073_-	HNH endonuclease	A0A1J0MFT4	Staphylococcus_phage	1.0e-19	45.2
WP_041161867.1\|2082065_2082404_-\|head	phage head closure protein	A0A2P0ZLF0	Lactobacillus_phage	5.1e-07	33.7
WP_016527228.1\|2082390_2082675_-	hypothetical protein	NA	NA	NA	NA
WP_016527229.1\|2082699_2083119_-	hypothetical protein	NA	NA	NA	NA
WP_016527230.1\|2083262_2084657_-	prophage P2b protein 8, helicase	Q4ZD27	Staphylococcus_phage	1.3e-69	35.8
WP_016527231.1\|2084656_2085457_-	bifunctional DNA primase/polymerase	A0A060ADS5	Enterococcus_phage	1.7e-13	27.7
WP_016527232.1\|2085456_2085708_-	hypothetical protein	NA	NA	NA	NA
WP_016527234.1\|2085978_2086158_-	helix-turn-helix domain-containing protein	E9LUT5	Lactobacillus_phage	3.0e-22	89.7
WP_016527235.1\|2086315_2086936_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_016527164.1\|2086959_2087958_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	2.9e-50	38.9
WP_016527236.1\|2088108_2089266_+\|integrase	site-specific integrase	Q938N9	Temperate_phage	3.9e-54	34.8
2095532:2095547	attR	NA	NA	NA	NA

DBSCAN-SWA_6

2277819 : 2286330

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645867.1\|2277819_2278398_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.3e-21	33.9
WP_003645866.1\|2278390_2279416_-	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	2.7e-59	41.0
WP_016527273.1\|2279412_2280867_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	3.3e-50	34.0
WP_016527274.1\|2280851_2283071_-	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	1.0e-143	39.1
WP_011101895.1\|2283063_2283744_-	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_003642588.1\|2283743_2283998_-	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_003642587.1\|2283999_2284731_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	M4SM18	Cyanophage	1.6e-37	37.3
WP_015380738.1\|2284733_2285864_-	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_003645861.1\|2285847_2286330_-	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	2.3e-16	41.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NC_021518

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 6775

Paenibacillus_phage(33.33%)

holin,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_072533465.1\|580_718_+\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_016526665.1\|1054_2623_-	ClC family H(+)/Cl(-) exchange transporter	NA	NA	NA	NA
WP_013356282.1\|2745_3900_-	cation:proton antiporter	NA	NA	NA	NA
WP_104795485.1\|4270_5046_-\|transposase	IS5-like element ISLpl3 family transposase	A0A0N9SHJ4	Paenibacillus_phage	2.1e-27	53.2
WP_016526667.1\|5153_6056_-	YitT family protein	M1Q1P6	Streptococcus_phage	6.3e-52	40.3
WP_016526668.1\|6142_6775_-	recombinase family protein	A0A286S1P7	Klebsiella_phage	3.6e-14	33.2

DBSCAN-SWA_2

11900 : 18561

Acanthocystis_turfacea_Chlorella_virus(25.0%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016526672.1\|11900_13937_-	KUP/HAK/KT family potassium transporter	M1HZV6	Acanthocystis_turfacea_Chlorella_virus	1.0e-62	33.4
WP_016526673.1\|14051_14648_-	recombinase family protein	A0A219YA40	Aeromonas_phage	6.0e-19	36.1
WP_016526674.1\|14757_15837_-	FRG domain-containing protein	Q9AZ51	Lactococcus_phage	2.4e-05	59.5
WP_006293514.1\|16115_16220_+\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_041142890.1\|16507_17899_+	MFS transporter	NA	NA	NA	NA
WP_014940864.1\|17898_18561_+	HD domain-containing protein	A0A1Q1PP35	Noumeavirus	5.0e-14	31.4

DBSCAN-SWA_3

39002 : 47954

Staphylococcus_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016526702.1\|39002_39863_+	ParA family protein	F0PIG8	Enterococcus_phage	5.1e-43	40.2
WP_016526703.1\|39864_40164_+	hypothetical protein	NA	NA	NA	NA
WP_016526704.1\|40201_41131_-\|transposase	IS30 family transposase	H7BW47	unidentified_phage	2.3e-25	34.4
WP_016526705.1\|41280_42246_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	8.3e-26	29.2
WP_013356274.1\|42491_43409_-	glycine/betaine ABC transporter	NA	NA	NA	NA
WP_013356275.1\|43416_44256_-	proline/glycine betaine ABC transporter permease	NA	NA	NA	NA
WP_041161897.1\|44255_45452_-	glycine betaine/L-proline ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	9.9e-29	36.4
WP_016526708.1\|45868_46855_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	2.4e-44	36.6
WP_041161898.1\|47237_47954_+	LysM peptidoglycan-binding domain-containing protein	K4ID66	Lactobacillus_phage	3.6e-10	55.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_021519

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NC_021517

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NC_021514

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

4. NC_021518

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection