CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NC_021485	Streptococcus agalactiae 09mas018883, complete genome	2 crisprs	cas3,DinG,cas9,cas1,cas2,csn2,csm6,DEDDh,csa3	1	9	5	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_021485_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_021485_1

940236-940997

TypeII

II-A

Consensus_repeat	Method
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAAC	PILER-CR
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAAC	CRISPRCasFinder
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAAC	CRT
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAAC	PILER-CR

11 spacers

csn2,cas2,cas1,cas9

The CRISPR arrays of NC_021485_1

>merge|NC_021485|1|940236-940997|PILER-CR,CRISPRCasFinder,CRT,PILER-CR
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAACCTTTTGTCCATCTTTTTGAATTTTTGCAAAGTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAACAACATTAGCCTTTTCTAACTCTTCAGCTGTGTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAACTATGTCTTCTAACAGTTGCTTCTTGTGCTTGTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAACCCGTCAAACAAGAGCGACAGCGAAACAAGCGTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAACTTAACAGTTTCAAGTCTGTCTTGTTACTTAGTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAACACTCTAAATGATAGTTATGAGTTAAATGTTGTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAACCAAATTACAGTTTCGACTGATTATGGAAATGTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAACATATGTTCCACTCTATGAATTTAGGCTCATGTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAACTTTTTACCAATGCTTCCATATCGCTTATATGTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAACTACTTGACGAATTGAAGATGACGGAATTTAGTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAACAAGCTAATTCTCATCTCACCGAGATGGATAGTTTTAGAGCTGTGCTGTTATTATGCTAGGACATCA

>NC_021485|1|1|940236-940667|PILER-CR
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAAC	CTTTTGTCCATCTTTTTGAATTTTTGCAAA
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAAC	AACATTAGCCTTTTCTAACTCTTCAGCTGT
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAAC	TATGTCTTCTAACAGTTGCTTCTTGTGCTT
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAAC	CCGTCAAACAAGAGCGACAGCGAAACAAGC
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAAC	TTAACAGTTTCAAGTCTGTCTTGTTACTTA
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAAC	ACTCTAAATGATAGTTATGAGTTAAATGTT
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAACCAAATTACAGTTTCGACTGATTATGGAAATGTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAAC	ATATGTTCCACTCTATGAATTTAGGCTCAT
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAAC	TTTTTACCAATGCTTCCATATCGCTTATAT
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAAC	TACTTGACGAATTGAAGATGACGGAATTTA


>NC_021485|1|1|940236-940931|CRISPRCasFinder
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAAC	CTTTTGTCCATCTTTTTGAATTTTTGCAAA
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAAC	AACATTAGCCTTTTCTAACTCTTCAGCTGT
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAAC	TATGTCTTCTAACAGTTGCTTCTTGTGCTT
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAAC	CCGTCAAACAAGAGCGACAGCGAAACAAGC
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAAC	TTAACAGTTTCAAGTCTGTCTTGTTACTTA
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAAC	ACTCTAAATGATAGTTATGAGTTAAATGTT
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAAC	CAAATTACAGTTTCGACTGATTATGGAAAT
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAAC	ATATGTTCCACTCTATGAATTTAGGCTCAT
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAAC	TTTTTACCAATGCTTCCATATCGCTTATAT
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAAC	TACTTGACGAATTGAAGATGACGGAATTTA
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAAC

>NC_021485|1|1|940236-940997|CRT
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAAC	CTTTTGTCCATCTTTTTGAATTTTTGCAAA
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAAC	AACATTAGCCTTTTCTAACTCTTCAGCTGT
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAAC	TATGTCTTCTAACAGTTGCTTCTTGTGCTT
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAAC	CCGTCAAACAAGAGCGACAGCGAAACAAGC
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAAC	TTAACAGTTTCAAGTCTGTCTTGTTACTTA
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAAC	ACTCTAAATGATAGTTATGAGTTAAATGTT
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAAC	CAAATTACAGTTTCGACTGATTATGGAAAT
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAAC	ATATGTTCCACTCTATGAATTTAGGCTCAT
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAAC	TTTTTACCAATGCTTCCATATCGCTTATAT
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAAC	TACTTGACGAATTGAAGATGACGGAATTTA
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAAC	AAGCTAATTCTCATCTCACCGAGATGGATA
GTTTTAGAGCTGTGCTGTTATTATGCTAGGACATCA

>NC_021485|1|2|940698-940931|PILER-CR
	CTTTTGTCCATCTTTTTGAATTTTTGCAAA
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAAC	AACATTAGCCTTTTCTAACTCTTCAGCTGT
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAAC	TATGTCTTCTAACAGTTGCTTCTTGTGCTT
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAAC	CCGTCAAACAAGAGCGACAGCGAAACAAGC
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAAC	TTAACAGTTTCAAGTCTGTCTTGTTACTTA
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAAC	ACTCTAAATGATAGTTATGAGTTAAATGTT
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAACCAAATTACAGTTTCGACTGATTATGGAAATGTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAAC	ATATGTTCCACTCTATGAATTTAGGCTCAT
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAAC	TTTTTACCAATGCTTCCATATCGCTTATAT
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAAC	TACTTGACGAATTGAAGATGACGGAATTTA
GTTTTAGAGCTGTGCTGTTTCGAATGGTTCCAAAAC

Protein	Signature genes	Signature genes Name	Protein_function
NC_021485.1\|WP_000323544.1\|932357_933128_+\|TIGR01457-family-HAD-type-hydrolase	unknown	unknown	gnl\|CDD\|319832
NC_021485.1\|WP_000159234.1\|929617_929989_+\|YbgA-family-protein	unknown	unknown	gnl\|CDD\|377982
NC_021485.1\|WP_000678298.1\|944185_946819_+\|pneumococcal-type-histidine-triad-protein	unknown	unknown	gnl\|CDD\|380193
NC_021485.1\|WP_042357774.1\|954001_954613_+\|TVP38/TMEM64-family-protein	unknown	unknown	gnl\|CDD\|223475
NC_021485.1\|WP_000438314.1\|941554_941971_+\|nucleoside-diphosphate-kinase	unknown	unknown	gnl\|CDD\|179085
NC_021485.1\|WP_000914664.1\|930485_931616_+\|oxygen-independent-coproporphyrinogen-III-oxidase	unknown	unknown	gnl\|CDD\|236309
NC_021485.1\|WP_001241816.1\|930013_930394_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|131381
NC_021485.1\|WP_000180007.1\|946918_947578_+\|HD-domain-containing-protein	unknown	unknown	gnl\|CDD\|224336
NC_021485.1\|WP_001040087.1\|934161_938274_+\|type-II-CRISPR-RNA-guided-endonuclease-Cas9	cas9	COG3513_cas9_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|273840
NC_021485.1\|WP_000665410.1\|948050_948485_+\|peptide-methionine-(R)-S-oxide-reductase-MsrB	unknown	unknown	gnl\|CDD\|234692
NC_021485.1\|WP_000168903.1\|948636_951429_+\|cation-transporting-P-type-ATPase	unknown	unknown	gnl\|CDD\|223550
NC_021485.1\|WP_000653357.1\|933117_933774_+\|TIGR01906-family-membrane-protein	unknown	unknown	gnl\|CDD\|226884
NC_021485.1\|WP_000523795.1\|931619_932357_+\|acyl-ACP-thioesterase	unknown	unknown	gnl\|CDD\|366738
NC_021485.1\|WP_000065321.1\|951428_952532_+\|DUF2974-domain-containing-protein	unknown	unknown	gnl\|CDD\|371412
NC_021485.1\|WP_000621142.1\|947586_948051_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NC_021485.1\|WP_000929489.1\|938275_939145_+\|type-II-CRISPR-associated-endonuclease-Cas1	cas1	cd09720_cas1_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|274694
NC_021485.1\|WP_041970307.1\|952652_953234_-\|CatB-related-O-acetyltransferase	unknown	unknown	gnl\|CDD\|100040
NC_021485.1\|WP_000122194.1\|939141_939483_+\|CRISPR-associated-endonuclease-Cas2	cas2	COG3512_cas2_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|226043
NC_021485.1\|WP_000590706.1\|939469_940135_+\|type-II-A-CRISPR-associated-protein-Csn2	csn2	pfam09711_csn2_CAS-II-A	gnl\|CDD\|213408
NC_021485.1\|WP_001019133.1\|942106_943939_+\|elongation-factor-4	unknown	unknown	gnl\|CDD\|235462

Protein	Function_ID	Function_description	E-value
NC_021485.1\|WP_000323544.1\|932357_933128_+\|TIGR01457-family-HAD-type-hydrolase	gnl\|CDD\|319832	cd07530, HAD_Pase_UmpH-like, UmpH/NagD family phosphatase, similar to Escherichia coli UmpH UMP phosphatase/NagD nucleotide phosphatase and Mycobacterium tuberculosis Rv1692 glycerol 3-phosphate phosphatase. Escherichia coli UmpH/NagD is a ribonucleoside tri-, di-, and monophosphatase with a preference for purines, it shows peak activity with UMP and functions in UMP-degradation. It is also an effective phosphatase with AMP, GMP and CMP. Mycobacterium tuberculosis phosphatase, Rv1692 is a glycerol 3-phosphate phosphatase. Rv1692 is the final enzyme involved in glycerophospholipid recycling/catabolism. This subfamily belongs to the UmpH/NagD phosphatase family, and to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	1.19143e-132
NC_021485.1\|WP_000159234.1\|929617_929989_+\|YbgA-family-protein	gnl\|CDD\|377982	pfam08349, DUF1722, Protein of unknown function (DUF1722). This domain of unknown function is found in bacteria and archaea and is homologous to the hypothetical protein ybgA from E. coli.	6.08694e-28
NC_021485.1\|WP_000678298.1\|944185_946819_+\|pneumococcal-type-histidine-triad-protein	gnl\|CDD\|380193	NF033189, internalin_A, class 1 internalin InlA. Internalins, as found in the intracellular human pathogen Listeria monocytogenes, are paralogous surface or secreted proteins with an N-terminal signal peptide, leucine-rich repeats, and usually a C-terminal LPXTG processing and cell surface anchoring site. See PMID:17764999 for a general discussion of internalins. Members of this family are internalin A (InlA), a class 1 (LPXTG-type) internalin.	9.80578e-22
NC_021485.1\|WP_042357774.1\|954001_954613_+\|TVP38/TMEM64-family-protein	gnl\|CDD\|223475	COG0398, COG0398, Uncharacterized conserved protein [Function unknown].	1.53247e-30
NC_021485.1\|WP_000438314.1\|941554_941971_+\|nucleoside-diphosphate-kinase	gnl\|CDD\|179085	PRK00668, ndk, mulitfunctional nucleoside diphosphate kinase/apyrimidinic endonuclease/3'-; Validated.	4.64422e-78
NC_021485.1\|WP_000914664.1\|930485_931616_+\|oxygen-independent-coproporphyrinogen-III-oxidase	gnl\|CDD\|236309	PRK08599, PRK08599, oxygen-independent coproporphyrinogen III oxidase.	0
NC_021485.1\|WP_001241816.1\|930013_930394_+\|hypothetical-protein	gnl\|CDD\|131381	TIGR02328, TIGR02328, conserved hypothetical protein. Members of this protein are found in a small number of taxonomically well separated species, yet are strongly conserved, suggesting lateral gene transfer. Members are found in Treponema denticola, Clostridium acetobutylicum, and several of the Firmicutes. The function of this protein is unknown. [Hypothetical proteins, Conserved].	6.45558e-80
NC_021485.1\|WP_000180007.1\|946918_947578_+\|HD-domain-containing-protein	gnl\|CDD\|224336	COG1418, COG1418, Predicted HD superfamily hydrolase [General function prediction only].	2.66997e-33
NC_021485.1\|WP_001040087.1\|934161_938274_+\|type-II-CRISPR-RNA-guided-endonuclease-Cas9	gnl\|CDD\|273840	TIGR01865, conserved_hypothetical_protein, CRISPR subtype II/NMENI RNA-guided endonuclease Cas9/Csn1. CRISPR loci appear to be mobile elements with a wide host range. This model represents a protein found only in CRISPR-containing species, near other CRISPR-associated proteins (cas), as part of the NMENI subtype of CRISPR/Cas locus. The species range so far for this protein is animal pathogens and commensals only.	0
NC_021485.1\|WP_000665410.1\|948050_948485_+\|peptide-methionine-(R)-S-oxide-reductase-MsrB	gnl\|CDD\|234692	PRK00222, PRK00222, peptide-methionine (R)-S-oxide reductase MsrB.	6.40832e-86
NC_021485.1\|WP_000168903.1\|948636_951429_+\|cation-transporting-P-type-ATPase	gnl\|CDD\|223550	COG0474, MgtA, Cation transport ATPase [Inorganic ion transport and metabolism].	0
NC_021485.1\|WP_000653357.1\|933117_933774_+\|TIGR01906-family-membrane-protein	gnl\|CDD\|226884	COG4478, COG4478, Predicted membrane protein [Function unknown].	9.75792e-52
NC_021485.1\|WP_000523795.1\|931619_932357_+\|acyl-ACP-thioesterase	gnl\|CDD\|366738	pfam01643, Acyl-ACP_TE, Acyl-ACP thioesterase. This family consists of various acyl-acyl carrier protein (ACP) thioesterases (TE) these terminate fatty acyl group extension via hydrolysing an acyl group on a fatty acid.	3.68196e-111
NC_021485.1\|WP_000065321.1\|951428_952532_+\|DUF2974-domain-containing-protein	gnl\|CDD\|371412	pfam11187, DUF2974, Protein of unknown function (DUF2974). This bacterial family of proteins has no known function.	1.82724e-105
NC_021485.1\|WP_000621142.1\|947586_948051_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	5.91796e-19
NC_021485.1\|WP_000929489.1\|938275_939145_+\|type-II-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|274694	TIGR03639, cas1_NMENI, CRISPR-associated endonuclease Cas1, subtype II/NMENI. The CRISPR-associated protein Cas1 is virtually universal to CRISPR systems. CRISPR, an acronym for Clustered Regularly Interspaced Short Palindromic Repeats, is a prokaryotic immunity system for foreign DNA, mostly from phage. CRISPR systems belong to different subtypes, distinguished by both nature of the repeats, the makeup of the cohort of associated Cas proteins, and by molecular phylogeny within the more universal Cas proteins such as this one. This model is of type EXCEPTION and provides more specific information than the EQUIVALOG model TIGR00287. It describes the Cas1 variant of the NMENI subtype of CRISPR/Cas system.	2.54315e-139
NC_021485.1\|WP_041970307.1\|952652_953234_-\|CatB-related-O-acetyltransferase	gnl\|CDD\|100040	cd03349, LbH_XAT, Xenobiotic acyltransferase (XAT): The XAT class of hexapeptide acyltransferases is composed of a large number of microbial enzymes that catalyze the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others. Members of this class of enzymes include Enterococcus faecium streptogramin A acetyltransferase and Pseudomonas aeruginosa chloramphenicol acetyltransferase. They contain repeated copies of a six-residue hexapeptide repeat sequence motif (X-[STAV]-X-[LIV]-[GAED]-X) and adopt a left-handed parallel beta helix (LbH) structure. The active enzyme is a trimer with CoA and substrate binding sites at the interface of two separate LbH subunits. XATs are implicated in inactivating xenobiotics leading to xenobiotic resistance in patients.	1.12772e-70
NC_021485.1\|WP_000122194.1\|939141_939483_+\|CRISPR-associated-endonuclease-Cas2	gnl\|CDD\|226043	COG3512, COG3512, CRISPR-associated protein, Cas2 homolog [Defense mechanisms].	2.38084e-52
NC_021485.1\|WP_000590706.1\|939469_940135_+\|type-II-A-CRISPR-associated-protein-Csn2	gnl\|CDD\|213408	cd09758, Csn2, CRISPR/Cas system-associated protein Csn2. Csn2 is a Nmeni subtype-specific Cas protein, which may function in the adaptation process which mediates the incorporation of foreign nucleic acids into the microbial host genome. Csn 2 may interact directly with double-stranded DNA. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA. Csn2 has been predicted to be a functional analog of Cas4 based on anti-correlated phyletic patterns; also known as SPy1049 family.	3.61399e-122
NC_021485.1\|WP_001019133.1\|942106_943939_+\|elongation-factor-4	gnl\|CDD\|235462	PRK05433, PRK05433, GTP-binding protein LepA; Provisional.	0

>NC_021485.1|WP_000590706.1|939469_940135_+|type-II-A-CRISPR-associated-protein-Csn2
MIKINFPILDEPLVLSNATILTIEDVSVYSSLVKHFYQYDVDEHLKLFDDKQKSLKATELMLVTDILGYDVNSAPILKLIHGDLENQFNEKPEVKSMVEKLAATITELIAFECLENELDLEYDEITILELIKALGVKIETQSDTIFEKCFEIIQVYHYLTKKNLLVFVNSGAYLTKDEVIKLCEYINLMQKSVLFLEPRRLYDLPQYVIDKDYFLIGENMV
>NC_021485.1|WP_000122194.1|939141_939483_+|CRISPR-associated-endonuclease-Cas2
MSYRYMRMILMFDMPTETAEERKAYRKFRKFLLSEGFIMHQFSVYSKLLLNNTANNAMIGRLKVNNPKKGNITLLTVTEKQFARMVYLHGERNTSVANSDSRLVFLGDSYDQD
>NC_021485.1|WP_000929489.1|938275_939145_+|type-II-CRISPR-associated-endonuclease-Cas1
MAGWRTVVVNTHSKLSYKNNHLIFKDSYQTEMIHLSEIDILIMETTDIVLSTMLIKRLVDENILVIFCDDKRLPTAMLMPYYARHDSSLQLSRQMSWIEDVKADVWTSIIAQKILNQSFYLGECSFFEKSQSIMNLYHDLEPFDPSNREGHAARIYFNTLFGNDFSREQDNPINAGLDYGYSLLLSMFAREVVKCGCMTQFGLKHANQFNQFNLASDIMEPFRPIVDRIIYENRQSDFVKMKRELFSMFSETYSYNGKEMYLSNIVSDYTKKVIKSLNSDGNGIPEFRI
>NC_021485.1|WP_001040087.1|934161_938274_+|type-II-CRISPR-RNA-guided-endonuclease-Cas9
MNKPYSIGLDIGTNSVGWSIITDDYKVPAKKMRVLGNTDKEYIKKNLIGALLFDGGNTAADRRLKRTARRRYTRRRNRILYLQEIFAEEMSKVDDSFFHRLEDSFLVEEDKRGSKYPIFATLQEEKDYHEKFSTIYHLRKELADKKEKADLRLIYIALAHIIKFRGHFLIEDDSFDVRNTDISKQYQDFLEIFNTTFENNDLLSQNVDVEAILTDKISKSAKKDRILAQYPNQKSTGIFAEFLKLIVGNQADFKKYFNLEDKTPLQFAKDSYDEDLENLLGQIGDEFADLFSAAKKLYDSVLLSGILTVIDLSTKAPLSASMIQRYDEHREDLKQLKQFVKASLPEKYQEIFADSSKDGYAGYIEGKTNQEAFYKYLSKLLTKQEDSENFLEKIKNEDFLRKQRTFDNGSIPHQVHLTELKAIIRRQSEYYPFLKENQDRIEKILTFRIPYYIGPLAREKSDFAWMTRKTDDSIRPWNFEDLVDKEKSAEAFIHRMTNNDFYLPEEKVLPKHSLIYEKFTVYNELTKVRYKNEQGETYFFDSNIKQEIFDGVFKEHRKVSKKKLLDFLAKEYEEFRIVDVIGLDKENKAFNASLGTYHDLEKILDKDFLDNPDNESILEDIVQTLTLFEDREMIKKRLENYKDLFTESQLKKLYRRHYTGWGRLSAKLINGIRDKESQKTILDYLIDDGRSNRNFMQLINDDGLSFKSIISKAQAGSHSDNLKEVVGELAGSPAIKKGILQSLKIVDELVKVMGYEPEQIVVEMARENQTTNQGRRNSRQRYKLLDDGVKNLASDLNGNILKEYPTDNQALQNERLFLYYLQNGRDMYTGEALDIDNLSQYDIDHIIPQAFIKDDSIDNRVLVSSAKNRGKSDDVPSLEIVKDCKVFWKKLLDAKLMSQRKYDNLTKAERGGLTSDDKARFIQRQLVETRQITKHVARILDERFNNELDSKGRRIRKVKIVTLKSNLVSNFRKEFGFYKIREVNNYHHAHDAYLNAVVAKAILTKYPQLEPEFVYGDYPKYNSYKTRKSATEKLFFYSNIMNFFKTKVTLADGTVVVKDDIEVNNDTGEIVWDKKKHFATVRKVLSYPQNNIVKKTEIQTGGFSKESILAHGNSDKLIPRKTKDIYLDPKKYGGFDSPIVAYSVLVVADIKKGKAQKLKTVTELLGITIMERSRFEKNPSAFLESKGYLNIRADKLIILPKYSLFELENGRRRLLASAGELQKGNELALPTQFMKFLYLASRYNESKGKPEEIEKKQEFVNQHVSYFDDILQLINDFSKRVILADANLEKINKLYQDNKENISVDELANNIINLFTFTSLGAPAAFKFFDKIVDRKRYTSTKEVLNSTLIHQSITGLYETRIDLGKLGED
>NC_021485.1|WP_000653357.1|933117_933774_+|TIGR01906-family-membrane-protein
MKDKLLVVLTWIWIISLATLATIYIAWLIYPIEIQFLKLEKVVYLKAETIYYNFNKLMIYLTHPFISDLNMPSFPSSEDGLKHFADVKYLFTLAHGLFVILTFPVIYFLRRGWKQKSIFLYEGFFKIAIMLPIFIVVCAFLLGFDQFFTLFHEVLFPGDSTWQFNPLTDPVIWILPETFFLHCFIIFLLIYETITIILLIIGRKHLKLRKYKNKMQAL
>NC_021485.1|WP_000323544.1|932357_933128_+|TIGR01457-family-HAD-type-hydrolase
MAYKGYLIDLDGTIYKGKSRIPAGERFIERLQEKGIPYMLVTNNTTRTPESVQEMLRGFNVETPLETIYTATMATVDYMNDMNRGKTAYVIGEEGLKKAIADAGYVEDTKNPAYVVVGLDWNVTYDKLATATLAIQNGALFIGTNPDLNIPTERGLLPGAGSLNALLEAATRIKPVFIGKPNAIIMNKALEILNIPRNQAVMVGDNYLTDIMAGINNDIDTLLVTTGFTTVEEVPDLPIQPSYVLASLDEWTFNEG
>NC_021485.1|WP_000523795.1|931619_932357_+|acyl-ACP-thioesterase
MGLLYRETYEVPFYESDTNHYMKLPQLLALALQISAKQSLKLGIGDDIVFKRYGLVWVVTDYIIDIERLPKHAEKIVIETEAKAHNKLLCYRYFYIYGEDGQKIITISSAFVLMDFKTRKIHPVLDDITSIYQSQRIKKVIRGPKYHPIGDSKVKQYHVRYFDLDMNGHVNNSKYLEWMYDVLDLDFLSSHIPKKIDLKYIKEIQYGTDIKSHWYQDGLVTRHDIIGGDAIHAQARIEWQEKKED
>NC_021485.1|WP_000914664.1|930485_931616_+|oxygen-independent-coproporphyrinogen-III-oxidase
MLKKPTSAYVHIPFCTQICYYCDFSKVFIKNQPVDAYLQALIREFRSYDITELRTLYIGGGTPTSISAVQLDYLLTELSRDLNLNTLEEFTIEANPGDLTVDKIEVLQKSAVNRVSLGVQTFNDKHLKRIGRSHNEAQIYSTIDALKTAGFQNISIDLIYALPGQTMDDVRSNVAKALSLNIPHLSLYSLILEHHTVFMNKMRRGKLHLPTEDLEAEMFEYIISEMERNGFEHYEISNFTKPGFESRHNLMYWDNVEYYGVGAGASGYLDGIRYRNRGPIQHYLKGVSEGNARLSEEVLSKNEMMEEELFLGLRKKEGVSIGKFEQKFGTSFEKRYGQIVQELQSDGLLKENNGFIQMTKKGLFLGDTVAEKFIVE
>NC_021485.1|WP_001241816.1|930013_930394_+|hypothetical-protein
MRLWHQDIIELLPRQQLLGQHRECCALRGNGWGRKHETVDYVFRYSPYRLFAYHQLVMEEMMERGYRVSKEWLIAEYRGMKCPRYDTLNPVDLETPIYPEHNQDYLQECLWNLKAKGIDLPINKIK
>NC_021485.1|WP_000159234.1|929617_929989_+|YbgA-family-protein
MTKEAELLWAKHKYLVLSKSQKIYLDIRQTLKSPNCTVLDVQSLIDQAVLLEESPSQVTNAYMHIWGYFKNKAERQEKEEFLTLLEKYRKTGYQRRKLLAFLKQLLAKYPNSYLQNSSIFEEE
>NC_021485.1|WP_000438314.1|941554_941971_+|nucleoside-diphosphate-kinase
MEQTFFMIKPDGVKRGFIGEVISRIERRGFSIDRLEVRYADADILKRHYAELTDRPFFPTLVDYMTSGPVIIGVISGEEVISTWRTMMGSTNPKDALPGTIRGDFAQAPSPNQATCNIVHGSDSPESATREIAIWFNN
>NC_021485.1|WP_001019133.1|942106_943939_+|elongation-factor-4
MNIEDLKKRQEKIRNFSIIAHIDHGKSTLADRILEKTETVSSREMQAQLLDSMDLERERGITIKLNAIELNYTAKDGETYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNDLEILPVINKIDLPAADPERVRAEVEDVIGLDASEAVLASAKAGIGIEEILEQIVEKVPAPTGEVDAPLQALIFDSVYDAYRGVILQVRIVNGMVKPGDKIQMMSNGKTFDVTEVGIFTPKAVGRDFLATGDVGYIAASIKTVADTRVGDTITLANNPAIEPLHGYKQMNPMVFAGLYPIESNKYNDLREALEKLQLNDASLQFEPETSQALGFGFRCGFLGLLHMDVIQERLEREFNIDLIMTAPSVVYHVNTTDGEMLEVSNPSEFPDPTRVDSIEEPYVKAQIMVPQEFVGAVMELAQRKRGDFVTMDYIDDNRVNVIYQIPLAEIVFDFFDKLKSSTRGYASFDYEISEYRRSQLVKMDILLNGDKVDALSFIVHKEFAYERGKLIVDKLKKIIPRQQFEVPIQAAIGQKIVARSDIKALRKNVLAKCYGGDVSRKRKLLEKQKAGKKRMKAIGSVEVPQEAFLSVLSMDDDDKK
>NC_021485.1|WP_000678298.1|944185_946819_+|pneumococcal-type-histidine-triad-protein
MKGQKIIALAGLVLSCHFALTACHTQEHKNSHHIKTKQVAKKKANKKKVSVKESHKKRKGVAGVDFPTDDGFLLTKDSKILSHTDSGIVVAHGNHSHFIFYSDLKGSKFSYLIPNANTKTNKNQAVRNFKAGAVAVNTLNDGYVFNPADIVSEDANGYVVRHGDHFHYIPKASLSQQKQVQASRAVSRLGNQSNSHYRVNSSKIAGLHYPTSNGFLFNGRGIKGTTPTGILVEHHNHLHFISFADLRKGGWGSIADRYQPQKKADSKKQSPSSKKPRTENTLPKDIKDKLAYLARELHLDISRIRVLKTLNGEIGFEYPHDDHTHVIMAKDIDLSKPIPNPHHDDEDHHKGHHHDESDHKHEEHEHTKSNKLSDEDQKKLIYLAEKLGLNPNQIEVLTSEDGSIIFKYPHDDHSHTIASKDIEIGKPIPDGHHDHSHAKDKVGMATLKQIGFDDEIIQDILHADAPTPFPSNETNPEKMRQWLATVTKINIGQRTNPFQRFGLSLMPNIEVLGIGFTPINDMTPVLQFKKLKQLWMTNTGITDYSFLDKMPLLEGLDISQNGIKDLSFLTKYKQLSLIAAANNGITSLKPLAELPNLQFLVLSHNNISDLTPLSNLTKLQELHLDHNNVKNLSALSGKKDLKVLDLSNNKSADLSTLKTTSLETLLLNETNTSNLSFLKQNPKVSNLTINNAKLASLDGIEESDEIVKVEAEGNQIKSLVLKNKQGSLKFLNVTNNQLTSLEGVNNYTSLETLSVSKNKLESLDIKTPNKTVTNLDFSHNNVPTSQLKLNEKNIPEAVAKNFPAVVEGSMVGNGSLAEKAAMASKEDKQVSDNTNHQKNTEKSAQANADSKKENPKTHDEHHDHEETDHAHVGHHHH
>NC_021485.1|WP_000180007.1|946918_947578_+|HD-domain-containing-protein
MTMVKREDVILNATENMVHHKLKNDPSGHDWFHIVRVRNLAVELAHKEGANTFICQMAALLHDIIDDKICQDSKQASYELTQWLYSQDLAIAEVEHILDILENISFKAGTGLTMKTLEGQIVQDADRLDAMGAIGIARTMAYSGSKGRLIHDPNLKPRENLTLEEYRNGQDTAIMHFYEKLLKLKDLMNTKQGKMLAQKRHDFLELYLAEFYAEWNGKR
>NC_021485.1|WP_000621142.1|947586_948051_+|GNAT-family-N-acetyltransferase
MIRRAKEKDLPDIAELLKQILMLHHEVRPDIFHTRGSKFSKEQLKEMLIDESKPIFVYESDEGKVVAHLFLQLQEKRDLPRKSFKTLYIDDLCIDEEVRGQQIGQKLMDFARQYAKKHGCYNITLNVWNDNQRAVSFYEKLGFKPQQTQMEEIL
>NC_021485.1|WP_000665410.1|948050_948485_+|peptide-methionine-(R)-S-oxide-reductase-MsrB
MKETQEELRQRIGHTAYQVTQNSATEHAFTGKYDDFFEEGIYVDIVSGEVLFSSLDKFQSGCGWPAFSKPIENRMVTNHQDHSHGMHRIEVRSRQADSHLGHVFNDGPVDAGGLRYCINSAALDFIPYDQMAKRGYGDYLSLFD
>NC_021485.1|WP_000168903.1|948636_951429_+|cation-transporting-P-type-ATPase
MASTNNVSDTNTRFAKEELEEVFEELGTTQGGLSDEEVAVRQKKYGLNLLSEVKQESIILLFLKNFTSLMAILLWVGGFVAIVSNSLELGLAIWMVNVINGIFSFIQEYRASQATQALEKMLPSYSRVLRKGSEEKILSEQLVPGDIVLIEEGDRISADGRLIKTTDLQVNQSALTGESNPIYKDSNVENDQSKTLIECDNMVFAGTTVSSGSATMVVTAIGMQTQFGQIADLTQGMKSEKSPLQRELDRLTKQISIISITVGIIFFLAATFFVKEPVSKSFIFALGMIVAFIPEGLLPTVTPSLAMAVQRMAKEHALVKKLSSVETLGATSVICSDKTGTLTQNEMTVNHLWQNGKSYQVTGLGYAPEGQILFEGDNICFGNSDRGDLEKLIRFAHLCSNAQVLPPNDDRSTYTVLGDPTEACLNVLLEKSGINIQENRKFAPRLKELPFDSVRKRMTTIHSLGGDEKDKKISITKGAPKEILDLSDYVLSDGKVIPLNKEERNKIQLANDTFAKDGLRVLAVSYCDIEGFSKEQWTQENLEQHMVFIGLIAMSDPPREGVREAIDKCHAASIRIIMVTGDYGLTALSIAKNIGIIRNDDAKVISGLELSEMTDSQLKKELSGEVVFARVAPEQKYRVVTILQEMGEVVAVTGDGVNDAPALKKSDIGVAMGVTGTDVAKESADMILTDDHFASIVHAVEEGRAVYQNIKKFLTYIFNSNTPEAVPSAFFLFSKGFIPLPLTVMQILAVDLGTDMLPALGLGVEPPETDVMNRPPRRLTDRLLDKGLLIKSFLWYGTIESVLAMGGFFWAHYLRYGNFTFFVANGIPYREATTMTLGAIIFSQIGMVMNSRTSYQSIKALSIFGNKLINFGIIMEILAFLVLVYVPLFHNLFNTASLGLSHWLYLISCPFIMIGLDEVRKLFSSRKNKR
>NC_021485.1|WP_000065321.1|951428_952532_+|DUF2974-domain-containing-protein
MSNIITYLKNNSNLTFDELALNDVDILCLNEFGYISFEKLINTTEMKSVLVCELYHEYLQTMAKSYSFMFTSQRHDLCQLMMTSKRFKNLTLSYYRAEISLEFEKQFAAMVFTIPNINYHQVVFRGTDANLIGWKEDFKLTYMREISAHRSAIKYLNTILPYFDKVVLSGHSKGGNLALYAAMFTKPDLKAKIDLIWLIDSPGLQKTLLPTTEYKTTKQKCIRLLPEESIVGMMLYSDIEPLIISSNARGILQHDVTTWEIQEPAILKTGTGLSLKSICFEKTFQQWMAELKSQERKLFFDLLFDSFLSSGVSSLDDFNLASRAKMMKAFHSFRELDDDKKRLFNKSLKLLVTIFWGAYHDNSRETK
>NC_021485.1|WP_041970307.1|952652_953234_-|CatB-related-O-acetyltransferase
MRTDMSTGASYPKYGFSVGKYTYGYQQFFYEGVNLKEIGAFCSIAQNVTITGLNHPTDHITTNPFIYYKSRGFINEDRADLIDEKKNGKVIIGNDVWIGTNVTILPSVTIGNGAIIGAGSVITKDIPDYAVVAGTPAKIIKYRFSEEEITLLNASQWWNWSDEAIKEHISEFSDKKEFFNTLKSISENKNHKL
>NC_021485.1|WP_042357774.1|954001_954613_+|TVP38/TMEM64-family-protein
MNMKLSKRYRFWQKVIKALGVLALIATLVLVVYLYKLGILNDSNELKDLVHKYEFWGPMIFIVAQIVQIVFPVIPGGVTTVAGFLIFGPTLGFIYNYIGIIIGSVILFWLVKFYGRKFVLLFMDQKTFDKYESKLETSGYEKFFIFCMASPISPADIMVMITGLSNMSIKRFVTIIMITKSISIIGYSYLWIYGGDILKNFLN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_021485_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_021485_2

2005935-2006204

Orphan

Consensus_repeat	Method
CTGGTTTNGCNTCTGGTT	CRT

6 spacers

The CRISPR arrays of NC_021485_2

>merge|NC_021485|2|2005935-2006204|CRT
CTGGTTTAGCCTCTGGCTTAACGTCTGGTTTAACTTCTGGCTTAGCCTCTGGTCTGGCCTCTGGCTTAACGTCTGGTTTAACTTCTGGCTTAGCCTCTGGTTTAACTTCTGGCTTAGCCTCTGGTTTGGCTTCTGGTTTGGCCTCTGGTTTGGCTTCTGGTTTGGCCTCTGGTTTGGCTTCTGGCTTAGCTTCTGGCTTAACGTCTGGCTTAACATCTGGTTTGGCTTCTGGTTTAACTTCTGGCTTAGCTTCTGGTTTGGCTACTTTTT

>NC_021485|2|2|2005935-2006204|CRT
CTGGTTTAGCCTCTGGCT	TAACGTCTGGTTTAACTT
CTGGCTTAGCCTCTGGTC	TGGCCTCTGGCTTAACGTCTGGTTTAACTT
CTGGCTTAGCCTCTGGTT	TAACTTCTGGCTTAGCCTCTGGTTTGGCTT
CTGGTTTGGCCTCTGGTT	TGGCTTCTGGTTTGGCCT
CTGGTTTGGCTTCTGGCT	TAGCTTCTGGCTTAACGTCTGGCTTAACAT
CTGGTTTGGCTTCTGGTT	TAACTTCTGGCTTAGCTT
CTGGTTTGGCTACTTTTT

Protein	Signature genes	Signature genes Name	Protein_function
NC_021485.1\|WP_001159688.1\|2016643_2017846_-\|NupC/NupG-family-nucleoside-CNT-transporter	unknown	unknown	gnl\|CDD\|224883
NC_021485.1\|WP_000057521.1\|2009379_2009532_-\|50S-ribosomal-protein-L33	unknown	unknown	gnl\|CDD\|234783
NC_021485.1\|WP_000903269.1\|1999143_1999752_+\|hypothetical-protein	unknown	unknown	unknown
NC_021485.1\|WP_000161343.1\|1996979_1997666_+\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|223816
NC_021485.1\|WP_000764812.1\|2009580_2011902_-\|penicillin-binding-protein	unknown	unknown	gnl\|CDD\|223815
NC_021485.1\|WP_144063145.1\|2007456_2008280_+\|IS5-family-transposase	unknown	unknown	gnl\|CDD\|372577
NC_021485.1\|WP_000497678.1\|2009170_2009344_-\|preprotein-translocase-subunit-SecE	unknown	unknown	gnl\|CDD\|223762
NC_021485.1\|WP_000010477.1\|2011945_2012830_+\|RluA-family-pseudouridine-synthase	unknown	unknown	gnl\|CDD\|223638
NC_021485.1\|WP_001182060.1\|2017866_2018646_-\|uridine-phosphorylase	unknown	unknown	gnl\|CDD\|350167
NC_021485.1\|WP_000453154.1\|2015942_2016614_-\|deoxyribose-phosphate-aldolase	unknown	unknown	gnl\|CDD\|234784
NC_021485.1\|WP_000730416.1\|1997662_1999051_+\|HAMP-domain-containing-histidine-kinase	unknown	unknown	gnl\|CDD\|223715
NC_021485.1\|WP_000887149.1\|2004992_2005532_-\|transcription-termination/antitermination-protein-NusG	unknown	unknown	gnl\|CDD\|180161
NC_021485.1\|WP_000459240.1\|2012854_2014495_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226987
NC_021485.1\|WP_000077187.1\|2014664_2015876_-\|phosphopentomutase	unknown	unknown	gnl\|CDD\|235430
NC_021485.1\|WP_000610952.1\|1990703_1991027_-\|AzlD-domain-containing-protein	unknown	unknown	gnl\|CDD\|226827
NC_021485.1\|WP_000410672.1\|1991016_1991709_-\|AzlC-family-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224215
NC_021485.1\|WP_000145177.1\|1999841_2002343_-\|leucine--tRNA-ligase	unknown	unknown	gnl\|CDD\|234743
NC_021485.1\|WP_000953628.1\|2004009_2004855_-\|patatin-family-protein	unknown	unknown	gnl\|CDD\|132847
NC_021485.1\|WP_001093374.1\|1992031_1996747_+\|S8-family-serine-peptidase	unknown	unknown	gnl\|CDD\|173801
NC_021485.1\|WP_000074727.1\|2002719_2003967_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340929

Protein	Function_ID	Function_description	E-value
NC_021485.1\|WP_000057521.1\|2009379_2009532_-\|50S-ribosomal-protein-L33	gnl\|CDD\|234783	PRK00504, rpmG, 50S ribosomal protein L33; Validated.	2.53308e-18
NC_021485.1\|WP_000453154.1\|2015942_2016614_-\|deoxyribose-phosphate-aldolase	gnl\|CDD\|234784	PRK00507, PRK00507, deoxyribose-phosphate aldolase; Provisional.	3.25832e-110
NC_021485.1\|WP_000161343.1\|1996979_1997666_+\|response-regulator-transcription-factor	gnl\|CDD\|223816	COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription].	8.44527e-63
NC_021485.1\|WP_000764812.1\|2009580_2011902_-\|penicillin-binding-protein	gnl\|CDD\|223815	COG0744, MrcB, Membrane carboxypeptidase (penicillin-binding protein) [Cell envelope biogenesis, outer membrane].	0
NC_021485.1\|WP_144063145.1\|2007456_2008280_+\|IS5-family-transposase	gnl\|CDD\|372577	pfam13359, DDE_Tnp_4, DDE superfamily endonuclease. This family of proteins are related to pfam00665 and are probably endonucleases of the DDE superfamily. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	2.31999e-22
NC_021485.1\|WP_000953628.1\|2004009_2004855_-\|patatin-family-protein	gnl\|CDD\|132847	cd07208, Pat_hypo_Ecoli_yjju_like, Hypothetical patatin similar to yjju protein of Escherichia coli. Patatin-like phospholipase similar to yjju protein of Escherichia coli. This family predominantly consists of bacterial patatin glycoproteins, and some representatives from eukaryotes and archaea. The patatin protein accounts for up to 40% of the total soluble protein in potato tubers. Patatin is a storage protein, but it also has the enzymatic activity of a lipid acyl hydrolase, catalyzing the cleavage of fatty acids from membrane lipids. Members of this family have also been found in vertebrates.	5.90358e-122
NC_021485.1\|WP_000010477.1\|2011945_2012830_+\|RluA-family-pseudouridine-synthase	gnl\|CDD\|223638	COG0564, RluA, Pseudouridylate synthases, 23S RNA-specific [Translation, ribosomal structure and biogenesis].	1.5846e-84
NC_021485.1\|WP_001182060.1\|2017866_2018646_-\|uridine-phosphorylase	gnl\|CDD\|350167	cd17767, UP_EcUdp-like, uridine phosphorylases similar to Escherichia coli Udp and related phosphorylases. Uridine phosphorylase (UP) is specific for pyrimidines, and is involved in pyrimidine salvage and in the maintenance of uridine homeostasis. In addition to E. coli Udp, this subfamily includes Shewanella oneidensis MR-1 UP and Plasmodium falciparum purine nucleoside phosphorylase (PfPNP). PfPNP is an outlier in terms of genetic distance from the other families of PNPs. PfPNP is catalytically active for inosine and guanosine, and in addition, has a weak UP activity. This subfamily belongs to the nucleoside phosphorylase-I (NP-I) family, whose members accept a range of purine nucleosides as well as the pyrimidine nucleoside uridine. The NP-1 family includes phosphorolytic nucleosidases, such as purine nucleoside phosphorylase (PNPs, EC. 2.4.2.1), uridine phosphorylase (UP, EC 2.4.2.3), and 5'-deoxy-5'-methylthioadenosine phosphorylase (MTAP, EC 2.4.2.28), and hydrolytic nucleosidases, such as AMP nucleosidase (AMN, EC 3.2.2.4), and 5'-methylthioadenosine/S-adenosylhomocysteine (MTA/SAH) nucleosidase (MTAN, EC 3.2.2.16). The NP-I family is distinct from nucleoside phosphorylase-II, which belongs to a different structural family.	4.65794e-137
NC_021485.1\|WP_001159688.1\|2016643_2017846_-\|NupC/NupG-family-nucleoside-CNT-transporter	gnl\|CDD\|224883	COG1972, NupC, Nucleoside permease [Nucleotide transport and metabolism].	3.49248e-155
NC_021485.1\|WP_000730416.1\|1997662_1999051_+\|HAMP-domain-containing-histidine-kinase	gnl\|CDD\|223715	COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms].	5.77969e-46
NC_021485.1\|WP_000497678.1\|2009170_2009344_-\|preprotein-translocase-subunit-SecE	gnl\|CDD\|223762	COG0690, SecE, Preprotein translocase subunit SecE [Intracellular trafficking and secretion].	5.81702e-09
NC_021485.1\|WP_000459240.1\|2012854_2014495_-\|hypothetical-protein	gnl\|CDD\|226987	COG4640, COG4640, Predicted membrane protein [Function unknown].	3.13723e-08
NC_021485.1\|WP_000077187.1\|2014664_2015876_-\|phosphopentomutase	gnl\|CDD\|235430	PRK05362, PRK05362, phosphopentomutase; Provisional.	0
NC_021485.1\|WP_000610952.1\|1990703_1991027_-\|AzlD-domain-containing-protein	gnl\|CDD\|226827	COG4392, COG4392, Predicted membrane protein [Function unknown].	3.50446e-14
NC_021485.1\|WP_000410672.1\|1991016_1991709_-\|AzlC-family-ABC-transporter-permease	gnl\|CDD\|224215	COG1296, AzlC, Predicted branched-chain amino acid permease (azaleucine resistance) [Amino acid transport and metabolism].	2.08703e-51
NC_021485.1\|WP_000145177.1\|1999841_2002343_-\|leucine--tRNA-ligase	gnl\|CDD\|234743	PRK00390, leuS, leucyl-tRNA synthetase; Validated.	0
NC_021485.1\|WP_000887149.1\|2004992_2005532_-\|transcription-termination/antitermination-protein-NusG	gnl\|CDD\|180161	PRK05609, nusG, transcription antitermination protein NusG; Validated.	3.00072e-83
NC_021485.1\|WP_001093374.1\|1992031_1996747_+\|S8-family-serine-peptidase	gnl\|CDD\|173801	cd07475, Peptidases_S8_C5a_Peptidase, Peptidase S8 family domain in Streptococcal C5a peptidases. Streptococcal C5a peptidase (SCP), is a highly specific protease and adhesin/invasin. The subtilisin-like protease domain is located at the N-terminus and contains a protease-associated domain inserted into a loop. There are three fibronectin type III (Fn) domains at the C-terminus. SCP binds to integrins with the help of Arg-Gly-Asp motifs which are thought to stabilize conformational changes required for substrate binding. Peptidases S8 or Subtilases are a serine endo- and exo-peptidase clan. They have an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. The stability of subtilases may be enhanced by calcium, some members have been shown to bind up to 4 ions via binding sites with different affinity. Some members of this clan contain disulfide bonds. These enzymes can be intra- and extracellular, some function at extreme temperatures and pH values.	3.28365e-89
NC_021485.1\|WP_000074727.1\|2002719_2003967_+\|MFS-transporter	gnl\|CDD\|340929	cd17371, MFS_MucK, Cis,cis-muconate transport protein and similar proteins of the Major Facilitator Superfamily. This subfamily is composed of Acinetobacter sp. Cis,cis-muconate transport protein (MucK), Escherichia coli putative sialic acid transporter 1, and similar proteins. MucK functions in the uptake of muconate and allows Acinetobacter calcoaceticus ADP1 (BD413) to grow on exogenous cis,cis-muconate as the sole carbon source. The MucK subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	2.00017e-68

>NC_021485.1|WP_000887149.1|2004992_2005532_-|transcription-termination/antitermination-protein-NusG
MLDSFDKGWFVLQTYSGYENKVKENLLQRAQTYNMLDNILRVEIPTQTVNVEKNGKTKEIEENRFPGYVLVEMVMTDEAWFVVRNTPNVTGFVGSHGNRSKPTPLLEEEIRSILISMGQTVDVFDTNIKEGDVVQIIDGAFIGQEGRVVEIENNKVKLMINMFGSETQAELELYQVAEL
>NC_021485.1|WP_000953628.1|2004009_2004855_-|patatin-family-protein
MLSVGLVLEGGGMRGLYTAGVLDAFLDAGIKVDGIISVSAGALFGVNFVSRQRERALRYNKKYLSHPKYMSLRSWLRTGNFVNKDFTYYEVPMKLDVFDDEAFKKSSIDFYAVATEMTSGKPEYFKIDSVFEQMEILRASSALPVVSKMVVWQGKKYLDGGLSDSIPVDFARGLGFDKLIVVMTRPLNYQKKPSSGRLYKTLYRKYPNFVKTASNRYQQYNNSLEKVMSLEKTGDLFAIRPSKSLVIGRLEKNPDKLDSIYQLGMKDAKSGMPELNSYLMK
>NC_021485.1|WP_000074727.1|2002719_2003967_+|MFS-transporter
MSPLNINKNNWRALIAAIVASGTDDLNIMFLAFSMSTIITDLHLSAAQAGWIGTITNLGMLVGGLIFGLLADRYNKFKVFKWTILIFSIATGLVFFTTNLSYLYIMRFIAGIGVGGEYGIAIAIMAGIVPANKMGRISSLNGIAGQVGSISSALLAGWLAPALGWRGLFLFGLLPIVLVLWMQFAIDDKDILDQYNTDADDEPLDISIKALFDTPVLATQSLALMVMTTVQIAGFFGMMNWLPTIIQTNLNVSVKNSSLWMIATILGMCLGMLVFGQLLDKFGPRLVYGCFLLSSAICVYLFQFATTMPSMIIGGAVVGFFVNGMFAGYGAMITRLYPHHIRSTANNLILNVGRAIGGFSSVIIGMILDVSNVSMVMLFLASLYIVSFLSMLSIKQLKHQKYHTNLTQLDVKPTD
>NC_021485.1|WP_000145177.1|1999841_2002343_-|leucine--tRNA-ligase
MTFYNHKEIEPKWQAFWADNHTFKTGTDASKPKFYALDMFPYPSGAGLHVGHPEGYTATDILSRFKRAQGHNVLHPMGWDAFGLPAEQYAMDTGNDPAEFTAENIANFKRQINALGFSYDWDREVNTTDPNYYKWTQWIFTKLYEKGLAYEAEVPVNWVEELGTAIANEEVLPDGTSERGGYPVVRKPMRQWMLKITAYAERLLEDLEEVDWPESIKDMQRNWIGKSTGANVTFKVKDTDKDFTVFTTRPDTLFGATYAVLAPEHALVDAITTADQAEAVAEYKRQASLKSDLARTDLAKEKTGVWTGAYAINPVNGKEIPVWIADYVLASYGTGAIMAVPAHDERDWEFAKQFKLDIIPVLEGGNVEEAAFTEDGLHINSDFLDGLDKASAIAKMVEWLEAEGVGNEKVTYRLRDWLFSRQRYWGEPIPIIHWEDGTSTAVPESELPLVLPVTKDIRPSGTGESPLANLTDWLEVTREDGVKGRRETNTMPQWAGSSWYYLRYIDPHNTEKLADEELLKQWLPVDIYVGGAEHAVLHLLYARFWHKVLYDLGVVPTKEPFQKLFNQGMILGTSYRDSRGALVATDKVEKRDGSFFHVETGEELEQAPAKMSKSLKNVVNPDDVVEQYGADTLRVYEMFMGPLDASIAWSEEGLEGSRKFLDRVYRLITTKEITKENSGALDKVYNETVKAVTEQVDQMKFNTAIAQLMVFVNAANKEDKLFSDYAKGFVQLIAPFAPHLGEELWQVLTASGESISYVPWPSYDESKLVENEIEIVVQIKGKVKAKLVVAKDLSREELQDLALANEKVQSEIAGKDIIKVIAVPNKLVNIVVK
>NC_021485.1|WP_000903269.1|1999143_1999752_+|hypothetical-protein
MLHSKKIHSLSLIAVLSLATYTSLQPNHVTAEQSQKTSTVHMSQKTIEHKLKVADKEAAPLYAKIDHIQRHIEVKKAKDLKVIELYINKDINQLEKQNKRLLTKFYTSIDNQTWDSTSEVKKLIDKTNLSTNEKNRLKLYFEQRAYLETRLNDRYQKFDNSIENQNKELKILTSKIEKIYQKHGITKEVLKTYYAKKTVRAD
>NC_021485.1|WP_000730416.1|1997662_1999051_+|HAMP-domain-containing-histidine-kinase
MKKKSLISNLILINSITLFLGFYLIYFSVNYVIKDYVHQMTRNSMQANFTILDSIYNNKKIPDENMVNQDSIFVWSYYAIFDQHYRMKYGTDNHKKESHDIIRYLTQKRLWQISKEKDGMFVTIKKKTYYVMTKDYSGILVDGSIKKVPKAQSQLFHVINFSDITYTQHLITKINHFLIVILVLTYIPMLFIMRKTFTGIRESIQSVQTYISSLWKNQGNHQSSQKEIVFSDFDPLLLESQEMANRIYQAEESQRNFFQNASHELRTPLMSIQGYTEGVQEGIIDAELAHSVILQESKKMKQLVDDIILLSKLDSNLSDQKDEFSLNELLNSIIAYFKPLANKQKISITYRPDEHEKLLKGNEELIQRAINNILSNALRYAVSHIEISYTNQKLTISNDGPAISKEDLPYIFDRFYKGHGGQTGIGLAMTKEIIKQHHGNIIAESDSTSTTFTIYFNCHKIA
>NC_021485.1|WP_000161343.1|1996979_1997666_+|response-regulator-transcription-factor
MTKIIYFADDEKNIRDLVVPFLEHDGFTVRAFETGDLLLEAYKNQKPDLVILDIMMPGTNGLDVMKSIRQYDNVPIIMLTARDSDVDFITAFNLGTDDYFTKPFSPIKLSLHVKALFKRLDEKAIKNDTQYQFLDLTLDTEKRIALLSNEEMPLTKTEFDFLLVLIEKPETAFSRETLLNRIWGFDDIESRAVDDTIKRLRKKFKQYHSQVSIKTVWGYGFKLIKEDK
>NC_021485.1|WP_001093374.1|1992031_1996747_+|S8-family-serine-peptidase
MNTKQRFSIRKYKLGAVSVLLGTLFFLGGITNVAADSVINKPSDIAVEQQVKDSPTSIANETPTNNTSSALASTAQDNLVTKANNNSPTETQPVAESHSQATETFSPAANQPVESTQEVSKTPLTKQNLAVKPTPAISKETPQNIDSNKIITVPKVWNTGYKGEGTVVAIIDSGLDTNHDALQLNDSTKAKYQNEQQMNAAKAKAGINYGKWYNNKVIFGHNYVDVNTELKEVKSTSHGMHVTSIATANPSKKDTNELIYGVAPEAQVMFMRVFSDEKRGTGPALYVKAIEDAVKLGADSINLSLGGANGSLVNADDRLIKALEMARLAGVSVVIAAGNDGTFGSGASKPSALYPDYGLIGSPSTAREAISVASYNNTTLVNKVFNIIGLENNKNLNNGLAAYADPKVSDKTFEVGKQYDYVFVGKGNDNDYKDKTLNGKIALIERGDITFTKKVVNAINHGAVGAIIFNNKAGEANLTMSLDPEASTIPAIFTQKEFGDVLAQKSYKIVFNNIKNKQANPNAGVLSDFSSWGLTADGQLKPDLSAPGGSIYAAINDNEYDMMSGTSMASPHVAGATALVKQYLLKEHPELKKGDIERTVKYLLMSTAKAHLNKDTGAYTSPRQQGAGIIDVAAAVQTGLYLTGGENNYGSVTLGNIKDKISFDVTVHNINKVAKDLHYTTYLNTDQVKDGFVTLAPQQLGTFTGKTIRIEPGQTKTITIDIDVSKYHDMLKKVMPNGYFLEGYVRFTDPVDGGEVLSIPYVGFKGEFQNLEVLEKSIYKLVANKEKGFYFQPKQTNEVPGSEDYTALMTTSSEPIYSTDGTSPIQLKALGSYKSIDGKWILQLDQKGQPHLAISPNDDQNQDAVAVKGVFLRNFNNLRAKVYRADDVNLQKPLWVSAPQAGDKNYYSGNTENPKSTFLYDTEWKGTTTDGIPLEDGKYKYVLTYYSDVPGSKPQQMVFDITLDRQAPTLTTATYDKDRRIFKARPAVEHGESDIFREQVFYLKKDKDGHYNSVLRQKGEDGILVEDNKVFIKQEKDGSFILPKEVNDFSHVYYTVEDYAGNLVSAKLEDLINIGNKNGLVNVKVFSPELNSNVDIDFSYSVKDDKGNVIKKQHHGKDLNLLKLPFGTYTFDLFLYDEERANLISPKSVTVTISEKDSLKDVLFKVNLLKKAALLVEFDKLLPKGATVQLVTKTNTVVDLPKATYSPTDYGKNIPVGDYRLNVTLPSGYSTLENLDDLLVSVKEGQVNLTKLTLINKAPLINALAEQTDIITQPVFYNAGTHLKNNYLANLEKAQTLIKNRVEQTSIDNAIAALRESRQALNGKETDTSLLAKAILAETEIKGNYQFVNASPLSQSTYINQVQLAKNLLQKPNVTQSEVDKALENLDIAKNQLNGHETDYSGLHHMIIKANVLKQTSSKYQNASQFAKENYNNLIKKAELLLSNRQATQAQVEELLNQIKATEQELDGRDRVSSAENYSQSLNDNDSLNTTPINPPNQPQALIFKKGMTKESEVAQKRVLGVTSQTDNQKVKTNKLPKTGESTPKITYTILLFSLSMLGLATIKLKSIKRE
>NC_021485.1|WP_000410672.1|1991016_1991709_-|AzlC-family-ABC-transporter-permease
MEKGFKDGVKDALPTALGYISIGLAFGIVASASDLSAIEVGLMSALVYGGSAQFAMCALLLAKADLMTITITVFLVNLRNMLMSLHATTIFKSAHLMNQLAIGTLVTDESYGVLLGEALHHKVVSPSWMHGNNVMSYLTWVISTIIGTLLGSTIPNPEMFGLDFALVAMFIGLFVFQLFGMLSDGKRLVVYVLASVGLSYFLLATFLSGALSVLLATVVGCSVGVVLDDK
>NC_021485.1|WP_000610952.1|1990703_1991027_-|AzlD-domain-containing-protein
MINSTVFLAILLGFVVSWVPRVAPFIFVKYKGLPNSLVKFLKFLPLSILFALTFSSFFSVKLGQLPTLKCLDLLAGIPTLVVTIRYRNLFYTVLTGIVTMALLRLLF
>NC_021485.1|WP_144063145.1|2007456_2008280_+|IS5-family-transposase
MNYEASKQLTDVRFKRLVGVQRTTFEEMLAVLKTAYQRKHAKGGRTPKLSLEDLLMATLQYMREYRTYEQIAADFGIHESNLIRRSQWVESTLIQSGFTISKTHLSAEDTVIVDATEVKINRPKKQLANYSGKKKCHAMKAQAIVTSQGRIVSLDIAVNYCHDMKLFKMSRRNIGQAAKILADSGYQGIMKMYSQAQTPRKSSKLKPLTLEDKTYNHTLSKERIKVENIFAKVKTFKIFSTTYRNRRKRFGLRMNLISGMINRELGFYELIQP
>NC_021485.1|WP_000497678.1|2009170_2009344_-|preprotein-translocase-subunit-SecE
MFVKGIFQVLRDTTWPNRKQRWKDFISILEYTVFFTIVIYIFDKLLAAGVMDLINRF
>NC_021485.1|WP_000057521.1|2009379_2009532_-|50S-ribosomal-protein-L33
MAQKKASLACTECGSRNYSIGVSSTPKPTRLEVNKFCKYCKKYTIHKETR
>NC_021485.1|WP_000764812.1|2009580_2011902_-|penicillin-binding-protein
MKLFDKFIDLFRVDEDNDEMTRKNEQETREETSNLDGEEVYDIDDITRPSKSQYQRGIRHQKKNAKSRPEWLQKVDRYLPSPKNPIRRFWRRYRIGKLLFIALMAFILIFGSYLFYLSKTATVSDLQSALKTTTTIYDKNKEYAGKLSGQKGTYVELNAISDHLKNAVIATEDRTFYENNGVNFKRFFLAVATLGKFGGGSTITQQLAKNAYLSQDQTIKRKAREFFLALELTKKYSKAEILTMYLNNSYFGNGVWGVEDASRKYFGTSAANLTVDEAATLAGMLKGPEVYNPYYSVENATNRRDTVLAAMVDAGKLTKSQAKEAASIGMKNRLADTYAGKINDYRYPSYFDAVVNEAIDTYGISEKDIVNNGYKIYTALDQNYQSGMQKTFDDTSLFPVSDYDGQSAQGASVALDPKTGGVRGLVGRVQSTKDAQFRSFNYATQSKRSPASTIKPLVVYSPAIASGWSIDKELPNKVQDFHGYKPSNYGGIETESIPMYQALANSYNIPAVYTLDKLGINKAFTYGRKFGLNMSSANKELGVALGGSVTTNPLEMAQAYSTFANDGIMHRAHLITRIETANGKLVKQFTDKPKRVISRSVASKMTSMMLGTFSNGTAINANVYGYTMAGKTGTTETDFNPNLSGDQWVVGYTPDVVISQWVGFKKTDKHHYLTDSSAGTASNIFSTQASYILPYTKGSSFTHIENAYFQNGIGSVYNAQDASNTTNQESRSIINDLKDSASKAAQDISRAVEDSNFQEKVKDAWNSLKDYFR
>NC_021485.1|WP_000010477.1|2011945_2012830_+|RluA-family-pseudouridine-synthase
MSFSLKIRNPYGEHTVKELLEDYFLIPRKIRHFLRVKKHVLINNEFINWQTVVQENDTITLIFDDEDYPTKKIPLGRAELIDCLYEDEHLIIVNKPEGMKTHGNQPNEIALLNHVSAYSGQTCYVVHRLDMETSGAVLFAKNPFILPLINQRLERKEIWREYWALVEGKFSPKHQVLRDKIGRNRHDRRKRIIDSKNGQHAMTIIDVLKYTQNSSLIKCRLETGRTHQIRIHLSHHGHPLIGDPLYNPSSNNERLMLHAHRLTLSHPLTCETISVEAPSSTFEKILNNYKKGVG
>NC_021485.1|WP_000459240.1|2012854_2014495_-|hypothetical-protein
MFDFFKKKVVKVCLVIFGIVLVSLLSLGFFYFSKGQVLSRFVAARSRTSGQAFDNIKEYMVWSDTGESITNDEANYANFEPLSKSEARKLGQEIKEGNKNDSMYLKRVGSRLGIFPDYRIANKPMSLTLKTNVPKLDVLLNQKKVATSNSDHFSVTVERLPRTHYTASLEGTSDGKEIKLKKDYDGKNQTIDLSVAFKSFTVTSNLMDGNLYFGDNRIAKLKDGSYSVENYPVTDGSKAYIKKVFNDGEITSHKQKLISIADNQTIKLDVDGLLNEKEAGQKLITAFNQLILYVSTGQDPQTLGTVFEKGAENDFYKGLKESIKAKFVTDNRKASHFTIPNIVLNKMTQVGKESYQVNFAADYDFNYDKSTDPDKKTYGHIIQNLTGNFIMKKSGNSYLISNDGKKDITVAKETNKVKADPVSIFPENLVGSWKGEVEDGTVTMTFDKDGKVTQKKVYKDSKSKESNHSAKVTKLEDKGNGLYLYQYESGTDTTTFVTGGIGGLKVKYAYGIKIEGNKIIPVIWQTSSDGEFDYHKPLLSKPLTKQ
>NC_021485.1|WP_000077187.1|2014664_2015876_-|phosphopentomutase
MSQFDRIHLVVLDSVGIGAAPDANDFVNAGVPDGASDTLGHISKTVGLAVPNMAKIGLGNIPRPQALKTVPAEENPSGYATKLQEVSLGKDTMTGHWEIMGLNITEPFDTFWNGFPEDIITKIEDFSGRKVIREANKPYSGTAVIDDFGPRQMETGELIIYTSADPVLQIAAHEDIIPLEELYRICEYARSITMERPALLGRIIARPYVGEPGNFTRTANRHDYAVSPFEDTVLNKLDQAGIDTYAVGKINDIFNGSGINHDMGHNKSNSHGIDTLIKTMGLSEFEKGFSFTNLVDFDALYGHRRDPHGYRDCLHEFDERLPEIISAMRDKDLLLITADHGNDPTYAGTDHTREYIPLLAYSPSFTGNGLIPVGHFADISATVADNFGVDTAMIGESFLQDLV
>NC_021485.1|WP_000453154.1|2015942_2016614_-|deoxyribose-phosphate-aldolase
MEVKDILKTVDHTLLATTATWPEIQTILDDAMAYETASACIPASYVKKAAEYVSGKLAICTVIGFPNGYSTTAAKVFECQDAIKNGADEIDMVINLTDVKNGDFDTVEEEIRQIKAACQDHILKVIVETCQLTKEELIELCGVVTRSGADFIKTSTGFSTAGATFEDVEVMAKYVGEGVKIKAAGGISSLEDAEKFIALGASRLGTSRIIKIVKNQKVEEGTY
>NC_021485.1|WP_001159688.1|2016643_2017846_-|NupC/NupG-family-nucleoside-CNT-transporter
MQFIYSIIGILLVLGIVYAISFNRKSVSLSLIGKALIVQFIIALILVRIPLGQQVVSVVSTGVTKVINCGQAGLNFVFGSLADSGAKTGFIFAIQTLGNIVFLSALVSLLYYVGILGFVVKWIGKGVGKIMKSSEVESFVAVANMFLGQTDSPILVSKYLGRMTDSEIMVVLVSGMGSMSVSILGGYIALGIPMEYLLIASTMVPIGSILIAKILLPQTEPVQKIDDIKMDNKGNNANVIDAIAEGASTGAQMAFSIGASLIAFVGLVSLINMMLSGLGIRLEQIFSYVFAPFGFLMGFDHKNILLEGNLLGSKLILNEFVSFQQLGHLIKSLDYRTALVATISLCGFANLSSLGICVSGIAVLCPEKRGTLARLVFRAMIGGIAVSMLSAFIVGIVTLF
>NC_021485.1|WP_001182060.1|2017866_2018646_-|uridine-phosphorylase
MQNYSGEVGLQYHLQIRPGDVGRYVIMPGDPKRCAKIAEHFDNAVLVADSREYVTYTGTLNGEKVSVTSTGIGGPSASIAMEELKLCGADTFIRVGTCGGIDLDVKGGDIVIATGAIRMEGTSKEYAPIEFPAVADLEVTNALVNAAKKLGYTSHAGVVQCKDAFYGQHEPERMPVSYELLNKWEAWKRLGTKASEMESAALFVAASHLGVRCGSDFLVVGNQERNALGMDNPMAHDTEAAIQVAVEALRTLIENDKSQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NC_021485_2	2.4\|2006085\|18\|NC_021485\|CRT	2006085-2006102	18	NC_021485.1	2005929-2005946	1	0.944

1. spacer 2.4|2006085|18|NC_021485|CRT matches to position: 2005929-2005946, mismatch: 1, identity: 0.944

tggcttctggtttggcct	CRISPR spacer
tggcttctggtttagcct	Protospacer
*************.****

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_021485_1	1.1\|940272\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940272-940301	30	MK448971	Streptococcus phage Javan52, complete genome	41832-41861	0	1.0
NC_021485_1	1.1\|940272\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940272-940301	30	MK448956	Streptococcus phage Javan48, complete genome	39915-39944	0	1.0
NC_021485_1	1.1\|940272\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940272-940301	30	MK448729	Streptococcus phage Javan31, complete genome	36910-36939	0	1.0
NC_021485_1	1.1\|940272\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940272-940301	30	MK448742	Streptococcus phage Javan37, complete genome	35968-35997	0	1.0
NC_021485_1	1.1\|940272\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940272-940301	30	MK448691	Streptococcus phage Javan17, complete genome	36910-36939	0	1.0
NC_021485_1	1.1\|940272\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940272-940301	30	MK448851	Streptococcus phage Javan14, complete genome	40799-40828	0	1.0
NC_021485_1	1.1\|940272\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940272-940301	30	MK448948	Streptococcus phage Javan46, complete genome	36853-36882	0	1.0
NC_021485_1	1.1\|940272\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940272-940301	30	MK448769	Streptococcus phage Javan471, complete genome	33270-33299	1	0.967
NC_021485_1	1.1\|940272\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940272-940301	30	MK448684	Streptococcus phage Javan151, complete genome	33270-33299	1	0.967
NC_021485_1	1.3\|940404\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940404-940433	30	MK448911	Streptococcus phage Javan34, complete genome	37564-37593	1	0.967
NC_021485_1	1.8\|940734\|30\|NC_021485\|CRISPRCasFinder,CRT,PILER-CR	940734-940763	30	NC_049930	Enterococcus phage vB_EfaP_Zip, complete genome	13877-13906	3	0.9
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NZ_CP020439	Streptococcus equinus strain FDAARGOS_251 plasmid unamed1 sequence	39389-39418	3	0.9
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NZ_CP020439	Streptococcus equinus strain FDAARGOS_251 plasmid unamed1 sequence	39878-39907	3	0.9
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NZ_CP020439	Streptococcus equinus strain FDAARGOS_251 plasmid unamed1 sequence	224839-224868	3	0.9
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NZ_CP020439	Streptococcus equinus strain FDAARGOS_251 plasmid unamed1 sequence	225328-225357	3	0.9
NC_021485_1	1.2\|940338\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940338-940367	30	MN692993	Marine virus AFVG_117M87, complete genome	14759-14788	4	0.867
NC_021485_1	1.2\|940338\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940338-940367	30	MG575419	Proteus phage vB_PmiP_RS8pmA, complete genome	12347-12376	5	0.833
NC_021485_1	1.3\|940404\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940404-940433	30	MT074138	Bacteroides phage DAC17, complete genome	72897-72926	5	0.833
NC_021485_1	1.3\|940404\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940404-940433	30	MT074136	Bacteroides phage DAC15, complete genome	73490-73519	5	0.833
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NC_047926	Lactobacillus phage Semele, complete genome	8764-8793	5	0.833
NC_021485_1	1.2\|940338\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940338-940367	30	HQ259105	Escherichia phage vB_EcoP_G7C, complete genome	35761-35790	6	0.8
NC_021485_1	1.2\|940338\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940338-940367	30	MN694692	Marine virus AFVG_250M385, complete genome	12561-12590	6	0.8
NC_021485_1	1.2\|940338\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940338-940367	30	NZ_CP020118	Escherichia coli strain AR_0104 plasmid unitig_6, complete sequence	49130-49159	6	0.8
NC_021485_1	1.7\|940668\|30\|NC_021485\|CRISPRCasFinder,CRT	940668-940697	30	AP014352	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S39-C33, * SEQUENCING IN PROGRESS *	25577-25606	6	0.8
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NZ_CP011358	Bacillus thuringiensis strain YC-10 plasmid pYC2226, complete sequence	78177-78206	6	0.8
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NZ_CP011358	Bacillus thuringiensis strain YC-10 plasmid pYC2226, complete sequence	78285-78314	6	0.8
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NZ_CP011358	Bacillus thuringiensis strain YC-10 plasmid pYC2226, complete sequence	78357-78386	6	0.8
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NC_018879	Bacillus thuringiensis Bt407 plasmid BTB_78p, complete sequence	37302-37331	6	0.8
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NC_018879	Bacillus thuringiensis Bt407 plasmid BTB_78p, complete sequence	37446-37475	6	0.8
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NC_018879	Bacillus thuringiensis Bt407 plasmid BTB_78p, complete sequence	37482-37511	6	0.8
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NC_018879	Bacillus thuringiensis Bt407 plasmid BTB_78p, complete sequence	37518-37547	6	0.8
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NC_018879	Bacillus thuringiensis Bt407 plasmid BTB_78p, complete sequence	37554-37583	6	0.8
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NZ_CP013057	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-2, complete sequence	77354-77383	6	0.8
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NZ_CP013057	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-2, complete sequence	77462-77491	6	0.8
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NZ_CP013057	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-2, complete sequence	77534-77563	6	0.8
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NC_020382	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-68, complete sequence	43038-43067	6	0.8
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NC_020382	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-68, complete sequence	43182-43211	6	0.8
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NC_020382	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-68, complete sequence	43218-43247	6	0.8
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NC_020382	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-68, complete sequence	43254-43283	6	0.8
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	MG603697	Vibrio phage Vp_R1, complete genome	46473-46502	6	0.8
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NZ_CP004872	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB64, complete sequence	16929-16958	6	0.8
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NC_017205	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT72, complete sequence	24291-24320	6	0.8
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NC_017205	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT72, complete sequence	24327-24356	6	0.8
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NC_017205	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT72, complete sequence	24363-24392	6	0.8
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NC_017205	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT72, complete sequence	24507-24536	6	0.8
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NZ_CP010581	Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB68, complete sequence	28831-28860	6	0.8
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NZ_CP010581	Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB68, complete sequence	29011-29040	6	0.8
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NZ_CP010581	Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB68, complete sequence	29119-29148	6	0.8
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NZ_CP015156	Bacillus thuringiensis strain Bc601 plasmid pBTBC6, complete sequence	23581-23610	6	0.8
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NZ_CP015156	Bacillus thuringiensis strain Bc601 plasmid pBTBC6, complete sequence	23653-23682	6	0.8
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NZ_CP015156	Bacillus thuringiensis strain Bc601 plasmid pBTBC6, complete sequence	23761-23790	6	0.8
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NZ_CP004869	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB67, complete sequence	54579-54608	6	0.8
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NZ_CP004869	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB67, complete sequence	54651-54680	6	0.8
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NZ_CP004869	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB67, complete sequence	54759-54788	6	0.8
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	CP020758	Bacillus thuringiensis strain ATCC 10792 plasmid pLDW-19, complete sequence	54719-54748	6	0.8
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	CP020758	Bacillus thuringiensis strain ATCC 10792 plasmid pLDW-19, complete sequence	54755-54784	6	0.8
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	CP020758	Bacillus thuringiensis strain ATCC 10792 plasmid pLDW-19, complete sequence	54791-54820	6	0.8
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	CP020758	Bacillus thuringiensis strain ATCC 10792 plasmid pLDW-19, complete sequence	54935-54964	6	0.8
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NZ_CP010093	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB71, complete sequence	16224-16253	6	0.8
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NZ_CP010093	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB71, complete sequence	16260-16289	6	0.8
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NZ_CP010093	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB71, complete sequence	16296-16325	6	0.8
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NZ_CP010093	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB71, complete sequence	16440-16469	6	0.8
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NZ_CP021065	Bacillus thuringiensis strain ATCC 10792 plasmid poh4, complete sequence	80194-80223	6	0.8
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NZ_CP021065	Bacillus thuringiensis strain ATCC 10792 plasmid poh4, complete sequence	80230-80259	6	0.8
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NZ_CP021065	Bacillus thuringiensis strain ATCC 10792 plasmid poh4, complete sequence	80266-80295	6	0.8
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NZ_CP021065	Bacillus thuringiensis strain ATCC 10792 plasmid poh4, complete sequence	80410-80439	6	0.8
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NC_018503	Bacillus thuringiensis HD-771 plasmid p07, complete sequence	5542-5571	6	0.8
NC_021485_1	1.1\|940272\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940272-940301	30	MF001361	Enterococcus phage EF5, partial genome	103178-103207	7	0.767
NC_021485_1	1.1\|940272\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940272-940301	30	MF001358	Enterococcus phage EF1, partial genome	14139-14168	7	0.767
NC_021485_1	1.1\|940272\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940272-940301	30	LN885237	Lactobacillus phage EV3 genome assembly, complete genome: monopartite	27614-27643	7	0.767
NC_021485_1	1.1\|940272\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940272-940301	30	AP014168	Uncultured Mediterranean phage uvMED isolate uvMED-GF-C61A-MedDCM-OCT-S34-C2, * SEQUENCING IN PROGRESS *	35536-35565	7	0.767
NC_021485_1	1.1\|940272\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940272-940301	30	MN693150	Marine virus AFVG_25M172, complete genome	21900-21929	7	0.767
NC_021485_1	1.1\|940272\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940272-940301	30	MN693485	Marine virus AFVG_25M173, complete genome	21901-21930	7	0.767
NC_021485_1	1.1\|940272\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940272-940301	30	AP014167	Uncultured Mediterranean phage uvMED isolate uvMED-GF-C61A-MedDCM-OCT-S26-C30, * SEQUENCING IN PROGRESS *	6396-6425	7	0.767
NC_021485_1	1.1\|940272\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940272-940301	30	MN693097	Marine virus AFVG_25M78, complete genome	39238-39267	7	0.767
NC_021485_1	1.1\|940272\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940272-940301	30	AP014165	Uncultured Mediterranean phage uvMED isolate uvMED-GF-C61-MedDCM-OCT-S33-C79, * SEQUENCING IN PROGRESS *	8281-8310	7	0.767
NC_021485_1	1.2\|940338\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940338-940367	30	NZ_LR214986	Mycoplasma cynos strain NCTC10142 plasmid 13	517179-517208	7	0.767
NC_021485_1	1.2\|940338\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940338-940367	30	MN692987	Marine virus AFVG_117M51, complete genome	20101-20130	7	0.767
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NZ_CP020748	Bacillus mycoides strain Gnyt1 plasmid unnamed5, complete sequence	15344-15373	7	0.767
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NZ_CP020748	Bacillus mycoides strain Gnyt1 plasmid unnamed5, complete sequence	15404-15433	7	0.767
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NZ_CP020748	Bacillus mycoides strain Gnyt1 plasmid unnamed5, complete sequence	15548-15577	7	0.767
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NZ_CP020748	Bacillus mycoides strain Gnyt1 plasmid unnamed5, complete sequence	15656-15685	7	0.767
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NZ_CP011358	Bacillus thuringiensis strain YC-10 plasmid pYC2226, complete sequence	78465-78494	7	0.767
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NC_018879	Bacillus thuringiensis Bt407 plasmid BTB_78p, complete sequence	37590-37619	7	0.767
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NZ_CP013057	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-2, complete sequence	77642-77671	7	0.767
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NZ_CP009317	Bacillus cereus 03BB102 plasmid unnamed, complete sequence	83884-83913	7	0.767
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NC_020382	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-68, complete sequence	43290-43319	7	0.767
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NC_017205	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT72, complete sequence	24255-24284	7	0.767
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NZ_CP016317	Bacillus cereus strain M3 plasmid pBCM301, complete sequence	143792-143821	7	0.767
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NZ_CP015156	Bacillus thuringiensis strain Bc601 plasmid pBTBC6, complete sequence	23473-23502	7	0.767
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NZ_CP004869	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB67, complete sequence	54471-54500	7	0.767
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NC_011777	Bacillus cereus AH820 plasmid pAH820_272, complete sequence	68912-68941	7	0.767
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NC_017726	Bacillus anthracis str. H9401 plasmid BAP1, complete sequence	68414-68443	7	0.767
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	CP020758	Bacillus thuringiensis strain ATCC 10792 plasmid pLDW-19, complete sequence	54683-54712	7	0.767
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NZ_CP010093	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB71, complete sequence	16188-16217	7	0.767
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NZ_CP021065	Bacillus thuringiensis strain ATCC 10792 plasmid poh4, complete sequence	80158-80187	7	0.767
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NC_012473	Bacillus cereus 03BB102 plasmid p03BB102_179, complete sequence	53010-53039	7	0.767
NC_021485_2	2.5\|2006121\|30\|NC_021485\|CRT	2006121-2006150	30	NC_048797	Bacillus phage vB_BmeM-Goe8, complete genome	33780-33809	7	0.767
NC_021485_1	1.1\|940272\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940272-940301	30	NZ_CP019919	Borreliella burgdorferi strain PAbe plasmid p_cp32-2, complete sequence	4381-4410	8	0.733
NC_021485_1	1.1\|940272\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940272-940301	30	NZ_CP019921	Borreliella burgdorferi strain PAbe plasmid p_cp32-9-4, complete sequence	4386-4415	8	0.733
NC_021485_1	1.1\|940272\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940272-940301	30	NZ_CP019921	Borreliella burgdorferi strain PAbe plasmid p_cp32-9-4, complete sequence	35038-35067	8	0.733
NC_021485_1	1.1\|940272\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940272-940301	30	NZ_CP019926	Borreliella burgdorferi strain PAbe plasmid p_lp56, complete sequence	7844-7873	8	0.733
NC_021485_1	1.1\|940272\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940272-940301	30	NC_019006	Borrelia burgdorferi 297 plasmid 297_cp32-3, complete sequence	4384-4413	8	0.733
NC_021485_1	1.1\|940272\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940272-940301	30	NC_017428	Borreliella burgdorferi JD1 plasmid JD1 cp32-10, complete sequence	4381-4410	8	0.733
NC_021485_1	1.1\|940272\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940272-940301	30	NC_017393	Borreliella burgdorferi JD1 plasmid JD1 cp32-11, complete sequence	4381-4410	8	0.733
NC_021485_1	1.1\|940272\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940272-940301	30	NC_017394	Borreliella burgdorferi JD1 plasmid JD1 cp32-1+5, complete sequence	4354-4383	8	0.733
NC_021485_1	1.1\|940272\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940272-940301	30	NC_017394	Borreliella burgdorferi JD1 plasmid JD1 cp32-1+5, complete sequence	35020-35049	8	0.733
NC_021485_1	1.1\|940272\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940272-940301	30	NZ_CP031406	Borreliella burgdorferi strain MM1 plasmid plsm_cp32-9, complete sequence	4311-4340	8	0.733
NC_021485_1	1.1\|940272\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940272-940301	30	NZ_CP028099	Synechocystis sp. IPPAS B-1465 plasmid pSYSM, complete sequence	6356-6385	8	0.733
NC_021485_1	1.1\|940272\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940272-940301	30	NC_005229	Synechocystis sp. PCC 6803 plasmid pSYSM, complete sequence	6356-6385	8	0.733
NC_021485_1	1.1\|940272\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940272-940301	30	NC_011722	Borreliella burgdorferi ZS7 plasmid ZS7_cp32-9, complete sequence	4387-4416	8	0.733
NC_021485_1	1.1\|940272\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940272-940301	30	NC_000951	Borreliella burgdorferi B31 plasmid cp32-6, complete sequence	4381-4410	8	0.733
NC_021485_1	1.1\|940272\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940272-940301	30	NC_000954	Borreliella burgdorferi B31 plasmid cp32-9, complete sequence	4386-4415	8	0.733
NC_021485_1	1.1\|940272\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940272-940301	30	NC_000956	Borreliella burgdorferi B31 plasmid lp56, complete sequence	7844-7873	8	0.733
NC_021485_1	1.1\|940272\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940272-940301	30	NZ_CP031268	Staphylococcus warneri strain 16A plasmid unnamed2	30021-30050	8	0.733
NC_021485_1	1.1\|940272\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940272-940301	30	NZ_CP031268	Staphylococcus warneri strain 16A plasmid unnamed2	65418-65447	8	0.733
NC_021485_1	1.1\|940272\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940272-940301	30	NZ_CP015799	Borrelia mayonii strain MN14-1539 plasmid cp32-13, complete sequence	3011-3040	8	0.733
NC_021485_1	1.1\|940272\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940272-940301	30	NZ_CP015800	Borrelia mayonii strain MN14-1539 plasmid cp32-3, complete sequence	4384-4413	8	0.733
NC_021485_1	1.1\|940272\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940272-940301	30	NZ_CP019848	Borreliella burgdorferi plasmid cp32-4, complete sequence	4384-4413	8	0.733
NC_021485_1	1.1\|940272\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940272-940301	30	NZ_CP019850	Borreliella burgdorferi plasmid cp32-9, complete sequence	4386-4415	8	0.733
NC_021485_1	1.1\|940272\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940272-940301	30	NZ_CP019855	Borreliella burgdorferi plasmid lp56, complete sequence	7844-7873	8	0.733
NC_021485_1	1.1\|940272\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940272-940301	30	NZ_CP019757	Borreliella burgdorferi strain B31_NRZ isolate B31 plasmid p_cp32-2, complete sequence	4381-4410	8	0.733
NC_021485_1	1.1\|940272\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940272-940301	30	NZ_CP019759	Borreliella burgdorferi strain B31_NRZ isolate B31 plasmid p_cp32-4, complete sequence	4384-4413	8	0.733
NC_021485_1	1.1\|940272\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940272-940301	30	NZ_CP019760	Borreliella burgdorferi strain B31_NRZ isolate B31 plasmid p_cp32-9, complete sequence	4386-4415	8	0.733
NC_021485_1	1.1\|940272\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940272-940301	30	NZ_CP019766	Borreliella burgdorferi strain B31_NRZ isolate B31 plasmid p_lp56, complete sequence	7824-7853	8	0.733
NC_021485_1	1.1\|940272\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940272-940301	30	NZ_CP017203	Borreliella burgdorferi strain B331 plasmid B331_cp32_1, complete sequence	4381-4410	8	0.733
NC_021485_1	1.1\|940272\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940272-940301	30	NZ_CP017205	Borreliella burgdorferi strain B331 plasmid B331_cp32_11, complete sequence	4384-4413	8	0.733
NC_021485_1	1.1\|940272\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940272-940301	30	NZ_CP017206	Borreliella burgdorferi strain B331 plasmid B331_cp32_4, complete sequence	4379-4408	8	0.733
NC_021485_1	1.1\|940272\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940272-940301	30	NZ_CP017208	Borreliella burgdorferi strain B331 plasmid B331_cp32_6, complete sequence	4383-4412	8	0.733
NC_021485_1	1.1\|940272\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940272-940301	30	NZ_CP017209	Borreliella burgdorferi strain B331 plasmid B331_cp32_7, complete sequence	4387-4416	8	0.733
NC_021485_1	1.1\|940272\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940272-940301	30	NZ_CP015784	Borrelia mayonii strain MN14-1420 plasmid cp32-3, complete sequence	4384-4413	8	0.733
NC_021485_1	1.1\|940272\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940272-940301	30	NZ_CP051646	Staphylococcus caprae strain SY333 plasmid pSY333-7, complete sequence	1620-1649	8	0.733
NC_021485_1	1.1\|940272\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940272-940301	30	NZ_LR735436	Staphylococcus epidermidis strain none isolate Se_BPH0736 plasmid 3	13737-13766	8	0.733
NC_021485_1	1.2\|940338\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940338-940367	30	MN693222	Marine virus AFVG_25M67, complete genome	28877-28906	8	0.733
NC_021485_1	1.2\|940338\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940338-940367	30	MN693638	Marine virus AFVG_250M154, complete genome	10512-10541	8	0.733
NC_021485_1	1.2\|940338\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940338-940367	30	NZ_CP020456	Vibrio coralliilyticus strain SNUTY-1 plasmid pSNUTY2, complete sequence	53311-53340	8	0.733
NC_021485_1	1.2\|940338\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940338-940367	30	MN694591	Marine virus AFVG_250M155, complete genome	26122-26151	8	0.733
NC_021485_2	2.2\|2005989\|30\|NC_021485\|CRT	2005989-2006018	30	MN855875	Bacteriophage sp. isolate 328, complete genome	1404-1433	8	0.733
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NZ_CP020748	Bacillus mycoides strain Gnyt1 plasmid unnamed5, complete sequence	15776-15805	8	0.733
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NZ_CP013715	Staphylococcus equorum strain C2014 plasmid pC2014-1, complete sequence	54375-54404	8	0.733
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NZ_CP021813	Sinorhizobium meliloti strain M270 plasmid psymA, complete sequence	1320469-1320498	8	0.733
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NC_017327	Sinorhizobium meliloti SM11 plasmid pSmeSM11c, complete sequence	658938-658967	8	0.733
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NZ_CP009145	Sinorhizobium meliloti strain RMO17 plasmid pSymA, complete sequence	672799-672828	8	0.733
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NZ_CP021801	Sinorhizobium meliloti strain USDA1021 plasmid psymA, complete sequence	598028-598057	8	0.733
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NZ_CP021819	Sinorhizobium meliloti strain M162 plasmid psymA, complete sequence	498887-498916	8	0.733
NC_021485_2	2.3\|2006037\|30\|NC_021485\|CRT	2006037-2006066	30	NZ_CP021217	Sinorhizobium meliloti RU11/001 plasmid pSymA, complete sequence	241950-241979	8	0.733
NC_021485_1	1.1\|940272\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940272-940301	30	NZ_CP017204	Borreliella burgdorferi strain B331 plasmid B331_cp32_10, complete sequence	4385-4414	9	0.7
NC_021485_1	1.1\|940272\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940272-940301	30	MK765570	Tortoise microvirus 20 isolate 20_SP_90, complete genome	1396-1425	9	0.7
NC_021485_1	1.1\|940272\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940272-940301	30	NZ_CP028880	Borreliella bavariensis PBi plasmid cp32-5, complete sequence	22667-22696	9	0.7
NC_021485_1	1.3\|940404\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940404-940433	30	KM236245	Bacillus phage Mater, complete genome	119964-119993	9	0.7
NC_021485_1	1.4\|940470\|30\|NC_021485\|PILER-CR,CRISPRCasFinder,CRT	940470-940499	30	NZ_CP040335	Bacillus cereus strain DLOU-Changhai plasmid unnamed1, complete sequence	31536-31565	9	0.7
NC_021485_2	2.5\|2006121\|30\|NC_021485\|CRT	2006121-2006150	30	NC_011759	Yersinia pseudotuberculosis pGDT4 plasmid	35429-35458	9	0.7

1. spacer 1.1|940272|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to MK448971 (Streptococcus phage Javan52, complete genome) position: , mismatch: 0, identity: 1.0

cttttgtccatctttttgaatttttgcaaa	CRISPR spacer
cttttgtccatctttttgaatttttgcaaa	Protospacer
******************************

2. spacer 1.1|940272|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to MK448956 (Streptococcus phage Javan48, complete genome) position: , mismatch: 0, identity: 1.0

cttttgtccatctttttgaatttttgcaaa	CRISPR spacer
cttttgtccatctttttgaatttttgcaaa	Protospacer
******************************

3. spacer 1.1|940272|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to MK448729 (Streptococcus phage Javan31, complete genome) position: , mismatch: 0, identity: 1.0

cttttgtccatctttttgaatttttgcaaa	CRISPR spacer
cttttgtccatctttttgaatttttgcaaa	Protospacer
******************************

4. spacer 1.1|940272|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to MK448742 (Streptococcus phage Javan37, complete genome) position: , mismatch: 0, identity: 1.0

cttttgtccatctttttgaatttttgcaaa	CRISPR spacer
cttttgtccatctttttgaatttttgcaaa	Protospacer
******************************

5. spacer 1.1|940272|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to MK448691 (Streptococcus phage Javan17, complete genome) position: , mismatch: 0, identity: 1.0

cttttgtccatctttttgaatttttgcaaa	CRISPR spacer
cttttgtccatctttttgaatttttgcaaa	Protospacer
******************************

6. spacer 1.1|940272|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to MK448851 (Streptococcus phage Javan14, complete genome) position: , mismatch: 0, identity: 1.0

cttttgtccatctttttgaatttttgcaaa	CRISPR spacer
cttttgtccatctttttgaatttttgcaaa	Protospacer
******************************

7. spacer 1.1|940272|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to MK448948 (Streptococcus phage Javan46, complete genome) position: , mismatch: 0, identity: 1.0

cttttgtccatctttttgaatttttgcaaa	CRISPR spacer
cttttgtccatctttttgaatttttgcaaa	Protospacer
******************************

8. spacer 1.1|940272|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to MK448769 (Streptococcus phage Javan471, complete genome) position: , mismatch: 1, identity: 0.967

cttttgtccatctttttgaatttttgcaaa	CRISPR spacer
cttttgtccctctttttgaatttttgcaaa	Protospacer
********* ********************

9. spacer 1.1|940272|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to MK448684 (Streptococcus phage Javan151, complete genome) position: , mismatch: 1, identity: 0.967

cttttgtccatctttttgaatttttgcaaa	CRISPR spacer
cttttgtccctctttttgaatttttgcaaa	Protospacer
********* ********************

10. spacer 1.3|940404|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to MK448911 (Streptococcus phage Javan34, complete genome) position: , mismatch: 1, identity: 0.967

tatgtcttctaacagttgcttcttgtgctt	CRISPR spacer
tatgtcttctaacagttgcttcttgtactt	Protospacer
**************************.***

11. spacer 1.8|940734|30|NC_021485|CRISPRCasFinder,CRT,PILER-CR matches to NC_049930 (Enterococcus phage vB_EfaP_Zip, complete genome) position: , mismatch: 3, identity: 0.9

atatgttccactctatgaatttaggctcat	CRISPR spacer
aaatgttccaccctatgaatttagggtcat	Protospacer
* *********.************* ****

12. spacer 2.3|2006037|30|NC_021485|CRT matches to NZ_CP020439 (Streptococcus equinus strain FDAARGOS_251 plasmid unamed1 sequence) position: , mismatch: 3, identity: 0.9

taacttctggcttagcctctggtttggctt	CRISPR spacer
taacttctggcttagcctctgccttggctg	Protospacer
********************* .******

13. spacer 2.3|2006037|30|NC_021485|CRT matches to NZ_CP020439 (Streptococcus equinus strain FDAARGOS_251 plasmid unamed1 sequence) position: , mismatch: 3, identity: 0.9

taacttctggcttagcctctggtttggctt	CRISPR spacer
taacttctggcttagcctctgccttggctg	Protospacer
********************* .******

14. spacer 2.3|2006037|30|NC_021485|CRT matches to NZ_CP020439 (Streptococcus equinus strain FDAARGOS_251 plasmid unamed1 sequence) position: , mismatch: 3, identity: 0.9

taacttctggcttagcctctggtttggctt	CRISPR spacer
taacttctggcttagcctctgccttggctg	Protospacer
********************* .******

15. spacer 2.3|2006037|30|NC_021485|CRT matches to NZ_CP020439 (Streptococcus equinus strain FDAARGOS_251 plasmid unamed1 sequence) position: , mismatch: 3, identity: 0.9

taacttctggcttagcctctggtttggctt	CRISPR spacer
taacttctggcttagcctctgccttggctg	Protospacer
********************* .******

16. spacer 1.2|940338|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to MN692993 (Marine virus AFVG_117M87, complete genome) position: , mismatch: 4, identity: 0.867

aacattagccttttctaactcttcagctgt	CRISPR spacer
agccttagcatttgctaactcttcagctgt	Protospacer
*.* ***** *** ****************

17. spacer 1.2|940338|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to MG575419 (Proteus phage vB_PmiP_RS8pmA, complete genome) position: , mismatch: 5, identity: 0.833

aacattagccttttctaact---cttcagctgt	CRISPR spacer
aaccttagccttttctaactcaactccagc---	Protospacer
*** ****************   **.****

18. spacer 1.3|940404|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to MT074138 (Bacteroides phage DAC17, complete genome) position: , mismatch: 5, identity: 0.833

tatgtcttctaacagttgcttctt-gtgctt	CRISPR spacer
tatagcttctaacagttgcttcttagtgaa-	Protospacer
***. ******************* ***

19. spacer 1.3|940404|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to MT074136 (Bacteroides phage DAC15, complete genome) position: , mismatch: 5, identity: 0.833

tatgtcttctaacagttgcttctt-gtgctt	CRISPR spacer
tatagcttctaacagttgcttcttagtgaa-	Protospacer
***. ******************* ***

20. spacer 2.3|2006037|30|NC_021485|CRT matches to NC_047926 (Lactobacillus phage Semele, complete genome) position: , mismatch: 5, identity: 0.833

taacttctggcttagcctctggtttggctt	CRISPR spacer
gaacttctggcttagcttctggttcagttt	Protospacer
 ***************.*******..*.**

21. spacer 1.2|940338|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to HQ259105 (Escherichia phage vB_EcoP_G7C, complete genome) position: , mismatch: 6, identity: 0.8

aacattagccttttctaactcttcagctgt	CRISPR spacer
gcctttagcgttttctaactcttcagcttc	Protospacer
. * ***** ****************** .

22. spacer 1.2|940338|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to MN694692 (Marine virus AFVG_250M385, complete genome) position: , mismatch: 6, identity: 0.8

aacattagccttttctaactcttcagctgt	CRISPR spacer
atcattggccttatctaactcttcagcctg	Protospacer
* ****.***** **************.

23. spacer 1.2|940338|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP020118 (Escherichia coli strain AR_0104 plasmid unitig_6, complete sequence) position: , mismatch: 6, identity: 0.8

aacattagccttttctaactcttcagctgt	CRISPR spacer
aggcgtagccctttcgaactcttcagctgt	Protospacer
*.   *****.**** **************

24. spacer 1.7|940668|30|NC_021485|CRISPRCasFinder,CRT matches to AP014352 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S39-C33, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.8

caaattacagtttcgactgattatggaaat	CRISPR spacer
ccaagaccagtttcaactgattatgcaaat	Protospacer
* **   *******.********** ****

25. spacer 2.3|2006037|30|NC_021485|CRT matches to NZ_CP011358 (Bacillus thuringiensis strain YC-10 plasmid pYC2226, complete sequence) position: , mismatch: 6, identity: 0.8

taacttctggcttagcctctggtttggctt	CRISPR spacer
tcacttctggcttagtctcaggtttttcct	Protospacer
* *************.*** *****  *.*

26. spacer 2.3|2006037|30|NC_021485|CRT matches to NZ_CP011358 (Bacillus thuringiensis strain YC-10 plasmid pYC2226, complete sequence) position: , mismatch: 6, identity: 0.8

taacttctggcttagcctctggtttggctt	CRISPR spacer
tcacttctggcttagtctcaggtttttcct	Protospacer
* *************.*** *****  *.*

27. spacer 2.3|2006037|30|NC_021485|CRT matches to NZ_CP011358 (Bacillus thuringiensis strain YC-10 plasmid pYC2226, complete sequence) position: , mismatch: 6, identity: 0.8

taacttctggcttagcctctggtttggctt	CRISPR spacer
tcacttctggcttagtctcaggtttttcct	Protospacer
* *************.*** *****  *.*

28. spacer 2.3|2006037|30|NC_021485|CRT matches to NC_018879 (Bacillus thuringiensis Bt407 plasmid BTB_78p, complete sequence) position: , mismatch: 6, identity: 0.8

taacttctggcttagcctctggtttggctt	CRISPR spacer
ttacttctggcttagtctcaggtttttcct	Protospacer
* *************.*** *****  *.*

29. spacer 2.3|2006037|30|NC_021485|CRT matches to NC_018879 (Bacillus thuringiensis Bt407 plasmid BTB_78p, complete sequence) position: , mismatch: 6, identity: 0.8

taacttctggcttagcctctggtttggctt	CRISPR spacer
tcacttctggcttagtctcaggtttttcct	Protospacer
* *************.*** *****  *.*

30. spacer 2.3|2006037|30|NC_021485|CRT matches to NC_018879 (Bacillus thuringiensis Bt407 plasmid BTB_78p, complete sequence) position: , mismatch: 6, identity: 0.8

taacttctggcttagcctctggtttggctt	CRISPR spacer
tcacttctggcttagtctcaggtttttcct	Protospacer
* *************.*** *****  *.*

31. spacer 2.3|2006037|30|NC_021485|CRT matches to NC_018879 (Bacillus thuringiensis Bt407 plasmid BTB_78p, complete sequence) position: , mismatch: 6, identity: 0.8

taacttctggcttagcctctggtttggctt	CRISPR spacer
tcacttctggcttagtctcaggtttttcct	Protospacer
* *************.*** *****  *.*

32. spacer 2.3|2006037|30|NC_021485|CRT matches to NC_018879 (Bacillus thuringiensis Bt407 plasmid BTB_78p, complete sequence) position: , mismatch: 6, identity: 0.8

taacttctggcttagcctctggtttggctt	CRISPR spacer
tcacttctggcttagtctcaggtttttcct	Protospacer
* *************.*** *****  *.*

33. spacer 2.3|2006037|30|NC_021485|CRT matches to NZ_CP013057 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-2, complete sequence) position: , mismatch: 6, identity: 0.8

taacttctggcttagcctctggtttggctt	CRISPR spacer
tcacttctggcttagtctcaggtttttcct	Protospacer
* *************.*** *****  *.*

34. spacer 2.3|2006037|30|NC_021485|CRT matches to NZ_CP013057 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-2, complete sequence) position: , mismatch: 6, identity: 0.8

taacttctggcttagcctctggtttggctt	CRISPR spacer
tcacttctggcttagtctcaggtttttcct	Protospacer
* *************.*** *****  *.*

35. spacer 2.3|2006037|30|NC_021485|CRT matches to NZ_CP013057 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-2, complete sequence) position: , mismatch: 6, identity: 0.8

taacttctggcttagcctctggtttggctt	CRISPR spacer
tcacttctggcttagtctcaggtttttcct	Protospacer
* *************.*** *****  *.*

36. spacer 2.3|2006037|30|NC_021485|CRT matches to NC_020382 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-68, complete sequence) position: , mismatch: 6, identity: 0.8

taacttctggcttagcctctggtttggctt	CRISPR spacer
ttacttctggcttagtctcaggtttttcct	Protospacer
* *************.*** *****  *.*

37. spacer 2.3|2006037|30|NC_021485|CRT matches to NC_020382 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-68, complete sequence) position: , mismatch: 6, identity: 0.8

taacttctggcttagcctctggtttggctt	CRISPR spacer
tcacttctggcttagtctcaggtttttcct	Protospacer
* *************.*** *****  *.*

38. spacer 2.3|2006037|30|NC_021485|CRT matches to NC_020382 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-68, complete sequence) position: , mismatch: 6, identity: 0.8

taacttctggcttagcctctggtttggctt	CRISPR spacer
tcacttctggcttagtctcaggtttttcct	Protospacer
* *************.*** *****  *.*

39. spacer 2.3|2006037|30|NC_021485|CRT matches to NC_020382 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-68, complete sequence) position: , mismatch: 6, identity: 0.8

taacttctggcttagcctctggtttggctt	CRISPR spacer
tcacttctggcttagtctcaggtttttcct	Protospacer
* *************.*** *****  *.*

40. spacer 2.3|2006037|30|NC_021485|CRT matches to MG603697 (Vibrio phage Vp_R1, complete genome) position: , mismatch: 6, identity: 0.8

taacttctggcttagcctctggtttggctt	CRISPR spacer
taggttctggcttaggctctggtttcacct	Protospacer
**. *********** ********* .*.*

41. spacer 2.3|2006037|30|NC_021485|CRT matches to NZ_CP004872 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB64, complete sequence) position: , mismatch: 6, identity: 0.8

taacttctggcttagcctctggtttggctt	CRISPR spacer
tcacctctggcttagcctcaggtttttcct	Protospacer
* **.************** *****  *.*

42. spacer 2.3|2006037|30|NC_021485|CRT matches to NC_017205 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT72, complete sequence) position: , mismatch: 6, identity: 0.8

taacttctggcttagcctctggtttggctt	CRISPR spacer
tcacttctggcttagtctcaggtttttcct	Protospacer
* *************.*** *****  *.*

43. spacer 2.3|2006037|30|NC_021485|CRT matches to NC_017205 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT72, complete sequence) position: , mismatch: 6, identity: 0.8

taacttctggcttagcctctggtttggctt	CRISPR spacer
tcacttctggcttagtctcaggtttttcct	Protospacer
* *************.*** *****  *.*

44. spacer 2.3|2006037|30|NC_021485|CRT matches to NC_017205 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT72, complete sequence) position: , mismatch: 6, identity: 0.8

taacttctggcttagcctctggtttggctt	CRISPR spacer
tcacttctggcttagtctcaggtttttcct	Protospacer
* *************.*** *****  *.*

45. spacer 2.3|2006037|30|NC_021485|CRT matches to NC_017205 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT72, complete sequence) position: , mismatch: 6, identity: 0.8

taacttctggcttagcctctggtttggctt	CRISPR spacer
ttacttctggcttagtctcaggtttttcct	Protospacer
* *************.*** *****  *.*

46. spacer 2.3|2006037|30|NC_021485|CRT matches to NZ_CP010581 (Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB68, complete sequence) position: , mismatch: 6, identity: 0.8

taacttctggcttagcctctggtttggctt	CRISPR spacer
tcacttctggcttagtctcaggtttttcct	Protospacer
* *************.*** *****  *.*

47. spacer 2.3|2006037|30|NC_021485|CRT matches to NZ_CP010581 (Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB68, complete sequence) position: , mismatch: 6, identity: 0.8

taacttctggcttagcctctggtttggctt	CRISPR spacer
tcacttctggcttagtctcaggtttttcct	Protospacer
* *************.*** *****  *.*

48. spacer 2.3|2006037|30|NC_021485|CRT matches to NZ_CP010581 (Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB68, complete sequence) position: , mismatch: 6, identity: 0.8

taacttctggcttagcctctggtttggctt	CRISPR spacer
tcacttctggcttagtctcaggtttttcct	Protospacer
* *************.*** *****  *.*

49. spacer 2.3|2006037|30|NC_021485|CRT matches to NZ_CP015156 (Bacillus thuringiensis strain Bc601 plasmid pBTBC6, complete sequence) position: , mismatch: 6, identity: 0.8

taacttctggcttagcctctggtttggctt	CRISPR spacer
tcacttctggcttagtctcaggtttttcct	Protospacer
* *************.*** *****  *.*

50. spacer 2.3|2006037|30|NC_021485|CRT matches to NZ_CP015156 (Bacillus thuringiensis strain Bc601 plasmid pBTBC6, complete sequence) position: , mismatch: 6, identity: 0.8

taacttctggcttagcctctggtttggctt	CRISPR spacer
tcacttctggcttagtctcaggtttttcct	Protospacer
* *************.*** *****  *.*

51. spacer 2.3|2006037|30|NC_021485|CRT matches to NZ_CP015156 (Bacillus thuringiensis strain Bc601 plasmid pBTBC6, complete sequence) position: , mismatch: 6, identity: 0.8

taacttctggcttagcctctggtttggctt	CRISPR spacer
tcacttctggcttagtctcaggtttttcct	Protospacer
* *************.*** *****  *.*

52. spacer 2.3|2006037|30|NC_021485|CRT matches to NZ_CP004869 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB67, complete sequence) position: , mismatch: 6, identity: 0.8

taacttctggcttagcctctggtttggctt	CRISPR spacer
tcacttctggcttagtctcaggtttttcct	Protospacer
* *************.*** *****  *.*

53. spacer 2.3|2006037|30|NC_021485|CRT matches to NZ_CP004869 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB67, complete sequence) position: , mismatch: 6, identity: 0.8

taacttctggcttagcctctggtttggctt	CRISPR spacer
tcacttctggcttagtctcaggtttttcct	Protospacer
* *************.*** *****  *.*

54. spacer 2.3|2006037|30|NC_021485|CRT matches to NZ_CP004869 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB67, complete sequence) position: , mismatch: 6, identity: 0.8

taacttctggcttagcctctggtttggctt	CRISPR spacer
tcacttctggcttagtctcaggtttttcct	Protospacer
* *************.*** *****  *.*

55. spacer 2.3|2006037|30|NC_021485|CRT matches to CP020758 (Bacillus thuringiensis strain ATCC 10792 plasmid pLDW-19, complete sequence) position: , mismatch: 6, identity: 0.8

taacttctggcttagcctctggtttggctt	CRISPR spacer
tcacttctggcttagtctcaggtttttcct	Protospacer
* *************.*** *****  *.*

56. spacer 2.3|2006037|30|NC_021485|CRT matches to CP020758 (Bacillus thuringiensis strain ATCC 10792 plasmid pLDW-19, complete sequence) position: , mismatch: 6, identity: 0.8

taacttctggcttagcctctggtttggctt	CRISPR spacer
tcacttctggcttagtctcaggtttttcct	Protospacer
* *************.*** *****  *.*

57. spacer 2.3|2006037|30|NC_021485|CRT matches to CP020758 (Bacillus thuringiensis strain ATCC 10792 plasmid pLDW-19, complete sequence) position: , mismatch: 6, identity: 0.8

taacttctggcttagcctctggtttggctt	CRISPR spacer
tcacttctggcttagtctcaggtttttcct	Protospacer
* *************.*** *****  *.*

58. spacer 2.3|2006037|30|NC_021485|CRT matches to CP020758 (Bacillus thuringiensis strain ATCC 10792 plasmid pLDW-19, complete sequence) position: , mismatch: 6, identity: 0.8

taacttctggcttagcctctggtttggctt	CRISPR spacer
ttacttctggcttagtctcaggtttttcct	Protospacer
* *************.*** *****  *.*

59. spacer 2.3|2006037|30|NC_021485|CRT matches to NZ_CP010093 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB71, complete sequence) position: , mismatch: 6, identity: 0.8

taacttctggcttagcctctggtttggctt	CRISPR spacer
tcacttctggcttagtctcaggtttttcct	Protospacer
* *************.*** *****  *.*

60. spacer 2.3|2006037|30|NC_021485|CRT matches to NZ_CP010093 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB71, complete sequence) position: , mismatch: 6, identity: 0.8

taacttctggcttagcctctggtttggctt	CRISPR spacer
tcacttctggcttagtctcaggtttttcct	Protospacer
* *************.*** *****  *.*

61. spacer 2.3|2006037|30|NC_021485|CRT matches to NZ_CP010093 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB71, complete sequence) position: , mismatch: 6, identity: 0.8

taacttctggcttagcctctggtttggctt	CRISPR spacer
tcacttctggcttagtctcaggtttttcct	Protospacer
* *************.*** *****  *.*

62. spacer 2.3|2006037|30|NC_021485|CRT matches to NZ_CP010093 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB71, complete sequence) position: , mismatch: 6, identity: 0.8

taacttctggcttagcctctggtttggctt	CRISPR spacer
ttacttctggcttagtctcaggtttttcct	Protospacer
* *************.*** *****  *.*

63. spacer 2.3|2006037|30|NC_021485|CRT matches to NZ_CP021065 (Bacillus thuringiensis strain ATCC 10792 plasmid poh4, complete sequence) position: , mismatch: 6, identity: 0.8

taacttctggcttagcctctggtttggctt	CRISPR spacer
tcacttctggcttagtctcaggtttttcct	Protospacer
* *************.*** *****  *.*

64. spacer 2.3|2006037|30|NC_021485|CRT matches to NZ_CP021065 (Bacillus thuringiensis strain ATCC 10792 plasmid poh4, complete sequence) position: , mismatch: 6, identity: 0.8

taacttctggcttagcctctggtttggctt	CRISPR spacer
tcacttctggcttagtctcaggtttttcct	Protospacer
* *************.*** *****  *.*

65. spacer 2.3|2006037|30|NC_021485|CRT matches to NZ_CP021065 (Bacillus thuringiensis strain ATCC 10792 plasmid poh4, complete sequence) position: , mismatch: 6, identity: 0.8

taacttctggcttagcctctggtttggctt	CRISPR spacer
tcacttctggcttagtctcaggtttttcct	Protospacer
* *************.*** *****  *.*

66. spacer 2.3|2006037|30|NC_021485|CRT matches to NZ_CP021065 (Bacillus thuringiensis strain ATCC 10792 plasmid poh4, complete sequence) position: , mismatch: 6, identity: 0.8

taacttctggcttagcctctggtttggctt	CRISPR spacer
ttacttctggcttagtctcaggtttttcct	Protospacer
* *************.*** *****  *.*

67. spacer 2.3|2006037|30|NC_021485|CRT matches to NC_018503 (Bacillus thuringiensis HD-771 plasmid p07, complete sequence) position: , mismatch: 6, identity: 0.8

taacttctggcttagcctctggtttggctt	CRISPR spacer
tagtttctggcttagtctctggtttagtct	Protospacer
**..***********.*********.*..*

68. spacer 1.1|940272|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to MF001361 (Enterococcus phage EF5, partial genome) position: , mismatch: 7, identity: 0.767

cttttgtccatctttttgaatttttgcaaa	CRISPR spacer
agtctgtccatctttttgaatttctgctgc	Protospacer
  *.*******************.*** .

69. spacer 1.1|940272|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to MF001358 (Enterococcus phage EF1, partial genome) position: , mismatch: 7, identity: 0.767

cttttgtccatctttttgaatttttgcaaa	CRISPR spacer
agtctgtccatctttttgaatttctgctgc	Protospacer
  *.*******************.*** .

70. spacer 1.1|940272|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to LN885237 (Lactobacillus phage EV3 genome assembly, complete genome: monopartite) position: , mismatch: 7, identity: 0.767

cttttgtccatctttttgaatttttgcaaa	CRISPR spacer
attgtcataatctttttgaatttttggaaa	Protospacer
 ** *  . ***************** ***

71. spacer 1.1|940272|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to AP014168 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-C61A-MedDCM-OCT-S34-C2, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 7, identity: 0.767

cttttgtccatctttttgaatttttgcaaa	CRISPR spacer
tattagcccatctttttgaatttttaaaac	Protospacer
. ** *.******************. **

72. spacer 1.1|940272|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to MN693150 (Marine virus AFVG_25M172, complete genome) position: , mismatch: 7, identity: 0.767

cttttgtccatctttttgaatttttgcaaa	CRISPR spacer
acttaatccatctttttcaatttttgtaat	Protospacer
 .** .*********** ********.**

73. spacer 1.1|940272|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to MN693485 (Marine virus AFVG_25M173, complete genome) position: , mismatch: 7, identity: 0.767

cttttgtccatctttttgaatttttgcaaa	CRISPR spacer
acttaatccatctttttcaatttttgtaat	Protospacer
 .** .*********** ********.**

74. spacer 1.1|940272|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to AP014167 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-C61A-MedDCM-OCT-S26-C30, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 7, identity: 0.767

cttttgtccatctttttgaatttttgcaaa	CRISPR spacer
tattagcccatctttttgaatttttaaaac	Protospacer
. ** *.******************. **

75. spacer 1.1|940272|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to MN693097 (Marine virus AFVG_25M78, complete genome) position: , mismatch: 7, identity: 0.767

cttttgtccatctttttgaatttttgcaaa	CRISPR spacer
tctttatccatcttgttgaattttttctac	Protospacer
..***.******** ********** * *

76. spacer 1.1|940272|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to AP014165 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-C61-MedDCM-OCT-S33-C79, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 7, identity: 0.767

cttttgtccatctttttgaatttttgcaaa	CRISPR spacer
tattagaccatctttttgaatttttaaaac	Protospacer
. ** * ******************. **

77. spacer 1.2|940338|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to NZ_LR214986 (Mycoplasma cynos strain NCTC10142 plasmid 13) position: , mismatch: 7, identity: 0.767

aacattagccttttctaactcttcagctgt	CRISPR spacer
cccattttccttttctaactcttcaattat	Protospacer
  ****  *****************..*.*

78. spacer 1.2|940338|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to MN692987 (Marine virus AFVG_117M51, complete genome) position: , mismatch: 7, identity: 0.767

aacattagccttttctaactcttcagctgt-	CRISPR spacer
aaccttagctttttctaactctt-gtctacc	Protospacer
*** *****.************* . **..

79. spacer 2.3|2006037|30|NC_021485|CRT matches to NZ_CP020748 (Bacillus mycoides strain Gnyt1 plasmid unnamed5, complete sequence) position: , mismatch: 7, identity: 0.767

taacttctggcttagcctctggtttggctt	CRISPR spacer
ttggttctggcttaggctctggttttggct	Protospacer
* . *********** ********* * .*

80. spacer 2.3|2006037|30|NC_021485|CRT matches to NZ_CP020748 (Bacillus mycoides strain Gnyt1 plasmid unnamed5, complete sequence) position: , mismatch: 7, identity: 0.767

taacttctggcttagcctctggtttggctt	CRISPR spacer
ttggttctggcttaggctctggttttggct	Protospacer
* . *********** ********* * .*

81. spacer 2.3|2006037|30|NC_021485|CRT matches to NZ_CP020748 (Bacillus mycoides strain Gnyt1 plasmid unnamed5, complete sequence) position: , mismatch: 7, identity: 0.767

taacttctggcttagcctctggtttggctt	CRISPR spacer
ttggttctggcttaggctctggttttggct	Protospacer
* . *********** ********* * .*

82. spacer 2.3|2006037|30|NC_021485|CRT matches to NZ_CP020748 (Bacillus mycoides strain Gnyt1 plasmid unnamed5, complete sequence) position: , mismatch: 7, identity: 0.767

taacttctggcttagcctctggtttggctt	CRISPR spacer
ttggttctggcttaggctctggttttggct	Protospacer
* . *********** ********* * .*

83. spacer 2.3|2006037|30|NC_021485|CRT matches to NZ_CP011358 (Bacillus thuringiensis strain YC-10 plasmid pYC2226, complete sequence) position: , mismatch: 7, identity: 0.767

taacttctggcttagcctctggtttggctt	CRISPR spacer
tcacttctggcttagtctcaggttttttct	Protospacer
* *************.*** *****  ..*

84. spacer 2.3|2006037|30|NC_021485|CRT matches to NC_018879 (Bacillus thuringiensis Bt407 plasmid BTB_78p, complete sequence) position: , mismatch: 7, identity: 0.767

taacttctggcttagcctctggtttggctt	CRISPR spacer
tcacttctggcttagtctcaggttttttct	Protospacer
* *************.*** *****  ..*

85. spacer 2.3|2006037|30|NC_021485|CRT matches to NZ_CP013057 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-2, complete sequence) position: , mismatch: 7, identity: 0.767

taacttctggcttagcctctggtttggctt	CRISPR spacer
tcacttctggcttagtctcaggttttttct	Protospacer
* *************.*** *****  ..*

86. spacer 2.3|2006037|30|NC_021485|CRT matches to NZ_CP009317 (Bacillus cereus 03BB102 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

taacttctggcttagcctctggtttggctt	CRISPR spacer
gtactgctggcttagtctctggttttggat	Protospacer
  *** *********.********* *  *

87. spacer 2.3|2006037|30|NC_021485|CRT matches to NC_020382 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-68, complete sequence) position: , mismatch: 7, identity: 0.767

taacttctggcttagcctctggtttggctt	CRISPR spacer
tcacttctggcttagtctcaggttttttct	Protospacer
* *************.*** *****  ..*

88. spacer 2.3|2006037|30|NC_021485|CRT matches to NC_017205 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT72, complete sequence) position: , mismatch: 7, identity: 0.767

taacttctggcttagcctctggtttggctt	CRISPR spacer
tcacttctggcttagtctcaggttttttct	Protospacer
* *************.*** *****  ..*

89. spacer 2.3|2006037|30|NC_021485|CRT matches to NZ_CP016317 (Bacillus cereus strain M3 plasmid pBCM301, complete sequence) position: , mismatch: 7, identity: 0.767

taacttctggcttagcctctggtttggctt	CRISPR spacer
gtacttctggctttgtctctggtttttcct	Protospacer
  *********** *.*********  *.*

90. spacer 2.3|2006037|30|NC_021485|CRT matches to NZ_CP015156 (Bacillus thuringiensis strain Bc601 plasmid pBTBC6, complete sequence) position: , mismatch: 7, identity: 0.767

taacttctggcttagcctctggtttggctt	CRISPR spacer
tcacttctggcttagtctcaggttttttct	Protospacer
* *************.*** *****  ..*

91. spacer 2.3|2006037|30|NC_021485|CRT matches to NZ_CP004869 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB67, complete sequence) position: , mismatch: 7, identity: 0.767

taacttctggcttagcctctggtttggctt	CRISPR spacer
tcacttctggcttagtctcaggttttttct	Protospacer
* *************.*** *****  ..*

92. spacer 2.3|2006037|30|NC_021485|CRT matches to NC_011777 (Bacillus cereus AH820 plasmid pAH820_272, complete sequence) position: , mismatch: 7, identity: 0.767

taacttctggcttagcctctggtttggctt	CRISPR spacer
gtacttctggctttgtctctggtttttcct	Protospacer
  *********** *.*********  *.*

93. spacer 2.3|2006037|30|NC_021485|CRT matches to NC_017726 (Bacillus anthracis str. H9401 plasmid BAP1, complete sequence) position: , mismatch: 7, identity: 0.767

taacttctggcttagcctctggtttggctt	CRISPR spacer
ttgtttctggcttagtctctggttttgtct	Protospacer
* ..***********.********* *..*

94. spacer 2.3|2006037|30|NC_021485|CRT matches to CP020758 (Bacillus thuringiensis strain ATCC 10792 plasmid pLDW-19, complete sequence) position: , mismatch: 7, identity: 0.767

taacttctggcttagcctctggtttggctt	CRISPR spacer
tcacttctggcttagtctcaggttttttct	Protospacer
* *************.*** *****  ..*

95. spacer 2.3|2006037|30|NC_021485|CRT matches to NZ_CP010093 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB71, complete sequence) position: , mismatch: 7, identity: 0.767

taacttctggcttagcctctggtttggctt	CRISPR spacer
tcacttctggcttagtctcaggttttttct	Protospacer
* *************.*** *****  ..*

96. spacer 2.3|2006037|30|NC_021485|CRT matches to NZ_CP021065 (Bacillus thuringiensis strain ATCC 10792 plasmid poh4, complete sequence) position: , mismatch: 7, identity: 0.767

taacttctggcttagcctctggtttggctt	CRISPR spacer
tcacttctggcttagtctcaggttttttct	Protospacer
* *************.*** *****  ..*

97. spacer 2.3|2006037|30|NC_021485|CRT matches to NC_012473 (Bacillus cereus 03BB102 plasmid p03BB102_179, complete sequence) position: , mismatch: 7, identity: 0.767

taacttctggcttagcctctggtttggctt	CRISPR spacer
gtactgctggcttagtctctggttttggat	Protospacer
  *** *********.********* *  *

98. spacer 2.5|2006121|30|NC_021485|CRT matches to NC_048797 (Bacillus phage vB_BmeM-Goe8, complete genome) position: , mismatch: 7, identity: 0.767

tagcttctggcttaacgtctggcttaacat	CRISPR spacer
ctgcttctggcttaacctctggctctgctt	Protospacer
. ************** *******. .* *

99. spacer 1.1|940272|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP019919 (Borreliella burgdorferi strain PAbe plasmid p_cp32-2, complete sequence) position: , mismatch: 8, identity: 0.733

cttttgtccatctttttgaatttttgcaaa	CRISPR spacer
attttttccatctttttgaattgaaacagt	Protospacer
 **** ****************   .**.

100. spacer 1.1|940272|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP019921 (Borreliella burgdorferi strain PAbe plasmid p_cp32-9-4, complete sequence) position: , mismatch: 8, identity: 0.733

cttttgtccatctttttgaatttttgcaaa	CRISPR spacer
attttttccatctttttgaattgaaacagt	Protospacer
 **** ****************   .**.

101. spacer 1.1|940272|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP019921 (Borreliella burgdorferi strain PAbe plasmid p_cp32-9-4, complete sequence) position: , mismatch: 8, identity: 0.733

cttttgtccatctttttgaatttttgcaaa	CRISPR spacer
attttttccatctttttgaattgaaacagt	Protospacer
 **** ****************   .**.

102. spacer 1.1|940272|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP019926 (Borreliella burgdorferi strain PAbe plasmid p_lp56, complete sequence) position: , mismatch: 8, identity: 0.733

cttttgtccatctttttgaatttttgcaaa	CRISPR spacer
attttttccatctttttgaattgaaacagt	Protospacer
 **** ****************   .**.

103. spacer 1.1|940272|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to NC_019006 (Borrelia burgdorferi 297 plasmid 297_cp32-3, complete sequence) position: , mismatch: 8, identity: 0.733

cttttgtccatctttttgaatttttgcaaa	CRISPR spacer
attttttccatctttttgaattgaaacagt	Protospacer
 **** ****************   .**.

104. spacer 1.1|940272|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to NC_017428 (Borreliella burgdorferi JD1 plasmid JD1 cp32-10, complete sequence) position: , mismatch: 8, identity: 0.733

cttttgtccatctttttgaatttttgcaaa	CRISPR spacer
attttttccatctttttgaattgaaacagt	Protospacer
 **** ****************   .**.

105. spacer 1.1|940272|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to NC_017393 (Borreliella burgdorferi JD1 plasmid JD1 cp32-11, complete sequence) position: , mismatch: 8, identity: 0.733

cttttgtccatctttttgaatttttgcaaa	CRISPR spacer
attttttccatctttttgaattgaaacagt	Protospacer
 **** ****************   .**.

106. spacer 1.1|940272|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to NC_017394 (Borreliella burgdorferi JD1 plasmid JD1 cp32-1+5, complete sequence) position: , mismatch: 8, identity: 0.733

cttttgtccatctttttgaatttttgcaaa	CRISPR spacer
attttttccatctttttgaattgaaacagt	Protospacer
 **** ****************   .**.

107. spacer 1.1|940272|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to NC_017394 (Borreliella burgdorferi JD1 plasmid JD1 cp32-1+5, complete sequence) position: , mismatch: 8, identity: 0.733

cttttgtccatctttttgaatttttgcaaa	CRISPR spacer
attttttccatctttttgaattgaaacagt	Protospacer
 **** ****************   .**.

108. spacer 1.1|940272|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP031406 (Borreliella burgdorferi strain MM1 plasmid plsm_cp32-9, complete sequence) position: , mismatch: 8, identity: 0.733

cttttgtccatctttttgaatttttgcaaa	CRISPR spacer
attttttccatctttttgaattgaaacagt	Protospacer
 **** ****************   .**.

109. spacer 1.1|940272|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP028099 (Synechocystis sp. IPPAS B-1465 plasmid pSYSM, complete sequence) position: , mismatch: 8, identity: 0.733

cttttgtccatctttttgaatttttgcaaa	CRISPR spacer
gatttgtccacctatttgaattttttgacc	Protospacer
  ********.** ***********  *

110. spacer 1.1|940272|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to NC_005229 (Synechocystis sp. PCC 6803 plasmid pSYSM, complete sequence) position: , mismatch: 8, identity: 0.733

cttttgtccatctttttgaatttttgcaaa	CRISPR spacer
gatttgtccacctatttgaattttttgacc	Protospacer
  ********.** ***********  *

111. spacer 1.1|940272|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to NC_011722 (Borreliella burgdorferi ZS7 plasmid ZS7_cp32-9, complete sequence) position: , mismatch: 8, identity: 0.733

cttttgtccatctttttgaatttttgcaaa	CRISPR spacer
attttttccatctttttgaattgaaacagt	Protospacer
 **** ****************   .**.

112. spacer 1.1|940272|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to NC_000951 (Borreliella burgdorferi B31 plasmid cp32-6, complete sequence) position: , mismatch: 8, identity: 0.733

cttttgtccatctttttgaatttttgcaaa	CRISPR spacer
attttttccatctttttgaattgaaacagt	Protospacer
 **** ****************   .**.

113. spacer 1.1|940272|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to NC_000954 (Borreliella burgdorferi B31 plasmid cp32-9, complete sequence) position: , mismatch: 8, identity: 0.733

cttttgtccatctttttgaatttttgcaaa	CRISPR spacer
attttttccatctttttgaattgaaacagt	Protospacer
 **** ****************   .**.

114. spacer 1.1|940272|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to NC_000956 (Borreliella burgdorferi B31 plasmid lp56, complete sequence) position: , mismatch: 8, identity: 0.733

cttttgtccatctttttgaatttttgcaaa	CRISPR spacer
attttttccatctttttgaattgaaacagt	Protospacer
 **** ****************   .**.

115. spacer 1.1|940272|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP031268 (Staphylococcus warneri strain 16A plasmid unnamed2) position: , mismatch: 8, identity: 0.733

cttttgtccatctttttgaatttttgcaaa	CRISPR spacer
tttttgtccatctttttgacctttatatga	Protospacer
.****************** .***    .*

116. spacer 1.1|940272|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP031268 (Staphylococcus warneri strain 16A plasmid unnamed2) position: , mismatch: 8, identity: 0.733

cttttgtccatctttttgaatttttgcaaa	CRISPR spacer
tttttgtccatctttttgacctttatatga	Protospacer
.****************** .***    .*

117. spacer 1.1|940272|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP015799 (Borrelia mayonii strain MN14-1539 plasmid cp32-13, complete sequence) position: , mismatch: 8, identity: 0.733

cttttgtccatctttttgaatttttgcaaa	CRISPR spacer
attttttccatctttttgaattgaaacagt	Protospacer
 **** ****************   .**.

118. spacer 1.1|940272|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP015800 (Borrelia mayonii strain MN14-1539 plasmid cp32-3, complete sequence) position: , mismatch: 8, identity: 0.733

cttttgtccatctttttgaatttttgcaaa	CRISPR spacer
attttttccatctttttgaattgaaacagt	Protospacer
 **** ****************   .**.

119. spacer 1.1|940272|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP019848 (Borreliella burgdorferi plasmid cp32-4, complete sequence) position: , mismatch: 8, identity: 0.733

cttttgtccatctttttgaatttttgcaaa	CRISPR spacer
attttttccatctttttgaattgaaacagt	Protospacer
 **** ****************   .**.

120. spacer 1.1|940272|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP019850 (Borreliella burgdorferi plasmid cp32-9, complete sequence) position: , mismatch: 8, identity: 0.733

cttttgtccatctttttgaatttttgcaaa	CRISPR spacer
attttttccatctttttgaattgaaacagt	Protospacer
 **** ****************   .**.

121. spacer 1.1|940272|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP019855 (Borreliella burgdorferi plasmid lp56, complete sequence) position: , mismatch: 8, identity: 0.733

cttttgtccatctttttgaatttttgcaaa	CRISPR spacer
attttttccatctttttgaattgaaacagt	Protospacer
 **** ****************   .**.

122. spacer 1.1|940272|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP019757 (Borreliella burgdorferi strain B31_NRZ isolate B31 plasmid p_cp32-2, complete sequence) position: , mismatch: 8, identity: 0.733

cttttgtccatctttttgaatttttgcaaa	CRISPR spacer
attttttccatctttttgaattgaaacagt	Protospacer
 **** ****************   .**.

123. spacer 1.1|940272|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP019759 (Borreliella burgdorferi strain B31_NRZ isolate B31 plasmid p_cp32-4, complete sequence) position: , mismatch: 8, identity: 0.733

cttttgtccatctttttgaatttttgcaaa	CRISPR spacer
attttttccatctttttgaattgaaacagt	Protospacer
 **** ****************   .**.

124. spacer 1.1|940272|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP019760 (Borreliella burgdorferi strain B31_NRZ isolate B31 plasmid p_cp32-9, complete sequence) position: , mismatch: 8, identity: 0.733

cttttgtccatctttttgaatttttgcaaa	CRISPR spacer
attttttccatctttttgaattgaaacagt	Protospacer
 **** ****************   .**.

125. spacer 1.1|940272|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP019766 (Borreliella burgdorferi strain B31_NRZ isolate B31 plasmid p_lp56, complete sequence) position: , mismatch: 8, identity: 0.733

cttttgtccatctttttgaatttttgcaaa	CRISPR spacer
attttttccatctttttgaattgaaacagt	Protospacer
 **** ****************   .**.

126. spacer 1.1|940272|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP017203 (Borreliella burgdorferi strain B331 plasmid B331_cp32_1, complete sequence) position: , mismatch: 8, identity: 0.733

cttttgtccatctttttgaatttttgcaaa	CRISPR spacer
attttttccatctttttgaattgaaacagt	Protospacer
 **** ****************   .**.

127. spacer 1.1|940272|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP017205 (Borreliella burgdorferi strain B331 plasmid B331_cp32_11, complete sequence) position: , mismatch: 8, identity: 0.733

cttttgtccatctttttgaatttttgcaaa	CRISPR spacer
attttttccatctttttgaattgaaacagt	Protospacer
 **** ****************   .**.

128. spacer 1.1|940272|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP017206 (Borreliella burgdorferi strain B331 plasmid B331_cp32_4, complete sequence) position: , mismatch: 8, identity: 0.733

cttttgtccatctttttgaatttttgcaaa	CRISPR spacer
attttttccatctttttgaattgaaacagt	Protospacer
 **** ****************   .**.

129. spacer 1.1|940272|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP017208 (Borreliella burgdorferi strain B331 plasmid B331_cp32_6, complete sequence) position: , mismatch: 8, identity: 0.733

cttttgtccatctttttgaatttttgcaaa	CRISPR spacer
attttttccatctttttgaattgaaacagt	Protospacer
 **** ****************   .**.

130. spacer 1.1|940272|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP017209 (Borreliella burgdorferi strain B331 plasmid B331_cp32_7, complete sequence) position: , mismatch: 8, identity: 0.733

cttttgtccatctttttgaatttttgcaaa	CRISPR spacer
attttttccatctttttgaattgaaacagt	Protospacer
 **** ****************   .**.

131. spacer 1.1|940272|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP015784 (Borrelia mayonii strain MN14-1420 plasmid cp32-3, complete sequence) position: , mismatch: 8, identity: 0.733

cttttgtccatctttttgaatttttgcaaa	CRISPR spacer
attttttccatctttttgaattgaaacagt	Protospacer
 **** ****************   .**.

132. spacer 1.1|940272|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP051646 (Staphylococcus caprae strain SY333 plasmid pSY333-7, complete sequence) position: , mismatch: 8, identity: 0.733

cttttgtccatctttttgaatttttgcaaa	CRISPR spacer
tttttgtccatctttttgacctttatatga	Protospacer
.****************** .***    .*

133. spacer 1.1|940272|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to NZ_LR735436 (Staphylococcus epidermidis strain none isolate Se_BPH0736 plasmid 3) position: , mismatch: 8, identity: 0.733

cttttgtccatctttttgaatttttgcaaa	CRISPR spacer
tttttgtccatctttttgacctttatatga	Protospacer
.****************** .***    .*

134. spacer 1.2|940338|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to MN693222 (Marine virus AFVG_25M67, complete genome) position: , mismatch: 8, identity: 0.733

aacattagccttttctaactcttcagctgt	CRISPR spacer
tttgtatgctttttctaactcttcagctga	Protospacer
  ..*  **.*******************

135. spacer 1.2|940338|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to MN693638 (Marine virus AFVG_250M154, complete genome) position: , mismatch: 8, identity: 0.733

aacattagccttttctaactcttcagctgt	CRISPR spacer
taacttagccttttctatctcatcagcaac	Protospacer
 *  ************* *** ***** ..

136. spacer 1.2|940338|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP020456 (Vibrio coralliilyticus strain SNUTY-1 plasmid pSNUTY2, complete sequence) position: , mismatch: 8, identity: 0.733

aacattagccttttctaactcttcagctgt	CRISPR spacer
agcattagccttatcaaactcttcaatacg	Protospacer
*.********** ** *********..

137. spacer 1.2|940338|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to MN694591 (Marine virus AFVG_250M155, complete genome) position: , mismatch: 8, identity: 0.733

aacattagccttttctaactcttcagctgt	CRISPR spacer
taacttagccttttctatctcatcagcaac	Protospacer
 *  ************* *** ***** ..

138. spacer 2.2|2005989|30|NC_021485|CRT matches to MN855875 (Bacteriophage sp. isolate 328, complete genome) position: , mismatch: 8, identity: 0.733

tggcctctggcttaacgtctggtttaactt	CRISPR spacer
tggcctctggctcaacgtctgcgccatccg	Protospacer
************.********  ..* *.

139. spacer 2.3|2006037|30|NC_021485|CRT matches to NZ_CP020748 (Bacillus mycoides strain Gnyt1 plasmid unnamed5, complete sequence) position: , mismatch: 8, identity: 0.733

taacttctggcttagcctctggtttggctt	CRISPR spacer
ttggttctggcttaggctctggtttttcag	Protospacer
* . *********** *********  *

140. spacer 2.3|2006037|30|NC_021485|CRT matches to NZ_CP013715 (Staphylococcus equorum strain C2014 plasmid pC2014-1, complete sequence) position: , mismatch: 8, identity: 0.733

taacttctggcttagcctctggtttggctt	CRISPR spacer
tatcttctggcttagcctcaggtaaaacac	Protospacer
** **************** ***  ..* .

141. spacer 2.3|2006037|30|NC_021485|CRT matches to NZ_CP021813 (Sinorhizobium meliloti strain M270 plasmid psymA, complete sequence) position: , mismatch: 8, identity: 0.733

taacttctggcttagcctctggtttggctt	CRISPR spacer
tgtgcgctggcttagcgtctggtttcgctg	Protospacer
*.  . ********** ******** ***

142. spacer 2.3|2006037|30|NC_021485|CRT matches to NC_017327 (Sinorhizobium meliloti SM11 plasmid pSmeSM11c, complete sequence) position: , mismatch: 8, identity: 0.733

taacttctggcttagcctctggtttggctt	CRISPR spacer
tgtgcgctggcttagcgtctggtttcgctg	Protospacer
*.  . ********** ******** ***

143. spacer 2.3|2006037|30|NC_021485|CRT matches to NZ_CP009145 (Sinorhizobium meliloti strain RMO17 plasmid pSymA, complete sequence) position: , mismatch: 8, identity: 0.733

taacttctggcttagcctctggtttggctt	CRISPR spacer
tgtgcgctggcttagcgtctggtttcgctg	Protospacer
*.  . ********** ******** ***

144. spacer 2.3|2006037|30|NC_021485|CRT matches to NZ_CP021801 (Sinorhizobium meliloti strain USDA1021 plasmid psymA, complete sequence) position: , mismatch: 8, identity: 0.733

taacttctggcttagcctctggtttggctt	CRISPR spacer
tgtgcgctggcttagcgtctggtttcgctg	Protospacer
*.  . ********** ******** ***

145. spacer 2.3|2006037|30|NC_021485|CRT matches to NZ_CP021819 (Sinorhizobium meliloti strain M162 plasmid psymA, complete sequence) position: , mismatch: 8, identity: 0.733

taacttctggcttagcctctggtttggctt	CRISPR spacer
tgtgcgctggcttagcgtctggtttcgctg	Protospacer
*.  . ********** ******** ***

146. spacer 2.3|2006037|30|NC_021485|CRT matches to NZ_CP021217 (Sinorhizobium meliloti RU11/001 plasmid pSymA, complete sequence) position: , mismatch: 8, identity: 0.733

taacttctggcttagcctctggtttggctt	CRISPR spacer
tgtgcgctggcttagcgtctggtttcgctg	Protospacer
*.  . ********** ******** ***

147. spacer 1.1|940272|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP017204 (Borreliella burgdorferi strain B331 plasmid B331_cp32_10, complete sequence) position: , mismatch: 9, identity: 0.7

cttttgtccatctttttgaatttttgcaaa	CRISPR spacer
attttttccatctttttgaattgaaacggt	Protospacer
 **** ****************   .*..

148. spacer 1.1|940272|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to MK765570 (Tortoise microvirus 20 isolate 20_SP_90, complete genome) position: , mismatch: 9, identity: 0.7

cttttgtccatctttttgaatttttgcaaa	CRISPR spacer
aagtaacacatctttttgaattttagcaag	Protospacer
   * .. **************** ****.

149. spacer 1.1|940272|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP028880 (Borreliella bavariensis PBi plasmid cp32-5, complete sequence) position: , mismatch: 9, identity: 0.7

cttttgtccatctttttgaatttttgcaaa	CRISPR spacer
attttttccatctttttgaattgaaacggt	Protospacer
 **** ****************   .*..

150. spacer 1.3|940404|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to KM236245 (Bacillus phage Mater, complete genome) position: , mismatch: 9, identity: 0.7

tatgtcttctaacagttgcttcttgtgctt	CRISPR spacer
agtatcttctaacagttgcttcatgaatac	Protospacer
 .*.****************** ** .. .

151. spacer 1.4|940470|30|NC_021485|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP040335 (Bacillus cereus strain DLOU-Changhai plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.7

ccgtcaaacaagagcgacagcgaaacaagc	CRISPR spacer
aaacaaaacaagagagacagcggaacaact	Protospacer
  .. ********* *******.***** .

152. spacer 2.5|2006121|30|NC_021485|CRT matches to NC_011759 (Yersinia pseudotuberculosis pGDT4 plasmid) position: , mismatch: 9, identity: 0.7

tagcttctggcttaacgtctggcttaacat	CRISPR spacer
ggccggactgcttagcgtctggcttaacat	Protospacer
 . *   . *****.***************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

36583 : 48648

Synechococcus_phage(28.57%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001042250.1\|36583_40309_+	phosphoribosylformylglycinamidine synthase	A6N228	Microbacterium_phage	1.9e-38	25.9
WP_000220676.1\|40542_41997_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	3.7e-54	32.7
WP_001291328.1\|42024_43047_+	phosphoribosylformylglycinamidine cyclo-ligase	R9TMC7	Synechococcus_phage	1.1e-63	42.7
WP_000685109.1\|43214_43763_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.4e-25	35.6
WP_000780022.1\|43785_44538_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_000166549.1\|44557_46105_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	3.9e-78	49.2
WP_001045908.1\|46297_47197_+	peptidoglycan DD-metalloendopeptidase family protein	A0A221J6U0	Arthrobacter_phage	4.1e-19	45.9
WP_000783419.1\|47343_48648_+	LysM peptidoglycan-binding domain-containing protein	A0A2D1GNZ3	Streptomyces_phage	3.7e-05	40.5

DBSCAN-SWA_2

588976 : 659233

Streptococcus_phage(98.28%)

terminase,head,integrase,holin,portal,protease,capsid,tail

attL 590876:590892|attR 636909:636925

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000902645.1\|588976_590332_+	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	D0R096	Streptococcus_phage	2.3e-191	73.4
WP_001261523.1\|590853_591372_+	ClbS/DfsB family four-helix bundle protein	NA	NA	NA	NA
590876:590892	attL	NA	NA	NA	NA
WP_001291561.1\|591563_592781_-\|integrase	tyrosine-type recombinase/integrase	A0A1S5SEW7	Streptococcus_phage	3.7e-233	100.0
WP_000814511.1\|592862_593066_-	excisionase	A0A1S5SF07	Streptococcus_phage	4.0e-31	100.0
WP_000857133.1\|593526_593757_-	helix-turn-helix domain-containing protein	A0A1S5SEX1	Streptococcus_phage	2.7e-36	100.0
WP_000804885.1\|593753_594176_-	sigma-70 family RNA polymerase sigma factor	A0A1S5SEW0	Streptococcus_phage	2.5e-72	100.0
WP_001227347.1\|594680_595034_+	helix-turn-helix domain-containing protein	A0A1S5SFA6	Streptococcus_phage	1.3e-58	100.0
WP_000336323.1\|595093_595261_-	cysteine-rich KTR domain-containing protein	D0R0F6	Streptococcus_phage	1.6e-14	68.0
WP_000691736.1\|595379_597299_-	tetracycline resistance ribosomal protection protein Tet(M)	A0A1S5SF82	Streptococcus_phage	0.0e+00	99.5
WP_001814923.1\|597314_597431_-	tetracycline resistance determinant leader peptide	NA	NA	NA	NA
WP_001224318.1\|597675_598608_-	conjugal transfer protein	A0A1S5SF22	Streptococcus_phage	3.1e-171	99.4
WP_000769868.1\|598604_599606_-	lysozyme family protein	A0A1S5SEZ8	Streptococcus_phage	5.0e-191	100.0
WP_000804748.1\|599602_601780_-	membrane protein	A0A1S5SF30	Streptococcus_phage	0.0e+00	100.0
WP_000331160.1\|601782_604230_-	ATP-binding protein	A0A1S5SF64	Streptococcus_phage	0.0e+00	100.0
WP_000506270.1\|604213_604720_-	conjugal transfer protein	A0A1S5SEX7	Streptococcus_phage	8.6e-91	100.0
WP_000342539.1\|604694_605192_-	antirestriction protein ArdA	A0A1S5SF25	Streptococcus_phage	1.7e-91	100.0
WP_001009056.1\|605308_605530_-	hypothetical protein	A0A1S5SEY0	Streptococcus_phage	4.3e-31	100.0
WP_000398284.1\|605572_606778_-	replication initiation factor domain-containing protein	A0A1S5SEX3	Streptococcus_phage	2.8e-233	100.0
WP_000879507.1\|606800_606953_-	hypothetical protein	NA	NA	NA	NA
WP_016480032.1\|606955_608341_-	DNA translocase FtsK	A0A1S5SFB5	Streptococcus_phage	2.5e-265	99.8
WP_000985015.1\|608369_608756_-	YdcP family protein	A0A1S5SF96	Streptococcus_phage	3.0e-64	100.0
WP_000420682.1\|608771_609086_-	YdcP family protein	A0A1S5SF38	Streptococcus_phage	5.2e-54	100.0
WP_000445922.1\|609712_610243_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_000944911.1\|610412_614519_+	YSIRK signal domain/LPXTG anchor domain surface protein	NA	NA	NA	NA
WP_000459852.1\|616288_618157_+	ImmA/IrrE family metallo-endopeptidase	E4ZFJ9	Streptococcus_phage	2.0e-302	80.9
WP_001122250.1\|618565_619135_+	hypothetical protein	A0A1B0RXB3	Streptococcus_phage	1.1e-86	81.0
WP_000905644.1\|619173_621129_-	DNA polymerase	D0R0B0	Streptococcus_phage	0.0e+00	83.6
WP_000464240.1\|621178_621343_-	hypothetical protein	NA	NA	NA	NA
WP_000208946.1\|621359_621923_-	DUF2815 family protein	A0A1B0RXA9	Streptococcus_phage	3.3e-91	93.4
WP_001868547.1\|621927_623049_-	DUF2800 domain-containing protein	A0A1X9I6D8	Streptococcus_phage	8.0e-198	88.5
WP_000041407.1\|623041_623365_-	hypothetical protein	A0A1B0RXB7	Streptococcus_phage	2.0e-32	71.2
WP_001160916.1\|623761_626041_+	hypothetical protein	M1NSF0	Streptococcus_phage	0.0e+00	80.7
WP_001208304.1\|626391_626673_+	VRR-NUC domain-containing protein	M1PFY8	Streptococcus_phage	5.5e-39	82.8
WP_000777509.1\|626653_628030_+	DEAD/DEAH box helicase	A0A1X9I6B0	Streptococcus_phage	5.3e-228	84.5
WP_000373917.1\|628022_628532_+	hypothetical protein	Q6DMV6	Streptococcus_phage	1.4e-45	54.5
WP_000166942.1\|628711_628894_+	hypothetical protein	A0A1B0RXC3	Streptococcus_phage	2.0e-21	88.3
WP_016480034.1\|628941_629979_+	methionine adenosyltransferase	E4ZFL0	Streptococcus_phage	3.0e-167	84.6
WP_001138025.1\|629980_630346_+	HNH endonuclease	E4ZFL2	Streptococcus_phage	3.9e-61	86.7
WP_000999418.1\|630634_631090_+	hypothetical protein	A0A1B0RXC6	Streptococcus_phage	5.4e-44	51.0
WP_000211619.1\|631061_632318_+	DNA modification methylase	E4ZFL4	Streptococcus_phage	3.7e-220	88.7
WP_000176353.1\|632314_633568_+	DNA (cytosine-5-)-methyltransferase	M1NSK8	Streptococcus_phage	3.6e-231	93.5
WP_000342208.1\|633910_634360_+	DUF4314 domain-containing protein	E4ZFL7	Streptococcus_phage	1.8e-15	63.6
WP_000290862.1\|634411_634885_+\|terminase	phage terminase small subunit P27 family	A0A1X9I6K0	Streptococcus_phage	2.3e-85	96.8
WP_000220988.1\|634881_636474_+\|terminase	terminase large subunit	A0A1B0RXJ8	Streptococcus_phage	2.5e-306	95.5
WP_001166641.1\|636544_636802_+	type II toxin-antitoxin system Phd/YefM family antitoxin	E4ZFM1	Streptococcus_phage	1.2e-35	95.3
WP_001221830.1\|636798_637170_+	type II toxin-antitoxin system death-on-curing family toxin	A0A1X9I6C0	Streptococcus_phage	1.2e-57	89.4
636909:636925	attR	NA	NA	NA	NA
WP_000149740.1\|637195_637522_+	hypothetical protein	NA	NA	NA	NA
WP_016480035.1\|637589_638879_+\|portal	phage portal protein	D0R0D3	Streptococcus_phage	1.2e-229	90.0
WP_001225239.1\|638871_639570_+\|protease	Clp protease ClpP	A0A1B0RXE1	Streptococcus_phage	3.8e-105	83.2
WP_000040499.1\|639583_640792_+\|capsid	phage major capsid protein	M1Q1R5	Streptococcus_phage	4.0e-211	90.8
WP_000988604.1\|640788_641046_+\|head,tail	phage gp6-like head-tail connector protein	D0R0D7	Streptococcus_phage	9.5e-30	77.6
WP_000684963.1\|641045_641384_+\|head,tail	head-tail adaptor protein	A0A1B0RXE4	Streptococcus_phage	4.7e-37	68.8
WP_000161246.1\|641376_641745_+	HK97 gp10 family phage protein	Q6DMT7	Streptococcus_phage	1.0e-32	62.1
WP_001209972.1\|641753_642080_+	hypothetical protein	M1Q1Z4	Streptococcus_phage	2.4e-38	68.5
WP_000818569.1\|642082_642652_+	hypothetical protein	A0A1B0RXE2	Streptococcus_phage	3.6e-98	95.2
WP_001249617.1\|642663_643083_+	hypothetical protein	A0A1X9I691	Streptococcus_phage	9.7e-56	76.3
WP_016480036.1\|643377_646500_+\|tail	phage tail tape measure protein	Q6DMT2	Streptococcus_phage	1.3e-250	76.8
WP_000589859.1\|646496_647222_+	hypothetical protein	M1Q107	Streptococcus_phage	1.6e-82	61.1
WP_000966173.1\|647221_650137_+\|tail	phage tail protein	Q6DMT0	Streptococcus_phage	0.0e+00	64.1
WP_000796414.1\|650149_652006_+	hypothetical protein	Q6DMS9	Streptococcus_phage	6.7e-258	72.9
WP_000661349.1\|652023_652422_+\|holin	phage holin family protein	D0R0E9	Streptococcus_phage	5.1e-38	60.8
WP_000143481.1\|652423_653830_+	glucosaminidase domain-containing protein	A0A1B0RXL4	Streptococcus_phage	2.4e-106	63.1
WP_000123549.1\|653965_654073_+\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_000290969.1\|654380_655622_+	recombinase family protein	A0A1X9I6J1	Streptococcus_phage	7.8e-170	69.2
WP_170960311.1\|655524_656871_+	recombinase family protein	E4ZFN9	Streptococcus_phage	4.2e-201	79.1
WP_000504420.1\|656940_657714_+	hypothetical protein	NA	NA	NA	NA
WP_000247957.1\|657727_659233_+	serine/threonine protein kinase	A0A0G2YBE6	Acanthamoeba_polyphaga_mimivirus	3.8e-09	25.1

DBSCAN-SWA_3

1596344 : 1607078

Streptococcus_phage(84.62%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000767485.1\|1596344_1597172_+	exodeoxyribonuclease III	M1PSC0	Streptococcus_phage	5.1e-125	78.4
WP_000287943.1\|1597212_1597569_-	arsenate reductase family protein	M1PLC0	Streptococcus_phage	5.2e-42	72.6
WP_000966772.1\|1597570_1598047_-	methylated-DNA--[protein]-cysteine S-methyltransferase	M1PFU9	Streptococcus_phage	7.1e-39	50.9
WP_000232152.1\|1598103_1599285_-	phosphoglycerate dehydrogenase	M1NSB9	Streptococcus_phage	1.1e-168	75.3
WP_001167085.1\|1599347_1599896_-	acetyltransferase	M1PSC3	Streptococcus_phage	1.1e-54	58.4
WP_000158399.1\|1599963_1601055_-	3-phosphoserine/phosphohydroxythreonine transaminase	M1Q1P2	Streptococcus_phage	1.7e-165	78.0
WP_000603275.1\|1601187_1601823_+	copper homeostasis protein CutC	NA	NA	NA	NA
WP_000425864.1\|1602092_1602962_-	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	3.7e-110	70.7
WP_000358198.1\|1602961_1603288_-	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	3.2e-30	61.1
WP_000364568.1\|1603318_1604182_-	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	2.5e-74	50.0
WP_000715594.1\|1604201_1604837_-	dTMP kinase	M1PSC7	Streptococcus_phage	1.4e-66	60.1
WP_001144246.1\|1604925_1605585_-	CBS domain-containing protein	M1NSC5	Streptococcus_phage	4.7e-65	56.5
WP_000178141.1\|1605603_1606314_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.0e-17	27.7
WP_001185989.1\|1606313_1607078_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	8.9e-15	24.8

DBSCAN-SWA_4

2083945 : 2093438

Streptococcus_phage(81.82%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000038826.1\|2083945_2084323_-	DUF1492 domain-containing protein	Q7Y4J3	Streptococcus_phage	3.2e-10	37.9
WP_000891151.1\|2084456_2084945_-	hypothetical protein	A0A1X9I5V2	Streptococcus_phage	1.0e-48	58.6
WP_001258765.1\|2085017_2085575_-	hypothetical protein	A0A1X9I5U4	Streptococcus_phage	2.4e-30	59.8
WP_000694573.1\|2085732_2085906_-	hypothetical protein	A0A1X9I5U0	Streptococcus_phage	4.3e-10	56.1
WP_001069293.1\|2085902_2086160_-	hypothetical protein	NA	NA	NA	NA
WP_000656430.1\|2086452_2087847_-	hypothetical protein	W8CQP1	Croceibacter_phage	3.7e-43	33.7
WP_001029296.1\|2087858_2088716_-	primase C-terminal domain-containing protein	A0A1X9I6L2	Streptococcus_phage	3.0e-120	72.9
WP_001100460.1\|2088716_2088989_-	hypothetical protein	A0A1X9I5U9	Streptococcus_phage	1.8e-18	56.8
WP_001157003.1\|2089330_2089522_-	hypothetical protein	NA	NA	NA	NA
WP_001256559.1\|2089524_2089746_-	hypothetical protein	NA	NA	NA	NA
WP_000877499.1\|2089742_2090075_-	hypothetical protein	NA	NA	NA	NA
WP_001259478.1\|2090151_2090658_-	hypothetical protein	A0A1X9I5V7	Streptococcus_phage	4.5e-07	35.4
WP_000130289.1\|2090746_2090920_-	hypothetical protein	NA	NA	NA	NA
WP_016480139.1\|2091018_2091657_-	hypothetical protein	NA	NA	NA	NA
WP_001258609.1\|2091892_2092495_-	phage repressor protein	A0A1W6JPC3	Staphylococcus_phage	6.7e-42	46.7
WP_000909285.1\|2092510_2092696_-	hypothetical protein	A0A1X9I5U7	Streptococcus_phage	6.2e-07	54.8
WP_001080836.1\|2092850_2093438_+	helix-turn-helix domain-containing protein	A0A1X9I5U6	Streptococcus_phage	4.0e-15	37.5

DBSCAN-SWA_5

2108073 : 2115247

Staphylococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001042665.1\|2108073_2108748_-	transglycosylase SLT domain-containing protein	Q4Z8Z7	Staphylococcus_phage	8.9e-27	54.3
WP_000029069.1\|2108853_2109393_-	LysM peptidoglycan-binding domain-containing protein	A0A249XZV3	Enterococcus_phage	1.3e-17	46.4
WP_000359358.1\|2109608_2110403_-	energy-coupling factor transporter transmembrane protein EcfT	NA	NA	NA	NA
WP_000510606.1\|2110395_2111238_-	energy-coupling factor transporter ATPase	A0A2H4PQG7	Staphylococcus_phage	2.0e-15	28.5
WP_000181758.1\|2111213_2112053_-	energy-coupling factor transporter ATPase	W8CYL7	Bacillus_phage	6.7e-16	31.0
WP_000239225.1\|2112052_2112595_-	CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase	NA	NA	NA	NA
WP_000217762.1\|2112717_2114001_-	insulinase family protein	A0A2H4UVM3	Bodo_saltans_virus	1.6e-05	23.6
WP_000706188.1\|2114002_2115247_-	insulinase family protein	A0A1X9I714	Streptococcus_phage	3.7e-87	41.3

Anti-CRISPR protein detection

Acr_ID: NC_021485.1|WP_000384270.1|234158_234485_+|replication-initiator-protein-A

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

NC_021485.1|WP_000384270.1|234158_234485_+|replication-initiator-protein-A

234158_234485_+

108 aa aa

hit_Aca_id	identity	query_coverage	hit_coverage
gnl\|BL_ORD_ID\|63	0.9444444444444444	1	1.0

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_021485

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

Click the colored protein region to show detailed information