CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NC_021821	Vibrio parahaemolyticus O1:Kuk str. FDA_R31 chromosome II, complete sequence	1 crisprs	cas5f,cas7f,cas6f,RT,WYL,DEDDh,csa3,cas3	0	1	1	0
NC_021847	Vibrio parahaemolyticus O1:Kuk str. FDA_R31 chromosome I, complete sequence	0 crisprs	DEDDh,csa3,cas3,RT,DinG,csx1	0	0	7	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_021821_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_021821_1

1594808-1594911

Orphan

Consensus_repeat	Method
CGGTTACCACGGAAACCACCTTCACGACGACCGCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_021821_1

>merge|NC_021821|1|1594808-1594911|CRISPRCasFinder
CGGTTACCACGGAAACCACCTTCACGACGACCGCCTTCACGACGCTCACCACCACGGTTGCCACCTTCGCGGTTACCACGGAAACCACCTTCACGACGACCGCC

>NC_021821|1|1|1594808-1594911|CRISPRCasFinder
CGGTTACCACGGAAACCACCTTCACGACGACCGCC	TTCACGACGCTCACCACCACGGTTGCCACCTTCG
CGGTTACCACGGAAACCACCTTCACGACGACCGCC

Protein	Signature genes	Signature genes Name	Protein_function
NC_021821.1\|WP_020842260.1\|1586396_1587242_+\|gamma-carboxygeranoyl-CoA-hydratase	unknown	unknown	gnl\|CDD\|235664
NC_021821.1\|WP_020842274.1\|1608495_1610046_-\|methyl-accepting-chemotaxis-protein	unknown	unknown	gnl\|CDD\|214599
NC_021821.1\|WP_020842265.1\|1591510_1592704_-\|acetate/propionate-family-kinase	unknown	unknown	gnl\|CDD\|183528
NC_021821.1\|WP_025632129.1\|1603579_1604818_+\|anaerobic-sulfatase-maturase	unknown	unknown	gnl\|CDD\|188457
NC_021821.1\|WP_005487889.1\|1601366_1602047_-\|MaoC-family-dehydratase	unknown	unknown	gnl\|CDD\|239534
NC_021821.1\|WP_020842273.1\|1607216_1608152_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176155
NC_021821.1\|WP_020842269.1\|1599066_1599870_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225117
NC_021821.1\|WP_005462123.1\|1599874_1600228_-\|DUF3024-domain-containing-protein	unknown	unknown	gnl\|CDD\|371425
NC_021821.1\|WP_005462121.1\|1600484_1601312_+\|phosphate-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270371
NC_021821.1\|WP_020842272.1\|1604825_1607195_+\|arylsulfatase	unknown	unknown	gnl\|CDD\|293749
NC_021821.1\|WP_020842270.1\|1602490_1603444_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223656
NC_021821.1\|WP_020842258.1\|1583550_1584720_+\|isovaleryl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|173845
NC_021821.1\|WP_020842261.1\|1587238_1588141_+\|hydroxymethylglutaryl-CoA-lyase	unknown	unknown	gnl\|CDD\|180206
NC_021821.1\|WP_020842263.1\|1588753_1589632_-\|DMT-family-transporter	unknown	unknown	gnl\|CDD\|273359
NC_021821.1\|WP_020842262.1\|1588176_1588728_-\|membrane-protein	unknown	unknown	gnl\|CDD\|227700
NC_021821.1\|WP_005455792.1\|1583097_1583472_+\|MerR-family-DNA-binding-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133403
NC_021821.1\|WP_020842268.1\|1596988_1598995_+\|exoribonuclease-II	unknown	unknown	gnl\|CDD\|179920
NC_021821.1\|WP_020842264.1\|1589917_1591231_-\|PAS-domain-S-box-protein	unknown	unknown	gnl\|CDD\|206779
NC_021821.1\|WP_025630942.1\|1593064_1594603_+\|bifunctional-diguanylate-cyclase/phosphodiesterase	unknown	unknown	gnl\|CDD\|238923
NC_021821.1\|WP_020842259.1\|1584754_1586359_+\|methylcrotonoyl-CoA-carboxylase	unknown	unknown	gnl\|CDD\|178415

Protein	Function_ID	Function_description	E-value
NC_021821.1\|WP_020842260.1\|1586396_1587242_+\|gamma-carboxygeranoyl-CoA-hydratase	gnl\|CDD\|235664	PRK05995, PRK05995, enoyl-CoA hydratase; Provisional.	4.42146e-98
NC_021821.1\|WP_020842274.1\|1608495_1610046_-\|methyl-accepting-chemotaxis-protein	gnl\|CDD\|214599	smart00283, MA, Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer). Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.	2.08724e-62
NC_021821.1\|WP_020842265.1\|1591510_1592704_-\|acetate/propionate-family-kinase	gnl\|CDD\|183528	PRK12440, PRK12440, acetate/propionate family kinase.	0
NC_021821.1\|WP_025632129.1\|1603579_1604818_+\|anaerobic-sulfatase-maturase	gnl\|CDD\|188457	TIGR03942, sulfatase_rSAM, anaerobic sulfatase-maturating enzyme. Members of this protein family are radical SAM family enzymes, maturases that prepare the oxygen-sensitive radical required in the active site of anaerobic sulfatases. This maturase role has led to many misleading legacy annotations suggesting that this enzyme maturase is instead a sulfatase regulatory protein. All members of the seed alignment are radical SAM enzymes encoded next to or near an anaerobic sulfatase. Note that a single genome may encode more than one sulfatase/maturase pair. [Protein fate, Protein modification and repair].	0
NC_021821.1\|WP_005487889.1\|1601366_1602047_-\|MaoC-family-dehydratase	gnl\|CDD\|239534	cd03450, NodN, NodN (nodulation factor N) contains a single hot dog fold similar to those of the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit. Rhizobium and related species form nodules on the roots of their legume hosts, a symbiotic process that requires production of Nod factors, which are signal molecules involved in root hair deformation and meristematic cell division. The nodulation gene products, including NodN, are involved in producing the Nod factors, however the role played by NodN is unclear.	7.87357e-69
NC_021821.1\|WP_020842273.1\|1607216_1608152_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176155	cd08466, PBP2_LeuO, The C-terminal substrate binding domain of LysR-type transcriptional regulator LeuO, an activator of leucine synthesis operon, contains the type 2 periplasmic binding fold. LeuO, a LysR-type transcriptional regulator, was originally identified as an activator of the leucine synthesis operon (leuABCD). Subsequently, LeuO was found to be not a specific regulator of the leu gene but a global regulator of unrelated various genes. LeuO activates bglGFB (utilization of beta-D-glucoside) and represses cadCBA (lysine decarboxylation) and dsrA (encoding a regulatory small RNA for translational control of rpoS and hns). LeuO also regulates the yjjQ-bglJ operon which coding for a LuxR-type transcription factor. In Salmonella enterica serovar Typhi, LeuO is a positive regulator of ompS1 (encoding an outer membrane), ompS2 (encoding a pathogenicity determinant), and assT, while LeuO represses the expression of OmpX and Tpx. Both osmS1 and osmS2 influence virulence in the mouse model of Salmonella. In Vibrio cholerae, LeuO is involved in control of biofilm formation and in the stringent response. The topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	4.88194e-28
NC_021821.1\|WP_020842269.1\|1599066_1599870_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|225117	COG2207, AraC, AraC-type DNA-binding domain-containing proteins [Transcription].	6.54448e-25
NC_021821.1\|WP_005462123.1\|1599874_1600228_-\|DUF3024-domain-containing-protein	gnl\|CDD\|371425	pfam11225, DUF3024, Protein of unknown function (DUF3024). This family of proteins has no known function.	1.37712e-19
NC_021821.1\|WP_005462121.1\|1600484_1601312_+\|phosphate-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270371	cd13653, PBP2_phosphate_like_1, Substrate binding domain of putative ABC-type phosphate transporter, a member of the type 2 periplasmic binding fold superfamily. This subfamily contains uncharacterized phosphate binding domains found in PstS proteins that serve as initial receptors in the ABC transport of phosphate in eubacteria and archaea. After binding the ligand, PstS interacts with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. The PstS proteins belong to the PBP2 superfamily of periplasmic binding proteins that differ in size and ligand specificity, but have similar tertiary structures consisting of two globular subdomains connected by a flexible hinge. They have been shown to bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	4.95335e-86
NC_021821.1\|WP_020842272.1\|1604825_1607195_+\|arylsulfatase	gnl\|CDD\|293749	cd16025, PAS_like, Bacterial Arylsulfatase of Pseudomonas aeruginosa and related proteins. Sulfatases catalyze the hydrolysis of sulfate esters from wide range of substrates, including steroids, carbohydrates and proteins. Sulfate esters may be formed from various alcohols and amines. The biological roles of sulfatase includes the cycling of sulfur in the environment, in the degradation of sulfated glycosaminoglycans and glycolipids in the lysosome, and in remodeling sulfated glycosaminoglycans in the extracellular space. The sulfatases are essential for human metabolism. At least eight human monogenic diseases are caused by the deficiency of individual sulfatases.	0
NC_021821.1\|WP_020842270.1\|1602490_1603444_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|223656	COG0583, LysR, Transcriptional regulator [Transcription].	2.61098e-30
NC_021821.1\|WP_020842258.1\|1583550_1584720_+\|isovaleryl-CoA-dehydrogenase	gnl\|CDD\|173845	cd01156, IVD, Isovaleryl-CoA dehydrogenase. Isovaleryl-CoA dehydrogenase (IVD) is an is an acyl-CoA dehydrogenase, which catalyzes the third step in leucine catabolism, the conversion of isovaleryl-CoA (3-methylbutyryl-CoA) into 3-methylcrotonyl-CoA. IVD is a homotetramer and has the greatest affinity for small branched chain substrates.	0
NC_021821.1\|WP_020842261.1\|1587238_1588141_+\|hydroxymethylglutaryl-CoA-lyase	gnl\|CDD\|180206	PRK05692, PRK05692, hydroxymethylglutaryl-CoA lyase; Provisional.	3.58607e-178
NC_021821.1\|WP_020842263.1\|1588753_1589632_-\|DMT-family-transporter	gnl\|CDD\|273359	TIGR00950, Uncharacterized_inner_membrane_transporter_YicL, Carboxylate/Amino Acid/Amine Transporter. [Transport and binding proteins, Amino acids, peptides and amines].	6.26624e-12
NC_021821.1\|WP_020842262.1\|1588176_1588728_-\|membrane-protein	gnl\|CDD\|227700	COG5413, COG5413, Uncharacterized integral membrane protein [Function unknown].	1.25715e-23
NC_021821.1\|WP_005455792.1\|1583097_1583472_+\|MerR-family-DNA-binding-transcriptional-regulator	gnl\|CDD\|133403	cd04776, HTH_GnyR, Helix-Turn-Helix DNA binding domain of the regulatory protein GnyR. Putative helix-turn-helix (HTH) regulatory protein, GnyR, and other related proteins. GnyR belongs to the gnyRDBHAL cluster, which is involved in acyclic isoprenoid degradation in Pseudomonas aeruginosa. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain predicted winged HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules.	3.20261e-51
NC_021821.1\|WP_020842268.1\|1596988_1598995_+\|exoribonuclease-II	gnl\|CDD\|179920	PRK05054, PRK05054, exoribonuclease II; Provisional.	0
NC_021821.1\|WP_020842264.1\|1589917_1591231_-\|PAS-domain-S-box-protein	gnl\|CDD\|206779	cd11386, MCP_signal, Methyl-accepting chemotaxis protein (MCP), signaling domain. Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.	3.72191e-45
NC_021821.1\|WP_025630942.1\|1593064_1594603_+\|bifunctional-diguanylate-cyclase/phosphodiesterase	gnl\|CDD\|238923	cd01948, EAL, EAL domain. This domain is found in diverse bacterial signaling proteins. It is called EAL after its conserved residues and is also known as domain of unknown function 2 (DUF2). The EAL domain has been shown to stimulate degradation of a second messenger, cyclic di-GMP, and is a good candidate for a diguanylate phosphodiesterase function. Together with the GGDEF domain, EAL might be involved in regulating cell surface adhesiveness in bacteria.	5.88116e-91
NC_021821.1\|WP_020842259.1\|1584754_1586359_+\|methylcrotonoyl-CoA-carboxylase	gnl\|CDD\|178415	PLN02820, PLN02820, 3-methylcrotonyl-CoA carboxylase, beta chain.	0

>NC_021821.1|WP_025630942.1|1593064_1594603_+|bifunctional-diguanylate-cyclase/phosphodiesterase
MTKNICSKTEVPGWTWLLMLISCFIFAYAAFLHAIMKKPVASLLETGVSLLLFGGSIFVVLVIKWSNDSILELHSVAEREKRNAVHDSLTGLPNRKYCFELIDDRIQSGDPFSVILFDVVNFKQVNDAMGHFCGDQLLIQIGQRLQDKLKGSDKIFRVGGDEFVILTSSACEKTGTELIESLDCALSARFHLEEFQVSSRVVFGISTYPYDAISNDLLIKHADIAMYHAKRNGNLFAFYHDDMNVGAKYQLEISSRIQCALEKEEFQLYYQPLIDANTSLAVGFEAVIRWHDENGKTISPNDFIPIAERSNQVHNITMWVLGQVEKDLKTFIEKGIKLPVHVNLSAKDLSSNLLFHRLEKLLENNPQFADLISLEITETMAIDRVVELNPLIHQIKGLGIKISLDDFGTGYSSLSLLRDLPVDQIKIDRSFLCTANRTEGSRSIVENTIALAHGLGYSVVAEGVQDMDTLYFLRSRGCDIIQGYLFCPALPLNEVINWVNEHDDKQSHTRRA
>NC_021821.1|WP_020842265.1|1591510_1592704_-|acetate/propionate-family-kinase
MSNSFVLVINSGSSSLKFAVIDSVSGDAVLSGLGECFGLSDARMSWKFNGEKKEISIEGDDSHHKIAIGKLVGLTEELGLAQDIVAVGHRIVHGGEKFTQTVRITEEVTQEIEKLADLAPLHNPAGAIGIRAAVEAFPSLPQFAVFDTAFHQTMPQRAFTGAIAKELYTDFGIRRYGFHGTSHYFVSREAAKMINKPIEESSFISVHLGNGASVCAINNGESVDTSMGFTPLSGLMMGTRCGDLDPGIIEYLLKKGWSQEKVFNSLNKASGFLGVSGLTSDARGILEAMEEGHEGAALAFQVFTYRVSKYIASYLAALDSFDGIIFTGGIGENSMPIRREILKNLKLLGFVEDVKGNEDARFGNAGVIATSELLGAKALVIPTNEEWVIAQQSVELL
>NC_021821.1|WP_020842264.1|1589917_1591231_-|PAS-domain-S-box-protein
MFFNKSLQQENQRLKQELYSLQQIQQSLDEEMLRLTLDAKGNVTSANQKFLQQLSLSDKDILAKHISDLVPSNVRNTDHFYRMKQSVQAKAFWNGAFQITKGDGEEAWLRVVIQPVRNTSDQVESFFVFASELTRTITTSREYEDMLNALSRSMAVIEFTLDGTVLKANDNFLSTMGYKHEQVVGKHHRIFCLPEEANSSAYHDFWKRLASGQFVTDRFKRVDQYGSVVWLEASYNPIHNDRGELYKVVKFATNITQQVLQEQSMAQAAQLANEVSQETGTQTVQGRQVIGSTLEKMQTLSEQMQQANAAIEDLKAHSSKISELVNSISGIADQTNLLALNAAIEAARAGDHGRGFAVVADEVRQLAMRTNTTTDEIVSMVTENLERTNNAVALISQCQKEALDTLELSEKAGNVMNDIQDGASRVVEAVAQFNRTL
>NC_021821.1|WP_020842263.1|1588753_1589632_-|DMT-family-transporter
MFNSERKATVILVATTMIAALGWIFSKETIQGLPPFGFIGLRFTIASLCLLPLCYRPLKAARLKEVLAASGVGLLLGGAVMTWIYAISISDTLGEGAFIMSLSMLFVPIVAWVMFQQRPQRIFWISLPIAVIGLACLSLAGGWKQSASQLWFLGAALILALHFNVNSKYSQKLPVLLLTCVQLFSAGCLGLLVSFLMESRPEQVDSSIWWWFALSTLLATSLRYVMQTMGQKFVQAGNAALIMILEPVWTVVLSILWYGEVLTANKLVGCLLILFSLVIYRTGGRFRFPKRA
>NC_021821.1|WP_020842262.1|1588176_1588728_-|membrane-protein
MANTEHQETLDFLDKLSVCLYRAGISVFAIALLGLAALESQWLDGMDGRYRAVFAVFAISGAMSASNIHVYSKSVRTIISWSGWIGVILMVCDPELNRVWLALGFIFVTFSGIALKESFCFKVLGLKLVPTLLVVTTFTLWFEQSTIVAISALLAGLIMAYLSIAKWRMPLHFDIGIKANYEV
>NC_021821.1|WP_020842261.1|1587238_1588141_+|hydroxymethylglutaryl-CoA-lyase
MTLPTNVNIVEVGPRDGLQNESPVSTRTKIRLIDLLSDTGLSHIEAGSFVSPKWVPQMADSKEVMQNITRRASVTYSALTPNLQGLEQALDAGANQVAIFTSASEGFCQHNINCSIAESLKRFEPLMVQADKYHIPVRGYLSCVVDCPYDGATSPTQVANISQALIELGCYEVSLGDTIGTGTPNRIKEMLESVLARIPNQRLAVHFHDTWGQALANIYQALSMGINTVDSSVAGLGGCPYAHGASGNVATEDVLYLCQGLGIETGVDLELLAKAGWMISDELQRQPTSKVSQALRHRME
>NC_021821.1|WP_020842260.1|1586396_1587242_+|gamma-carboxygeranoyl-CoA-hydratase
MQERQPSIVPNAQRHNDVLWQVDEFGVATLTLNRTKKHNAFDACMIDLIIHRLDYLALRTDVRCLVLRSNGKHFSSGADLAWMQSMANSTRKENLVDAQSLARLMETLDTFPQPTIAVVQGSAFGGALGLICCSDIAIASNSAQFCLSEVKLGLVPATIAPYVMRAMGNRQARRYILSGEVIPAVKAQQFGIVHEVKKDDELESCVSEVVASLLLNSPDAMRKAKALCEQCHQNPIDSQLIRYTSQLIADIRVSPQGQDGLQAFLEKRPPSWVHQPDAEEE
>NC_021821.1|WP_020842259.1|1584754_1586359_+|methylcrotonoyl-CoA-carboxylase
MAIIKSKTKPTDELFLSNQAAMEMLVEKLQKDIATIKLGGGERAIAHQRQKGKLPVRERISHLLDDGSNFLEIGQFAAWQVYDESIPCAGVVAGIGIIEGVQCMVIANDPSVKGGTYYPLTVKKHLRAQEIAQRCQLPCVYLVDSGGANLPHQSDVFPDKDHFGRIFFNQARMSAKGIPQIAVVMGLCTAGGAYVPAMADVSIMVKEQGTIFLAGPPLVKAATGEVVTGEELGGADVHCRKSGVADYYAENDEHALDLAREAIANANRPKPPKSDSAILPPRYDAEEMYGIVNANLRLSFDVREIIARIVDDSDFDEFKALYGRTLVCGFARIHGQLIGIVANNGILFSDSSQKGAHFIELCAKRKTPLLFLQNITGFMVGKKVEEEGIAKHGAKLVMAVACADVPKFTVIIGGSYGAGNYGMCGRAYDPTMMWMWPNARISVMGGEQAAGVLTQVRKEINQRRGEEWSEQEEHTFKESIIDLYETQGHPYFASARLWDDGIIDPKETRNVLAQALMAALNAPIPDSEFGIFRM
>NC_021821.1|WP_020842258.1|1583550_1584720_+|isovaleryl-CoA-dehydrogenase
MKTSYIPLNFGLGETIDMLRDHVNAFASEHIAPIAADIDHYNQFPSHLWPLLGEMGLLGVTVSEEYGGAEMGYLAHVVAMEEISRASASVALSYGAHSNLCVNQIFRNGTPTQREKYLPKLVDGSHIGALAMSEVNSGSDVVSMQLKAEDKGDHFLLNGTKMWITNGPDADVVVVYAKTDADAGSRGITAFIVERSFTGFSDAQKLDKLGMRGSNTSELVFNNCKVPRENILGALNFGVEVLMSGLDYERVVLAAGPLGIMQACMDIVVPYVHERKQFGKSIGEFQLVQGKLADMYSRMNAAKAYVYTVAAACDRGECTRKDAAGVILYSAELATQMALDAIQLLGGNGYINEYATGRLLRDAKLYEIGAGTSEIRRMLIGRELFEESR
>NC_021821.1|WP_005455792.1|1583097_1583472_+|MerR-family-DNA-binding-transcriptional-regulator
MEKYKISDLAKEFDITTRSIRFYEDVGLIEPERKGNMRVYQRRDKIRLKLILRGKRLGFSLAEIRELFELYDMQQTDEQLLKMLNIIEEKQAVLQQQLNDIGVVMGELNAAKERCLQTLKNNEK
>NC_021821.1|WP_020842268.1|1596988_1598995_+|exoribonuclease-II
MFQDNPLLAQLKQQIQENLPKKEGSIKATDKGFGFLEVDSKTSFFIPPAYMKKCIHGDKVVAIIRTENEREVAEPQELIEQSLTRFIGRVKMFKGKLNVVPDHPQLKKLSLKAKLKKGLKPDNFAEGDWVVAHLVRHPLKGDNTFFVEISEKITDADDKIAPWWVTLAQNDLPNSEPAGIENWELKDDADLERIDMTHVPFVTIDGESTKDMDDALYAKKTESGDFELTIAIADPTAYITPEDEMDKVARERGYTIYLPGRNIPMLPRDLADNLCSLIEGEIRPAICCTVTVSKGGVIGDDIKFFAANIKSHARLAYDHVSDWLENGNSDAWQPSEEIATIVRDLYEFSLARAEWREKNAVVFPDRPDYRFELSEDNDVIAIHADMRRSANRLVEESMITANICAGRTLREKFETGVFNTHAGLKPEKIEEVVQLVNPEGTLEFTAESIATLEGFAALRRWLAVQETSYLDNRIRKFQAYSEVGNQPLPHYAMGLDIYATWTSPIRKYGDMINHRMLKAVILDKEPVQKPDDQVGEELALHRKHHKIAERNVSDWLYARTLADEPSKQTCFTGEIFDINRAGARVRLLENGAAAFIPGALILDNKERIECNGDNGTISIDKEVVYKLGDTLEIVLADVNQENRSLVAKPTQVFADQPAAQTEQTVSEE
>NC_021821.1|WP_020842269.1|1599066_1599870_+|helix-turn-helix-transcriptional-regulator
MPNIEIIRFNHFTARKSERYTATHNGLYVVEEGALVIHQPNGEQFELQAGDFTLYNSSDLRSAEAIPGENGFKAVALVFDISLFCEFKKAHPGLHSEAEHRRFYPFSPESNSEVTQLKNTLLALASRNAPDYTQSHIAMALLSLMVEVQPDILSIIDDASSLTASQKAIKYIEKNIEKDITLEGLAAHMSMSIATLKRRLAAENLSFSQILKVKRINYAATQLRVSQKSITEIAFESGFKSAAHFSTAFKSIYNITPKDFRNQVVRG
>NC_021821.1|WP_005462123.1|1599874_1600228_-|DUF3024-domain-containing-protein
MSVSQMATSRLYKLVQILCSARNANLPVEQGKCLYEPIENGVELHHAHFLLDSQHSEYTSPIAKILFDSQTQLWRFYVPASRSEEIRWIPYKKLPHSHTLEDLLAELESDPQACFWE
>NC_021821.1|WP_005462121.1|1600484_1601312_+|phosphate-ABC-transporter-substrate-binding-protein
MLRFTVATLLAMAVSLPSAMAKEVNISGSTSVARVMDVLAEEYNKTHPDNYIAVQGIGSSAGITMVNKGVVKLGMSSRYLTESEKGEDLNVFPIAYDGLAVVVNRTNSVTNLSAQQLFDIYKGEIKNWKEVGGADQPIAVVTREASSGSRYSFESLLGLTKIINDRLVSDISPNNLVVNSNSMVKTIVNHNTRAIGFISVGSVDLSVKAIQFNGIEPTAANIANHKYKLARPFLVLYKVDSLDQAGKDFVAFLKSEAGQKTIADYGYIPVKNFNQ
>NC_021821.1|WP_005487889.1|1601366_1602047_-|MaoC-family-dehydratase
MKVTNLFKDKVDAISAHQSEFMNWMSPTLRDYWSDFLGKAQNSFLFSNVRDHNQPAVNEEVAPQPAPIVLQPEAQKLYDELIGKIGEVIHTGDWVHVSQERINQFGAVTEDMQWIHTDPERASVESPFKTTIAHGFLTLALLPKLTDSVDADKPLFPTAKLVVNLGLNQVRFPYPVKAGNNVRAVSTLTKVTPIKKGLEIEREIKVEIEGVRRPGAVVVSVIQLHF
>NC_021821.1|WP_020842270.1|1602490_1603444_-|LysR-family-transcriptional-regulator
MIFNYNLLKPLALLLETKSITATANQMSTSASAVSRTLRSLREIFQDELLTRKNGRMELTPKAISIRAKLNNIIHDIDELTEGMSFDPSTSDIKINIAMNSYIAYWLAPEIIQYFSENAPNIELTIEDWNELTPDRINNQLVHFGIHYFPLNLNKNLVQRKVGKDMSVMVCRKDHPINNESISLETIASYPLAIHLQKHWNERQDKLSRLLLSHGIDFKVKLKTTHISVIINAVETTDLLFPCSIYIAEQLDEKFSYVTSSDEVFLPVLEKEFGFIYDKAYKNDPMIVWLHSTISKLMNDFLDVYNKKFDNRYEKSR
>NC_021821.1|WP_025632129.1|1603579_1604818_+|anaerobic-sulfatase-maturase
MAGLHTTVKVVGSKCNYDCQYCFYLEKDLLLKSKKSMNIETLETYIKNYISSQDTPIVEFAWHGGEPTLIGIDFFEKAVEFQKQYANGKLIKNTIQTNGSKLNSDWCRFFRENNFLVGLSLDGPEWLQEKYRTKQGKSAFIESFSALKLLQKMNVEYNVLACVTKEYCKHAEAIYSFFRKNKVKHIQFSPLVESSPLETEQARGQHFGSNLIFSTDKHHTDPQKYEPIAWSVDAKEYGRFLTDVFHLWVSQDVGKVFISNFEQALTQYLGNPSPNCIHAKKCGSSYAVEANGDVYFCDHVAYPESKLGNVFETSLHEMSLNHELQFNKESRLSMRCKQCQFLSLCNGGCPKHRYLSDTGEHENVLCDGYFYFFSSVQKYLQAMTTLLAHGYPASYVMQALDGPLILTPSNKR
>NC_021821.1|WP_020842272.1|1604825_1607195_+|arylsulfatase
MDILKTTVTITGALAPCLVAAGTVDRTKLPIPDIEPQTYTQLDVRDVQRPEPTRRIAAPKDAPNVLVILLDDVGFSQSSLFGGAVDMPTLDALAKQGLIYNQFHTTGVSSATRTALLTGRNHHQNNMGSIAETSTAFPGNTSVRPNYIAALPKILKYNGYSTAMFGKNHEIPAWETGPAGNQTLWPSEVGFDKFYGFFGGETDQFQPVLIDGNTRIKTPRKKNYHFTADMTDQTIEWLNLQHSYNADQPFFAYYAPGAAHAPHQAPREWIDKFKGKFSMGWDKLRQESFERQKKLGIIPQDTVLPPMPDFVPRWDSLSSDEKRVFERQMEVYAGFLAHTDHEIGRVIDTLKKNGEFDNTLIFYIVGDNGASAEGNRNGSFNSLAFYNLITEDPNRVQENIDKLGGPDSFPHYASGWAVAGDSPFTWTKGMSSDFGGTRNGMVVSWPAGIDNKGQPLRDQWSHVVDIAPTVLEAANLPVPKEVDGVEQIPMAGVSFTNTFKETKAQTRHKPQYFELGGNRAIYHEGWLARVTHWALTEGATKFRDLQDDKWELYDTTKDFSLANDLAKSNPQKLEELKKLFDKEAEKNHVYPIDDRTIERMNAEIAGRPDALFGKKSLTLYEGARGIPENSFLNIKNKSFDIVADISTDNASKTNGVIIAQGGNFGGWTLYVKNGVPTFEYNWLTYEYTKVSGSKLKEGKNEIKVAFRYDENGQGGKGNAAGRGKGGNVYLYVNNKLVEKKLIPNTNSRLFSLDDGVGIGEDEGGAVSKDYQAPFEFNQKIEQVTTSIVQ
>NC_021821.1|WP_020842273.1|1607216_1608152_+|LysR-family-transcriptional-regulator
MLIVAQESLLTPVDFPNNSLLEFKMSKAIDLNLINTFIVVAECFSYTKAADKLGVTQPAISASIKRLERTTNTKLFTKRGRNIELTSTAQKWLPQLQQALSVIDSVITQPAPYNVYCSNIYPAQLSKLENVFFHESTLSENHLFSLLYSNEADLLLGDIESREASIIVEDVCREPCVVICRNGHPRINEHISTEMLSDEKHCVLASKWSFDTEFEKHLGLIVKSNNIDSIASNYLGILTHVAQSDCIGVIPLSLAKKWGKTFNIKHFTSPFSACFIQYQIAYHQRKVNCKRHGAMRALIKSRVLEGQQRII
>NC_021821.1|WP_020842274.1|1608495_1610046_-|methyl-accepting-chemotaxis-protein
MSEKEYDYPASYSLVSITDPSSYIKYASAHFNEVAGFEEGELIGKPHNVVRHPDMPKQAFKDLWSHLKAGKHWMGMVKNRRKNGGYYWVDAFASPIKYNGEIVEYQSVRFKPERIYVKRAEKAYAKLRNDKKPLQLYLPRTRLWMRAAFFLFISNFLGLLLLEMNQSPMVAFSAAALLSALSIYMLTRPIEKLAKQARQDFNNPLMEYIYCGKVNDLAEIELAMKMRKQFANALLGRVGVSVKDSCEETKTNADSAADNSERVTENLSAQKIEIDSVATAVNEMQASSSEISHNAQATADATLKAQNTMTDSRNVIDNVNHSVLDLVGELGEISKVVMRLNQQTDQIGTVIEVINGIAEQTNLLALNAAIEAARAGEQGRGFAVVADEVRTLAKRTQESTTEIKSAIESIQHGSKSAVSALEKGNEMSTGTVTLLGTALESIQQLESLIQDVVERNQQIAVAIEEQVYVTDEINENIQSLNLKYSESYDLMTETNQMNSRVQSCTNELSDMIKKFA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_021821_1	1.1\|1594843\|34\|NC_021821\|CRISPRCasFinder	1594843-1594876	34	MK672805	Vibrio phage Va_PF430-3_p42, complete genome	5689-5722	11	0.676
NC_021821_1	1.1\|1594843\|34\|NC_021821\|CRISPRCasFinder	1594843-1594876	34	NZ_CP016452	Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence	230583-230616	11	0.676

1. spacer 1.1|1594843|34|NC_021821|CRISPRCasFinder matches to MK672805 (Vibrio phage Va_PF430-3_p42, complete genome) position: , mismatch: 11, identity: 0.676

ttcacgacgctcaccaccacggttgccaccttcg	CRISPR spacer
accacgatggtcaccaccacggttgcggtcaaaa	Protospacer
 .*****.* **************** ..*   .

2. spacer 1.1|1594843|34|NC_021821|CRISPRCasFinder matches to NZ_CP016452 (Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence) position: , mismatch: 11, identity: 0.676

ttcacgacgctcaccaccacggttgccaccttcg	CRISPR spacer
acgaaagcgctcacaaccacggttgccatctgtc	Protospacer
 . * ..******* *************.** .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1368655 : 1378523

Vibrio_phage(83.33%)

coat,transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029854238.1\|1368655_1369024_-	hypothetical protein	Q858Q3	Vibrio_phage	1.6e-41	71.2
WP_020842134.1\|1369146_1369419_+	hypothetical protein	NA	NA	NA	NA
WP_005488200.1\|1369421_1369637_+	hypothetical protein	A0A1W6UGD1	Vibrio_phage	1.8e-34	98.6
WP_020842135.1\|1369560_1370769_+	replication initiation factor family	Q7DKP2	Vibrio_phage	1.4e-243	99.5
WP_015975173.1\|1370772_1371126_+	DUF1293 family protein	O88148	Vibrio_phage	2.9e-61	100.0
WP_020842136.1\|1371137_1371383_+	hypothetical protein	A0A1W6UH23	Vibrio_phage	1.0e-36	98.8
WP_015975175.1\|1371393_1371627_+\|coat	major coat protein	O88142	Vibrio_phage	1.0e-30	100.0
WP_020842138.1\|1371758_1373288_+	methyl-accepting chemotaxis protein	O88107	Vibrio_phage	8.2e-153	93.2
WP_015975177.1\|1373289_1373604_+	DUF2523 domain-containing protein	O88125	Vibrio_phage	8.0e-47	100.0
WP_020842139.1\|1373600_1374743_+	assembly protein	O88128	Vibrio_phage	1.1e-213	99.2
WP_020842140.1\|1375146_1375470_+	hypothetical protein	Q5QF73	Pseudomonas_virus	8.9e-17	57.5
WP_020842141.1\|1375462_1375744_+	hypothetical protein	NA	NA	NA	NA
WP_020842142.1\|1375830_1376331_+	hypothetical protein	NA	NA	NA	NA
WP_139148879.1\|1376293_1376584_+	hypothetical protein	NA	NA	NA	NA
WP_020842144.1\|1376608_1376983_-	phage protein	Q9MCC4	Vibrio_phage	9.2e-50	78.5
WP_089183838.1\|1377319_1378523_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	1.7e-28	31.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NC_021847

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1093572 : 1100274

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005483011.1\|1093572_1094712_+	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	1.3e-62	41.7
WP_020840182.1\|1094729_1095980_+	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	1.6e-98	48.2
WP_005482986.1\|1096107_1096557_+	transcriptional regulator NrdR	NA	NA	NA	NA
WP_020840183.1\|1096564_1097689_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A1V0SE20	Indivirus	8.9e-48	36.0
WP_005483039.1\|1097701_1098355_+	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	1.6e-33	37.5
WP_020840184.1\|1098524_1099634_+	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	2.0e-63	39.6
WP_005440184.1\|1099803_1100274_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	1.7e-32	49.3

DBSCAN-SWA_2

1542537 : 1552342

Mycobacterium_phage(16.67%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_020840366.1\|1542537_1545624_+	DNA translocase FtsK	A0A218M9A2	Mycobacterium_phage	3.8e-88	49.9
WP_017448307.1\|1545698_1546325_+	outer membrane lipoprotein chaperone LolA	NA	NA	NA	NA
WP_020840367.1\|1546331_1547681_+	replication-associated recombination protein A	G3MBE0	Bacillus_virus	6.4e-85	42.1
WP_020840368.1\|1547772_1549080_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	2.2e-90	42.8
WP_020840369.1\|1549273_1550173_+	N-acetylmuramidase family protein	K4RM41	Pseudomonas_phage	2.2e-36	43.0
WP_079855457.1\|1550147_1550591_+	hypothetical protein	NA	NA	NA	NA
WP_015296513.1\|1550725_1550992_+	DksA/TraR family C4-type zinc finger protein	A0A1S6UBD1	Serratia_phage	3.6e-16	47.7
WP_020840371.1\|1551061_1552342_-	adenosylmethionine--8-amino-7-oxononanoate transaminase	A0A1V0SKB7	Klosneuvirus	1.3e-21	26.7

DBSCAN-SWA_3

2015331 : 2025319

Vibrio_phage(90.91%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_020840615.1\|2015331_2015697_+	phage protein	Q9MCC4	Vibrio_phage	2.8e-59	90.1
WP_020840616.1\|2015742_2016651_-	DUF2971 domain-containing protein	NA	NA	NA	NA
WP_020840618.1\|2017281_2018667_-	toxin	Q783T9	Vibrio_phage	2.1e-264	99.8
WP_005477634.1\|2018671_2019016_-	DUF2523 domain-containing protein	Q783U0	Vibrio_phage	5.0e-58	100.0
WP_041170644.1\|2019017_2020124_-	hypothetical protein	Q783U1	Vibrio_phage	6.5e-152	89.1
WP_005477614.1\|2020700_2020946_-	hypothetical protein	Q783U2	Vibrio_phage	4.3e-32	100.0
WP_005477619.1\|2020951_2021182_-	hypothetical protein	Q783U3	Vibrio_phage	1.6e-36	100.0
WP_005477647.1\|2021185_2021545_-	DUF1293 family protein	Q783U4	Vibrio_phage	9.1e-63	100.0
WP_020840620.1\|2021548_2022757_-	replication initiation factor family	Q783T8	Vibrio_phage	5.2e-243	98.8
WP_005477640.1\|2022680_2022896_-	hypothetical protein	A0A1W6UGD1	Vibrio_phage	3.1e-34	98.6
WP_005490072.1\|2023052_2023421_+	hypothetical protein	Q9MCC3	Vibrio_phage	3.3e-60	98.3
WP_020840621.1\|2023588_2025319_-	response regulator	A0A1V0SGX0	Hokovirus	1.2e-43	31.5

DBSCAN-SWA_4

2365178 : 2388057

Vibrio_phage(88.24%)

capsid,terminase,portal

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_020840878.1\|2365178_2365685_-	hypothetical protein	M4MCN4	Vibrio_phage	1.3e-14	41.3
WP_020840879.1\|2365707_2366385_-	hypothetical protein	M4M9K5	Vibrio_phage	5.6e-29	39.0
WP_020840880.1\|2366377_2366794_-	hypothetical protein	NA	NA	NA	NA
WP_021822615.1\|2366812_2369308_-	fibronectin type III family protein	M4M9M2	Vibrio_phage	1.7e-30	36.0
WP_020840882.1\|2369308_2370919_-	hypothetical protein	M4MHD1	Vibrio_phage	8.4e-132	46.2
WP_020840883.1\|2370918_2371143_-	hypothetical protein	NA	NA	NA	NA
WP_020840884.1\|2371264_2372125_-	DUF4376 domain-containing protein	A0A2I7RB39	Vibrio_phage	5.4e-29	44.3
WP_020840885.1\|2372121_2376492_-	hypothetical protein	M4M9Z4	Vibrio_phage	4.3e-154	36.2
WP_020840886.1\|2376511_2377183_-	hypothetical protein	M4M9I0	Vibrio_phage	9.1e-40	38.9
WP_020840887.1\|2377191_2377770_-	hypothetical protein	A0A1B1ITE9	uncultured_Mediterranean_phage	4.2e-09	28.9
WP_020840888.1\|2377769_2378234_-	hypothetical protein	M4MB04	Vibrio_phage	3.0e-18	36.8
WP_020840889.1\|2378348_2378795_-	hypothetical protein	NA	NA	NA	NA
WP_020840890.1\|2378854_2380078_-\|capsid	N4-gp56 family major capsid protein	M4M9G4	Vibrio_phage	5.9e-170	75.1
WP_127891399.1\|2380092_2381205_-	hypothetical protein	M4M9I4	Vibrio_phage	2.2e-46	40.1
WP_020840892.1\|2381412_2381898_-	hypothetical protein	M4MH86	Vibrio_phage	1.3e-35	46.0
WP_020840893.1\|2381924_2382242_-	hypothetical protein	G4WAN4	Salmonella_phage	2.2e-12	39.0
WP_020840894.1\|2382246_2382759_-	hypothetical protein	NA	NA	NA	NA
WP_020840895.1\|2382778_2384884_-\|portal	portal protein	M4MB09	Vibrio_phage	1.5e-261	70.3
WP_041170708.1\|2384895_2386626_-\|terminase	terminase	M4MCI5	Vibrio_phage	6.4e-186	55.6
WP_020840897.1\|2386678_2387596_-	hypothetical protein	M4M9G7	Vibrio_phage	6.7e-09	21.4
WP_020840898.1\|2387634_2388057_-	hypothetical protein	M4M9H1	Vibrio_phage	3.7e-39	60.3

DBSCAN-SWA_5

2397495 : 2407706

Vibrio_phage(62.5%)

integrase

attL 2399685:2399699|attR 2409437:2409451

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_020840924.1\|2397495_2398305_-	hypothetical protein	A0A2R2ZGJ9	Clostridioides_phage	2.7e-22	38.0
WP_020840925.1\|2398348_2398540_-	hypothetical protein	NA	NA	NA	NA
WP_020840926.1\|2398542_2398692_-	hypothetical protein	NA	NA	NA	NA
WP_020840927.1\|2398699_2399005_-	DUF4406 domain-containing protein	A0A0U2SAZ1	Escherichia_phage	7.3e-13	45.1
WP_020840928.1\|2399001_2399403_-	hypothetical protein	NA	NA	NA	NA
WP_020840929.1\|2399465_2399831_-	hypothetical protein	NA	NA	NA	NA
2399685:2399699	attL	NA	NA	NA	NA
WP_139128357.1\|2399827_2400337_-	hypothetical protein	M4PMR5	Vibrio_phage	6.7e-19	34.4
WP_020840931.1\|2400257_2401217_-	hypothetical protein	A0A1C9LVZ5	Vibrio_phage	3.3e-11	34.7
WP_020840932.1\|2401291_2401606_-	hypothetical protein	NA	NA	NA	NA
WP_139128358.1\|2401894_2402533_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_025541885.1\|2402877_2403285_+	hypothetical protein	R9TMP0	Vibrio_phage	1.0e-22	47.8
WP_020840935.1\|2403298_2404123_+	DUF2303 family protein	R9TRN9	Vibrio_phage	1.4e-58	42.2
WP_020840936.1\|2404188_2405313_+	hypothetical protein	NA	NA	NA	NA
WP_020840937.1\|2405309_2405936_+	adenine methylase	A0A2I7RS54	Vibrio_phage	4.1e-58	60.0
WP_020840938.1\|2405920_2406130_+	hypothetical protein	NA	NA	NA	NA
WP_043043188.1\|2406222_2406564_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_020840940.1\|2406545_2407706_-\|integrase	site-specific integrase	B6ET93	Enterobacteria_phage	2.8e-44	30.3
2409437:2409451	attR	NA	NA	NA	NA

DBSCAN-SWA_6

2710620 : 2743303

Vibrio_phage(88.24%)

capsid,tail,portal,head,terminase,integrase

attL 2712893:2712909|attR 2750121:2750137

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_020841088.1\|2710620_2712570_-	acyltransferase	A0A193GZ69	Enterobacter_phage	5.3e-88	34.6
2712893:2712909	attL	NA	NA	NA	NA
WP_020841089.1\|2713345_2713543_-	hypothetical protein	A0A2I7RNJ8	Vibrio_phage	1.8e-20	84.6
WP_020841090.1\|2713544_2714240_-	hypothetical protein	A0A2I7RNK2	Vibrio_phage	3.7e-121	88.7
WP_020841091.1\|2714230_2714920_-	hypothetical protein	A0A2I7RNK1	Vibrio_phage	6.1e-116	85.2
WP_020841092.1\|2714933_2715470_-	hypothetical protein	A0A2I7RNK5	Vibrio_phage	8.0e-79	86.4
WP_020841093.1\|2715472_2715730_-	hypothetical protein	NA	NA	NA	NA
WP_020841095.1\|2718241_2718844_-	hypothetical protein	A0A2I7RNJ4	Vibrio_phage	1.6e-104	88.0
WP_020841096.1\|2718830_2720018_-	hypothetical protein	A0A2I7RNJ7	Vibrio_phage	4.1e-200	86.1
WP_020841097.1\|2720010_2720358_-	DUF2590 family protein	A0A2I7RNH9	Vibrio_phage	6.5e-50	90.4
WP_020841098.1\|2720357_2722244_-\|tail	phage tail tape measure protein	A0A1D9C9V3	Salinivibrio_phage	2.5e-228	61.2
WP_020841100.1\|2722454_2722718_-	hypothetical protein	A0A2I7RNJ9	Vibrio_phage	3.0e-31	79.3
WP_020841101.1\|2722714_2722996_-	hypothetical protein	NA	NA	NA	NA
WP_020841102.1\|2722996_2723581_-	hypothetical protein	A0A1D9CA16	Salinivibrio_phage	2.2e-53	56.7
WP_020841103.1\|2723586_2724009_-	hypothetical protein	M4M9N1	Vibrio_phage	8.5e-44	61.3
WP_020841104.1\|2724005_2724224_-	hypothetical protein	A0A2I7RNJ6	Vibrio_phage	2.2e-19	72.3
WP_020841105.1\|2724251_2724707_-	DUF2597 family protein	A0A2I7RNI0	Vibrio_phage	2.6e-78	95.4
WP_020841106.1\|2724710_2725841_-	DUF2586 family protein	A0A2I7RNI8	Vibrio_phage	3.6e-190	86.7
WP_020841107.1\|2725856_2726513_-	virion morphogenesis protein	A0A2I7RNI6	Vibrio_phage	4.1e-109	91.3
WP_020841108.1\|2726496_2726991_-\|tail	phage tail protein	A0A2I7RNH2	Vibrio_phage	6.4e-83	92.7
WP_020841109.1\|2726987_2727407_-\|head	head completion/stabilization protein	A0A2I7RNH7	Vibrio_phage	7.9e-58	82.0
WP_020841110.1\|2727517_2728234_-\|terminase	terminase	A0A2I7RNJ0	Vibrio_phage	6.8e-118	83.6
WP_020841111.1\|2728246_2729260_-\|capsid	phage major capsid protein, P2 family	A0A2I7RNH6	Vibrio_phage	5.4e-177	91.1
WP_020841112.1\|2729273_2730164_-	hypothetical protein	A0A2I7RNH1	Vibrio_phage	8.0e-68	57.1
WP_020841113.1\|2730339_2732121_+\|terminase	terminase	A0A2I7RNI3	Vibrio_phage	9.8e-312	91.6
WP_020841114.1\|2732117_2733143_+\|portal	phage portal protein	A0A2I7RNI9	Vibrio_phage	1.4e-145	74.6
WP_020841115.1\|2733504_2734233_-	hypothetical protein	NA	NA	NA	NA
WP_079855376.1\|2734372_2734825_+	transcriptional regulator	A0A2I7RNG8	Vibrio_phage	2.7e-64	77.2
WP_020841118.1\|2734825_2735128_-	hypothetical protein	Q8HA64	Vibrio_phage	1.7e-14	61.1
WP_020841119.1\|2735431_2737945_-	replication endonuclease	A0A166YHE2	Vibrio_phage	9.6e-292	61.3
WP_020841120.1\|2737944_2738169_-	hypothetical protein	NA	NA	NA	NA
WP_020841121.1\|2738165_2738708_-	DNA methyltransferase	U3PDF3	Vibrio_phage	1.7e-84	83.4
WP_020841122.1\|2738718_2739126_-	hypothetical protein	A0A2I7RNG1	Vibrio_phage	3.6e-39	61.7
WP_020841123.1\|2739122_2739677_-	hypothetical protein	U3PB56	Vibrio_phage	3.5e-29	45.6
WP_020841124.1\|2739756_2740107_-	hypothetical protein	NA	NA	NA	NA
WP_079757863.1\|2740116_2740638_-	transcriptional regulator	A0A2I7RNI1	Vibrio_phage	1.2e-76	82.7
WP_020841127.1\|2740808_2741009_-	hypothetical protein	A0A1D9C9M5	Salinivibrio_phage	8.4e-18	61.5
WP_020841128.1\|2741201_2741801_+	phage repressor protein CI	A0A2I7RNF9	Vibrio_phage	1.3e-58	55.3
WP_020841129.1\|2741831_2742269_+	hypothetical protein	U3PDE6	Vibrio_phage	2.3e-12	30.7
WP_020841130.1\|2742268_2743303_+\|integrase	tyrosine-type recombinase/integrase	A0A2I7RNH5	Vibrio_phage	3.3e-182	91.2
2750121:2750137	attR	NA	NA	NA	NA

DBSCAN-SWA_7

3154556 : 3171945

Klosneuvirus(18.18%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005455546.1\|3154556_3157139_-\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	1.0e-78	37.9
WP_005455548.1\|3157281_3157749_-	recombination regulator RecX	NA	NA	NA	NA
WP_005478550.1\|3157872_3158916_-	recombinase RecA	A0A2D1GPX2	Mycobacterium_phage	8.1e-112	60.7
WP_020841267.1\|3159116_3159599_-	nicotinamide-nucleotide amidase	B5TK85	Pseudomonas_phage	8.3e-27	48.1
WP_020841268.1\|3159683_3162245_+	DNA mismatch repair protein MutS	A0A1V0SJ67	Klosneuvirus	2.0e-34	24.8
WP_041170661.1\|3162323_3163310_-	RNA polymerase sigma factor RpoS	F4YCU2	Synechococcus_phage	6.9e-36	35.2
WP_005455560.1\|3163387_3164311_-	peptidoglycan DD-metalloendopeptidase family protein	D7RWE0	Brochothrix_phage	4.1e-06	35.2
WP_005455562.1\|3164325_3164952_-	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	1.3e-35	52.1
WP_020841269.1\|3164951_3165728_-	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	6.6e-66	52.4
WP_020841270.1\|3165727_3166771_-\|tRNA	tRNA pseudouridine(13) synthase TruD	NA	NA	NA	NA
WP_005380896.1\|3166817_3167294_-	2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase	NA	NA	NA	NA
WP_020841271.1\|3167311_3168016_-	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	A0A2H4UTB4	Bodo_saltans_virus	2.0e-05	25.0
WP_005455577.1\|3168017_3168299_-	cell division protein FtsB	NA	NA	NA	NA
WP_005455579.1\|3168924_3170226_-	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	4.2e-134	59.2
WP_005455581.1\|3170304_3171945_-	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	4.2e-155	52.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_021821

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NC_021847

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection