CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NC_021278	Mycobacteroides abscessus subsp. bolletii 50594 plasmid 1, complete sequence	0 crisprs	c2c9_V-U4	0	2
NC_021282	Mycobacteroides abscessus subsp. bolletii 50594, complete sequence	1 crisprs	cas3,DEDDh,csa3,DinG,cas4,WYL	1	7
NC_021279	Mycobacteroides abscessus subsp. bolletii 50594 plasmid 2, complete sequence	0 crisprs	c2c9_V-U4	0	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

2318 : 64900

Enterobacteria_phage(15.38%)

transposase,integrase

attL 26206:26222|attR 31792:31808

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016343783.1\|2318_3521_+\|integrase	tyrosine-type recombinase/integrase	A8ATM2	Listeria_phage	2.7e-10	24.4
WP_079276886.1\|3540_5745_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_016343785.1\|5741_6149_+	hypothetical protein	NA	NA	NA	NA
WP_158022859.1\|6278_7549_-\|transposase	IS3 family transposase	Q6H9S6	Enterobacteria_phage	2.5e-54	44.4
WP_016343787.1\|7723_8563_-	adenine-specific DNA methyltransferase	A0A076YNT4	Mesorhizobium_phage	1.2e-68	65.4
WP_158022920.1\|8737_10561_+	AAA domain-containing protein	K4I1H4	Acidithiobacillus_phage	1.1e-13	31.2
WP_041928115.1\|10770_11922_+	hypothetical protein	NA	NA	NA	NA
WP_162145472.1\|12006_12492_-	hypothetical protein	NA	NA	NA	NA
WP_051223683.1\|13884_14160_-	hypothetical protein	G8I4U6	Mycobacterium_phage	1.3e-05	42.4
WP_016343794.1\|14888_15368_-	hypothetical protein	NA	NA	NA	NA
WP_036438668.1\|15939_17877_-	Rieske 2Fe-2S domain-containing protein	A0A0P0YLY7	Yellowstone_lake_phycodnavirus	1.5e-29	25.4
WP_016343796.1\|17879_18893_-	DUF4331 family protein	NA	NA	NA	NA
WP_016343797.1\|19067_19700_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_016343798.1\|19980_20697_+	flavodoxin family protein	NA	NA	NA	NA
WP_016343799.1\|21368_22571_+	Na+/H+ antiporter-like protein	NA	NA	NA	NA
WP_016343800.1\|23330_23738_-	cupin domain-containing protein	NA	NA	NA	NA
WP_158022925.1\|23869_24043_-	hypothetical protein	NA	NA	NA	NA
WP_016343801.1\|24900_25299_-	hypothetical protein	NA	NA	NA	NA
WP_051223711.1\|25291_26551_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
26206:26222	attL	NA	NA	NA	NA
WP_016343803.1\|27443_29276_-	hypothetical protein	NA	NA	NA	NA
WP_041928199.1\|29272_30091_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_016343806.1\|32488_32698_+	hypothetical protein	NA	NA	NA	NA
31792:31808	attR	NA	NA	NA	NA
WP_158022927.1\|32966_33995_+	hypothetical protein	NA	NA	NA	NA
WP_016343807.1\|34328_34877_+	hypothetical protein	NA	NA	NA	NA
WP_016343808.1\|35005_35302_+	hypothetical protein	NA	NA	NA	NA
WP_016343809.1\|35282_35525_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_016343810.1\|35915_36569_+\|transposase	TnsA-like heteromeric transposase endonuclease subunit	NA	NA	NA	NA
WP_016343813.1\|38326_39451_+	AAA family ATPase	NA	NA	NA	NA
WP_079276887.1\|39447_40356_+	TniQ family protein	NA	NA	NA	NA
WP_162145473.1\|40418_41717_+	hypothetical protein	NA	NA	NA	NA
WP_041927470.1\|41654_42890_-\|transposase	IS256 family transposase	A0A220NQR7	Corynebacterium_phage	1.2e-82	44.6
WP_016343816.1\|43601_44993_+\|transposase	transposase	A0A7P9	Microcystis_virus	5.0e-24	29.2
WP_158022931.1\|44989_45448_+	hypothetical protein	NA	NA	NA	NA
WP_016343818.1\|45517_45856_-	hypothetical protein	NA	NA	NA	NA
WP_016343819.1\|45855_47619_-	hypothetical protein	NA	NA	NA	NA
WP_041928124.1\|47632_47899_-	DUF2694 family protein	NA	NA	NA	NA
WP_016343821.1\|47951_49076_-	DUF4226 domain-containing protein	NA	NA	NA	NA
WP_041928216.1\|49648_51592_+	hypothetical protein	V5UNW4	Mycobacterium_phage	8.0e-145	46.3
WP_016343823.1\|51772_52588_-	ATP-binding protein	U5N3V8	Enterobacteria_phage	2.4e-50	42.1
WP_016343824.1\|52587_53805_-\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_158022933.1\|53837_54116_-	hypothetical protein	NA	NA	NA	NA
WP_041927470.1\|54362_55598_+\|transposase	IS256 family transposase	A0A220NQR7	Corynebacterium_phage	1.2e-82	44.6
WP_016343825.1\|56165_56474_-	hypothetical protein	NA	NA	NA	NA
WP_016343826.1\|56736_57198_+	hypothetical protein	NA	NA	NA	NA
WP_041928130.1\|57274_57700_-	hypothetical protein	NA	NA	NA	NA
WP_158022935.1\|58019_58997_-	AAA family ATPase	H7BUL8	unidentified_phage	2.2e-10	27.0
WP_016343829.1\|60997_62071_+	hypothetical protein	A0A2H4JA91	uncultured_Caudovirales_phage	4.6e-09	42.7
WP_016343831.1\|64105_64900_+\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_2

83742 : 135443

Bacillus_phage(14.29%)

transposase,integrase

attL 82788:82803|attR 138955:138970

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
82788:82803	attL	NA	NA	NA	NA
WP_079276894.1\|83742_84996_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_099188425.1\|85718_87596_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_158022940.1\|87676_88018_+	hypothetical protein	NA	NA	NA	NA
WP_158022942.1\|89376_89520_-	hypothetical protein	NA	NA	NA	NA
WP_016343849.1\|89899_90826_-	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_016343850.1\|91302_92079_-	haloacid dehalogenase type II	NA	NA	NA	NA
WP_016343851.1\|92075_93104_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_016343852.1\|93090_93777_-	response regulator transcription factor	W8CYM9	Bacillus_phage	4.2e-32	36.7
WP_095786048.1\|93892_94549_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_016343854.1\|94545_95208_+	DUF2064 domain-containing protein	NA	NA	NA	NA
WP_016343855.1\|95209_95839_+	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_016343856.1\|95835_96939_+	molybdopterin-dependent oxidoreductase	NA	NA	NA	NA
WP_016343857.1\|96935_97394_+	hypothetical protein	NA	NA	NA	NA
WP_016343858.1\|97319_98669_-	hypothetical protein	NA	NA	NA	NA
WP_016343859.1\|98714_99137_-	heavy metal-responsive transcriptional regulator	NA	NA	NA	NA
WP_016343860.1\|99399_99762_+	hypothetical protein	NA	NA	NA	NA
WP_016343861.1\|99792_100269_-	peroxiredoxin family protein	NA	NA	NA	NA
WP_016343862.1\|100661_101321_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_016343863.1\|101415_101982_+	redoxin domain-containing protein	NA	NA	NA	NA
WP_016343864.1\|102186_102432_+	hypothetical protein	NA	NA	NA	NA
WP_016343865.1\|102497_103472_+	zinc-binding dehydrogenase	E3SJ82	Synechococcus_phage	1.6e-05	25.4
WP_016343866.1\|103510_104107_-	CGNR zinc finger domain-containing protein	NA	NA	NA	NA
WP_016343867.1\|104206_104776_+	TIGR03086 family protein	NA	NA	NA	NA
WP_109776941.1\|104875_106378_+	molybdopterin-dependent oxidoreductase	NA	NA	NA	NA
WP_016343869.1\|106374_107406_+	NAD-dependent epimerase/dehydratase family protein	A0A2H4UUK0	Bodo_saltans_virus	6.5e-21	28.8
WP_162145477.1\|107536_108046_+	RNA polymerase sigma factor	NA	NA	NA	NA
WP_016343871.1\|108042_108747_+	Rieske (2Fe-2S) protein	NA	NA	NA	NA
WP_079276897.1\|108996_109302_+	cupredoxin family copper-binding protein	NA	NA	NA	NA
WP_016343873.1\|109298_110240_+	metallophosphoesterase	NA	NA	NA	NA
WP_048896566.1\|110272_110632_+	hypothetical protein	NA	NA	NA	NA
WP_041928147.1\|113089_113416_+	hypothetical protein	NA	NA	NA	NA
WP_041928149.1\|114113_114692_+	hypothetical protein	NA	NA	NA	NA
WP_041928152.1\|114670_115222_-	DUF4226 domain-containing protein	NA	NA	NA	NA
WP_041928154.1\|115345_116029_+	hypothetical protein	NA	NA	NA	NA
WP_041927470.1\|116280_117516_-\|transposase	IS256 family transposase	A0A220NQR7	Corynebacterium_phage	1.2e-82	44.6
WP_041928156.1\|117698_118655_+	hypothetical protein	NA	NA	NA	NA
WP_162145474.1\|118793_118949_-	hypothetical protein	NA	NA	NA	NA
WP_041928158.1\|119155_120070_+	hypothetical protein	NA	NA	NA	NA
WP_158022946.1\|120119_120860_+	hypothetical protein	NA	NA	NA	NA
WP_016343880.1\|121226_121487_-	hypothetical protein	NA	NA	NA	NA
WP_016343881.1\|121664_122912_+	hypothetical protein	NA	NA	NA	NA
WP_016343882.1\|123183_123882_+	hypothetical protein	NA	NA	NA	NA
WP_016343883.1\|123946_124894_+	ImmA/IrrE family metallo-endopeptidase	B6SBZ6	Clostridium_virus	9.6e-11	26.2
WP_016343884.1\|125248_125443_-	hypothetical protein	NA	NA	NA	NA
WP_016343885.1\|125650_126034_-	hypothetical protein	NA	NA	NA	NA
WP_016343886.1\|126389_126977_+	hypothetical protein	NA	NA	NA	NA
WP_041928164.1\|127100_128594_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	A0A2H4JEQ4	uncultured_Caudovirales_phage	8.6e-06	25.1
WP_016343888.1\|128590_129406_+	AAA family ATPase	NA	NA	NA	NA
WP_016343889.1\|129960_130695_+	hypothetical protein	NA	NA	NA	NA
WP_016343890.1\|130744_131989_+	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_016343891.1\|132067_133225_+\|integrase	tyrosine-type recombinase/integrase	S5MBZ0	Brevibacillus_phage	5.8e-10	32.6
WP_016343892.1\|133208_135443_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
138955:138970	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NC_021282

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_021282_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_021282_1

989931-990018

Orphan

Consensus_repeat	Method
CGGCTGCTACAACGGCGTGTGCGGTGGCTGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_021282_1

>merge|NC_021282|1|989931-990018|CRISPRCasFinder
CGGCTGCTACAACGGCGTGTGCGGTGGCTGGAACCCCGGCCAGGGTGGTTGGGGCCACGGCTGCTACAACGGCGTGTGCGGTGGCTGG

>NC_021282|1|1|989931-990018|CRISPRCasFinder
CGGCTGCTACAACGGCGTGTGCGGTGGCTGG	AACCCCGGCCAGGGTGGTTGGGGCCA
CGGCTGCTACAACGGCGTGTGCGGTGGCTGG

Protein	Signature genes	Signature genes Name	Protein_function
NC_021282.1\|WP_016341950.1\|993984_995505_+\|aldehyde-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|143434
NC_021282.1\|WP_005063556.1\|987791_988007_+\|antitoxin	unknown	unknown	gnl\|CDD\|379416
NC_021282.1\|WP_005063548.1\|991580_993593_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340868
NC_021282.1\|WP_005063545.1\|995485_995920_+\|DUF779-domain-containing-protein	unknown	unknown	gnl\|CDD\|377532
NC_021282.1\|WP_005065999.1\|989202_989646_+\|SRPBCC-family-protein	unknown	unknown	gnl\|CDD\|378454
NC_021282.1\|WP_005102410.1\|988029_989166_+\|lipase	unknown	unknown	gnl\|CDD\|367570
NC_021282.1\|WP_005063540.1\|999474_1000680_-\|DNA-polymerase-IV	unknown	unknown	gnl\|CDD\|179663
NC_021282.1\|WP_016341947.1\|986903_987737_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|225852
NC_021282.1\|WP_005066003.1\|993753_993909_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|239527
NC_021282.1\|WP_005063562.1\|981845_982577_+\|enoyl-CoA-hydratase	unknown	unknown	gnl\|CDD\|236115
NC_021282.1\|WP_016341948.1\|990054_990975_-\|LLM-class-flavin-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|274648
NC_021282.1\|WP_005063558.1\|984471_986874_+\|cation-translocating-P-type-ATPase	unknown	unknown	gnl\|CDD\|319795
NC_021282.1\|WP_005063565.1\|980171_980753_+\|hypothetical-protein	unknown	unknown	unknown
NC_021282.1\|WP_005063549.1\|991066_991630_+\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380066
NC_021282.1\|WP_005066010.1\|997793_998540_-\|peroxide-stress-protein-YaaA	unknown	unknown	gnl\|CDD\|234999
NC_021282.1\|WP_005118343.1\|982579_983680_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|293841
NC_021282.1\|WP_005063544.1\|996013_997804_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|223021
NC_021282.1\|WP_005116170.1\|980732_981830_-\|NAD(P)/FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|224983
NC_021282.1\|WP_005063541.1\|998665_999448_+\|VOC-family-protein	unknown	unknown	gnl\|CDD\|319911
NC_021282.1\|WP_016341946.1\|983676_984354_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|379312

Protein	Function_ID	Function_description	E-value
NC_021282.1\|WP_016341950.1\|993984_995505_+\|aldehyde-dehydrogenase-family-protein	gnl\|CDD\|143434	cd07116, ALDH_ACDHII-AcoD, Ralstonia eutrophus NAD+-dependent acetaldehyde dehydrogenase II-like. Included in this CD is the NAD+-dependent, acetaldehyde dehydrogenase II (AcDHII, AcoD, EC=1.2.1.3) from Ralstonia (Alcaligenes) eutrophus H16 involved in the catabolism of acetoin and ethanol, and similar proteins, such as, the dimeric dihydrolipoamide dehydrogenase of the acetoin dehydrogenase enzyme system of Klebsiella pneumonia. Also included are sequences similar to the NAD+-dependent chloroacetaldehyde dehydrogenases (AldA and AldB) of Xanthobacter autotrophicus GJ10 which are involved in the degradation of 1,2-dichloroethane. These proteins apparently require RpoN factors for expression.	0
NC_021282.1\|WP_005063556.1\|987791_988007_+\|antitoxin	gnl\|CDD\|379416	pfam14013, MT0933_antitox, MT0933-like antitoxin protein. This family of proteins contains the MT0933 protein, which has been identified as an antitoxin to /protein MT0934. This family of proteins is found in bacteria. Proteins in this family are typically between 61 and 90 amino acids in length.	4.21227e-08
NC_021282.1\|WP_005063548.1\|991580_993593_-\|MFS-transporter	gnl\|CDD\|340868	cd06179, MFS_TRI12_like, Fungal trichothecene efflux pump (TRI12) of the Major Facilitator Superfamily of transporters. This family includes Fusarium sporotrichioides trichothecene efflux pump (TRI12), which may play a role in F. sporotrichioides self-protection against trichothecenes. TRI12 belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.84197e-66
NC_021282.1\|WP_005065999.1\|989202_989646_+\|SRPBCC-family-protein	gnl\|CDD\|378454	pfam10604, Polyketide_cyc2, Polyketide cyclase / dehydrase and lipid transport. This family contains polyketide cylcases/dehydrases which are enzymes involved in polyketide synthesis. It also includes other proteins of the START superfamily.	6.54669e-14
NC_021282.1\|WP_005102410.1\|988029_989166_+\|lipase	gnl\|CDD\|367570	pfam03583, LIP, Secretory lipase. These lipases are expressed and secreted during the infection cycle of these pathogens. In particular, C. albicans has a large number of different lipases, possibly reflecting broad lipolytic activity, which may contribute to the persistence and virulence of C. albicans in human tissue.	5.45097e-17
NC_021282.1\|WP_005063540.1\|999474_1000680_-\|DNA-polymerase-IV	gnl\|CDD\|179663	PRK03858, PRK03858, DNA polymerase IV; Validated.	0
NC_021282.1\|WP_016341947.1\|986903_987737_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|225852	COG3315, COG3315, O-Methyltransferase involved in polyketide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism].	1.7515e-47
NC_021282.1\|WP_005066003.1\|993753_993909_+\|hypothetical-protein	gnl\|CDD\|239527	cd03443, PaaI_thioesterase, PaaI_thioesterase is a tetrameric acyl-CoA thioesterase with a hot dog fold and one of several proteins responsible for phenylacetic acid (PA) degradation in bacteria. Although orthologs of PaaI exist in archaea and eukaryotes, their function has not been determined. Sequence similarity between PaaI, E. coli medium chain acyl-CoA thioesterase II, and human thioesterase III suggests they all belong to the same thioesterase superfamily. The conserved fold present in these thioesterases is referred to as an asymmetric hot dog fold, similar to those of 4-hydroxybenzoyl-CoA thioesterase (4HBT) and the beta-hydroxydecanoyl-ACP dehydratases (FabA/FabZ).	1.90021e-05
NC_021282.1\|WP_005063562.1\|981845_982577_+\|enoyl-CoA-hydratase	gnl\|CDD\|236115	PRK07854, PRK07854, enoyl-CoA hydratase; Provisional.	5.5316e-136
NC_021282.1\|WP_016341948.1\|990054_990975_-\|LLM-class-flavin-dependent-oxidoreductase	gnl\|CDD\|274648	TIGR03560, F420_Rv1855c, probable F420-dependent oxidoreductase, Rv1855c family. Coenzyme F420 has a limited phylogenetic distribution, including methanogenic archaea, Mycobacterium tuberculosis and related species, Colwellia psychrerythraea 34H, Rhodopseudomonas palustris HaA2, and others. Partial phylogenetic profiling identifies protein subfamilies, within the larger family called luciferase-like monooxygenanases (pfam00296), that appear only in F420-positive genomes and are likely to be F420-dependent. This model describes one such subfamily, exemplified by Rv1855c from Mycobacterium tuberculosis. [Unknown function, Enzymes of unknown specificity].	3.16234e-71
NC_021282.1\|WP_005063558.1\|984471_986874_+\|cation-translocating-P-type-ATPase	gnl\|CDD\|319795	cd02609, P-type_ATPase, uncharacterized subfamily of P-type ATPase transporter, similar to uncharacterized Streptococcus pneumoniae exported protein 7, Exp7. This subfamily contains P-type ATPase transporters of unknown function, similar to Streptococcus pneumoniae Exp7. The P-type ATPases, are a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids. They are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle. A general characteristic of P-type ATPases is a bundle of transmembrane helices which make up the transport path, and three domains on the cytoplasmic side of the membrane. Members include pumps that transport various light metal ions, such as H(+), Na(+), K(+), Ca(2+), and Mg(2+), pumps that transport indispensable trace elements, such as Zn(2+) and Cu(2+), pumps that remove toxic heavy metal ions, such as Cd(2+), and pumps such as aminophospholipid translocases which transport phosphatidylserine and phosphatidylethanolamine.	0
NC_021282.1\|WP_005063545.1\|995485_995920_+\|DUF779-domain-containing-protein	gnl\|CDD\|377532	pfam05610, DUF779, Protein of unknown function (DUF779). This family consists of several bacterial proteins of unknown function.	2.62965e-69
NC_021282.1\|WP_005063549.1\|991066_991630_+\|TetR-family-transcriptional-regulator	gnl\|CDD\|380066	pfam17940, TetR_C_31, Tetracyclin repressor-like, C-terminal domain. This is the C-terminal domain found in putative transcriptional regulator, TetR family proteins.	6.62571e-07
NC_021282.1\|WP_005066010.1\|997793_998540_-\|peroxide-stress-protein-YaaA	gnl\|CDD\|234999	PRK02101, PRK02101, peroxide stress protein YaaA.	1.51257e-69
NC_021282.1\|WP_005118343.1\|982579_983680_+\|hypothetical-protein	gnl\|CDD\|293841	cd16283, RomA-like_MBL-fold, Enterobacter cloacae RomA and related proteins; MBL-fold metallo hydrolase domain. Derepression of the romA-ramA locus results in a multidrug-resistance phenotype. Members of this subgroup belong to the MBL-fold metallo-hydrolase superfamily which is comprised mainly of hydrolytic enzymes which carry out a variety of biological functions. The class B metal beta-lactamases (MBLs) from which this fold was named are only a small fraction of the activities which are included in this superfamily. Activities carried out by superfamily members include class B beta-lactamases, hydroxyacylglutathione hydrolases, AHL (acyl homoserine lactone) lactonases, persulfide dioxygenases, flavodiiron proteins, cleavage and polyadenylation specificity factors such as the Int9 and Int11 subunits of Integrator, Sdsa1-like and AtsA-like arylsulfatases, 5'-exonucleases human SNM1A and yeast Pso2p, ribonuclease J and ribonuclease Z, cyclic nucleotide phosphodiesterases, insecticide hydrolases, and proteins required for natural transformation competence. Classical members of the superfamily are di-, or less commonly mono-, zinc-ion-dependent hydrolases, however the diversity of biological roles is reflected in variations in the active site metallo-chemistry.	7.12276e-68
NC_021282.1\|WP_005063544.1\|996013_997804_+\|hypothetical-protein	gnl\|CDD\|223021	PHA03247, PHA03247, large tegument protein UL36; Provisional.	0.000103621
NC_021282.1\|WP_005116170.1\|980732_981830_-\|NAD(P)/FAD-dependent-oxidoreductase	gnl\|CDD\|224983	COG2072, TrkA, Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism].	2.16826e-35
NC_021282.1\|WP_005063541.1\|998665_999448_+\|VOC-family-protein	gnl\|CDD\|319911	cd07247, SgaA_N_like, N-terminal domain of Streptomyces griseus SgaA and similar domains. SgaA suppresses the growth disturbances caused by high osmolarity and a high concentration of A-factor, a microbial hormone, during the early growth phase in Streptomyces griseus. A-factor (2-isocapryloyl-3R-hydroxymethyl-gamma-butyrolactone) controls morphological differentiation and secondary metabolism in Streptomyces griseus. It is a chemical signaling molecule that at a very low concentration acts as a switch for yellow pigment production, aerial mycelium formation, streptomycin production, and streptomycin resistance. The structure and amino acid sequence of SgaA are closely related to a group of antibiotics resistance proteins, including bleomycin resistance protein, mitomycin resistance protein, and fosfomycin resistance proteins. SgaA might also function as a streptomycin resistance protein.	1.84839e-40
NC_021282.1\|WP_016341946.1\|983676_984354_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	8.95291e-22

>NC_021282.1|WP_005065999.1|989202_989646_+|SRPBCC-family-protein
MAAKLNSSIDVPLPPEEAWAHASDLRRFDEWLSVHTAWRSALPETLEKGTVIDSIVCVKGMYNRVRWTLQKYDPPTGLFLDGQGRGGVKVKLRVTISPKGSGSVVDFNLHLGGPAMFGPIGAVVAAALRSDIDASLAKFVQVFAAAP
>NC_021282.1|WP_005102410.1|988029_989166_+|lipase
MLVLITAACARVEAEGVAPQPPSPPPGEVLSDVPLSLAPDLDAIADGHLIRYMSTSGATGTPTEVTGVVFAPKGEPPQAGWPIVSVGHGTTGLDDECAVSRAPDLRGYIWLVRNLSKRGWVVAITDYEGLGVPGPHPYLEPRSEGFNVIDAARAAVSLIPGASTKWAAIGASQGGQATWAASELAGNYASELEFVGSANLSPAADLTDMATHVGDGRYHWSQLSMMPTLLTGLSVTVPELRPENFLHGSFQDIPQDKALLLGCHNGLDPARSAAIGRLRAKDFHGTSPADPIVFAAALKRIALPLGPASGPMFVYAGGADRLIEAGWIHAAVRRACALGDTVQEVVSPGKGHVDPEGERLGVQWIADRFAGLPAPSNC
>NC_021282.1|WP_005063556.1|987791_988007_+|antitoxin
MADFKGLIDKLKSLLAGNKDKVNEAVDKVGDTIDSKTGGKYSAVVDKVQDAAKSAVEKVEGAAAPKDGDAQ
>NC_021282.1|WP_016341947.1|986903_987737_-|class-I-SAM-dependent-methyltransferase
MLVRVTDPVKITLTGAPETMLATLYGRAQDATSPNSVLHDHYAAEAVARIDYDFSKTKIKGTQAIGVALRARQLDDWTSEFLTAHREATVLHLACGLDTRVFRINPSETVRWVDVDYPDVIALRRALLPCREGDYRMIGSSVSEATWLDSIPADRPTLAVFEGLTMYLTEAEGQSLIRRITGRFPSGQLAFDCYGSIGIKLQKLVPAVRNAGATLHWGIDDPGQIEALHPGLRCVSDLRSTDVAGEEHLPLSGRIQMKVISHLPALRDIDRIMRFSF
>NC_021282.1|WP_005063558.1|984471_986874_+|cation-translocating-P-type-ATPase
MATIEGLTISGLTAAEVAERVAQGKTNDVPSRAARSVSDIVRANVFTRINAILGVLLIIVLSTGSIINGAFGLLIIANSAVGIIQELRAKQTLDKLAIVGQTRPLVRRDGAATALAPNEVVLDDIIELGPGDQIVVDGEVIEESALEIDESLLTGEADAIEKTIGSQVLSGSFVVAGSGAYRATKVGREAYAAKLAEEASKFTLVHSELRNGINKILQFITYLLLPAGALIIYTQLFTTDDSWQESVLRMVGALVPMVPEGLVLMTSIAFAVGVIRLGRRQCLVQELPAIEGLARVDTVCADKTGTLTENGMRLADVRFPDRDGDEDALAVLAQLAADDPRPNASIAAIAEAYDTPPGWETTAIAPFSSAKKWSGASYGDHGNWVIGAPDVLLDPADAIATAAEEIGARGLRVLLLASAELSVDDAYAPGAVTPRALVVLEQKIRPDARETLDYFASQHVSIKVISGDNAVSVSAVAQTLGLTGAAVDARTLPTDTDKLAATLADATTFGRVRPDQKRAMVKALQSHGHTVAMTGDGVNDVLALKDADIGVAMGAGSSASRAVAQIVLLDNKFATLPYVVAEGRRVIGNIERVSNLFLTKTVYSVLLALTVGLAGLGSKIFHYGAVPFPFQPIHVTIAAWFTIGIPAFILSLAPNNERAQTGFVRRVMLSAIPSGLTVGIATFLSYLLARQILHVSGNSTQASTAALITELVAAVWVLAVVARPYQWWRVVLVALSGLGYVAIFAIPLARKAFMLDPGNLAVTGPALGIGIAAAAVIEAVWWLQGKWSGQPRHFWATGED
>NC_021282.1|WP_016341946.1|983676_984354_-|class-I-SAM-dependent-methyltransferase
MTSNELPDWDATYQGKGELFQGEPPWNIGEPQPELAALIDAGKFHGTVLDVGCGHAETSLRLAALGHTTVGLDLSPTAIEAARAAAAERGLTNATFEVADITDFSGYDGRFNTIVDSTLFHSIPVEAREAYLRSISRAAAPDASYFVLVFAVGAFPPGIGPNAVTEDELRAAVEPYWAIDELSSAYIHSNIPEVIPGANFEMPVFHKDEKGRNKQPAFLLQAHKR
>NC_021282.1|WP_005118343.1|982579_983680_+|hypothetical-protein
MRALWVGAGAAIASTWIGRALRDVPQTLGASKGRIAEVAKGSPQYRGGTFHNAEPARQFSPDAETTTVVWDVLTRRSVGTPKGQVPLAVPEFAGPPADLAATWFGHSSVLVEIDGYRVLTDPVWSDRCSPSRVVGPHRQHPVPVELSALPALDAVVISHDHYDHLDMDSIIALTRSQNAVFVVPLGVGAHLRGWGVSPARVIELDWDQSHQLGKLTLTCTQARHFSGRSIARNTTLWASWAFAGPKHKVFFGGDTGYTKAFKVIGDTYGPFDLTLLPVGAYNTSWADIHMNPEEAVQTHLDLATAQAPLLPIHWATFNLALHPWAEPIERVLAAAEEQGVTVVTPRPGQRADARRPAAPDDWWRLS
>NC_021282.1|WP_005063562.1|981845_982577_+|enoyl-CoA-hydratase
MIGVTSDGPVTTIELQRPERRNAVTYELALAFAEEVKKAAETARAIVVTGQGTSFCAGADLSSGAPDPDKFADAWQHSIKSVDAADIPVIAAVNGPAIGAGVMLAMVADLRVVSETARFQFPVAKYGIALDNWSIRRLTSLVGYGRARAMLLAAEPLDAQTALQTGMANRIGELADAQAWAAELAGFAPLALKHAKRVLNDDGAFEDQWPEHKELFDKAWGSQDIIEAQVARIQKRPPNFQGA
>NC_021282.1|WP_005116170.1|980732_981830_-|NAD(P)/FAD-dependent-oxidoreductase
MAPMTTVAVIGGGQAGIAAGYFLRRRGLEPLSRRQPADAPGHGFVILDHSPGPGGAWQFRWPTLTLDNTNRIYQLPGLPFDEMGAIRASTAMPRYFGEYEDRYALDVRRPVHVRAVRPARGGFTIDTSVGEFPVDGLINATGTWDKPFVPFVPGAGTFRGRQLHTHDYQRPEEFTGQHVLVVGGGISAVQLLIEIAGIDSVTTSWVTRREPVFVTDLTVDRLRAAVAGVDERSRRGEPQRSVVSATGLPWTAETAEAARRGVLTRRPMFSRITPTGVTWPDGSALEVDVILWCTGFRHALDHLAPLHLRNGRGGITMTGRLLTQVAGQPAIHLLGYGSSASTIGANRASRAAVVELMNYLEGRTA
>NC_021282.1|WP_005063565.1|980171_980753_+|hypothetical-protein
MCAALGVGLLSGGAAVAHADPAFPDLSGFAVVPPDGFFVTNENSSVRSIHFSTPDGIGCMFRASPNMTPTSRQRLSCDGAVPGIPGDAPNAPNVPGIGGASANVPGLGGVNIPGVGTCPMGTVAQKGDGAFEISKGAWSCGTKPEAPLLNVGQKLTYGNVTCAVGAGSVTACQVVTGDQKHGFVLQPSGSTSF
>NC_021282.1|WP_016341948.1|990054_990975_-|LLM-class-flavin-dependent-oxidoreductase
MRFSIWGQTNQSWADLLDIAQYADDGTWRAFYAADHFMSHADTAEERTDFHEATALFAALAAATSRIRLAPLVLSMTFRHPAVLANWAATVDHVSQGRFTLGLGAGWQENEHQRYGLELGKPGARVDRFSEGLQVITGLLNEPATTVDGQYYRLAEGICEPKPLQRPLPILIGATQPRMLALTARYAHEWNQWSSPGTFREVSGRLDAAAEKIGRDPATIWRSTQARVIVTDGPQSEARAAETAAASPIPVLYGTAERIAEQMAPWAQEGVDEVILPDHLLGSGSARRDAYDALAQALRPLSNEKG
>NC_021282.1|WP_005063549.1|991066_991630_+|TetR-family-transcriptional-regulator
MIAAAIEVAGTMGIGGLTYRSVDAAANVPSGTTSNHFRTRDALLLGAILEIEKLRRAFWRALVTEINPTTVSDLVGIGTAYANGAVGAMSTRVRAYMALLMEGWSHPELREPLQRGRDAQIPRTLHLMCKVDPKTPQLHAEIFQDYLTGIIYQQLANPVADFNPRPGIEALLTALVTPPQTPRAAQR
>NC_021282.1|WP_005063548.1|991580_993593_-|MFS-transporter
MISVQRRNLIFVAVLLGMLLAALDGTIVATALPTVVADLGDAGHQSWVVTSYLLASTVATAVMGKFGDLFGRRTVFITCIVIFAGGSLLCGMAGSMAMLVGARAIQGLGSGGLMVTATALIGEIIPMRERGRYQGILGAVFGVTTVIGPLLGGLFTDHLGWRWAFYINLPISVVVIMVAAGAIPALAKATHPVIDYWGIVLIGLGASALTLATSWGGTTYPWSSPVIIGLFASSIAAIGTFVWVESRVPEPILPPRLFRDPVFTICCVLSFVVGFAMLGVMTYLPTFMQFVNGVSATVSGLRTLPMVAGMLITSTGTGTLVGRTGRYKRYPVAGTAIMAIALVLLSRMDDSTPFVLQSLYLFILGVGIGASMQVLTLIVQNTARFDDLGVATSGVTFFRTIGSSFGAAIFGSLFSNFLTRELSSVNTPPQATQSPQALHALPHDAAVPVIHAYADSLDLVFLCAAPVAAVGFVLALFLKEVPLRGADTSLAVDMGEGFGMPNSVSPDKLLEIAIGNAMRGFPHVGLRKLREHAGVSMPIAPLWALVQANRFLRATGSAEVSRIAQWYRIPPEIVDPAFNELVANGYALRTNDHIWLTDSGREEVDKISEAINQYLIERLSRTPDFEDRADREQIQAALERISRRIVTDTDWRENPIAALPAASGAASPAR
>NC_021282.1|WP_005066003.1|993753_993909_+|hypothetical-protein
MCGYGCLASLPEGASGCTTVELKTNFLGAAREGKLTAAVFRCTQLVLWPRG
>NC_021282.1|WP_016341950.1|993984_995505_+|aldehyde-dehydrogenase-family-protein
MAKYAAPGTEGSAVTFAPRYENFIGGEWVAPADGQYFENASPIDGKVFTQVARGTAPDIEKALDAAHAAAEGWGNTSAAERSNALLRIADRMEQHIERLAVAETWDNGKPIRESLNADIPLAIDHFRYFAGVLRAQEGSISEIDHDTVAYHFHEPLGVVGQIIPWNFPLLLAVWKLAPALAAGNCVVLKPAEQTPASILVLMELIADLLPSGTVNVVNGFGVEAGKPLASSPRIAKIAFTGETTTGRLIMQYATENIIPVTLELGGKSPNIFMPDVMAADDAFLDKALEGFTMFALNQGEVCTCPSRALVHASIYDEFIARAITRVEAIVGGDPLDEDTMIGAQASNDQYEKILSYIDIGRQEGAQVLTGGDARKVAEYPDGAYIQPTVFAGTNNMRIFQEEIFGPVLSVAKFDSLDEALKIANDTLYGLGAGVWSRDMTNAYRLGRGIKAGRVWTNCYHQYPAHAAFGGYKKSGIGRENHKMMLDHYQQTKNILVSYSPDAAGFF
>NC_021282.1|WP_005063545.1|995485_995920_+|DUF779-domain-containing-protein
MPRASSDEGSPGESRILINRVELTPAAAELLASLVAKHGPVMFHQSGGCCDGSAPMCYPRGEFRVGASDVLLGEVSRDTPFWMSADQFEYWSHTHLTVDVVPGRGSGFSLEAPEGVRFLIRSRLFTDDEVLALANQPVRTGADG
>NC_021282.1|WP_005063544.1|996013_997804_+|hypothetical-protein
MHVGIRTVAVAAVCGLCVGAGVDARAVRPNLSIAGTPTTRSVSSQAVSLASFSDLLAAAAPQNDAAAQMNSVGGGAVSSTDLIGTVAKLLAAPNITQSSVTPGINTAAVDTVDSPSSEPVDPPTGQPADPPAADEPAPPTNFPGERPAFGTPSYFAQLAFAVFHVVALPITVPVQFFLGSAEGVPTVIAAAINDLSGLLGQIPGLSPQQPTEPQPQQTAQSSSPLQKQAAAETGPTTDPEPPAEPLPTNFPGPRPAFGTPSYFAQLAFAVLHVLALPITVPVQAIIGKTEGVPSVIVAALNDLSSLLGQVPKLSAPVTDTKTTPQDSTSRQADKAAPTLDSASEKPETATSGADAKTSKIERNEHEGKTADKAAEAPKAEHETKPGAASEGTPKTDSAKEVVESKADPTKVVESKADPTKAVEPKADPTKVVEPKVDPAKVVEPKTDPAKAVEPKADTVAEPAKPESSKAEVAKPVTAKPETKVQPAKPESAGPVKVTRDSLKSTPGETGTTGGTKTTEGSKGSVTDSKTPAASTDTKVHDGLKPAVGAKPDKPADKPSTEKSSSEKSGSSSEGSSHSSESKSHSSEGKSHSGSKD
>NC_021282.1|WP_005066010.1|997793_998540_-|peroxide-stress-protein-YaaA
MIVLLPPSETKHEGGDGPPLRLNELATPTLNPLREALVDELIALAAEPDACRQALGISASQDAEIQRNAELRISPTMPALHRYTGVLYDNLDVTSLRGASATRARERLAVGSALFGLLRADDPVPAYRLSASSKLPGKPTLAARWRPVLEPVLAELAAGELVVDLRSGSYAGLGRLPHAVTVDCLTEHPDGRRTVITHFNKAHKGKLARILAGSRAEPNDAASVATVARRAGLHVERDGNTLTIVVSP
>NC_021282.1|WP_005063541.1|998665_999448_+|VOC-family-protein
MPTRDETPLGAPAWIDLASSDLEKSKAFYSALFGWTLQDAGPEYGGYINAHKDGKAVAGMITNNPEWNAPDAWTTYFATDDIDATLQKAVAHGGTNCLPPMEVPQLGYMALFADPAGAMVGLWQPLAHKGFQLVGEGGAPAWHELNTREYDRAVDFYTTVLGWNTKTEGDSADFRYACAQHDGAPIAGINDASVGQWALPEGVPAHWAVYFGTDDTDAGAAKATELGGVVLAPAQDTPYGRMALIRDTTGATFWLCSVDS
>NC_021282.1|WP_005063540.1|999474_1000680_-|DNA-polymerase-IV
MTGTASILHADLDSFYASVEQRDTPALRDRPVIVGGGVVLAASYEAKHCGVRTAMGGRQALRLCPHAVVVPPRFDAYSAASKLVFEVFRDTTPLVEPLSIDEAFLDVSGLLRISGAPRDIAAALRVEVRRRAGLPITVGIARTKFLAKVASRQGKPDGLLVVEPHEELSFLRPLPVQALWGVGSVTAEKLRVYGIRTVADVADLGESTLASMVGRAMGHQLHCLANNIDPRRVDGGRRRRSIGAQCALGRGPRADSEIDAIATQLMERIARRMRGTGRSCRTVVLRLRFGDYARATRSRTMPRPTTSTERLLSVARELVKDAGPLIKERGITLIGFSVSNFDPCGAAQLELPFSDAAENTLALDSTLDGLRNRFGTRSVTRANLLHGGGREEWGIPTFEDL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_021282_1	1.1\|989962\|26\|NC_021282\|CRISPRCasFinder	989962-989987	26	NZ_CP032323	Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence	418376-418401	5	0.808
NC_021282_1	1.1\|989962\|26\|NC_021282\|CRISPRCasFinder	989962-989987	26	NZ_CP007795	Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence	678153-678178	5	0.808
NC_021282_1	1.1\|989962\|26\|NC_021282\|CRISPRCasFinder	989962-989987	26	NZ_CP029333	Mycobacterium avium subsp. hominissuis strain MAC109 plasmid pMAC109a, complete sequence	54049-54074	6	0.769
NC_021282_1	1.1\|989962\|26\|NC_021282\|CRISPRCasFinder	989962-989987	26	NC_022654	Mycobacterium kansasii ATCC 12478 plasmid pMK12478, complete sequence	143457-143482	6	0.769

1. spacer 1.1|989962|26|NC_021282|CRISPRCasFinder matches to NZ_CP032323 (Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence) position: , mismatch: 5, identity: 0.808

aaccccggccagggtggttggggcca	CRISPR spacer
gaccccggccagggtggtcgcggcgg	Protospacer
.*****************.* *** .

2. spacer 1.1|989962|26|NC_021282|CRISPRCasFinder matches to NZ_CP007795 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence) position: , mismatch: 5, identity: 0.808

aaccccggccagggtggttggggcca	CRISPR spacer
gaccccggccagggtggtcgcggcgg	Protospacer
.*****************.* *** .

3. spacer 1.1|989962|26|NC_021282|CRISPRCasFinder matches to NZ_CP029333 (Mycobacterium avium subsp. hominissuis strain MAC109 plasmid pMAC109a, complete sequence) position: , mismatch: 6, identity: 0.769

aaccccggccagggtggttggggcca	CRISPR spacer
ttgcccggcgagggtggttggggcac	Protospacer
   ****** **************

4. spacer 1.1|989962|26|NC_021282|CRISPRCasFinder matches to NC_022654 (Mycobacterium kansasii ATCC 12478 plasmid pMK12478, complete sequence) position: , mismatch: 6, identity: 0.769

aaccccggccagggtggttggggcca	CRISPR spacer
ttgcccggcgagggtggttggggcac	Protospacer
   ****** **************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

801539 : 817068

Mycobacterium_phage(86.67%)

terminase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016341847.1\|801539_805232_-	hypothetical protein	Q854Y3	Mycobacterium_virus	1.8e-193	40.1
WP_016341848.1\|805246_805558_-	hypothetical protein	A0A2P1JR40	Mycobacterium_phage	7.2e-24	62.8
WP_016341849.1\|805670_806132_-	hypothetical protein	A0A0A7RVK9	Mycobacterium_phage	1.8e-26	42.1
WP_016341850.1\|806231_807311_-	hypothetical protein	A0A2H4PED2	Mycobacterium_phage	9.5e-63	46.1
WP_016341851.1\|807408_807819_-	hypothetical protein	NA	NA	NA	NA
WP_016341852.1\|807818_808178_-	HK97 gp10 family phage protein	NA	NA	NA	NA
WP_016341853.1\|808177_808585_-	hypothetical protein	NA	NA	NA	NA
WP_016341854.1\|808584_808947_-	hypothetical protein	A0A218M9J6	Mycobacterium_phage	1.6e-30	57.5
WP_016341855.1\|808951_809401_-	hypothetical protein	NA	NA	NA	NA
WP_016341856.1\|809400_810312_-	hypothetical protein	A0A2K9VEV5	Mycobacterium_phage	3.4e-138	80.7
WP_005070916.1\|810328_810706_-	hypothetical protein	W8EH90	Mycobacterium_phage	6.2e-46	82.4
WP_016341857.1\|810709_811963_-\|protease	Clp protease	A0A1B3AZ47	Gordonia_phage	1.9e-86	51.3
WP_016341858.1\|811956_813405_-	hypothetical protein	A0A249XTF7	Mycobacterium_phage	6.3e-171	66.0
WP_041927552.1\|813419_814832_-\|terminase	terminase	R4TCB6	Mycobacterium_phage	1.9e-151	56.8
WP_016341860.1\|814980_815382_-	hypothetical protein	A0A023ZWK1	Mycobacterium_phage	1.0e-06	34.0
WP_016341861.1\|815542_815995_-	AAA family ATPase	A0A1D8EX78	Mycobacterium_phage	1.3e-53	66.7
WP_057138219.1\|815991_816255_-	hypothetical protein	A0A1D8EX45	Mycobacterium_phage	3.7e-29	71.3
WP_016341863.1\|816361_816760_-	hypothetical protein	A0A088F7V7	Mycobacterium_phage	3.2e-16	53.3
WP_041927847.1\|816756_817068_-	hypothetical protein	A0A2H4PD32	Mycobacterium_phage	1.1e-29	62.1

DBSCAN-SWA_2

824452 : 834376

Mycobacterium_phage(72.73%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_041927565.1\|824452_825364_-	hypothetical protein	A0A1B3B1T0	Gordonia_phage	1.3e-41	62.6
WP_016341873.1\|825443_825812_-	hypothetical protein	G8I4T1	Mycobacterium_phage	2.0e-52	81.0
WP_051223575.1\|825811_826141_-	hypothetical protein	Q853R9	Mycobacterium_phage	2.3e-20	46.6
WP_016341876.1\|826526_827546_-	site-specific DNA-methyltransferase	A0A166YCK5	Gordonia_phage	3.6e-120	61.5
WP_016341877.1\|827542_828079_-	hypothetical protein	A0A142F2K5	Mycobacterium_phage	5.2e-46	56.6
WP_016341878.1\|828075_828492_-	hypothetical protein	NA	NA	NA	NA
WP_016341879.1\|828488_829019_-	hypothetical protein	A0A1D8ERW9	Mycobacterium_phage	1.4e-38	51.4
WP_016341880.1\|829046_829883_-	DUF2303 family protein	G8I4S3	Mycobacterium_phage	3.5e-105	65.8
WP_005123095.1\|829910_830252_-	hypothetical protein	G8I4S2	Mycobacterium_phage	1.5e-35	68.1
WP_016341881.1\|830254_831376_-	hypothetical protein	A0A2P1CGD3	Mycobacterium_phage	7.2e-98	69.3
WP_016341882.1\|831372_832266_-	recE	A0A2D1G8R5	Mycobacterium_phage	1.1e-77	50.3
WP_016341883.1\|832465_832753_-	hypothetical protein	NA	NA	NA	NA
WP_016341884.1\|832752_833073_-	hypothetical protein	NA	NA	NA	NA
WP_016341885.1\|833069_833456_-	hypothetical protein	NA	NA	NA	NA
WP_016341886.1\|833560_834376_-	phage antirepressor KilAC domain-containing protein	A0A159B6D6	Gordonia_phage	6.3e-51	45.0

DBSCAN-SWA_3

1573439 : 1654260

Mycobacterium_phage(66.67%)

tail,transposase,portal,capsid,integrase

attL 1573263:1573307|attR 1644763:1644807

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1573263:1573307	attL	NA	NA	NA	NA
WP_016342200.1\|1573439_1574708_+\|integrase	tyrosine-type recombinase/integrase	A0A059VKS6	Mycobacterium_phage	4.4e-120	53.7
WP_016342201.1\|1574704_1575340_-	DUF732 domain-containing protein	NA	NA	NA	NA
WP_016342203.1\|1575775_1576009_-	DUF3263 domain-containing protein	A0A0A7RXU7	Mycobacterium_phage	3.3e-13	60.3
WP_016342204.1\|1576005_1576428_-	ImmA/IrrE family metallo-endopeptidase	A0A2P1A0T3	Gordonia_phage	2.5e-35	54.4
WP_050597077.1\|1576537_1577158_+	NYN domain-containing protein	NA	NA	NA	NA
WP_005122201.1\|1579636_1579876_+	helix-turn-helix transcriptional regulator	A0A0A7RVM8	Mycobacterium_phage	2.7e-18	71.2
WP_005122202.1\|1579875_1580763_+	hypothetical protein	NA	NA	NA	NA
WP_032668141.1\|1580908_1581631_+	hypothetical protein	G8I4X5	Mycobacterium_virus	1.6e-45	40.6
WP_016342208.1\|1581632_1581932_+	hypothetical protein	A0A088F7N3	Mycobacterium_phage	1.9e-29	66.0
WP_005122206.1\|1581928_1582114_+	hypothetical protein	NA	NA	NA	NA
WP_016342209.1\|1582211_1582520_+	DUF732 domain-containing protein	NA	NA	NA	NA
WP_041927615.1\|1582516_1582765_+	hypothetical protein	NA	NA	NA	NA
WP_016342210.1\|1583729_1584854_+	hypothetical protein	NA	NA	NA	NA
WP_016342212.1\|1585137_1585449_+	hypothetical protein	NA	NA	NA	NA
WP_016342213.1\|1585445_1586084_+	ERF family protein	A0A1B0XTM7	Freshwater_phage	3.1e-45	65.0
WP_079276843.1\|1586118_1586436_+	hypothetical protein	A0A2H4JBJ1	uncultured_Caudovirales_phage	3.9e-09	41.0
WP_041927617.1\|1586423_1587107_+	hypothetical protein	G1D0U2	Mycobacterium_virus	1.1e-19	33.5
WP_158022851.1\|1590496_1590658_+	hypothetical protein	NA	NA	NA	NA
WP_041927619.1\|1590805_1591069_+	hypothetical protein	A0A2D1G9M8	Mycobacterium_phage	5.5e-09	40.0
WP_158022853.1\|1591065_1591239_+	hypothetical protein	NA	NA	NA	NA
WP_016342219.1\|1591235_1591457_+	hypothetical protein	A0A068F4K6	Mycobacterium_phage	6.5e-11	51.3
WP_158022855.1\|1591725_1591941_+	hypothetical protein	NA	NA	NA	NA
WP_016342221.1\|1592121_1592439_+	WhiB family transcriptional regulator	A0A2P1JRB7	Mycobacterium_phage	4.2e-11	44.2
WP_016342222.1\|1592438_1592726_+	WhiB family transcriptional regulator	A0A2P1JRB7	Mycobacterium_phage	1.1e-10	37.8
WP_016342223.1\|1592764_1593007_+	hypothetical protein	G1D3X4	Mycobacterium_virus	1.8e-09	53.1
WP_158022857.1\|1593003_1593294_+	hypothetical protein	NA	NA	NA	NA
WP_016342225.1\|1593615_1594053_+	DUF4326 domain-containing protein	A0A142KC74	Gordonia_phage	9.8e-27	46.7
WP_016342226.1\|1594049_1594712_+	hypothetical protein	A0A2L0HK00	Mycobacterium_phage	1.1e-48	46.2
WP_016342228.1\|1594989_1595349_-	type II toxin-antitoxin system HicB family antitoxin	NA	NA	NA	NA
WP_016342229.1\|1595345_1595609_-	HicA family toxin-antitoxin system toxin component	A0A2P1A0R7	Gordonia_phage	9.8e-06	56.8
WP_016342230.1\|1595821_1596313_+	HNH endonuclease	A0A0N9ESC4	Pseudomonas_phage	5.0e-19	47.5
WP_158022859.1\|1596956_1598227_-\|transposase	IS3 family transposase	A0A160DCU2	Gordonia_phage	1.8e-52	40.4
WP_016342235.1\|1598351_1598681_+	hypothetical protein	A0A088FQ47	Mycobacterium_phage	2.2e-15	44.4
WP_016342236.1\|1598718_1599063_+	hypothetical protein	NA	NA	NA	NA
WP_051223592.1\|1599101_1599344_+	hypothetical protein	A0A068F4K6	Mycobacterium_phage	2.0e-05	40.3
WP_016342238.1\|1599557_1599842_+	hypothetical protein	A0A059VG69	Mycobacterium_phage	3.7e-27	68.2
WP_041927897.1\|1600373_1600655_-	DUF732 domain-containing protein	NA	NA	NA	NA
WP_016342240.1\|1600784_1602047_+	glycosyltransferase	G8I6V8	Mycobacterium_virus	4.2e-70	72.6
WP_016342241.1\|1602053_1602878_+	hypothetical protein	S5VVU3	Mycobacterium_phage	7.4e-76	54.3
WP_016342242.1\|1604238_1604934_+	hypothetical protein	A0A0A1ENE4	Mycobacterium_phage	1.3e-89	71.7
WP_041927625.1\|1604933_1605179_+	hypothetical protein	NA	NA	NA	NA
WP_005110295.1\|1605178_1605595_+	hypothetical protein	A0A068F2M6	Mycobacterium_phage	6.3e-23	50.4
WP_158022859.1\|1605773_1607043_+\|transposase	IS3 family transposase	A0A160DCU2	Gordonia_phage	1.8e-52	40.4
WP_079276779.1\|1607030_1607978_+\|portal	phage portal protein	Q9ZX72	Mycobacterium_phage	1.1e-102	68.2
WP_158022859.1\|1608076_1609347_-\|transposase	IS3 family transposase	A0A160DCU2	Gordonia_phage	1.8e-52	40.4
WP_016342244.1\|1609667_1610093_+	hypothetical protein	A0A076G833	Mycobacterium_phage	1.2e-50	68.5
WP_016342245.1\|1610070_1611852_+	hypothetical protein	A0A076GDP6	Mycobacterium_phage	1.6e-280	77.2
WP_158022859.1\|1612393_1613663_+\|transposase	IS3 family transposase	A0A160DCU2	Gordonia_phage	1.8e-52	40.4
WP_041927627.1\|1614205_1614520_+	hypothetical protein	NA	NA	NA	NA
WP_158022859.1\|1614638_1615909_-\|transposase	IS3 family transposase	A0A160DCU2	Gordonia_phage	1.8e-52	40.4
WP_041927628.1\|1615973_1616504_+	DUF4355 domain-containing protein	A0A2R4AQA8	Mycobacterium_phage	3.7e-28	47.4
WP_016342250.1\|1616560_1617469_+\|capsid	phage major capsid protein	A0A221J736	Mycobacterium_phage	4.4e-122	76.9
WP_041927629.1\|1617961_1618189_+	hypothetical protein	G8I4C3	Mycobacterium_phage	7.4e-10	50.0
WP_016342252.1\|1618188_1618455_+	hypothetical protein	A0A068F3C1	Mycobacterium_phage	6.8e-15	51.2
WP_016342253.1\|1618454_1618832_+	hypothetical protein	NA	NA	NA	NA
WP_005067417.1\|1618898_1619486_+	hypothetical protein	A0A068F8K4	Mycobacterium_phage	1.6e-69	67.2
WP_016342254.1\|1619580_1619847_+	hypothetical protein	A0A068F4G7	Mycobacterium_phage	2.9e-13	44.7
WP_005067420.1\|1619963_1620275_+	hypothetical protein	A0A068F4G7	Mycobacterium_phage	4.0e-14	43.7
WP_016342255.1\|1620285_1624284_+\|tail	phage tail tape measure protein	A0A068F1L4	Mycobacterium_phage	1.2e-293	59.9
WP_016342256.1\|1624283_1625387_+	hypothetical protein	A0A068F3C3	Mycobacterium_phage	3.5e-153	67.9
WP_016342257.1\|1625389_1627186_+	hypothetical protein	A0A068F4H3	Mycobacterium_phage	5.9e-235	62.5
WP_041927901.1\|1627281_1627719_+	hypothetical protein	A0A068F2D2	Mycobacterium_phage	7.5e-35	51.8
WP_005110315.1\|1627711_1628797_+\|tail	tail protein	A0A068F8L3	Mycobacterium_phage	1.4e-151	67.8
WP_016342260.1\|1631237_1631438_+	hypothetical protein	NA	NA	NA	NA
WP_016342261.1\|1631438_1632593_+	hypothetical protein	NA	NA	NA	NA
WP_016342262.1\|1632608_1632992_+	hypothetical protein	A0A222ZQF4	Mycobacterium_phage	1.6e-41	68.5
WP_157929202.1\|1632988_1633126_+	hypothetical protein	NA	NA	NA	NA
WP_016342264.1\|1633125_1634571_+	chitinase	A0A249XQG4	Mycobacterium_phage	9.1e-162	62.1
WP_016342265.1\|1634573_1635014_+	hypothetical protein	NA	NA	NA	NA
WP_041927903.1\|1635064_1635979_+	hypothetical protein	A0A2P1CCW0	Mycobacterium_phage	1.2e-55	43.3
WP_041927904.1\|1636313_1637441_+	hypothetical protein	S5W0N6	Mycobacterium_phage	1.7e-118	57.6
WP_016342268.1\|1637437_1638085_+	HNH endonuclease	A0A076YKH2	Mycobacterium_phage	6.6e-19	60.0
WP_016342270.1\|1638315_1638636_-	hypothetical protein	R4TBK1	Mycobacterium_phage	6.5e-12	41.5
WP_079276780.1\|1638816_1639008_+	hypothetical protein	A0A222ZRJ5	Mycobacterium_phage	1.6e-05	61.5
WP_041927470.1\|1639081_1640317_+\|transposase	IS256 family transposase	A0A220NQR7	Corynebacterium_phage	1.2e-82	44.6
WP_016342272.1\|1640556_1640934_+	DUF2746 domain-containing protein	NA	NA	NA	NA
WP_016342273.1\|1640972_1641278_+	hypothetical protein	A0A1D8EQ56	Mycobacterium_phage	3.8e-09	43.4
WP_016342274.1\|1641316_1641643_+	hypothetical protein	NA	NA	NA	NA
WP_041927630.1\|1641730_1642102_-	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_016342275.1\|1642102_1642621_-	hypothetical protein	NA	NA	NA	NA
WP_041927906.1\|1642617_1644081_-	hypothetical protein	NA	NA	NA	NA
WP_016342277.1\|1644108_1644432_-	WXG100 family type VII secretion target	NA	NA	NA	NA
WP_041927631.1\|1644421_1644697_-	WXG100 family type VII secretion target	NA	NA	NA	NA
WP_005060026.1\|1644993_1646214_+	L,D-transpeptidase family protein	NA	NA	NA	NA
1644763:1644807	attR	NA	NA	NA	NA
WP_016342278.1\|1646283_1647171_-	hypothetical protein	NA	NA	NA	NA
WP_005099075.1\|1647817_1648558_-	oligoribonuclease	M4M9I5	Vibrio_phage	2.3e-23	39.0
WP_005099072.1\|1648571_1650098_+	DUF853 family protein	A0A248XCZ8	Klebsiella_phage	3.6e-60	37.7
WP_016342279.1\|1650136_1651087_-	diiron oxygenase	NA	NA	NA	NA
WP_025982906.1\|1651213_1651891_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_005060038.1\|1651869_1652673_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_041927470.1\|1653024_1654260_-\|transposase	IS256 family transposase	A0A220NQR7	Corynebacterium_phage	1.2e-82	44.6

DBSCAN-SWA_4

2869338 : 2877865

Streptococcus_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005057568.1\|2869338_2870010_-	MBL fold metallo-hydrolase	A0A1X9I5D3	Streptococcus_phage	4.9e-17	31.1
WP_005057567.1\|2870123_2871047_+	peptidylprolyl isomerase	A0A1V0SCU1	Indivirus	1.1e-08	31.6
WP_016342804.1\|2871048_2871918_+	class A beta-lactamase	A0A077SL40	Escherichia_phage	5.7e-42	38.7
WP_005057565.1\|2872008_2874375_-	RelA/SpoT family protein	A0A291L9W9	Bordetella_phage	1.8e-13	38.4
WP_016342805.1\|2874405_2874939_-	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	1.1e-14	36.4
WP_016342806.1\|2874935_2876612_-	hypothetical protein	NA	NA	NA	NA
WP_025982461.1\|2876611_2877865_-	protein translocase subunit SecF	A0A1B1IVP7	uncultured_Mediterranean_phage	1.5e-22	28.6

DBSCAN-SWA_5

3392845 : 3402188

Bacillus_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_162098388.1\|3392845_3395014_-	class 1b ribonucleoside-diphosphate reductase subunit alpha	V9VI16	Lactococcus_phage	1.5e-208	51.5
WP_016343037.1\|3394980_3395451_-	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	A0A217ER62	Bacillus_phage	1.5e-09	30.3
WP_005056596.1\|3395479_3395722_-	redoxin NrdH	V5UN81	Mycobacterium_phage	1.8e-22	67.5
WP_041927470.1\|3397557_3398793_-\|transposase	IS256 family transposase	A0A220NQR7	Corynebacterium_phage	1.2e-82	44.6
WP_016891234.1\|3399183_3399732_-	NAD(P)H-dependent oxidoreductase	NA	NA	NA	NA
WP_005103245.1\|3399848_3400463_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_005056589.1\|3400485_3401307_+	ammonia-dependent NAD(+) synthetase	G3MA24	Bacillus_virus	2.9e-80	55.2
WP_016343040.1\|3401303_3402188_-	SDR family oxidoreductase	W8CYX9	Bacillus_phage	2.3e-06	35.1

DBSCAN-SWA_6

3450419 : 3480450

Mycobacterium_phage(59.26%)

portal

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016343089.1\|3450419_3452093_+	bifunctional DNA primase/polymerase	S5Y832	Mycobacterium_phage	5.4e-81	44.0
WP_016343090.1\|3452356_3452848_+	recombination endonuclease VII	A0A220NQC3	Rhodococcus_phage	7.9e-33	55.9
WP_016343091.1\|3452844_3453351_+	hypothetical protein	NA	NA	NA	NA
WP_016343092.1\|3453347_3453761_+	hypothetical protein	NA	NA	NA	NA
WP_005094086.1\|3453762_3454440_+	hypothetical protein	G9FH23	Rhodococcus_phage	5.1e-22	38.8
WP_005100616.1\|3454567_3454804_+	hypothetical protein	G9FH24	Rhodococcus_phage	2.3e-14	57.1
WP_016343093.1\|3454800_3454941_+	hypothetical protein	NA	NA	NA	NA
WP_016343094.1\|3454946_3455135_+	hypothetical protein	NA	NA	NA	NA
WP_016343095.1\|3455131_3455410_+	HNH endonuclease	A0A1D8EQ93	Mycobacterium_phage	2.7e-22	58.0
WP_131809300.1\|3455406_3455601_+	hypothetical protein	NA	NA	NA	NA
WP_016343096.1\|3455771_3456023_+	hypothetical protein	NA	NA	NA	NA
WP_016343097.1\|3456030_3457878_+	hypothetical protein	A0A1I9SBW6	Mycobacterium_phage	5.1e-141	53.3
WP_016343098.1\|3457878_3459357_+\|portal	phage portal protein	A0A2P1A0M6	Gordonia_phage	1.6e-132	51.9
WP_016343099.1\|3459337_3460243_+	hypothetical protein	A0A088FUW7	Mycobacterium_phage	1.2e-79	54.2
WP_005100030.1\|3460388_3460946_+	hypothetical protein	A0A166XYP9	Gordonia_phage	1.1e-17	38.7
WP_016343100.1\|3460990_3461365_+	hypothetical protein	A0A2P1A0L4	Gordonia_phage	2.4e-45	72.4
WP_016343101.1\|3461379_3462417_+	hypothetical protein	A0A166XYQ6	Gordonia_phage	1.1e-121	63.9
WP_016343102.1\|3462416_3462719_+	hypothetical protein	NA	NA	NA	NA
WP_158022870.1\|3462660_3463077_+	DUF1320 family protein	A0A166XYS3	Gordonia_phage	1.4e-22	46.2
WP_016343104.1\|3463073_3463421_+	hypothetical protein	A0A142KAW9	Gordonia_phage	3.2e-12	38.7
WP_005101360.1\|3463417_3463714_+	hypothetical protein	NA	NA	NA	NA
WP_016343105.1\|3463710_3464118_+	hypothetical protein	NA	NA	NA	NA
WP_016343106.1\|3464176_3464854_+	hypothetical protein	S5YN28	Mycobacterium_phage	2.9e-41	45.1
WP_016343107.1\|3465052_3465508_+	hypothetical protein	NA	NA	NA	NA
WP_005098361.1\|3465612_3465942_+	hypothetical protein	S5Z5T8	Mycobacterium_phage	1.3e-15	56.7
WP_016343108.1\|3465946_3469285_+	hypothetical protein	A0A068F1L4	Mycobacterium_phage	3.7e-73	44.1
WP_005102507.1\|3469281_3470511_+	hypothetical protein	M4W8F3	Mycobacterium_phage	2.9e-68	38.3
WP_079276868.1\|3470568_3472233_+	hypothetical protein	S5XYP0	Mycobacterium_phage	2.2e-183	55.8
WP_005102329.1\|3472232_3472718_+	hypothetical protein	Q9ZX57	Mycobacterium_phage	9.6e-15	36.8
WP_005094140.1\|3472714_3473824_+	hypothetical protein	A0A068F8L3	Mycobacterium_phage	2.6e-92	48.8
WP_016343110.1\|3473823_3475212_+	hypothetical protein	I6X329	Mycobacteriophage	2.3e-13	34.2
WP_041927975.1\|3475217_3475559_+	hypothetical protein	A0A2K9VEW7	Mycobacterium_phage	2.4e-28	58.9
WP_016343112.1\|3475555_3475936_+	hypothetical protein	NA	NA	NA	NA
WP_016343113.1\|3475928_3476225_+	hypothetical protein	NA	NA	NA	NA
WP_016343114.1\|3476241_3476877_+	collagen-like protein	G9FHZ1	Nocardia_phage	8.1e-14	65.5
WP_005100057.1\|3476910_3477219_+	hypothetical protein	A0A2P1JT61	Mycobacterium_phage	4.8e-20	63.4
WP_016343115.1\|3477219_3477882_+	hypothetical protein	NA	NA	NA	NA
WP_016343116.1\|3477899_3478145_+	hypothetical protein	G1JWF1	Mycobacterium_phage	1.2e-05	34.4
WP_041927977.1\|3478669_3479443_+	N-acetylmuramoyl-L-alanine amidase	A0A1U9WRQ3	Mycobacterium_phage	3.2e-105	71.7
WP_005099947.1\|3479445_3480450_+	hypothetical protein	A0A2P1JR68	Mycobacterium_phage	2.4e-105	54.6

DBSCAN-SWA_7

4916788 : 4925468

Mycobacterium_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_041927778.1\|4916788_4918261_+	serine hydrolase	A0A1J0GRK9	Mycobacterium_phage	3.6e-12	28.5
WP_005082750.1\|4918388_4919201_+	DUF1906 domain-containing protein	A0A2D1GEF2	Gordonia_phage	3.1e-50	49.1
WP_016343748.1\|4919249_4920752_-	LysM peptidoglycan-binding domain-containing protein	A0A1W6JL93	Lactococcus_phage	3.3e-05	47.3
WP_005064639.1\|4921180_4922029_+	N-acetylmuramoyl-L-alanine amidase	A0A2D1GEV9	Mycobacterium_phage	2.9e-67	56.1
WP_016343749.1\|4922195_4922498_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_016343750.1\|4922789_4923239_+	hypothetical protein	NA	NA	NA	NA
WP_005072025.1\|4923259_4924711_+	HAMP domain-containing histidine kinase	Q8QKV4	Ectocarpus_siliculosus_virus	2.9e-06	33.6
WP_005064635.1\|4924790_4925468_-	response regulator transcription factor	W8CYM9	Bacillus_phage	4.4e-26	31.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NC_021279

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

33558 : 42240

Mycobacterium_phage(87.5%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016341444.1\|33558_33954_+	single-stranded DNA-binding protein	A0A0U4IHP1	Arthrobacter_phage	2.3e-19	50.4
WP_016341445.1\|34069_35812_+	ParB N-terminal domain-containing protein	V5UQR1	Mycobacterium_phage	1.1e-116	48.2
WP_016341446.1\|36277_37318_+	DUF945 domain-containing protein	Q1A023	Mycobacterium_phage	9.1e-71	44.2
WP_041928315.1\|37393_37843_+	hypothetical protein	NA	NA	NA	NA
WP_041928317.1\|37839_38346_+	hypothetical protein	NA	NA	NA	NA
WP_041928319.1\|38342_38621_+	hypothetical protein	A0A0A7HAI7	Mycobacterium_phage	3.0e-21	68.8
WP_016341448.1\|38746_39088_+	hypothetical protein	NA	NA	NA	NA
WP_041928321.1\|39129_39744_+	hypothetical protein	V5UP21	Mycobacterium_phage	3.6e-75	70.8
WP_162145478.1\|39815_40079_+	hypothetical protein	V5UPD3	Mycobacterium_phage	1.7e-26	63.2
WP_016341450.1\|40557_40806_+	glutaredoxin-like protein NrdH	V5UN81	Mycobacterium_phage	8.3e-23	64.6
WP_041928326.1\|40802_41429_+	hypothetical protein	NA	NA	NA	NA
WP_162145479.1\|41431_41599_+	hypothetical protein	NA	NA	NA	NA
WP_016341451.1\|41595_42240_+	hypothetical protein	V5UQP3	Mycobacterium_phage	4.6e-49	49.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_021278

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NC_021282

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NC_021279

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection